International Nuclear Information System (INIS)
Wang, Dapeng; Gao, Lixin; Zhang, Daquan; Yang, Dong; Wang, Hongxia; Lin, Tong
2016-01-01
The corrosion inhibition of L-cysteine on AA5052 aluminium alloy in 4 mol/L NaOH solution was investigated by hydrogen gas evolution experiment, polarisation curve, galvanostatic discharge, electrochemical impedance spectroscopy measurements and quantum chemical calculations. The adsorption of L-cysteine on aluminium alloy surface obeyed the amended Langmuir's adsorption isotherm. The polarisation curves indicated that L-cysteine acted as a cathodic inhibitor to inhibit cathodic reaction. The inhibition mechanism was dominated by the geometric covering effect. The galvanostatic discharge shows that the additives restrain the hydrogen evolution and increase the anodic utilization rate. Quantum chemical calculations indicated that L-cysteine molecules mainly interacted with on the carboxyl groups on the aluminium alloy surface. A strong hybridization occurred between the s-orbital and p-orbital of reactive sites in the L-cysteine molecule and the sp-orbital of Aluminium. - Highlights: • L-cysteine was used as corrosion inhibitor for Al alloy in alkaline solution. • Adsorption of L-cysteine on Al alloy surface obeyed the amended Langmuir's isotherm. • L-cysteine molecules interacted with the carboxyl groups on the Al alloy surface. • A strong orbital hybridization occurred between the reactive sites in L-cysteine and Al.
Energy Technology Data Exchange (ETDEWEB)
Wang, Dapeng; Gao, Lixin [School of Environmental and Chemical Engineering, Shanghai University of Electric Power, Shanghai 200090 (China); Zhang, Daquan, E-mail: zhangdaquan@shiep.edu.cn [School of Environmental and Chemical Engineering, Shanghai University of Electric Power, Shanghai 200090 (China); Yang, Dong [School of Environmental and Chemical Engineering, Shanghai University of Electric Power, Shanghai 200090 (China); Wang, Hongxia; Lin, Tong [Institute for Frontier Materials, Deakin University, Geelong, VIC 3216 (Australia)
2016-02-01
The corrosion inhibition of L-cysteine on AA5052 aluminium alloy in 4 mol/L NaOH solution was investigated by hydrogen gas evolution experiment, polarisation curve, galvanostatic discharge, electrochemical impedance spectroscopy measurements and quantum chemical calculations. The adsorption of L-cysteine on aluminium alloy surface obeyed the amended Langmuir's adsorption isotherm. The polarisation curves indicated that L-cysteine acted as a cathodic inhibitor to inhibit cathodic reaction. The inhibition mechanism was dominated by the geometric covering effect. The galvanostatic discharge shows that the additives restrain the hydrogen evolution and increase the anodic utilization rate. Quantum chemical calculations indicated that L-cysteine molecules mainly interacted with on the carboxyl groups on the aluminium alloy surface. A strong hybridization occurred between the s-orbital and p-orbital of reactive sites in the L-cysteine molecule and the sp-orbital of Aluminium. - Highlights: • L-cysteine was used as corrosion inhibitor for Al alloy in alkaline solution. • Adsorption of L-cysteine on Al alloy surface obeyed the amended Langmuir's isotherm. • L-cysteine molecules interacted with the carboxyl groups on the Al alloy surface. • A strong orbital hybridization occurred between the reactive sites in L-cysteine and Al.
Zúñiga-Navarrete, Fernando; Gómez, Isabel; Peña, Guadalupe; Bravo, Alejandra; Soberón, Mario
2013-03-01
Bacillus thuringiensis Cry toxins recognizes their target cells in part by the binding to glycosyl-phosphatidyl-inositol (GPI) anchored proteins such as aminopeptidase-N (APN) or alkaline phosphatases (ALP). Treatment of Tenebrio molitor brush border membrane vesicles (BBMV) with phospholipase C that cleaves out GPI-anchored proteins from the membranes, showed that GPI-anchored proteins are involved in binding of Cry3Aa toxin to BBMV. A 68 kDa GPI-anchored ALP was shown to bind Cry3Aa by toxin overlay assays. The 68 kDa GPI-anchored ALP was preferentially expressed in early instar larvae in comparison to late instar larvae. Our work shows for the first time that GPI-anchored ALP is important for Cry3Aa binding to T. molitor BBMV suggesting that the mode of action of Cry toxins is conserved in different insect orders. Copyright © 2012 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Zhou, Biner; Wang, Yishan; Zuo, Yu
2015-01-01
Highlights: • Inhibition effect of LaCl 3 and SDBS for AA 2024 in NaCl solution (pH 10) was studied. • At the beginning the active polarization behavior of the alloy changed to passivation. • The passive behavior gradually disappeared with time and pitting happened at S-phases. • The compounded inhibitors showed good inhibition but cannot totally inhibit pitting. • The adsorption of SDBS played the key role for inhibition to the corrosion process. - Abstract: The evolution of the corrosion process of AA 2024-T3 in 0.58 g L −1 NaCl solution (pH 10) with sodium dodecylbenzenesulfonate (SDBS) and lanthanum chloride inhibitors was studied with electrochemical and surface analysis methods. With the addition of the compounded LaCl 3 and SDBS inhibitors, in the early stage the polarization behavior of AA 2024-T3 changed from active corrosion to passivation, and both the general corrosion and pitting corrosion were inhibited. However, with the immersion time extended, the passive behavior gradually disappeared and pitting happened at the Cu-rich phases. After 24 h immersion, the compounded inhibitors still showed good inhibition for general corrosion, but the polarization curve again presented the characteristic similar to active polarization. The compounded inhibitors also inhibited the pitting corrosion to some extent. The acting mechanism of the inhibitors SDBS and La 3 Cl on the corrosion process of AA 2024-T3 in the test solution was discussed.
National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa index provides a long climatology of global geomagnetic activity using 2 antipodal observatories at Greenwich and Melbourne- IAGA Bulletin 37,...
African Journals Online (AJOL)
Abia, AA. Vol 4, No 6 (2010) - Articles Studies on the kinetics and intraparticle diffusivities of BOD, colour and TSS reduction from palm oil mill effluent (POME) using boiler fly ash. Abstract PDF. ISSN: 1996-0786. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...
Reduction of nitrobenzene with alkaline ascorbic acid: Kinetics and pathways
International Nuclear Information System (INIS)
Liang, Chenju; Lin, Ya-Ting; Shiu, Jia-Wei
2016-01-01
Highlights: • Alkaline ascorbic acid (a.k.a. vitamin C) is capable of reductively degrading NB. • The pH above the pK_a_2 of ascorbic acid increases reductive electron transfer to NB. • The rate equation for the reactions between NB and AA is determined. • NSB, AZOXY, and AZO are identified as intermediates and aniline as a final product. • Alkaline pH is essential for AA remediation of NB contaminated soils. - Abstract: Alkaline ascorbic acid (AA) exhibits the potential to reductively degrade nitrobenzene (NB), which is the simplest of the nitroaromatic compounds. The nitro group (NO_2"−) of NB has a +III oxidation state of the N atom and tends to gain electrons. The effect of alkaline pH ranging from 9 to 13 was initially assessed and the results demonstrated that the solution pH, when approaching or above the pK_a_2 of AA (11.79), would increase reductive electron transfer to NB. The rate equation for the reactions between NB and AA at pH 12 can be described as r = ((0.89 ± 0.11) × 10"−"4 mM"1"−"("a "+ "b") h"−"1) × [NB]"a "= "1"."3"5 "± "0"."1"0[AA]"b "= "0"."8"9 "± "0"."0"1. The GC/MS analytical method identified nitrosobenzene, azoxybenzene, and azobenzene as NB reduction intermediates, and aniline (AN) as a final product. These experimental results indicate that the alkaline AA reduction of NB to AN mainly proceeds via the direct route, consisting of a series of two-electron or four-electron transfers, and the condensation reaction plays a minor route. Preliminary evaluation of the remediation of spiked NB contaminated soils revealed that maintenance of alkaline pH and a higher water to soil ratio are essential for a successful alkaline AA application.
Campbell, John
2006-01-01
The welfare benefits of financial markets depend in large part on how effectively households use these markets. The study of household finance is challenging because household behavior is difficult to measure accurately, and because households face constraints that are not captured by textbook models, including fixed costs, uninsurable income risk, borrowing constraints, and contracts that are non-neutral with respect to inflation. Evidence on participation, diversification, and the exercise ...
Tha, Na Gya; Wus, Thay
2017-01-01
In this article, Aa Ah Nak, the authors' methodology presents not only various reflections but also diverse contradictions about the Aa Nii language as well as language revitalization. This article explores language foundation and how the Aa Nii language revitalization is inextricably linked to the genocide and resulting historic trauma pervasive…
Photographic Service
1980-01-01
The AA in its final stage of construction, before it disappeared from view under concrete shielding. Antiprotons were first injected, stochastically cooled and accumulated in July 1980. From 1981 on, the AA provided antiprotons for collisions with protons, first in the ISR, then in the SPS Collider. From 1983 on, it also sent antiprotons, via the PS, to the Low-Energy Antiproton Ring (LEAR). The AA was dismantled in 1997 and shipped to Japan.
CERN PhotoLab
1978-01-01
Quickly improvised measurement equipment for the AA (Antiproton Accumulator) was all the tight schedule permitted, but the high motivation of the team made up for the lack of convenience. From left to right: Roy Billinge (Joint AA Project Leader, the other one was Simon van der Meer); Bruno Autin, Brian Pincott, Colin Johnson.
CERN PhotoLab
1979-01-01
The AA at an early stage of construction, in the newly built AA-Hall. Cable-trays already outline the shape of the accumulator ring. To the right are huge cable-drums for the pulse-forming-network (PFN) of the injection kicker. Seeing this picture, can one imagine that only 8 months later beams were circulating in the completed accumulator ring ?
DEFF Research Database (Denmark)
Bruun, Ole
2013-01-01
dependency on state institutions under the Vietnamese transition to a market society. It discusses present poverty definitions and measures by comparing survey data with the formal economic categorization of rural households. Both the overall characteristics of rural society and qualitative data indicate...... that the reforms have set in motion a process by which a mix of new opportunities and increasing pressures creates new winners and losers. Second, the chapter draws attention to the nature of interactions between households, local communities and the Vietnamese state. This shows both potentials and limitations...
Reduction of nitrobenzene with alkaline ascorbic acid: Kinetics and pathways
Energy Technology Data Exchange (ETDEWEB)
Liang, Chenju, E-mail: cliang@nchu.edu.tw [Department of Environmental Engineering, National Chung Hsing University 250, Kuo-kuang Road, Taichung 402, Taiwan (China); Lin, Ya-Ting [Department of Environmental Engineering, Chung Yuan Christian University, 200 Chung Pei Road, Chung Li District, Taoyuan City 320, Taiwan (China); Shiu, Jia-Wei [Department of Environmental Engineering, National Chung Hsing University 250, Kuo-kuang Road, Taichung 402, Taiwan (China)
2016-01-25
Highlights: • Alkaline ascorbic acid (a.k.a. vitamin C) is capable of reductively degrading NB. • The pH above the pK{sub a2} of ascorbic acid increases reductive electron transfer to NB. • The rate equation for the reactions between NB and AA is determined. • NSB, AZOXY, and AZO are identified as intermediates and aniline as a final product. • Alkaline pH is essential for AA remediation of NB contaminated soils. - Abstract: Alkaline ascorbic acid (AA) exhibits the potential to reductively degrade nitrobenzene (NB), which is the simplest of the nitroaromatic compounds. The nitro group (NO{sub 2}{sup −}) of NB has a +III oxidation state of the N atom and tends to gain electrons. The effect of alkaline pH ranging from 9 to 13 was initially assessed and the results demonstrated that the solution pH, when approaching or above the pK{sub a2} of AA (11.79), would increase reductive electron transfer to NB. The rate equation for the reactions between NB and AA at pH 12 can be described as r = ((0.89 ± 0.11) × 10{sup −4} mM{sup 1−(a} {sup +} {sup b)} h{sup −1}) × [NB]{sup a} {sup =} {sup 1.35} {sup ±} {sup 0.10}[AA]{sup b} {sup =} {sup 0.89} {sup ±} {sup 0.01}. The GC/MS analytical method identified nitrosobenzene, azoxybenzene, and azobenzene as NB reduction intermediates, and aniline (AN) as a final product. These experimental results indicate that the alkaline AA reduction of NB to AN mainly proceeds via the direct route, consisting of a series of two-electron or four-electron transfers, and the condensation reaction plays a minor route. Preliminary evaluation of the remediation of spiked NB contaminated soils revealed that maintenance of alkaline pH and a higher water to soil ratio are essential for a successful alkaline AA application.
Volta potential of clad AA2024 aluminium after exposure to CeCl3 solution
International Nuclear Information System (INIS)
Andreatta, F.; Druart, M.-E.; Marin, E.; Cossement, D.; Olivier, M.-G.; Fedrizzi, L.
2014-01-01
Highlights: • Alkaline etch of clad AA2024 enhances precipitation of Ce compounds. • Exposure to CeCl 3 solution decreases Volta potential of alkaline etched substrate. • Ce compounds reduce the driving force for initiation of localized attack. - Abstract: AA2024 clad with AA1050 was immersed in CeCl 3 solution to promote deposition of cerium species. The deposition occurs on the entire sample surface for the alkaline etched substrate, while it is very limited for the degreased substrate. The surface potential (Volta potential) was investigated by scanning Kelvin probe force microscopy after different immersion times in CeCl 3 solution. The preferential deposition of Ce compounds at Al–Fe intermetallic sites progressively reduces their Volta potential difference relative to the matrix in the alkaline etched substrate. This reduces the susceptibility to localized attack of the intermetallics as proven by potentiodynamic polarization measurements
National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa indices are the continuation of the series beginning in the year 1868. A full description of these indices is given in the International...
Household Chemical Emergencies
... Content Home Be Informed Household Chemical Emergencies Household Chemical Emergencies Although the risk of a chemical accident ... reduce the risk of injury. Before a Household Chemical Emergency It is critical to store household chemicals ...
DEFF Research Database (Denmark)
Browning, Martin; Lusardi, Annamaria
suggested in the informal saving literature can be captured in the standard optimizing model. Particular attention is given to recent work on the precautionary motive and its implications for saving and consumption behavior. We also discuss the "behavioral" or "psychological" approach that eschews the use......In this survey, we review the recent theoretical and empirical literature on household saving and consumption. The discussion is structured around a list of motives for saving and how well the standard theory captures these motives. We show that almost all of the motives for saving that have been...
African Journals Online (AJOL)
Fred-Jaiyesimi, AA. Vol 12 (2008) - Articles Hypoglycaemic And Alpha-Amylase Inhibitory Activities Of Fermented Seeds Of Parkia Biglobosa (Jacq) Benth Abstract. ISSN: 1118-6267. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...
The Antiproton Accumulator (AA)
1980-01-01
Section 06 - 08*) of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A vacuum-tank, two bending magnets (BST06 and BST07 in blue) with a quadrupole (QDN07, in red) in between, another vacuum-tank, a wide quadrupole (QFW08) and a further tank . The tanks are covered with heating tape for bake-out. The tank left of BST06 contained the stack core pickup for stochastic cooling (see 7906193, 7906190, 8005051), the two other tanks served mainly as vacuum chambers in the region where the beam was large. Peter Zettwoch works on BST06. *) see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984)
CERN PhotoLab
1980-01-01
The very particular lattice of the AA required 2 types of dipole (bending magnets; BLG, long and narrow; BST, short and wide). The BLG had a steel length of 4.70 m, a good field width of 0.24 m, and a weight of about 70 t. Jean-Claude Brunet inspects the lower half of a BLG. For the BST magnets see 7811105 and 8006036.
The Antiproton Accumulator (AA)
1980-01-01
A section of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A large vacuum-tank, a quadrupole (QDN09*), a bending magnet (BST08), another vacuum-tank, a wide quadrupole (QFW08) and (in the background) a further bending magnet (BST08). The tanks are covered with heating tape for bake-out. The tank left of QDN09 contained the kickers for stochastic pre-cooling (see 790621, 8002234, 8002637X), the other one served mainly as vacuum chamber in the region where the beam was large. Peter Zettwoch works on QFW08. * see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984) See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
Household Income Composition and Household Goods
Voynov, Ivan
2005-01-01
The paper focuses on the change in household income composition and the factors that determine it. The results bring additional knowledge about household poverty dynamics. Based on the collective approach to the family and the cooperative game theory it is constructed theoretical model of household income composition change. The change in income composition is a result from bargaining between household members in attempt to defend the most suitable for them income source. Decisive influence i...
Catalytic oxidation of soot over alkaline niobates
International Nuclear Information System (INIS)
Pecchi, G.; Cabrera, B.; Buljan, A.; Delgado, E.J.; Gordon, A.L.; Jimenez, R.
2013-01-01
Highlights: ► No previous reported studies about alkaline niobates as catalysts for soot oxidation. ► NaNbO 3 and KNbO 3 perovskite-type oxides show lower activation energy than other lanthanoid perovskite-type oxides. ► The alkaline niobate does not show deactivation by metal loss. - Abstract: The lack of studies in the current literature about the assessment of alkaline niobates as catalysts for soot oxidation has motivated this research. In this study, the synthesis, characterization and assessment of alkaline metal niobates as catalysts for soot combustion are reported. The solids MNbO 3 (M = Li, Na, K, Rb) are synthesized by a citrate method, calcined at 450 °C, 550 °C, 650 °C, 750 °C, and characterized by AAS, N 2 adsorption, XRD, O 2 -TPD, FTIR and SEM. All the alkaline niobates show catalytic activity for soot combustion, and the activity depends basically on the nature of the alkaline metal and the calcination temperature. The highest catalytic activity, expressed as the temperature at which combustion of carbon black occurs at the maximum rate, is shown by KNbO 3 calcined at 650 °C. At this calcination temperature, the catalytic activity follows an order dependent on the atomic number, namely: KNbO 3 > NaNbO 3 > LiNbO 3 . The RbNbO 3 solid do not follow this trend presumably due to the perovskite structure was not reached. The highest catalytic activity shown by of KNbO 3 , despite the lower apparent activation energy of NaNbO 3 , stress the importance of the metal nature and suggests the hypothesis that K + ions are the active sites for soot combustion. It must be pointed out that alkaline niobate subjected to consecutive soot combustion cycles does not show deactivation by metal loss, due to the stabilization of the alkaline metal inside the perovskite structure.
Kohler, Susanna
2016-06-01
extraterrestrial life. The jets are highly alkaline and may contain molecular hydrogen, which links the inorganic and living worlds as a reactant and energy source. Although Cassinis very fruitful mission will come to a close in 2017 with a death spiral into Saturn, the future is still bright for Enceladus. Glein closed with a preview of the next mission to this special moon: ELF, the Enceladus Life Finder, will fly through and analyze Enceladuss icy plume in unprecedented detail using state-of-the-art instruments and is predicted to fly in 2031. 102: The NASA K2 Mission (by Meredith Rawls)Everyones favorite planet finding telescope continues to impress. In this morning session, we heard highlights about how the repurposed Kepler mission (K2) is contributing to research in areas ranging from nearby brown dwarfs to extragalactic supernovae. The session kicked off with an overview by Knicole Colon, who happily reported extended funding for K2 through 2018, when its fuel is projected to run out. Colon: despite a glitch in the celebratory cake, #K2mission has been extended until the end of life! #aas228 pic.twitter.com/9umZozOy0n Geert Barentsen (@GeertHub) June 13, 2016Bradley Tucker discussed recent extragalactic results from K2, and supernovae in particular. So far, the Kepler Extragalactic Survey has found 17 supernovae and they hope to find at least 20 more in the next three years. Because Kepler observations are so frequent, they reveal previously hidden subtleties in how supernovae fade over time..@btucker22: #K2mission is providing a statistical sample of high-precision supernova lightcurves! #aas228 pic.twitter.com/GWZUJhtmRW Geert Barentsen (@GeertHub) June 13, 2016Of course, exoplanet science is still a primary goal for the K2 team. Matthew Penny updated us on the status of the in-progress microlensing campaign, which uses Kepler to search for one-off brightening events that indicate the presence of a planet due to gravitational microlensing. Work is also underway by
International Nuclear Information System (INIS)
Murphy, M.; Wollenberg, H.; Strisower, B.; Bowman, H.; Flexser, S.; Carmichael, I.
1978-04-01
Geologic and geochemical criteria were developed for the occurrence of economic uranium deposits in alkaline igneous rocks. A literature search, a limited chemical analytical program, and visits to three prominent alkaline-rock localities (Ilimaussaq, Greenland; Pocos de Caldas, Brazil; and Powderhorn, Colorado) were made to establish criteria to determine if a site had some uranium resource potential. From the literature, four alkaline-intrusive occurrences of differing character were identified as type-localities for uranium mineralization, and the important aspects of these localities were described. These characteristics were used to categorize and evaluate U.S. occurrences. The literature search disclosed 69 U.S. sites, encompassing nepheline syenite, alkaline granite, and carbonatite. It was possible to compare two-thirds of these sites to the type localities. A ranking system identified ten of the sites as most likely to have uranium resource potential
Energy Technology Data Exchange (ETDEWEB)
Murphy, M.; Wollenberg, H.; Strisower, B.; Bowman, H.; Flexser, S.; Carmichael, I.
1978-04-01
Geologic and geochemical criteria were developed for the occurrence of economic uranium deposits in alkaline igneous rocks. A literature search, a limited chemical analytical program, and visits to three prominent alkaline-rock localities (Ilimaussaq, Greenland; Pocos de Caldas, Brazil; and Powderhorn, Colorado) were made to establish criteria to determine if a site had some uranium resource potential. From the literature, four alkaline-intrusive occurrences of differing character were identified as type-localities for uranium mineralization, and the important aspects of these localities were described. These characteristics were used to categorize and evaluate U.S. occurrences. The literature search disclosed 69 U.S. sites, encompassing nepheline syenite, alkaline granite, and carbonatite. It was possible to compare two-thirds of these sites to the type localities. A ranking system identified ten of the sites as most likely to have uranium resource potential.
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
The beryllium ion has a relatively small ionic radius. As a consequence of this small size, its hydrolysis reactions begin to occur at a relatively low pH. To determine the stability and solubility constants, however, the Gibbs energy of the beryllium ion is required. In aqueous solution calcium, like the other alkaline earth metals, only exists as a divalent cation. The size of the alkaline earth cations increases with increasing atomic number, and the calcium ion is bigger than the magnesium ion. The hydrolysis of barium(II) is weaker than that of strontium(II) and also occurs in quite alkaline pH solutions, and similarly, only the species barium hydroxide has been detected. There is only a single experimental study on the hydrolysis of radium. As with the stability constant trend, it would be expected that the enthalpy of radium would be lower than that of barium due to the larger ionic radius.
Advanced alkaline water electrolysis
International Nuclear Information System (INIS)
Marini, Stefania; Salvi, Paolo; Nelli, Paolo; Pesenti, Rachele; Villa, Marco; Berrettoni, Mario; Zangari, Giovanni; Kiros, Yohannes
2012-01-01
A short review on the fundamental and technological issues relevant to water electrolysis in alkaline and proton exchange membrane (PEM) devices is given. Due to price and limited availability of the platinum group metal (PGM) catalysts they currently employ, PEM electrolyzers have scant possibilities of being employed in large-scale hydrogen production. The importance and recent advancements in the development of catalysts without PGMs are poised to benefit more the field of alkaline electrolysis rather than that of PEM devices. This paper presents our original data which demonstrate that an advanced alkaline electrolyzer with performances rivaling those of PEM electrolyzers can be made without PGM and with catalysts of high stability and durability. Studies on the advantages/limitations of electrolyzers with different architectures do show how a judicious application of pressure differentials in a recirculating electrolyte scheme helps reduce mass transport limitations, increasing efficiency and power density.
Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo
Directory of Open Access Journals (Sweden)
Jing Y
2018-04-01
Full Text Available Yue Jing,1,2,* Gang Wang,1,* Qi Xiao,1 Yachun Zhou,1 Yingjie Wei,3 Zhunan Gong1 1Center for New Drug Research and Development, College of Life Science, Nanjing Normal University, Nanjing, China; 2Central Laboratory of Stomatology, Nanjing Stomatological Hospital, Medical School of Nanjing University, Nanjing, China; 3Key Laboratory of Oral Drug Delivery System of Chinese Materia Medica of State Administration of Traditional Chinese Medicine, Jiangsu Branch of China Academy of Chinese Medical Science, Nanjing, China *These authors contributed equally to this work Abstract: Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA has demonstrated anticancer properties and we suspect this might be attributable to an effect on angiogenesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl-L-proline methyl ester (AA-PMe, has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. Methods: In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs. First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over
Toxicological assessment of four common household surfactants on ...
African Journals Online (AJOL)
The acute toxicity of four common household liquid detergents coded as (FL, ML, MF and LC) was evaluated on two fish species; African Catfish (Clarias gariepinus) and Nile Tilapia (Oreochromis niloticus) fingerlings in a static bioassay. During the exposure period (96 hours), there was a remarkable rise of alkalinity from ...
Kohler, Susanna
2016-06-01
Editors Note: Lastweek we were at the 228th AAS Meeting in San Diego, CA. Here is a final post aboutselectedevents on the last day of the meeting, written by authors fromastrobites.com, a grad-student collaborative project with which we recently announced a new partnership! Starting in July,keep an eye out for astrobites postsat AAS Nova in between Highlights(i.e., on Tuesdays and Thursdays).Were excited to be working together to bring you more recent astronomy research from AAS journals!Extrasolar Planets: Detection (by Leonardo dos Santos)Thursdays first session on exoplanets was about detecting these distant worlds, and the opening talk was given by Robert Siverd (Las Cumbres Observatory). He describes the NRES, a network of spectrographs that will look for exoplanets using the radial velocity method. One of the coolest aspects of this instrument is that it will feature an on the fly scheduling system that will perform observations as efficiently as possible. The spectrograph is still being tested, but a unit will be deployed at CTIO later this year.@lcogt contracted by @NASA_TESS for follow up of their candidates. #aas228 Jessie Christiansen (@aussiastronomer) June 16, 2016Measuring the depths of transits and eclipses in Spitzer has been problematic in the past, since the Spitzer instrument IRAC (InfraRed Array Camera) has a non-uniform response in its detectors pixels. But, as reported by James Ingalls (Spitzer Science Center, Caltech), observers are circumventing this issue by using what they call the staring mode (avoiding large pointing jumps) and an algorithm to pick sweet spot pixels. Moreover, the results from the IRAC Data Challenge are helping to better understand its behavior. Giuseppe Morello (University College London), on the other hand, explained how his research group gets rid of instrumental effects from IRAC using machine learning. This method removes systematics from exoplanet transit data no matter if the noise source is from an instrument or
Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo.
Jing, Yue; Wang, Gang; Xiao, Qi; Zhou, Yachun; Wei, Yingjie; Gong, Zhunan
2018-01-01
Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA) has demonstrated anticancer properties and we suspect this might be attributable to an effect on angio-genesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-L-proline methyl ester (AA-PMe), has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs). First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF) present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2)-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP) transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline phosphatase assay. VEGFR2 expression in whole embryos following AA-PMe treatment was also determined. We found AA-PMe decreased cell viability and inhibited migration and tube formation in a dose-dependent manner in HUVECs. Similarly, AA-PMe disrupted the formation of intersegmental vessels, the dorsal aorta, and the posterior cardinal vein in zebrafish embryos. Both in vitro and in vivo AA-PMe surpassed AA in its ability to block angiogenesis by suppressing VEGF-induced phosphorylation of VEGFR2 and disrupting downstream extracellular regulated protein kinase and AKT signaling. For the first time
Energy Technology Data Exchange (ETDEWEB)
Rashvand avei, M. [Department of Chemistry, K.N. Toosi University of Technology, P.O. Box 15875-4416, Tehran (Iran, Islamic Republic of); Jafarian, M., E-mail: mjafarian@kntu.ac.ir [Department of Chemistry, K.N. Toosi University of Technology, P.O. Box 15875-4416, Tehran (Iran, Islamic Republic of); Moghanni Bavil Olyaei, H. [Department of Chemistry, K.N. Toosi University of Technology, P.O. Box 15875-4416, Tehran (Iran, Islamic Republic of); Gobal, F. [Department of Chemistry, Sharif University of Technology, P.O. Box 11365-8516, Tehran (Iran, Islamic Republic of); Hosseini, S.M. [Jahad Organization – Science and Technology Center, Tehran (Iran, Islamic Republic of); Mahjani, M.G. [Department of Chemistry, K.N. Toosi University of Technology, P.O. Box 15875-4416, Tehran (Iran, Islamic Republic of)
2013-12-16
The corrosion behavior of different grades of commercial aluminum such as AA1040, AA5083, AA6060 and AA7075 in ZnO-containing 4 M NaOH has been determined by using open circuit potential-time measurements (OCP), galvanostatic and potentiodynamic polarization and electrochemical impedance spectroscopy (EIS). The results of scanning electron microscopy (SEM) and energy dispersive analysis of X-ray (EDAX) reveal that ZnO produces the inhibition effect by the formation of a zinc-containing deposit layer on the surface of aluminum electrodes. Although the influence of zincating on the performance of aluminum alloys and considering the amount of alloying elements such as zinc, magnesium and manganese in AA7075 and AA5083 alloys is much more than AA6060 one, the AA6060 aluminum exhibits negligible corrosion rate. Alloying aluminum with other elements and modifying the composition of the electrolyte is a necessary condition for reducing the self-corrosion of the aluminum anodes, whereas the proportion of the amount of additive elements is sufficient and important condition. As AA6060 with a low amount of Zn and Mg, but the high value of the ratio of (Mg/Zn) content (>400) can serve as a good galvanic anode in the alkaline media. - Highlights: • Decreasing the corrosion rate of tested alloys in 4 M NaOH solution specially AA6060. • Lowering the extent of anodic polarization at a current density of 50 mA cm{sup −2}. • High inhibitor efficiency about 97% for AA6060.
International Nuclear Information System (INIS)
Rashvand avei, M.; Jafarian, M.; Moghanni Bavil Olyaei, H.; Gobal, F.; Hosseini, S.M.; Mahjani, M.G.
2013-01-01
The corrosion behavior of different grades of commercial aluminum such as AA1040, AA5083, AA6060 and AA7075 in ZnO-containing 4 M NaOH has been determined by using open circuit potential-time measurements (OCP), galvanostatic and potentiodynamic polarization and electrochemical impedance spectroscopy (EIS). The results of scanning electron microscopy (SEM) and energy dispersive analysis of X-ray (EDAX) reveal that ZnO produces the inhibition effect by the formation of a zinc-containing deposit layer on the surface of aluminum electrodes. Although the influence of zincating on the performance of aluminum alloys and considering the amount of alloying elements such as zinc, magnesium and manganese in AA7075 and AA5083 alloys is much more than AA6060 one, the AA6060 aluminum exhibits negligible corrosion rate. Alloying aluminum with other elements and modifying the composition of the electrolyte is a necessary condition for reducing the self-corrosion of the aluminum anodes, whereas the proportion of the amount of additive elements is sufficient and important condition. As AA6060 with a low amount of Zn and Mg, but the high value of the ratio of (Mg/Zn) content (>400) can serve as a good galvanic anode in the alkaline media. - Highlights: • Decreasing the corrosion rate of tested alloys in 4 M NaOH solution specially AA6060. • Lowering the extent of anodic polarization at a current density of 50 mA cm −2 . • High inhibitor efficiency about 97% for AA6060
Family and household demography
Willekens, F.J.C.; Zeng, Yi
2009-01-01
Households are groups of people that co-reside and share some resources. Families are households of related individuals. Household and family demography is the study of these primary social groups or social units, and in particular of group membership and the relationships between members of the
The Drentsche Aa valley system
International Nuclear Information System (INIS)
Gans, W. de.
1981-01-01
This thesis is composed of five papers concerned with Late Quaternary geology and geomorphology of the Aa valley system. The correlation and chronostratigraphic position of the layers have been established by radiocarbon dating. (Auth.)
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt
Spectroscopic characterization of alkaline earth uranyl carbonates
International Nuclear Information System (INIS)
Amayri, Samer; Reich, Tobias; Arnold, Thuro; Geipel, Gerhard; Bernhard, Gert
2005-01-01
A series of alkaline uranyl carbonates, M[UO 2 (CO 3 ) 3 ].nH 2 O (M=Mg 2 , Ca 2 , Sr 2 , Ba 2 , Na 2 Ca, and CaMg) was synthesized and characterized by inductively coupled plasma mass spectrometry (ICP-MS) and atomic absorption spectrometry (AAS) after nitric acid digestion, X-ray powder diffraction (XRD), and thermal analysis (TGA/DTA). The molecular structure of these compounds was characterized by extended X-ray absorption fine-structure (EXAFS) spectroscopy and X-ray photoelectron spectroscopy (XPS). Crystalline Ba 2 [UO 2 (CO 3 ) 3 ].6H 2 O was obtained for the first time. The EXAFS analysis showed that this compound consists of (UO 2 )(CO 3 ) 3 clusters similar to the other alkaline earth uranyl carbonates. The average U-Ba distance is 3.90+/-0.02A.Fluorescence wavelengths and life times were measured using time-resolved laser-induced fluorescence spectroscopy (TRLFS). The U-O bond distances determined by EXAFS, TRLFS, XPS, and Raman spectroscopy agree within the experimental uncertainties. The spectroscopic signatures observed could be useful for identifying uranyl carbonate species adsorbed on mineral surfaces
Alkalinity of the Mediterranean Sea
Schneider, Anke; Wallace, Douglas W.R.; Körtzinger, Arne
2007-01-01
Total alkalinity (AT) was measured during the Meteor 51/2 cruise, crossing the Mediterranean Sea from west to east. AT concentrations were high (∼2600 μmol kg−1) and alkalinity-salinity-correlations had negative intercepts. These results are explained by evaporation coupled with high freshwater AT inputs into coastal areas. Salinity adjustment of AT revealed excess alkalinity throughout the water column compared to mid-basin surface waters. Since Mediterranean waters are supersaturated with r...
Alkaline fuel cells applications
Kordesch, Karl; Hacker, Viktor; Gsellmann, Josef; Cifrain, Martin; Faleschini, Gottfried; Enzinger, Peter; Fankhauser, Robert; Ortner, Markus; Muhr, Michael; Aronson, Robert R.
On the world-wide automobile market technical developments are increasingly determined by the dramatic restriction on emissions as well as the regimentation of fuel consumption by legislation. Therefore there is an increasing chance of a completely new technology breakthrough if it offers new opportunities, meeting the requirements of resource preservation and emission restrictions. Fuel cell technology offers the possibility to excel in today's motive power techniques in terms of environmental compatibility, consumer's profit, costs of maintenance and efficiency. The key question is economy. This will be decided by the costs of fuel cell systems if they are to be used as power generators for future electric vehicles. The alkaline hydrogen-air fuel cell system with circulating KOH electrolyte and low-cost catalysed carbon electrodes could be a promising alternative. Based on the experiences of Kordesch [K. Kordesch, Brennstoffbatterien, Springer, Wien, 1984, ISBN 3-387-81819-7; K. Kordesch, City car with H 2-air fuel cell and lead-battery, SAE Paper No. 719015, 6th IECEC, 1971], who operated a city car hybrid vehicle on public roads for 3 years in the early 1970s, improved air electrodes plus new variations of the bipolar stack assembly developed in Graz are investigated. Primary fuel choice will be a major issue until such time as cost-effective, on-board hydrogen storage is developed. Ammonia is an interesting option. The whole system, ammonia dissociator plus alkaline fuel cell (AFC), is characterised by a simple design and high efficiency.
Hochgürtel, S.
1998-01-01
This thesis presents four topics on households' portfolio choices. Empirically, households do not hold well-diversified wealth portfolios. In particular, they refrain from putting their savings into risky assets. We explore several ways that might help explaining this observation. Using Dutch
Brounen, Dirk; Koedijk, Kees; Pownall, Rachel
2016-01-01
Greater personal responsibility toward financial decision-making is being advocated on a global basis. Individuals and households are encouraged to take a more active approach to personal finance. In this paper, we examine behavioral factors, which lead households toward savings and financial
Wahlen, S.; Winkel, Thomas
2017-01-01
Food waste is debated not only in the light of sustainable consumption in research and policy, but also in the broader public. This article focuses on food waste in household contexts, what is widely believed the end of the food chain. However, household food waste is far more complex and intricate
Djordjevic, Ljubica
2015-01-01
Household finance is a young and vibrant research field that continuously attracts public attention. There may be very few matters that people care so much about as their personal finance. Recent rise of academic interest in household finance is to a great extent due to households’ more active role
Xie, Yu; Jin, Yongai
2015-01-01
With new nationwide longitudinal survey data now available from the China Family Panel Studies (CFPS), we study the level, distribution, and composition of household wealth in contemporary China. We find that the wealth Gini coefficient of China was 0.73 in 2012. The richest 1 percent owned more than one-third of the total national household wealth, while the poorest 25 percent owned less than 2 percent. Housing assets, which accounted for over 70 percent, were the largest component of household wealth. Finally, the urban-rural divide and regional disparities played important roles in household wealth distribution, and institutional factors significantly affected household wealth holdings, wealth growth rate, and wealth mobility. PMID:26435882
Promoting household energy conservation
International Nuclear Information System (INIS)
Steg, Linda
2008-01-01
It is commonly assumed that households must change their behaviour to reduce the problems caused by increasing levels of fossil energy use. Strategies for behaviour change will be more effective if they target the most important causes of the behaviour in question. Therefore, this paper first discusses the factors influencing household energy use. Three barriers to fossil fuel energy conservation are discussed: insufficient knowledge of effective ways to reduce household energy use, the low priority and high costs of energy savings, and the lack of feasible alternatives. Next, the paper elaborates on the effectiveness and acceptability of strategies aimed to promote household energy savings. Informational strategies aimed at changing individuals' knowledge, perceptions, cognitions, motivations and norms, as well as structural strategies aimed at changing the context in which decisions are made, are discussed. This paper focuses on the psychological literature on household energy conservation, which mostly examined the effects of informational strategies. Finally, this paper lists important topics for future research
Long term immersion test of aluminum alloy AA 6061 used for fuel cladding in MTR type reactors
International Nuclear Information System (INIS)
Linardi, Evelina M.; Rodriguez, Sebastian; Haddad, Roberto; Lanzani, Liliana
2009-01-01
In this work we present the results of long term immersion tests performed in the aluminum alloy AA 6061, used for fuel cladding in MTR type reactors. The tests were performed at open circuit potential in high purity water (ρ = 18.2 MΩ.cm) and in 10 -3 M NaCl solution. Two kinds of assemblies were studied: simple sheets and artificial crevices, immersed during 6, 12 and 18 months at room temperature. In both media and both assemblies, the aluminum hydroxide phases crystalline bayerite and bohemite were identified. It was found that a kind of localized attack named alkaline attack occurs around the iron-rich intermetallics. These particles were confirmed to control the corrosion of the AA 6061 alloy in an aerated medium. Immersion times for up to 18 months did not increase the oxide growth or the alkaline attack on the AA 6061 alloy. (author)
Method of cleaning alkaline metal
International Nuclear Information System (INIS)
Kawakami, Yukio; Naito, Kesahiro; Iizawa, Katsuyuki; Nakasuji, Takashi
1981-01-01
Purpose: To prevent scattering of used sodium and aqueous alkaline solution when cleaning used sodium and metallic sodium adhering to equipment with an aqueous alkaline solution. Method: A sodium treating container is filled with an aqueous alkaline solution, and stainless steel gauze is sunk in the container. Equipment to be cleaned such as equipment with sodium adhering to it are retained under the gauze and are thus cleaned. On the other hand, the surface of the aqueous alkaline solution is covered with a fluid paraffin liquid covering material. Thus, the hydrogen produced by the reaction of the sodium and the aqueous alkaline solution will float up, pass through the liquid covering material and be discharged. The sodium will pass through the gauze and float upwardly while reacting with the aqueous alkaline solution in a partic ulate state to the boundary between the aqueous alkaline solution and up to the covering material, and thus the theratment reaction will continue. Thus, the cover material prevents the sodium and the aqueous alkaline solution from scattering. (Kamimura, M.)
DEFF Research Database (Denmark)
Hanspal, Tobin
This Ph.D. thesis, entitled Essays in Household Finance, analyzes the determinants and implications of investment biases, personal experiences in financial markets, and financing disruptions on households, individual investors, and entrepreneurs and small business owners. The first essay...... on risk taking is the potential bias resulting from inertia and inattention, which has been shown to be endemic in household finance. If individuals are inert or inattentive, it is difficult to establish whether changes in risk taking are caused by personal experiences or whether the change in risk taking...
Effects of pH and chloride concentration on pitting corrosion of AA6061 aluminum alloy
International Nuclear Information System (INIS)
Zaid, B.; Saidi, D.; Benzaid, A.; Hadji, S.
2008-01-01
Effects of pH solution and chloride (Cl - ) ion concentration on the corrosion behaviour of alloy AA6061 immersed in aqueous solutions of NaCl have been investigated using measurements of weight loss, potentiodynamic polarisation, linear polarisation, cyclic polarisation experiment combined with open circuit potential transient technique and optical or scanning electron microscopy. The corrosion behaviour of the AA6061 aluminum alloy was found to be dependant on the pH and chloride concentration [NaCl] of solution. In acidic or slightly neutral solutions, general and pitting corrosion occurred simultaneously. In contrast, exposure to alkaline solutions results in general corrosion. Experience revealed that the alloy AA6061 was susceptible to pitting corrosion in all chloride solution of concentration ranging between 0.003 wt% and 5.5 wt% NaCl and an increase in the chloride concentration slightly shifted both the pitting E pit and corrosion E cor potentials to more active values. In function of the conditions of treatment, the sheets of the alloy AA6061 undergo two types of localised corrosion process, leading to the formation of hemispherical and crystallographic pits. Polarisation resistance measurements in acidic (pH = 2) and alkaline chloride solutions (pH = 12) which are in good agreement with those of weight loss, show that the corrosion kinetic is minimised in slightly neutral solutions (pH = 6)
DEFF Research Database (Denmark)
Fjelsted, Lotte; Christensen, Thomas Højlund
2007-01-01
.) comprised 15-25% and foreign items comprised 10-20%. Water-based paint was the dominant part of the paint waste. The chemical composition of the paint waste and the paint-like waste was characterized by an analysis of 27 substances in seven waste fractions. The content of critical substances was tow......'Paint waste', a part of the 'household hazardous waste', amounting to approximately 5 tonnes was collected from recycling stations in two Danish cities. Sorting and analyses of the waste showed paint waste comprised approximately 65% of the mass, paint-like waste (cleaners, fillers, etc...... and the paint waste was less contaminated with heavy metals than was the ordinary household waste. This may suggest that households no longer need to source-segregate their paint if the household waste is incinerated, since the presence of a small quantity of solvent-based paint will not be harmful when...
Household electricity demand profiles
DEFF Research Database (Denmark)
Marszal, Anna Joanna; Heiselberg, Per Kvols; Larsen, Olena Kalyanova
2016-01-01
Highlights •A 1-min resolution household electricity load model is presented. •Model adapts a bottom-up approach with single appliance as the main building block. •Load profiles are used to analyse the flexibility potential of household appliances. •Load profiles can be applied in other domains, .......g. building energy simulations. •The demand level of houses with different number of occupants is well captured....
A.A., constructivism, and reflecting teams.
Nevels, B
1997-12-01
Numerous studies and clinical anecdotes reveal a relationship between attendance at A.A. meetings and/or degree of involvement in A.A. and maintenance of sobriety. Hypotheses as to how A.A. and/or the A.A. meeting is helpful to its members have ranged from a focus on factors common to all therapy groups, to aspects of A.A. "treatment" which are behavioral in nature. Presented here is another way of understanding A.A.'s effectiveness within the frame of more recent, constructivistic approaches to family therapy. In particular, the A.A. topic meeting is compared to the reflecting team concept of Tom Anderson.
Constitutive behavior of as-cast AA1050, AA3104, and AA5182
van Haaften, W. M.; Magnin, B.; Kool, W. H.; Katgerman, L.
2002-07-01
Recent thermomechanical modeling to calculate the stress field in industrially direct-chill (DC) cast-aluminum slabs has been successful, but lack of material data limits the accuracy of these calculations. Therefore, the constitutive behavior of three aluminum alloys (AA1050, AA3104, and AA5182) was determined in the as-cast condition using tensile tests at low strain rates and from room temperature to solidus temperature. The parameters of two constitutive equations, the extended Ludwik equation and a combination of the Sellars-Tegart equation with a hardening law, were determined. In order to study the effect of recovery, the constitutive behavior after prestraining at higher temperatures was also investigated. To evaluate the quantified constitutive equations, tensile tests were performed simulating the deformation and cooling history experienced by the material during casting. It is concluded that both constitutive equations perform well, but the combined hardening-Sellars-Tegart (HST) equation has temperature-independent parameters, which makes it easier to implement in a DC casting model. Further, the deformation history of the ingot should be taken into account for accurate stress calculations.
Laboratory Astrophysics Division of The AAS (LAD)
Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.
2012-10-01
The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.
Laboratory Astrophysics Division of the AAS (LAD)
Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.
2012-01-01
The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.
and alanine (EC. 2.6.1.2) transaminases, and alkaline phosphatase
African Journals Online (AJOL)
The activities of aspartate (E.C. 2.6.1.1) and alanine (E.C. 2.6.1.2) transaminases (AST and ALT, respectively), and alkaline phosphatase (ALP) (E.C. 3.1.3.1) were determined in erythrocytes obtained from 20 HbAA, 15 HbAS and 12 HbSS human subjects. The results showed that the three enzymes had different levels of ...
DEFF Research Database (Denmark)
Winther, Ida Wentzel
Keynote: Family relationships are normatively assumed to be characterized by ‘sharing’, such as living together in the same home, occupying the same place, sharing stuff, blood and biology, spending special and ordinary time together, and consequently creating shared biographical experiences....... In that way, families are thrown into togetherness. At the same time, we see families in varying forms where 'sharing' is lived and contested differently. In Denmark, many children live in nuclear families, and many live in different variations of more than one household. For those who share household...... and family, 'sharing' will be a basic condition. No matter what, they should share life circumstances, more stories, more places and spaces, more households families with both kin and non-kin. This keynote addresses the particular of children’s experiences of living apart and/or living together in sharing...
AA, closed orbit observation pickup
1980-01-01
Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. See also 8001372, 8010042, 8010045
AA, closed orbit observation pickup
CERN PhotoLab
1980-01-01
Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles QFW, at maximum dispersion. See also 8001372, 8001383, 8010045
AA, closed orbit observation pickup
CERN PhotoLab
1980-01-01
Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles, QFW, at maximum dispersion. See also 8001372,8001383, 8010042
AA, closed orbit observation pickup
CERN PhotoLab
1980-01-01
Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. Werner Sax contemplates his achievement. See also 8001383, 8010042, 8010045.
Banks, James; Smith, Sarah
2000-01-01
This paper presents a detailed analysis of the composition of household portfolios, using both aggregate and micro-data. Among the key findings are that: Most household wealth is held in the form of housing and pensions. Over time, there has been a shift away from housing towards financial assets, driven largely by the growth in life and pension funds. Liquid financial wealth (excluding life and pension funds) is not predominantly held in risky form. By far the most commonly held asset is an ...
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our
Households at Grasshopper Pueblo.
Reid, J. Jefferson; Whittlesey, Stephanie M.
1982-01-01
Describes the archaeological reconstruction of domestic life in Grasshopper, Arizona, a mogollon pueblo community which began around 1300 A.D. Categories of space and domestic activities are discussed. An analysis of variations in the patterns of household types within the pueblo is included. (AM)
DEFF Research Database (Denmark)
Walmsley, Alan George
2007-01-01
about the layout of buildings and the contextual origin of the many domestic objects recovered permit a full reconstruction of life in the household, especially the use of space. Generally, the upstairs area served as the primary living quarters, whereas the ground floor was used to house valuable...... domestic animals and for light workshop activities....
International Nuclear Information System (INIS)
Ohm, Jostein
1998-01-01
The report summarises the results from an investigation among households in the seven counties which participates in the project ''Sustainable local communities'' - Fredrikstad, Flora, Hurum, Kristiansand, Roeros, Stavanger and Steigen. The study contained the fields of environmental involvement and motivation, transportation, energy utilisation, purchases, waste management and communication with the local project leadership
Sample preparation in alkaline media
International Nuclear Information System (INIS)
Nobrega, Joaquim A.; Santos, Mirian C.; Sousa, Rafael A. de; Cadore, Solange; Barnes, Ramon M.; Tatro, Mark
2006-01-01
The use of tetramethylammonium hydroxide, tertiary amines and strongly alkaline reagents for sample treatment involving extraction and digestion procedures is discussed in this review. The preparation of slurries is also discussed. Based on literature data, alkaline media offer a good alternative for sample preparation involving an appreciable group of analytes in different types of samples. These reagents are also successfully employed in tailored speciation procedures wherein there is a critical dependence on maintenance of chemical forms. The effects of these reagents on measurements performed using spectroanalytical techniques are discussed. Several undesirable effects on transport and atomization processes necessitate use of the method of standard additions to obtain accurate results. It is also evident that alkaline media can improve the performance of techniques such as inductively coupled plasma mass spectrometry and accessories, such as autosamplers coupled to graphite furnace atomic absorption spectrometers
9708 INTRAHOUSEHOLD ALLOCATION, HOUSEHOLD HEADSHIP ...
African Journals Online (AJOL)
Mimi
agricultural production, education, healthcare and other household needs [17]. ... to various assets within the household depends on age, gender and power ..... Omilola B Patterns and Trends of Child and Maternal Nutrition Inequalities in.
Households and the Welfare State
Gustavo Ventura
2012-01-01
Consider the following facts. First, with dramatic changes in the household and family structure in every major industrialized country during the last couple of decades, today's households are very far from traditional breadwinner husband and housekeeper wife paradigm. Second, average households face significant uninsurable idiosyncratic risk and countries differ significantly on their social insurance expenditure. Third, since mid 1980s, household income inequality has been rising, generatin...
Lamination sheet of AA BST magnet
CERN PhotoLab
1979-01-01
The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.
Household energy consumption attitudes
Energy Technology Data Exchange (ETDEWEB)
Phillips, P
1976-05-01
This report contains a summary of the results of a study of household attitudes to energy use and conservation while the author was a member of staff at Massey University. During 1975 seven batches of a mail questionnaire were sent out to a random sample of people drawn from the 1974 Local Body Electoral Rolls. Valid replies were obtained from just under 60% of the 17,500 households to which the forms were sent. The study was undertaken for the simple reason that all energy demand depends on people and yet very little information seemed to be available which showed what people thought about the energy situation and how they felt about the need for conservation. The way people evaluate their energy needs represents a focal element in the energy system as it is this appraisal which results in their demand for energy. The impact of household attitudes goes far beyond the relative share of the energy market taken by the domestic sector, however, as the same people are involved in the demand from all other sectors.
PURIFICATION AND CHARACTERISATION OF ALKALINE ...
African Journals Online (AJOL)
Prof. Adipala Ekwamu
There was no clear decrease in the yield seen in the bands and the loss of enzyme was not observed with the gel analysis. It may ... The native gel results show clear distinct bands for the 3 alkaline phosphotase isoenzymes ..... British Medical.
Alkaline resistant ceramics; Alkalimotstaandskraftiga keramer
Energy Technology Data Exchange (ETDEWEB)
Westberg, Stig-Bjoern [Vattenfall Utveckling AB, Aelvkarleby (Sweden)
2001-02-01
Despite durability in several environments, ceramics and refractories can not endure alkaline environments at high temperature. An example of such an environment is when burning biofuel in modern heat and power plants in which the demand for increasing efficiency results in higher combustion temperatures and content of alkaline substances in the flue gas. Some experiences of these environments has been gained from such vastly different equipment as regenerator chambers in the glass industry and MHD-generators. The grains of a ceramic material are usually bonded together by a glassy phase which despite it frequently being a minor constituent render the materials properties and limits its use at elevated temperature. The damage is usually caused by alkaline containing low-melting phases and the decrease of the viscosity of the bonding glass phase which is caused by the alkaline. The surfaces which are exposed to the flue gas in a modern power plant are not only exposed to the high temperature but also a corroding and eroding, particle containing, gas flow of high velocity. The use of conventional refractory products is limited to 1300-1350 deg C. Higher strength and fracture toughness as well as durability against gases, slag and melts at temperatures exceeding 1700 deg C are expected of the materials of the future. Continuous transport of corrosive compounds to the surface and corrosion products from the surface as well as a suitable environment for the corrosion to occur in are prerequisites for extensive corrosion to come about. The highest corrosion rate is therefore found in a temperature interval between the dew point and the melting point of the alkaline-constituent containing compound. It is therefore important that the corrosion resistance is sufficient in the environment in which alkaline containing melts or slag may appear. In environments such as these, even under normal circumstances durable ceramics, such as alumina and silicon carbide, are attacked
Optical properties of alkaline earth borate glasses
African Journals Online (AJOL)
user
... devices; radiation shields, surgical lasers and their glass ceramic counter ... Alkaline earth oxides improve glass forming capability while heavy metal ... reports on optical properties of MO-B2O3 glasses containing alkaline earth oxides.
Qualitative Carbohydrate Analysis using Alkaline Potassium ...
Indian Academy of Sciences (India)
IAS Admin
CLASSROOM. 285. RESONANCE | March 2016. Qualitative Carbohydrate Analysis using Alkaline. Potassium Ferricyanide. Keywords. Alkaline potassium ferricyanide, qualitative ... Carbohydrates form a distinct class of organic compounds often .... Laboratory Techniques: A contemporary Approach, W B Saunders Com-.
Side effects of AAS abuse: an overview.
Turillazzi, E; Perilli, G; Di Paolo, M; Neri, M; Riezzo, I; Fineschi, V
2011-05-01
Anabolic - androgenic steroids (AAS) were originally developed to promote growth of skeletal muscle. AAS abuse is commonly associated with bodybuilders, weightlifters, and other athletes. The issue of AAS toxicity is not yet completely understood since the adverse effects outline a varied scenario with side effects reported affecting many organs and systems in humans. The true incidence of AAS related medical problems is not known, due to several drawbacks in human studies. The entity of side effects depends on the sex, the dose, the duration of treatment, whether they are taken during exercise training or under sedentary conditions, and the susceptibility of the individuals themselves to androgen exposure partly depending on genetic factors. Both the acute and the chronic effects can lead to toxicity, but generally the serious and even fatal effects depend on the time and the duration of AAS administration. A limitation of human studies is represented by the fact that information about the intake of steroids are, generally, self reported and it is hardly possible to assess the exact dosage. AAS are often used in combination with other dugs or substances, so it is difficult to separate their toxic effects from those caused by the other drugs abused. Hence experimental studies conducted on animal models are mandatory to investigate the mechanisms underlying to AAS toxicity and the organ alterations due to these substances. Finally, clinicians should be aware of the complex and varied pattern of toxicity so as to be able to perform correct diagnoses and treatments.
First circulating beam in the AA
CERN PhotoLab
1980-01-01
On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.56 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are too numerous to name them all, but the 3 most prominent ones are at the centre (left to right): Roy Billinge (Joint AA Project Leader, with his hand on the control box), Eifionydd Jones (white shirt), Simon van der Meer (spiritus rector and Joint AA Project Leader). The first antiprotons were injected, made to circulate and cooled soon after, on 14 July 1980.
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session 2015 Newton Lacy Pierce Prize Lecture: The Elephant in the Room: Effects of Distant, Massive Companions on Planetary System Architectures (by Leonardo dos Santos)The first session on Wednesday at 228th AAS Meeting was the Newton Lacy Pierce Prize Lecture by Heather Knutson (California Institute of Technology). This talk featured a broad range of research efforts on exoplanets, with the main focus on how we study the composition of their atmospheres, and how multi-body interactions carve the structure of the planetary systems we observe.One of her first points is the well-known idea that the Solar System is an oddball, compared to the exoplanet systems we have found so far: most of these systems contain hot Jupiters and mini-Neptunes at very close-in orbits around their host stars. Moreover, even when studying their transmission spectra, it is difficult to know the exact composition of their atmospheres.Knutson: it is difficult to constrain atmospheric composition of exoplanets (H-poor or H-rich+clouds?) #aas228pic.twitter.com/LdyN4o9RC7 astrobites (@astrobites) June 15, 2016The main proposal on how these systems formed is the migration scenario. In order to validate this idea, Dr. Knutson and her group The Friends of Hot Jupiters study systems with close-in gas giants and their frequency of binary companions, which are supposed to be the main culprits causing gas-giant migration. They found that approximately half of the observed systems have long-distance companions, providing strong validation of the migration scenario. Moreover, Dr. Knutson speculates that wide binaries have more
The Household Registration System
Directory of Open Access Journals (Sweden)
2000-06-01
Full Text Available Although longitudinal experimental community health research is crucial to testing hypotheses about the demographic impact of health technologies, longitudinal demographic research field stations are rare, owing to the complexity and high cost of developing requisite computer software systems. This paper describes the Household Registration System (HRS, a software package that has been used for the rapid development of eleven surveillance systems in sub-Saharan Africa and Asia. Features of the HRS automate software generation for a family of surveillance applications, obviating the need for new and complex computer software systems for each new longitudinal demographic study.
Development of alkaline fuel cells.
Energy Technology Data Exchange (ETDEWEB)
Hibbs, Michael R.; Jenkins, Janelle E.; Alam, Todd Michael; Janarthanan, Rajeswari; Horan, James L.; Caire, Benjamin R.; Ziegler, Zachary C.; Herring, Andrew M.; Yang, Yuan; Zuo, Xiaobing; Robson, Michael H.; Artyushkova, Kateryna; Patterson, Wendy; Atanassov, Plamen Borissov
2013-09-01
This project focuses on the development and demonstration of anion exchange membrane (AEM) fuel cells for portable power applications. Novel polymeric anion exchange membranes and ionomers with high chemical stabilities were prepared characterized by researchers at Sandia National Laboratories. Durable, non-precious metal catalysts were prepared by Dr. Plamen Atanassovs research group at the University of New Mexico by utilizing an aerosol-based process to prepare templated nano-structures. Dr. Andy Herrings group at the Colorado School of Mines combined all of these materials to fabricate and test membrane electrode assemblies for single cell testing in a methanol-fueled alkaline system. The highest power density achieved in this study was 54 mW/cm2 which was 90% of the project target and the highest reported power density for a direct methanol alkaline fuel cell.
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session: From Space Archeology to Serving the World Today: A 20-year Journey from the Jungles of Guatemala to a Network of Satellite Remote Sensing Facilities Around the World(by Michael Zevin)In the conferences second plenary session, NASAs Daniel Irwin turned the eyes of the conference back to Earth by highlighting the huge impact that NASA missions play in protecting and developing our own planet.Daniel Irwin: using satellite imagery to detect differences in vegetation and find ancient Mayan cities. #aas228 pic.twitter.com/9LFPQdCHTM astrobites (@astrobites) June 13, 2016Irwin came to be involved in NASA through his work mapping Guatemalan jungles, where he would spend 22 days at a time exploring the treacherous jungles on foot armed with a 1st generation GPS, a compass, and a machete. A colleague introduced Irwin to the satellite imagery thathe was exploring, demonstratinghow these images are a strong complement to field work. The sharing of this satellite data with nearby villages helped to show the encroachment of agriculture and the necessity of connecting space to the village. Satellite imagery also played a role in archeological endeavors, uncovering dozens of Mayan cities that have been buried for over a millennia by vegetation, and it provided evidence that the fall of the Mayan civilization may have been due to massive deforestation that ledto drought.Glacial retreat in Chile imaged by ISERV.Irwin displayed the constellation of NASAs Earth-monitoring satellites that have played an integral role in conserving our planet and alerting the world of natural disasters. He also showed
Efficient Intra-Household Allocations
DEFF Research Database (Denmark)
Browning, Martin
demands must satisfy a symmetry and rank condition on the Slutsky matrix. We also present some further results on the effects on demands of variables that do nor modify preferences but that do affect how decisions are made. We apply our theory to a series of surveys of household expendityres from Canada......The neo-classical theory of demand applies to individuals yet in empirical work it is usually taken as valid for households with many members. This paper explores what the theory of individuals implies for households with many members. This paper explores what the theory of individuals implies...... for households which have more than one member. We make minimal assumptions about how the individual members of the household resolve conflicts. All we assume is that however decisions are made, outcomes are efficient. We refer to this as the collective setting. We show that in the collective setting household...
Magnetic horn of the Antiproton Accumulator (AA)
Photographic Service
1988-01-01
In the 1960s, the invention of this "current sheet lens" has helped to greatly improve the flux of neutrino beams. It was used again at the AA, collecting antiprotons from the production target at angles too large to fit into the acceptance of the AA. It was machined from aluminium to a thickness of 1.4 mm and pulsed at 400 kA for 15 microseconds (half-sine).
Farm Households Food Production and Households' Food Security ...
African Journals Online (AJOL)
Food is an important basic human need for survival, growth, and good health. Most rural households in Tanzania, Kahama district inclusive produce the food they consume. Despite this reality, a number of households in the district suffer from food insecurity. However, there are inequalities across the districtfs ecological ...
International Nuclear Information System (INIS)
Gitopadmojo, Isminingsih
2000-01-01
Polypropylene yams that have been subjected to irradiation induced graftco-polymerization with acrylic acid, have gained its moisture regain and dyeability, that fulfilled the requirement as textile material for garment.However, the copolymer grafted PP-AA has suffered from degradation in thestorage, which was indicated in the previous study that the strengthretention has dropped tremendously by photo-oxidation or photo-degradation.After treatments of PP-AA yams with chemical compound that was able toprevent further photo-oxidation, will be expected to improve the stability ofPP-AA in storage. In this research activity, the polypropylene (PP) yams weresubjected to irradiation induced graft co-polymerization by means ofγ-Ray Co-60 as irradiation source with acrylic acid (AA) as monomer.Various after treatments were subjected to the grafted PP-AA yams such asalkalisation process; dyeing (anionic dyes, cationic dyes and nonionic dyes);as well as processing with optical brightening agent and UV stabilizer,separately. The PP-AA yams (before and after treatment) were subjected tostorage from 1 month up to 42 months, and then being tested for theirmoisture regain, strength retention and elongation at breaks. The samplesbeing stored for 12 months were subjected to radical analysis. It isconcluded from the experiment that after treatment of grafted PP-AA by meansof those various processes were able to improve the stability of copolymergrafted PP-AA in storage. The presence of peroxide radical in the ESR(electron spin resonance) spectrum on PP-AA yams before treatment and theones after treated with alkaline and being stored for 12 months haveindicated the presence of photo oxidation or photo degradation, while thepresence of poly enyl radical in the ESR spectrum of after treated PP-AA withdyes having azo and azine compound as chromophore, as well as with UVstabilizer with carbonyl as chromophore and being stored for 12 months haveproved that its presence have protected such
Smit, EN; Koopmann, M; Boersma, ER; Muskiet, FAJ
We investigated whether supplementation with arachidonic acid (20:4 omega 6; AA), ora combination of AA and docosahexaenoic acid (22:6 omega 3; DHA) would affect human milk polyunsaturated fatty acid (PUFA) composition. Ten women were daily supplemented with 300 mg AA, eight with 300 mg AA, 110 mg
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.The Limits of Scientific Cosmology: Setting the Stage: Accepted Facts, and Testing Limitations in Theory and Data (by Gourav Khullar)With a stellar lineup of speakers to talk about current and future prospects of cosmology and its limits (or lack thereof), the first session kicked off with talks by Risa Wechsler, Joseph Silk, and Sean Carroll (his talk on Multiverses is described below, by Nathan Sanders). Risa set the stage with an elaborate description of the current accepted facts in the era of precision cosmology including the standard model of concordance cosmology, described by seven parameters and an accepted Lambda-CDM paradigm (with a cosmological constant and cold dark matter). The talk stressed on the fact that all these parameters are understood to a percent order precision, which is a remarkable deviation from the time in 1990s when according to Risa, Alan Guth never thought that any of these numbers could be measured precisely!Risa Wechsler describing our current constraints on what Dark Matter could constitute.Joseph Silk discussing limits on cosmological parameters.The CMB measurements, Big Bang Nucleosynthesis estimates and galaxy clustering statistics all contribute to locking down the description of our universe. She emphasized on the tensions between different probes to measure expansion rate H0 of the universe, and small scale predictions of cold dark matter simulations, but she is hopeful that these shall be resolved eventually. Joe Silk followed this up with his interpretation of trying to understand our place in the universe and placing limits on different parameters and
Changing Age and Household Patterns
DEFF Research Database (Denmark)
Højbjerg Jacobsen, Rasmus; Hougaard Jensen, Svend E.
2014-01-01
finances by almost 1% of GDP on the yearly budget. While the net fiscal effect of changing household structures is minor, the gross effects are substantial. In a future characterized by population ageing, public finances may be adversely affected by changes in both age and household structures, thus...
Feedback on household electricity consumption
DEFF Research Database (Denmark)
Grønhøj, Alice; Thøgersen, John
2011-01-01
In this paper, we present results from a project aiming to develop a new feedback technology to support sustainable living in private households. Against the backdrop of a review of the relevant literature and based on qualitative family interviews and registration of the households' electricity ...
Obesity is a significant susceptibility factor for idiopathic AA amyloidosis.
Blank, Norbert; Hegenbart, Ute; Dietrich, Sascha; Brune, Maik; Beimler, Jörg; Röcken, Christoph; Müller-Tidow, Carsten; Lorenz, Hanns-Martin; Schönland, Stefan O
2018-03-01
To investigate obesity as susceptibility factor in patients with idiopathic AA amyloidosis. Clinical, biochemical and genetic data were obtained from 146 patients with AA amyloidosis. Control groups comprised 40 patients with long-standing inflammatory diseases without AA amyloidosis and 56 controls without any inflammatory disease. Patients with AA amyloidosis had either familial Mediterranean fever (FMF) or long-standing rheumatic diseases as underlying inflammatory disease (n = 111, median age 46 years). However, in a significant proportion of patients with AA amyloidosis no primary disease was identified (idiopathic AA; n = 37, median age 60 years). Patients with idiopathic AA amyloidosis were more obese and older than patients with AA amyloidosis secondary to FMF or rheumatic diseases. Serum leptin levels correlated with the body mass index (BMI) in all types of AA amyloidosis. Elevated leptin levels of more than 30 µg/l were detected in 18% of FMF/rheumatic + AA amyloidosis and in 40% of patients with idiopathic AA amyloidosis (p = .018). Finally, the SAA1 polymorphism was confirmed as a susceptibility factor for AA amyloidosis irrespective of the type of the disease. Obesity, age and the SAA1 polymorphism are susceptibility factors for idiopathic AA amyloidosis. Recent advances in treatment of FMF and rheumatic disorders will decrease the incidence of AA amyloidosis due to these diseases. Idiopathic AA, however, might be an emerging problem in the ageing and increasingly obese population.
Directory of Open Access Journals (Sweden)
Wei Sun
2005-12-01
Full Text Available An electrochemical assay of the enzyme alkaline phosphatase (ALP using ascorbic acid 2-phosphate (AAP as a new voltammetric substrate has been described in this paper. In the alkaline buffer solution the ALP enzymatic hydrolysis product of AAP was ascorbic acid (AA, which was an electro-active substance and had a sensitive differential pulse voltammetric (DPV oxidative response on glassy carbon electrode (GCE at +380 mV (versus Ag/AgCl, so the activity of ALP could be monitored voltammetrically of the oxidative peak current of AA. The electrochemical behaviours of AA were carefully studied and the AA standard solution could be measured by DPV method in the linear range from 10.0 to 1000.0 μmol/L with the detection limit of 8.0 μmol/L. The optimal conditions for ALP enzymatic reaction and the voltammetric detection were optimized. Under the optimal conditions the calibration curve for ALP assay exhibited a linear range from 0.4 to 2000.0 U/L with a detection limit of 0.3 U/L. This proposed method was further applied to determine the ALP content in healthy human serum and the results were in good agreement with the traditional p-nitrophenyl phosphate spectrophotometric method. The kinetic constants of enzymatic reaction were also investigated with the apparent kinetic constant Km as 2.77 mmol/L and the maximum velocity Vmax as 0.33 mol/min.
Antibacterial effect of PEO coating with silver on AA7075
Energy Technology Data Exchange (ETDEWEB)
Cerchier, P., E-mail: pietrogiovanni.cerchier@studenti.unipd.it [Department of Industrial Engineering, University of Padua, Via Marzolo 9, 35131 Padova (Italy); Pezzato, L.; Brunelli, K. [Department of Industrial Engineering, University of Padua, Via Marzolo 9, 35131 Padova (Italy); Dolcet, P. [Department of Chemical Science, University of Padua, INSTM, UdR Padova and ICMATE-CNR, Padova (Italy); Bartolozzi, A.; Bertani, R.; Dabalà, M. [Department of Industrial Engineering, University of Padua, Via Marzolo 9, 35131 Padova (Italy)
2017-06-01
In this work, plasma electrolytic oxidation (PEO) coatings were produced on AA7075 using alkaline solution containing silicates compounds and silver micrometric particles in order to give to the coating an antimicrobial effect. In the optic of circular economy, silver chloride derived from the acid pre-treatment of electronic scraps was used as raw material and successively silver powders were synthesized from silver chloride solution using glucose syrup as reducing agent. The coatings were characterized by scanning electron microscope (SEM), X-ray diffraction analysis (XRD), X-ray photoelectron spectroscopy (XPS), potentiodynamic polarization test and antimicrobial tests. The results evidenced that the obtained coatings were homogenous and give to the samples higher corrosion resistance than untreated alloy. The silver particles, found both inside and outside of the pores that characterize the PEO layer, produced an efficacious antimicrobial effect both against E. coli and S. aureus. - Highlights: • Silver particles were incorporated into PEO coatings produced on aluminum alloys. • The incorporation was performed with direct addition of the particles in the electrolyte. • The particles resulted equally distributed on the samples surfaces. • The obtained coatings show antimicrobial activity with both E. coli and S. aureus. • The obtained coatings were characterized by acceptable corrosion resistance.
Antibacterial effect of PEO coating with silver on AA7075
International Nuclear Information System (INIS)
Cerchier, P.; Pezzato, L.; Brunelli, K.; Dolcet, P.; Bartolozzi, A.; Bertani, R.; Dabalà, M.
2017-01-01
In this work, plasma electrolytic oxidation (PEO) coatings were produced on AA7075 using alkaline solution containing silicates compounds and silver micrometric particles in order to give to the coating an antimicrobial effect. In the optic of circular economy, silver chloride derived from the acid pre-treatment of electronic scraps was used as raw material and successively silver powders were synthesized from silver chloride solution using glucose syrup as reducing agent. The coatings were characterized by scanning electron microscope (SEM), X-ray diffraction analysis (XRD), X-ray photoelectron spectroscopy (XPS), potentiodynamic polarization test and antimicrobial tests. The results evidenced that the obtained coatings were homogenous and give to the samples higher corrosion resistance than untreated alloy. The silver particles, found both inside and outside of the pores that characterize the PEO layer, produced an efficacious antimicrobial effect both against E. coli and S. aureus. - Highlights: • Silver particles were incorporated into PEO coatings produced on aluminum alloys. • The incorporation was performed with direct addition of the particles in the electrolyte. • The particles resulted equally distributed on the samples surfaces. • The obtained coatings show antimicrobial activity with both E. coli and S. aureus. • The obtained coatings were characterized by acceptable corrosion resistance.
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session (Day 1) The Galaxy Zoo(by Benny Tsang)Galaxy Zoo was so hot that the servers hosting the galaxy images got melted down soon after being launched.Kevin Schawinski from ETH Zurich took us on a tour ofhis wonderful Galaxy Zoo. It is a huge zoo with about a quarter million zookeepers, they are citizen astronomers who collaboratively classify galaxies by their looks as an attempt to understand galaxy evolution. The big question that is being answered is: how do blue, actively star-forming galaxies evolve into red, quiescent (non-star-forming) galaxies? The Zoo helped reveal that blue galaxies turn into red galaxies via two possible paths galaxies might run out of supply of gas and shut off star formation slowly; or they could merge with one another and turn off star formation by destroying the gas reservoir rapidly!The Galaxy Zoo project also led to the discoveries of:Green Peas: they are the living fossils of galaxy evolution; compact, bright, green galaxies that are actively forming starsOverlapping galaxies: they are pairs of galaxies that are separated physically but happen to lie on the same line of sight; they provide excellent laboratories for studying dust extinctionHannys Voorwerp: an unusual object named after Hanny the discoverer, which is believed to be the first detection of quasar light echoThe idea of Galaxy Zoo in getting help from citizen scientists was further extended into an award-winningproject known as the Zooniverse, which is an online platform for streamlined crowd-sourcing for scientific research that requires human input. The future of astronomy is going to be
The AA disappearing under concrete shielding
CERN PhotoLab
1982-01-01
When the AA started up in July 1980, the machine stood freely in its hall, providing visitors with a view through the large window in the AA Control Room. The target area, in which the high-intensity 26 GeV/c proton beam from the PS hit the production target, was heavily shielded, not only towards the outside but also towards the AA-Hall. However, electrons and pions emanating from the target with the same momentum as the antiprotons, but much more numerous, accompanied these through the injection line into the AA ring. The pions decayed with a half-time corresponding to approximately a revolution period (540 ns), whereas the electrons lost energy through synchrotron radiation and ended up on the vacuum chamber wall. Electrons and pions produced the dominant component of the radiation level in the hall and the control room. With operation times far exceeding original expectations, the AA had to be buried under concrete shielding in order to reduce the radiation level by an order of magnitude.
International Nuclear Information System (INIS)
Ye Weimin; Zheng Zhenji; Chen Bao; Chen Yonggui
2011-01-01
Based on the previous laboratory studies and numerical simulation on bentonite in alkaline environments, the effects of alkaline cation and alkaline solution on mineral composition, microstructure, swelling capacity and hydraulic properties of bentonite are emphasized in this paper, temperature, pH values and concentration are discussed as main affecting factors. When bentonite is exposed to alkaline cation or alkaline solution, microstructure of bentonite will be changed due to the dissolution of montmorillonite and the formation of secondary minerals, which results in the decrease of swelling pressure. The amount of the reduction of swelling pressure depends on the concentration of alkaline solution. Temperature, polyvalent cation, salinity and concentration are the main factors affecting hydraulic properties of bentonite under alkaline conditions. Therefore, future research should focus on the mechanism of coupling effects of weak alkaline solutions on the mineral composition, microstructure, swelling capacity and hydraulic properties of bentonite under different temperatures and different pH values. (authors)
Household vehicles energy consumption 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-08-01
Household Vehicles Energy Consumption 1994 reports on the results of the 1994 Residential Transportation Energy Consumption Survey (RTECS). The RTECS is a national sample survey that has been conducted every 3 years since 1985. For the 1994 survey, more than 3,000 households that own or use some 6,000 vehicles provided information to describe vehicle stock, vehicle-miles traveled, energy end-use consumption, and energy expenditures for personal vehicles. The survey results represent the characteristics of the 84.9 million households that used or had access to vehicles in 1994 nationwide. (An additional 12 million households neither owned or had access to vehicles during the survey year.) To be included in then RTECS survey, vehicles must be either owned or used by household members on a regular basis for personal transportation, or owned by a company rather than a household, but kept at home, regularly available for the use of household members. Most vehicles included in the RTECS are classified as {open_quotes}light-duty vehicles{close_quotes} (weighing less than 8,500 pounds). However, the RTECS also includes a very small number of {open_quotes}other{close_quotes} vehicles, such as motor homes and larger trucks that are available for personal use.
Comparative Analysis of Households' Socioeconomic and ...
African Journals Online (AJOL)
This study analysed the socioeconomic and demographic characteristics of ... In order to improve households' food security status in both rural and urban areas, ... as reduction in household size through birth control, and increase in household ...
Detection of AA76, a Common Form of Amyloid A Protein, as a Way of Diagnosing AA Amyloidosis.
Sato, Junji; Okuda, Yasuaki; Kuroda, Takeshi; Yamada, Toshiyuki
2016-01-01
Reactive amyloid deposits consist of amyloid A (AA) proteins, the degradation products of serum amyloid A (SAA). Since the most common species of AA is the amino terminal portion produced by cleavage between residues 76 and 77 of SAA (AA76), the presence of AA76 in tissues could be a consequence of AA amyloid deposition. This study assessed the diagnostic significance of the detection of AA76 for AA amyloidosis using two different approaches. Biopsy specimens (n=130 from 54 subjects) from gastroduodenal mucosa or abdominal fat (n=9 from 9 subjects) of patients who had already been diagnosed with or were suspected of having AA amyloidosis were used. Fixed mucosal sections were subjected to immunohistochemistry using a newly developed antibody recognizing the carboxyl terminal end of AA76 (anti-AA76). The non-fixed materials from gastroduodenal mucosa or abdominal fat were subjected to immunoblotting for detection of the size of AA76. Among the gastroduodenal specimens (n=115) from already diagnosed patients, the positive rates of Congo red staining, immunohistochemistry using anti-AA76, and immunoblotting were 68.4%, 73.0%, and 92.2%, respectively. The anti-AA76 did not stain the supposed SAA in the blood or leakage, which was stained by anti-SAA antibody. AA76 was not detected either by immunohistochemistry or by immunoblot in the materials from patients in whom AA amyloidosis had been ruled out. In the abdominal fat, the immunoblot detected AA76 in 8 materials from 8 already diagnosed patients and did not in 1 patient whose gastroduodenal mucosa was negative. In conclusion, the detection of AA76 may alter the ability to diagnose AA amyloidosis. In immunohistochemistry for fixed specimens, the new anti-AA76 antibody can improve the specificity. Immunoblot for non-fixed materials, which can considerably improve the sensitivity, should be beneficial for small materials like abdominal fat. © 2016 by the Association of Clinical Scientists, Inc.
Farm Households Food Production and Households' Food Security ...
African Journals Online (AJOL)
insecurity existed among households in the study areas based on the recommended average DEC/AE, of 2200 kcal and ... An International Journal of Basic and Applied Research. 41 ... population, for example, eating of less preferred foods.
Development of continuous cooling precipitation diagrams for aluminium alloys AA7150 and AA7020
Energy Technology Data Exchange (ETDEWEB)
Zhang, Y., E-mail: yong.zhang@outlook.com [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia); Milkereit, B. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Kessler, O. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); Schick, C. [University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Rometsch, P.A. [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia)
2014-01-25
Highlights: • The DSC method was used for developing continuous cooling precipitation diagrams. • The quench-induced particles were observed by SEM for alloys AA7150 and AA7020. • There were more quench-induced particles in alloy AA7150. • Quench sensitivity of Al alloys can be evaluated by using the CCP diagrams. -- Abstract: Two commercial 7xxx series aluminium alloys with different solute contents and different quench-induced precipitation behaviour have been investigated by using a specialised differential scanning calorimetry (DSC) technique to record exothermal heat outputs during continuous cooling. Together with hardness testing and microstructural analysis, this DSC method was used to develop continuous cooling precipitation (CCP) diagrams for alloys AA7150 and AA7020. The results show that the total precipitation heat for each alloy decreases with increasing cooling rate. However, the excess specific heat at a given cooling rate in alloy AA7150 is much higher than that in alloy AA7020. It is evident that there are atleast three different quench-induced reactions in different temperature regimes for alloy AA7150 cooled at various linear cooling rates, but only equilibrium MgZn{sub 2} (η-phase) and Al{sub 2}CuMg (S-phase) particles were observed by scanning electron microscopy (SEM). There are at least two main precipitation peaks that can be found for alloy AA7020, which correspond to Mg{sub 2}Si and MgZn{sub 2} (η-phase). Furthermore, a method is developed to evaluate the quench sensitivity of an alloy based on a determination of the critical cooling rate. The maximum hardness values are reached at cooling rates that are faster than or similar to the critical cooling rate.
Alkaline azide mutagenicity in cowpea
Energy Technology Data Exchange (ETDEWEB)
Mahna, S K; Bhargava, Anubha; Mohan, Lalit [Cytogenetics and Mycology Laboratory, Department of Botany, Government College, Ajmer (India)
1990-07-01
Sodium azide is known as a potent mutagen in cereals and legumes. It is very effective in acidic medium in barley. Here an attempt is made to measure the effectiveness of sodium azide in alkaline medium (pH 7.4) on cowpea (Vigna unguiculata (L.) Walp., variety FS-68). Seeds pre-soaked in distilled water for 5 hours were treated with different concentrations (10{sup -6}, 10{sup -5}, 10{sup -4} and 10{sup -3}M) of sodium azide (NaN{sub 3}) for 4 hours at 28{+-} 2 deg. C. Bottles were intermittently shaken, then the seeds were thoroughly washed in running tap water and subsequently planted in pots. The treatment caused significant biological damage such as reduction in seed germination, length of root and shoot, number of nodules and pods per plant and morphological leaf variations. Morphological, as well as chlorophyll mutants, were detected in M{sub 2}.
Alkaline azide mutagenicity in cowpea
International Nuclear Information System (INIS)
Mahna, S.K.; Bhargava, Anubha; Mohan, Lalit
1990-01-01
Sodium azide is known as a potent mutagen in cereals and legumes. It is very effective in acidic medium in barley. Here an attempt is made to measure the effectiveness of sodium azide in alkaline medium (pH 7.4) on cowpea (Vigna unguiculata (L.) Walp., variety FS-68). Seeds pre-soaked in distilled water for 5 hours were treated with different concentrations (10 -6 , 10 -5 , 10 -4 and 10 -3 M) of sodium azide (NaN 3 ) for 4 hours at 28± 2 deg. C. Bottles were intermittently shaken, then the seeds were thoroughly washed in running tap water and subsequently planted in pots. The treatment caused significant biological damage such as reduction in seed germination, length of root and shoot, number of nodules and pods per plant and morphological leaf variations. Morphological, as well as chlorophyll mutants, were detected in M 2
catalysed oxidation of atenolol by alkaline permanganate
Indian Academy of Sciences (India)
Unknown
Abstract. Kinetics of ruthenium (III) catalyzed oxidation of atenolol by permanganate in alkaline medium at constant ionic strength of 0⋅30 mol dm3 has been studied spectrophotometrically using a rapid kinetic accessory. Reaction between permanganate and atenolol in alkaline medium exhibits 1 : 8 stoichiometry.
Increased liver alkaline phosphatase and aminotransferase ...
African Journals Online (AJOL)
The effect of daily, oral administration of ethanolic extract of Khaya senegalensis stem bark (2mg/kg body weight) for 18days on the alkaline phosphatase, aspartate and alanine aminotransferase activities of rat liver and serum were investigated. Compared with the control, the activities of liver alkaline phosphatase (ALP), ...
Household composition and psychological health
DEFF Research Database (Denmark)
Joensen, Lene Eide; Willaing, Ingrid; Holt, Richard I G
2017-01-01
AIMS: 1) To explore the effect of household composition on the psychological health of adults with diabetes by comparing those living with other adult(s) including a partner with those living with neither partner nor other adult(s); 2) to examine potential mediation of social support...... in the association between household composition and psychological health. METHODS: The study is part of the DAWN2 study conducted in 17 countries. The population comprised 8596 people with diabetes (PWD). Multiple regression models (linear and binary) were applied. RESULTS: People living with 'other adult...... to the other household composition groups. The association between household composition and psychological health was not mediated by diabetes-specific social support. CONCLUSIONS: The study indicates the psychological vulnerability of respondents living without a partner but with other adult(s). Appropriate...
DEFF Research Database (Denmark)
de Borger, Bruno; Mulalic, Ismir; Rouwendal, Jan
2013-01-01
In this paper we study the demand for car kilometres in two-car households, focusing on the substitution between cars in response to fuel price changes. We use a large sample of detailed Danish data on two-car households to estimate—for each car owned by the household—own and cross-price effects...... of increases in fuel costs per kilometre. The empirical results show that failure to capture substitution between cars within the household can result in substantial misspecification biases. Ignoring substitution, we estimate fuel price elasticities of –0.81 and -0.65 for the primary and secondary cars...... efficient car, finding partial support for the underlying hypothesis. More importantly, the results of this extended model emphasize the importance of behavioural differences related to the position of the most fuel efficient car in the household, suggesting that households’ fuel efficiency choices...
AA, vacuum tank for stochastic precooling
CERN PhotoLab
1979-01-01
The vaccum tank in which the fast stochastic precooling kicker was installed. It is clad with heating jackets for bake-out to 200 deg C, indispensable for reaching the operational vacuum of 7E-11 Torr. Alain Poncet, responsible for AA vacuum, is looking on. See also 7910268, 8002234.
Overview of the Antiproton Accumulator (AA)
1982-01-01
See photo 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
1980-01-01
See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
Overall view of AA in Bld. 193
1980-01-01
See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
AA, sandwich line with magnetic horn
CERN PhotoLab
1980-01-01
Continuation from 8010293: Finally, the sandwich line with the horn is placed on the ground, for the horn to be inspected and, if needed, exchanged for a new one. The whole procedure was trained with several members of the AA team, for quick and safe handling, and to share the radiation dose amongst them.
AA, mating of BST magnet halves
CERN PhotoLab
1980-01-01
The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.
Sale of electricity to households
International Nuclear Information System (INIS)
Anon
2011-01-01
The Company Slovenske elektrarne (SE) Predaj has after two years of presence in the market expanded their business activities to the households segment. The first customers can be particularly employees of Slovenske elektrarne. This chance will be provided to them starting from 1 October of this year. 'The electricity supplies for households will only be supplementary segment of sales at SE Predaj Company. We will still focus mainly at businesses with higher consumption,' says director of the Company Mr. Stanislav Reguli. (author)
Does fertility decrease household consumption?
Jungho Kim; Henriette Engelhardt; Alexia Fürnkranz-Prskawetz; Arnstein Aassve
2009-01-01
This paper presents an empirical analysis of the relationship between fertility and a direct measure of poverty for Indonesia, a country, which has experienced unprecedented economic growth and sharp fertility declines over recent decades. It focuses on illustrating the sensitivity of the effect of fertility on household consumption with respect to the equivalence scale by applying the propensity score matching method. The analysis suggests that a newborn child decreases household consumption...
Consumption Profiles for Future Households
Blikø, Marianne
2015-01-01
Over the last few years there has been a change in energy consumption in Norwegian households. New houses are far better insulated, have high demands for efficient energy carriers and new installations that affect the electricity consumption. Today, most of the electricity in a Norwegian household is used for space heating, but this demand is expected to be reduced in the future, mainly because the need for space heating is reduced as a result of stricter demands for isolation. Electricity co...
Murayama, Takashi; Maruyama, Ichiro N
2015-11-01
Animals can survive only within a narrow pH range. This requires continual monitoring of environmental and body-fluid pH. Although a variety of acidic pH sensor molecules have been reported, alkaline pH sensor function is not well understood. This Review describes neuronal alkaline pH sensors, grouped according to whether they monitor extracellular or intracellular alkaline pH. Extracellular sensors include the receptor-type guanylyl cyclase, the insulin receptor-related receptor, ligand-gated Cl- channels, connexin hemichannels, two-pore-domain K+ channels, and transient receptor potential (TRP) channels. Intracellular sensors include TRP channels and gap junction channels. Identification of molecular mechanisms underlying alkaline pH sensing is crucial for understanding how animals respond to environmental alkaline pH and how body-fluid pH is maintained within a narrow range. © 2015 Wiley Periodicals, Inc.
(PCL/AA) hydrogel for controlled drug delivery
Indian Academy of Sciences (India)
Administrator
applications, (iii) dental applications, (iv) injectable polymers, (v) ... PCL with AA grafted PCL(PCL-g-AA) on the structure ... porosity. Structure, morphology and crystallinity of PCL/ .... X-ray diffraction patterns were recorded, in reflection,.
Tian, Jing-Zhuo; Liang, Ai-Hua; Liu, Jing; Zhang, Bo-Li
2017-12-01
Aristolochic acids (AAs) widely exist in such plants as Aristolochia and Asarum. The renal toxicity of AAs as well as its carcinogenicity to urinary system have been widely known. In 2003 and 2004, China prohibited the use of Aristolochiae Radix, Aristolochiae Manshuriensis Caulis and Aristolochiae Fangchi Radix, and required administering other AAs-containing medicines in accordance with the regulations for prescription drugs. In this paper, we retrieved literatures on the content determination of AAs in recent 10 years in China. It suggested that the AAs content is lower in Asarum herb, especially in its roots and rhizomes, and most of which do not show detectable amount of AA-I. Some of traditional Chinese medicines show fairly small amount of detectable AA-I. The AAs content in Aristolochia herb (including Fructus Aristolochiae, kaempfer dutchmanspipe root) is relatively high; however, there are fewer literatures for studying the content determination of AAs in Chinese patent medicines. There were many factors affecting AAs content, including the parts used, origins, processing methods, extraction process. It suggested that we should pay attention to the toxicity of Chinese medicines containing AAs and use these decoction pieces and traditional Chinese medicines cautiously. In addition, basic studies for the origins, processing methods and extraction process of Chinese patent medicines containing AAs, as well as supervision and detection of AAs content in traditional Chinese medicinal materials, decoction pieces and Chinese patent medicines shall be strengthened for reducing medication risk and guaranteeing clinical medication safety. Copyright© by the Chinese Pharmaceutical Association.
Muhammad, Naeem; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka
2016-09-01
To investigate pathogenesis and kinetics of experimentally induced murine AA amyloidosis seeded with homologous (murine) and heterologous (bovine) AA fibrils. Experimental AA amyloidosis was induced by administration of inflammatory stimulus and preformed AA fibrils to a total of 111 female C57/Black mice. In this longitudinal study, heterologous (bovine) as well as homologous (murine) AA fibrils were injected intraperitoneally to mice in various combinations. Re-stimulation was done at 120 or 300 days post first inoculation. To analyze the intensity of amyloid depositions in mice organs, immunohistochemical techniques and image J software were used. Assessment of cytokines level in sera was done using a Mouse Th1/Th2/Th17 Cytokine CBA Kit. Incidence and severity of AA amyloidosis were quite low in mice inoculated with heterologous bovine AA fibrils than homologous murine one. Homologous AA fibrils administration at first and second inoculation caused maximum amount of amyloid depositions and severe systemic form of amyloidosis. Increase in the level of pro-inflammatory cytokine IL-6 was observed after first inoculation, while second inoculation caused a further increase in the level of anti-inflammatory cytokine IL-10. AA amyloidosis can be induced by heterologous as well as homologous AA fibrils. Severity of AA amyloidosis induced with homologous AA fibrils is higher compared to heterologous AA fibrils.
Alkaline pretreatment of Mexican pine residues for bioethanol ...
African Journals Online (AJOL)
Alkaline pretreatment of Mexican pine residues for bioethanol production. ... Keywords: Lignocellulosic biomass, alkaline pretreatment, enzymatic hydrolysis, fermentable sugars, fermentation. African Journal of Biotechnology Vol. 12(31), pp.
Alkaline sorbent injection for mercury control
Madden, Deborah A.; Holmes, Michael J.
2002-01-01
A mercury removal system for removing mercury from combustion flue gases is provided in which alkaline sorbents at generally extremely low stoichiometric molar ratios of alkaline earth or an alkali metal to sulfur of less than 1.0 are injected into a power plant system at one or more locations to remove at least between about 40% and 60% of the mercury content from combustion flue gases. Small amounts of alkaline sorbents are injected into the flue gas stream at a relatively low rate. A particulate filter is used to remove mercury-containing particles downstream of each injection point used in the power plant system.
Alkaline rocks and the occurrence of uranium
International Nuclear Information System (INIS)
Hambleton-Jones, B.B.; Toens, P.D.
1980-10-01
Many alkaline complexes contain uranium and other minerals in low concentrations and are regarded as constituting valuable potential reserves. Certain complex metallurgical problems, however, remain to be solved. Alkaline rocks occur in a number of forms and environments and it is noted that they are generated during periods of geological quiescence emplaced mainly in stable aseismic areas. Many occur along the extensions of oceanic transform faults beneath the continental crust and the application of this concept to areas not currently known to host alkaline complexes may prove useful in identifying potential target areas for prospecting operations [af
Absorption spectra of AA-stacked graphite
International Nuclear Information System (INIS)
Chiu, C W; Lee, S H; Chen, S C; Lin, M F; Shyu, F L
2010-01-01
AA-stacked graphite shows strong anisotropy in geometric structures and velocity matrix elements. However, the absorption spectra are isotropic for the polarization vector on the graphene plane. The spectra exhibit one prominent plateau at middle energy and one shoulder structure at lower energy. These structures directly reflect the unique geometric and band structures and provide sufficient information for experimental fitting of the intralayer and interlayer atomic interactions. On the other hand, monolayer graphene shows a sharp absorption peak but no shoulder structure; AA-stacked bilayer graphene has two absorption peaks at middle energy and abruptly vanishes at lower energy. Furthermore, the isotropic features are expected to exist in other graphene-related systems. The calculated results and the predicted atomic interactions could be verified by optical measurements.
AA, inner conductor of a magnetic horn
CERN PhotoLab
1981-01-01
At the start-up of the AA and during its initial operation, magnetic horns focused the antiprotons emanating from the production target. These "current-sheet lenses" had a thin inner conductor (for minimum absorption of antiprotons), machined from aluminium to wall thicknesses of 0.7 or 1 mm. The half-sine pulses rose to 150 kA in 8 microsec. The angular acceptance was 50 mrad.
First circulating beam in the AA
CERN PhotoLab
1980-01-01
On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.5 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are to numerous to name them all. Heribert Koziol, apparently asleep, is answering the call from an impatient director. See also 8007094.
AA, assembly of wide bending magnet
CERN PhotoLab
1980-01-01
The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.
AAS Publishing News: Astronomical Software Citation Workshop
Kohler, Susanna
2015-07-01
Do you write code for your research? Use astronomical software? Do you wish there were a better way of citing, sharing, archiving, or discovering software for astronomy research? You're not alone! In April 2015, AAS's publishing team joined other leaders in the astronomical software community in a meeting funded by the Sloan Foundation, with the purpose of discussing these issues and potential solutions. In attendance were representatives from academic astronomy, publishing, libraries, for-profit software sharing platforms, telescope facilities, and grantmaking institutions. The goal of the group was to establish “protocols, policies, and platforms for astronomical software citation, sharing, and archiving,” in the hopes of encouraging a set of normalized standards across the field. The AAS is now collaborating with leaders at GitHub to write grant proposals for a project to develop strategies for software discoverability and citation, in astronomy and beyond. If this topic interests you, you can find more details in this document released by the group after the meeting: http://astronomy-software-index.github.io/2015-workshop/ The group hopes to move this project forward with input and support from the broader community. Please share the above document, discuss it on social media using the hashtag #astroware (so that your conversations can be found!), or send private comments to julie.steffen@aas.org.
Alkalinity in oil field waters - what alkalinity is and how it is measured
International Nuclear Information System (INIS)
Kaasa, B.; Oestvold, T.
1996-01-01
The alkalinity is an important parameter in the description of pH-behaviour, buffer capacity and scaling potentials in oil field waters. Although the alkalinity is widely used, it seems to be considerable confusion in connection with the concept. It is often used incorrectly and different authors define the concept in different ways. Several different methods for the determination of alkalinity can be found in the literature. This paper discusses the definition of alkalinity and how to use alkalinity in oil field waters to obtain data of importance for scale and pH predictions. There is also shown how a simple titration of oil field waters can give both the alkalinity and the content of organic acids in these waters. It is obvious from these findings that most of the methods used to day may give considerable errors when applied to oil field waters with high contents of organic acids. 8 refs., 8 figs., 5 tabs
Optical properties of alkaline earth borate glasses
African Journals Online (AJOL)
user
The alkaline earth borate glasses containing heavy metal oxides show good solubility of rare-earth ions. Glasses containing PbO exhibit low glass transition temperature (Tg) and high ..... These oxygen ions carry a partial negative charge and.
Technetium recovery from high alkaline solution
Energy Technology Data Exchange (ETDEWEB)
Nash, Charles A.
2016-07-12
Disclosed are methods for recovering technetium from a highly alkaline solution. The highly alkaline solution can be a liquid waste solution from a nuclear waste processing system. Methods can include combining the solution with a reductant capable of reducing technetium at the high pH of the solution and adding to or forming in the solution an adsorbent capable of adsorbing the precipitated technetium at the high pH of the solution.
2010-07-01
... (40 CFR Part 63, Subpart A) to Subpart AA A Appendix A to Subpart AA of Part 63 Protection of... Hazardous Air Pollutants From Phosphoric Acid Manufacturing Plants Pt. 63, Subpt. AA, App. A Appendix A to Subpart AA of Part 63—Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA 40 CFR...
Financial planning for young households
DEFF Research Database (Denmark)
Pedersen, Anne Marie Boiden; Weissensteiner, Alex; Poulsen, Rolf
2013-01-01
We analyze the financial planning problems of young households whose main decisions are how to finance the purchase of a house (liabilities) and how to allocate investments in pension savings schemes (assets). The problems are solved using a multi-stage stochastic programming model where...
Family Issues in Multigenerational Households.
Feinauer, Leslie L; And Others
1987-01-01
Studied issues faced by multigenerational families and their implications for family therapy. Major factors in multigenerational households included dependency, sibling relationships, depression, and demanding and egocentric behavior. Factors to consider during family therapy include respite care, age, interdependence, dignity, provision of care,…
Household Arthropod Allergens in Korea
Jeong, Kyoung Yong
2009-01-01
Arthropods are important in human health, which can transmit pathogens to humans, parasitize, or produce important allergens. Allergy prevalence becomes higher in Korea recently as well as other developed countries in contrast to a decrease of infectious diseases. Allergic diseases caused by household arthropods have increased dramatically during the last few decades since human beings spend more their time for indoor activities in modernized life style. Household arthropods are one of the most common causes of allergic diseases. Biological characterization of household arthropods and researches on their allergens will provide better understanding of the pathogenesis of allergic diseases and suggest new therapeutic ways. Therefore, studies on arthropods of allergenic importance can be considered one of the major research areas in medical arthropodology and parasitology. Here, the biology of several household arthropods, including house dust mites and cockroaches, the 2 most well known arthropods living indoor together with humans worldwide, and characteristics of their allergens, especially the research activities on these allergens performed in Korea, are summarized. PMID:19885330
Inflation differentials among Czech households
Czech Academy of Sciences Publication Activity Database
Janský, Petr; Hait, Pavel
2016-01-01
Roč. 25, č. 1 (2016), s. 71-84 ISSN 1210-0455 R&D Projects: GA TA ČR(CZ) TD020188 Institutional support: RVO:67985998 Keywords : households * inflation * inflation differentials Subject RIV: AH - Economics Impact factor: 0.710, year: 2016
Household Portfolios in the Netherlands
Alessie, R.J.M.; Hochgürtel, S.; van Soest, A.H.O.
2000-01-01
We describe and analyse the portfolio structure of Dutch households using micro panel data from the CentER Savings Survey, 1993-1998.The data allows for a distinction between many types of assets.Moreover, we have information on mortgage debt, consumer debt, etc.We analyse the composition of
Improved electrodes and gas impurity investigations on alkaline electrolysers
DEFF Research Database (Denmark)
Reissner, R.; Schiller, G.; Knoeri, T.
Alkaline water electrolysis for hydrogenproduction is a well-established techniquebut some technological issues regarding thecoupling of alkaline water electrolysis andRenewable Energy Sources (RES) remain tobe improved.......Alkaline water electrolysis for hydrogenproduction is a well-established techniquebut some technological issues regarding thecoupling of alkaline water electrolysis andRenewable Energy Sources (RES) remain tobe improved....
Ascorbic acid (AA) metabolism in protection against radiation damage
International Nuclear Information System (INIS)
Rose, R.C.; Koch, M.J.
1986-01-01
The possibility is considered that AA protects tissues against radiation damage by scavenging free radicals that result from radiolysis of water. A physiologic buffer (pH 6.7) was incubated with 14 C-AA and 1 mM thiourea (to slow spontaneous oxidation of AA). Aliquots were assayed by HPLC and scintillation spectrometry to identify the 14 C-label. Samples exposed to Cobalt-60 radiation had a half time of AA decay of 30 minutes) indicating that AA scavenges radiation-induced free radicals and forms the ascorbate free radical (AFR). Pairs of 14 C-AFR disproportionate, with the net effect of 14 C-dehydroascorbic acid formation from 14 C-AA. Having established that AFR result from ionizing radiation in an aqueous solution, the possibility was evaluated that a tissue factor reduces AFR. Cortical tissue from the kidneys of male rats was minced, homogenized in buffer and centrifuged at 8000 xg. The supernatant was found to slow the rate of radiation-induced AA degradation by > 90% when incubated at 23 0 C in the presence of 15 μM 14 C-AA. Samples of supernatant maintained at 100 0 C for 10 minutes or precipitated with 5% PCA did not prevent radiation-induced AA degradation. AA may have a specific role in scavenging free radicals generated by ionizing radiation and thereby protect body tissues
AA, Inner Conductor of Magnetic Horn
CERN PhotoLab
1979-01-01
Antiprotons emerging at large angles from the production target (hit by an intense 26 GeV proton beam from the PS), were focused into the acceptance of the injection line of the AA by means of a "magnetic horn" (current-sheet lens). Here we see an early protype of the horn's inner conductor, machined from solid aluminium to a thickness of less than 1 mm. The 1st version had to withstand pulses of 150 kA, 15 us long, every 2.4 s. See 8801040 for a later version.
Paul, Sujay; Zhang, Angel; Ludeña, Yvette; Villena, Gretty K; Yu, Fengan; Sherman, David H; Gutiérrez-Correa, Marcel
2017-06-10
Here, we report the complete genome sequence of a high alkaline cellulase producing Aspergillus fumigatus strain LMB-35Aa isolated from soil of Peruvian Amazon rainforest. The genome is ∼27.5mb in size, comprises of 228 scaffolds with an average GC content of 50%, and is predicted to contain a total of 8660 protein-coding genes. Of which, 6156 are with known function; it codes for 607 putative CAZymes families potentially involved in carbohydrate metabolism. Several important cellulose degrading genes, such as endoglucanase A, endoglucanase B, endoglucanase D and beta-glucosidase, are also identified. The genome of A. fumigatus strain LMB-35Aa represents the first whole sequenced genome of non-clinical, high cellulase producing A. fumigatus strain isolated from forest soil. Copyright © 2017 Elsevier B.V. All rights reserved.
A Picture of Subsidized Households 2009
Department of Housing and Urban Development — Picture of Subsidized Households describes the nearly 5 million households living in HUD-subsidized housing in the United States for the year 2009. Picture 2009...
Characterization of household food waste in Denmark
DEFF Research Database (Denmark)
Edjabou, Vincent Maklawe Essonanawe; Petersen, C.; Scheutz, Charlotte
This paper presents a methodology and the results of compositional analysis of food waste from Danish families living in single-family houses. Residual household waste was sampled and manually sorted from 211 single-family houses in the suburb of Copenhagen. The main fractions contributing...... to the household food waste were avoidable vegetable food waste and non-avoidable vegetable food waste. Statistical analysis found a positive linear relationship between household size and the amount of the household food waste....
Household energy and consumption and expenditures, 1990
International Nuclear Information System (INIS)
1993-01-01
The purpose of this supplement to the Household Energy Consumption and Expenditures 1990 report is to provide information on the use of energy in residential housing units, specifically at the four Census regions and nine Census division levels. This report includes household energy consumption, expenditures, and prices for natural gas, electricity, fuel oil, liquefied petroleum gas (LPG), and kerosene as well as household wood consumption. For national-level data, see the main report, Household Energy Consumption and Expenditures 1990
Household Consumption, Investment and Life Insurance
DEFF Research Database (Denmark)
Bruhn, Kenneth; Steffensen, Mogens
2011-01-01
This paper develops a continuous-time Markov model for utility optimization of households. The household optimizes expected future utility from consumption by controlling consumption, investments and purchase of lifeinsurance for each person in the household. The optimal controls are investigated...... in the special case of a two-person household, and we present graphics illustrating how differences between the two persons affect the controls....
Microstructural features of friction stir welded dissimilar Aluminium alloys AA2219-AA7475
Zaman Khan, Noor; Ubaid, Mohammed; Siddiquee, Arshad Noor; Khan, Zahid A.; Al-Ahmari, Abdulrahman; Chen, Xizhang; Haider Abidi, Mustufa
2018-05-01
High strength, good corrosion resistance, light weight make aluminium alloys a material of choice in many industrial sectors like aerospace, marine etc. Problems associated with welding of these alloys by fusion welding processes restricted their use in various industries. Friction stir welding (FSW), a clean solid-state joining process, easily overcomes various difficulties encountered during conventional fusion welding processes. In the present work, the effect of rotational speed (710 rpm, 900 rpm and 1120 rpm) on micro-hardness distribution and microstructure of FSWed dissimilar aluminium alloy joints were analyzed. Plates of AA7475-T761 and AA2219-O having thickness of 2.5 mm were welded by fixing AA7475 on retreating side (RS) and AA2219 on advancing side (AS). Welded joints were characterized by Vickers micro-hardness testing, scanning electron microscopy (SEM) and optical microscopy (OM). Results revealed that rotational speed significantly affects the micro-hardness due to increase in grain size, coarsening and dissolution of strengthening precipitates and re-precipitation. Higher micro-hardness values were observed in stir zone due to grain refinement and re-precipitation. Minimum micro-hardness value was observed at the TMAZ/HAZ of advancing side due to thermal softening.
International Nuclear Information System (INIS)
Knospe, W.H.; Steinberg, D.; Gratwohl, A.; Speck, B.
1984-01-01
Immunologically mediated aplastic anemia (AA) in mice was induced by the i.v. injection of 10(7) lymph node cells (LNC) from H-2k identical but Mls mismatched CBA/J donor mice into previously irradiated (600 rad total body gamma) C3H/HeJ mice. Cyclosporin A (CsA), 25 mg/kg, was administered subcutaneously from day -1 to day 30. Control mice included C3H/HeJ mice which received 600 rad alone, C3H/HeJ mice which received 600 rad plus CsA as above, and C3H/HeJ mice which received 600 rad total body irradiation followed by 10(7) LNC from CBA/J donors. CsA failed to prevent lethal AA. These results suggest that the pathogenetic mechanisms operating in immunologically mediated AA differ from the mechanisms operating in rodents transplanted with allogeneically mismatched marrow or spleen cells which develop graft-versus-host disease. The results are consistent with a non-T cell-dependent mechanism causing the AA
Division of household tasks and financial management
Antonides, G.
2011-01-01
Both the standard economic model and bargaining theory make predictions about financial management and the division of household labor between household partners. Using a large Internet survey, we have tested several predictions about task divisions reported by Dutch household partners. The division
7 CFR 273.1 - Household concept.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Household concept. 273.1 Section 273.1 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF ELIGIBLE HOUSEHOLDS § 273.1 Household concept...
Size of households and income disparities.
Kuznets, S
1981-01-01
The author examines "the relation between differentials in size of households, (preponderantly family households including one-person units) and disparities in income per household, per person, or per some version of consuming unit." The analysis is based on data for the United States, the Federal Republic of Germany, Israel, Taiwan, the Philippines, and Thailand. excerpt
Spending time and money within the household
DEFF Research Database (Denmark)
Browning, Martin; Gørtz, Mette
We consider theoretically and empirically the allocation of time and money within the household. The novelty of our empirical work is that we have a survey which provides information on both time use and the allocation of some goods within the household, for the same households. We can consider...
Intrahousehold allocation, household headship and nutrition of ...
African Journals Online (AJOL)
This paper aims to establish whether there is a significant difference in nutritional status of children in male-headed households, de jure female-headed households and de facto female-headed households. The study uses a sample of 199 children aged 6 to 60 months, of mothers in reproductive age, derived from 499 ...
Simon van der Meer in the AA Control Room
CERN PhotoLab
1984-01-01
Simon van der Meer, spiritus rector of the Antiproton Accumulator, in the AA Control Room. Inventor of stochastic cooling, on which the AA was based, and of the magnetic horn, with which the antiprotons were focused, he also wrote most of the software with which the AA was controlled, and spent uncountable numbers of hours in this chair to tickle the AA to top performance. 8 months after this picture was taken, he received, in October 1984, the Nobel prize, together with Carlo Rubbia, the moving force behind the whole Proton-Antiproton Collider project that led to the discovery, in 1983, of the W and Z intermediate bosons.
Mechanical and corrosion properties of AA8011 sheets and foils:
Asanović, Vanja; Dalijić, Kemal; Radonjić, Dragan
2006-01-01
The mechanical and corrosion properties of a twin-roll cast Al-Fe-Si aluminum alloy with 0.74 % Fe and 0.52 % Si (AA8011) were investigated. The influence of the thermo-mehanical processing route on the mechanical behavior of AA8011 sheets was determined. Comparisons were made with AA3003 and A199.5 sheets. The restoration of the mechanical properties was used in the analysis of the recrystallization behavior of the twin-roll cast AA8011 alloy deformed under cold-working conditions and subseq...
Assessing ocean alkalinity for carbon sequestration
Renforth, Phil; Henderson, Gideon
2017-09-01
Over the coming century humanity may need to find reservoirs to store several trillions of tons of carbon dioxide (CO2) emitted from fossil fuel combustion, which would otherwise cause dangerous climate change if it were left in the atmosphere. Carbon storage in the ocean as bicarbonate ions (by increasing ocean alkalinity) has received very little attention. Yet recent work suggests sufficient capacity to sequester copious quantities of CO2. It may be possible to sequester hundreds of billions to trillions of tons of C without surpassing postindustrial average carbonate saturation states in the surface ocean. When globally distributed, the impact of elevated alkalinity is potentially small and may help ameliorate the effects of ocean acidification. However, the local impact around addition sites may be more acute but is specific to the mineral and technology. The alkalinity of the ocean increases naturally because of rock weathering in which >1.5 mol of carbon are removed from the atmosphere for every mole of magnesium or calcium dissolved from silicate minerals (e.g., wollastonite, olivine, and anorthite) and 0.5 mol for carbonate minerals (e.g., calcite and dolomite). These processes are responsible for naturally sequestering 0.5 billion tons of CO2 per year. Alkalinity is reduced in the ocean through carbonate mineral precipitation, which is almost exclusively formed from biological activity. Most of the previous work on the biological response to changes in carbonate chemistry have focused on acidifying conditions. More research is required to understand carbonate precipitation at elevated alkalinity to constrain the longevity of carbon storage. A range of technologies have been proposed to increase ocean alkalinity (accelerated weathering of limestone, enhanced weathering, electrochemical promoted weathering, and ocean liming), the cost of which may be comparable to alternative carbon sequestration proposals (e.g., $20-100 tCO2-1). There are still many
Posttranslational heterogeneity of bone alkaline phosphatase in metabolic bone disease.
Langlois, M R; Delanghe, J R; Kaufman, J M; De Buyzere, M L; Van Hoecke, M J; Leroux-Roels, G G
1994-09-01
Bone alkaline phosphatase is a marker of osteoblast activity. In order to study the posttranscriptional modification (glycosylation) of bone alkaline phosphatase in bone disease, we investigated the relationship between mass and catalytic activity of bone alkaline phosphatase in patients with osteoporosis and hyperthyroidism. Serum bone alkaline phosphatase activity was measured after lectin precipitation using the Iso-ALP test kit. Mass concentration of bone alkaline phosphatase was determined with an immunoradiometric assay (Tandem-R Ostase). In general, serum bone alkaline phosphatase mass and activity concentration correlated well. The activity : mass ratio of bone alkaline phosphatase was low in hyperthyroidism. Activation energy of the reaction catalysed by bone alkaline phosphatase was high in osteoporosis and in hyperthyroidism. Experiments with neuraminidase digestion further demonstrated that the thermodynamic heterogeneity of bone alkaline phosphatase can be explained by a different glycosylation of the enzyme.
High temperature and pressure alkaline electrolysis
DEFF Research Database (Denmark)
Allebrod, Frank; Chatzichristodoulou, Christodoulos; Mogensen, Mogens Bjerg
2013-01-01
Alkaline electrolyzers have proven to operate reliable for decades on a large scale, but in order to become commercially attractive and compete against conventional technologies for hydrogen production, the production and investment costs have to be reduced. This may occur by increasing the opera......Alkaline electrolyzers have proven to operate reliable for decades on a large scale, but in order to become commercially attractive and compete against conventional technologies for hydrogen production, the production and investment costs have to be reduced. This may occur by increasing...
Alkaline earth filled nickel skutterudite antimonide thermoelectrics
Singh, David Joseph
2013-07-16
A thermoelectric material including a body centered cubic filled skutterudite having the formula A.sub.xFe.sub.yNi.sub.zSb.sub.12, where A is an alkaline earth element, x is no more than approximately 1.0, and the sum of y and z is approximately equal to 4.0. The alkaline earth element includes guest atoms selected from the group consisting of Be, Mb, Ca, Sr, Ba, Ra and combinations thereof. The filled skutterudite is shown to have properties suitable for a wide variety of thermoelectric applications.
Baranek, Jakub; Kaznowski, Adam; Konecka, Edyta; Naimov, Samir
2015-09-01
Vegetative insecticidal proteins (Vips) secreted by some isolates of Bacillus thuringiensis show activity against insects and are regarded as insecticides against pests. A number of B. thuringiensis strains harbouring vip3A genes were isolated from different sources and identified by using a PCR based approach. The isolates with the highest insecticidal activity were indicated in screening tests, and their vip genes were cloned and sequenced. The analysis revealed two polymorphic Vip protein forms, which were classified as Vip3Aa58 and Vip3Aa59. After expression of the vip genes, the proteins were isolated and characterized. The activity of both toxins was estimated against economically important lepidopteran pests of woodlands (Dendrolimus pini), orchards (Cydia pomonella) and field crops (Spodoptera exigua). Vip3Aa58 and Vip3Aa59 were highly toxic and their potency surpassed those of many Cry proteins used in commercial bioinsecticides. Vip3Aa59 revealed similar larvicidal activity as Vip3Aa58 against S. exigua and C. pomonella. Despite 98% similarity of amino acid sequences of both proteins, Vip3Aa59 was significantly more active against D. pini. Additionally the effect of proteolytic activation of Vip58Aa and Vip3Aa59 on toxicity of D. pini and S. exigua was studied. Both Vip3Aa proteins did not show any activity against Tenebrio molitor (Coleoptera) larvae. The results suggest that the Vip3Aa58 and Vip3Aa59 toxins might be useful for controlling populations of insect pests of crops and forests. Copyright © 2015 Elsevier Inc. All rights reserved.
Household pesticide usage in the United States.
Savage, E P; Keefe, T J; Wheeler, H W; Mounce, L; Helwic, L; Applehans, F; Goes, E; Goes, T; Mihlan, G; Rench, J; Taylor, D K
1981-01-01
A total of 10,000 U.S. households in 25 standard metropolitan statistical areas and 25 counties were included in the United States. More than 8,200 households granted an interview. Nine of every ten households in the United States used some types of pesticide in their house, garden, or yard. Households in the southeastern United States used the most pesticides. Although more than 500 different pesticide formulations were used by the sampled households, 15 pesticides accounted for 65.5% of all pesticides reported in this study. Thirteen of these 15 pesticides were insecticides, one was a herbicide, and one was a rodenticide.
Morbidelli, L.; Gomes, C. B.; Beccaluva, L.; Brotzu, P.; Conte, A. M.; Ruberti, E.; Traversa, G.
1995-12-01
A general description of Mesozoic and Tertiary (Fortaleza) Brazilian alkaline and alkaline-carbonatite districts is presented with reference to mineralogy, petrology, geochemistry and geochronology. It mainly refers to scientific results obtained during the last decade by an Italo-Brazilian research team. Alkaline occurrences are distributed across Brazilian territory from the southern (Piratini, Rio Grande do Sul State) to the northeastern (Fortaleza, Ceará State) regions and are mainly concentrated along the borders of the Paraná Basin generally coinciding with important tectonic lineaments. The most noteworthy characteristics of these alkaline and alkaline-carbonatite suites are: (i) prevalence of intrusive forms; (ii) abundance of cumulate assemblages (minor dunites, frequent clinopyroxenites and members of the ijolite series) and (iii) abundance of evolved rock-types. Many data demonstrate that crystal fractionation was the main process responsible for magma evolution of all Brazilian alkaline rocks. A hypothesis is proposed for the genesis of carbonatite liquids by immiscibility processes. The incidence of REE and trace elements for different major groups of lithotypes, belonging both to carbonatite-bearing and carbonatite-free districts, are documented. Sr and preliminary Nd isotopic data are indicative of a mantle origin for the least evolved magmas of all the studied occurrences. Mantle source material and melting models for the generation of the Brazilian alkaline magma types are also discussed.
Urban household energy consumption in Thailand
Energy Technology Data Exchange (ETDEWEB)
Pongsapich, Amara; Wongsekiarttirat, Wathana (Chulalongkorn Univ., Bangkok (Thailand). Social Research Inst.)
1994-05-01
This study was aimed at developing a better understanding of urban household energy consumption in Thailand through a series of in-depth household energy surveys. Households in urban areas used electricity, LPG, charcoal and fuelwood. Traditional biomass fuels such as husk and dung, as well as kerosene, were essentially not used in urban households. Nearly all households used electricity and most households used LPG. Some households used more than one fuel for cooking, particularly LPG and charcoal. There was a great difference in electricity used between the households in Bangkok and other urban areas. Most households in the study areas used LPG stove or burners for cooking. But charcoal stoves were also used by many households for specific culinary purposes. Electric rice-cookers are widely used for convenience. The study suggests that the number of households using charcoal stoves will decrease gradually and fuelwood use will disappear. Saturation rates for refrigerators and colour television sets were very high and air conditioners were common in Bangkok. Some users may be unaware of the benefits of LPG as a cooking fuel. To improve indoor air quality and cooking safety and reduce pressures on forests from commercial fuelwood use, measures to promote LPG should be undertaken. The government should also provide information about efficient appliances and electricity conservation. (Author)
Household demographic determinants of Ebola epidemic risk.
Adams, Ben
2016-03-07
A salient characteristic of Ebola, and some other infectious diseases such as Tuberculosis, is intense transmission among small groups of cohabitants and relatively limited indiscriminate transmission in the wider population. Here we consider a mathematical model for an Ebola epidemic in a population structured into households of equal size. We show that household size, a fundamental demographic unit, is a critical factor that determines the vulnerability of a community to epidemics, and the effort required to control them. Our analysis is based on the household reproduction number, but we also consider the basic reproduction number, intrinsic growth rate and final epidemic size. We show that, when other epidemiological parameters are kept the same, all of these quantifications of epidemic growth and size are increased by larger households and more intense within-household transmission. We go on to model epidemic control by case detection and isolation followed by household quarantine. We show that, if household quarantine is ineffective, the critical probability with which cases must be detected to halt an epidemic increases significantly with each increment in household size and may be a very challenging target for communities composed of large households. Effective quarantine may, however, mitigate the detrimental impact of large household sizes. We conclude that communities composed of large households are fundamentally more vulnerable to epidemics of infectious diseases primarily transmitted by close contact, and any assessment of control strategies for these epidemics should take into account the demographic structure of the population. Copyright © 2015 Elsevier Ltd. All rights reserved.
Determination of Acidity and Alkalinity of Food Materials
三浦,芳助; 福永,祐子; 瀧川,裕里子; 津田,真美; 渡辺,陽子; 瀨山,一正
2006-01-01
The acidity and alkalinity of food materials in various menus was determined to clarify the influence of food on physiological functions. Menus mainly containing alkaline food materials (alkaline menu) and acid ones (acid menu) were compared. Determination of acidity and alkalinity was performed for each food material in the alkaline menu and acid menu, and acidity and alkalinity of one meal and a day's one were estimated. 1. Most of food materials in acid menu were assessed to be...
The Determinants of Agricultural Productivity and Rural Household ...
African Journals Online (AJOL)
Rahel
Key Words: Labor productivity, Land productivity; Rural household income, Rural ... household labor ratio of rural household farmers, given fixed level of inputs ... because households are rarely practicing dominated by a subsistence.
Under-reported income of Russian households
Directory of Open Access Journals (Sweden)
Yaroslav Murashov
2016-03-01
Full Text Available In the proposed paper, an attempt is made to estimate the proportion of unstated income for Russian households based on micro data. An overview of microeconomic approaches to estimating the scale of under-reported income is provided. These approaches are weakly represented in the national literature, so their strengths and weaknesses are also analyzed. A theoretical model of household consumer behavior is described that allows the size of under-reported income to be estimated. The structure of household incomes and expenditures is studied based on an RLMS sample for 2012. The model is estimated using household subsamples based on the type of household and household income. The estimation technique utilizes regression variables and random effects. The resulting subsample estimates were applied to the general population and compared with those obtained by other researchers using alternative methods and other data. A comparison is made to estimates of under-reported income developed for British households.
The Alkaline Diet: Is There Evidence That an Alkaline pH Diet Benefits Health?
Directory of Open Access Journals (Sweden)
Gerry K. Schwalfenberg
2012-01-01
Full Text Available This review looks at the role of an alkaline diet in health. Pubmed was searched looking for articles on pH, potential renal acid loads, bone health, muscle, growth hormone, back pain, vitamin D and chemotherapy. Many books written in the lay literature on the alkaline diet were also reviewed and evaluated in light of the published medical literature. There may be some value in considering an alkaline diet in reducing morbidity and mortality from chronic diseases and further studies are warranted in this area of medicine.
The Alkaline Diet: Is There Evidence That an Alkaline ph Diet Benefits Health?
International Nuclear Information System (INIS)
Schwalfenberg, G.K.
2012-01-01
This review looks at the role of an alkaline diet in health. Pub med was searched looking for articles on ph, potential renal acid loads, bone health, muscle, growth hormone, back pain, vitamin D and chemotherapy. Many books written in the lay literature on the alkaline diet were also reviewed and evaluated in light of the published medical literature. There may be some value in considering an alkaline diet in reducing morbidity and mortality from chronic diseases and further studies are warranted in this area of medicine
Recent trend in family households in Beijing.
Guo, Z; Guo, L
1997-01-01
This study examined trends in household size and age structure in Beijing, China, in 1995. Data were reliably obtained from the 1% sample survey of China. Findings indicate that the average size of a family household was 3.15 persons, that is, 0.050 persons fewer than the 3.20 from the 1990 Census. Children aged 0-14 years in each household averaged 0.04 fewer children during 1990-95. 80% of the decline in household size was due to decreases in the number of children. The percentage of single-family and single-person households declined. Three-person households were the only size group that increased (23.2-40.7%). The household headship (HH) rate for males increased dramatically between the ages of 20 and 30 years and stabilized after 35 years. The HH rate for women grew slowly and continuously until age 50 years and then stabilized. The gender gap in HH appeared at an early age and remained thereafter. The HH rate declined at older ages. The HH rate in Beijing, compared to the national rate, suggests relative gender equity in Beijing. As a child ages, the percentage of three-generation households declines and the percentage of two-generation households rises. As a child becomes an adult, the percentages of single-person households and single-couple households increase. Single-couple households decreased among the middle-aged. 67.4% of the elderly lived in two- or three-generation households. 31.4% of elderly lived in single-person/couple households. The percentage of elderly living with their children declined by 2 points during 1990-95.
van Haaften, W. M.; Kool, W. H.; Katgerman, L.
2002-10-01
One of the major problems during direct chill (DC) casting is hot tearing. These tears initiate during solidification of the alloy and may run through the entire ingot. To study the hot tearing mechanism, tensile tests were carried out in semisolid state and at low strain rates, and crack propagation was studied in situ by scanning electron microscopy (SEM). These experimentally induced cracks were compared with hot tears developed in an AA5182 ingot during a casting trial in an industrial research facility. Similarities in the microstructure of the tensile test specimens and the hot tears indicate that hot tearing can be simulated by performing tensile tests at semisolid temperatures. The experimental data were compared with existing hot tearing models and it was concluded that the latter are restricted to relatively high liquid fractions because they do not take into account the existence of solid bridges in the crack.
Predicting Hot Deformation of AA5182 Sheet
Lee, John T.; Carpenter, Alexander J.; Jodlowski, Jakub P.; Taleff, Eric M.
Aluminum 5000-series alloy sheet materials exhibit substantial ductilities at hot and warm temperatures, even when grain size is not particularly fine. The relatively high strain-rate sensitivity exhibited by these non-superplastic materials, when deforming under solute-drag creep, is a primary contributor to large tensile ductilities. This active deformation mechanism influences both plastic flow and microstructure evolution across conditions of interest for hot- and warm-forming. Data are presented from uniaxial tensile and biaxial bulge tests of AA5182 sheet material at elevated temperatures. These data are used to construct a material constitutive model for plastic flow, which is applied in finite-element-method (FEM) simulations of plastic deformation under multiaxial stress states. Simulation results are directly compared against experimental data to explore the usefulness of this constitutive model. The effects of temperature and stress state on plastic response and microstructure evolution are discussed.
AA, shims and washers on quadrupole ends
CERN PhotoLab
1981-01-01
Due to the fact that much of the field of the quadrupoles was outside the iron (in particular with the wide quadrupoles) and that thus the fields of quadrupoles and bending magnets interacted, the lattice properties of the AA could not be predicted with the required accuracy. After a first running period in 1980, during which detailed measurements were made with proton test beams, corrections to the quadrupoles were made in 1981, in the form of laminated shims at the ends of the poles, and with steel washers. With the latter ones, further refinements were made in an iterative procedure with measurements on the circulating beam. This eventually resulted, amongst other things, in a very low chromaticity, with the Q-values being constant to within +- 0.001 over the total momentum range of 6 %. Here we see the shims and washers on a narrow qudrupole (QFN, QDN). See also 8103203, 8103204, 8103205, 8103206.
Alkaline Activator Impact on the Geopolymer Binders
Błaszczyński, Tomasz Z.; Król, Maciej R.
2017-10-01
Concrete structures are constantly moving in the direction of improving the durability. Durability depends on many factors, which are the composition of concrete mix, the usage of additives and admixtures and the place, where material will work and carry the load. The introduction of new geopolymer binders for geopolymer structures adds a new aspect that is type of used activator. This substance with strongly alkaline reaction is divided because of the physical state, the alkaline degree and above all the chemical composition. Taking into account, that at present the geopolymer binders are made essentially from waste materials or by-products from the combustion of coal or iron ore smelting, unambiguous determination of the effect of the activator on the properties of the geopolymer material requires a number of trials, researches and observation. This paper shows the influence of the most alkaline activators on the basic parameters of the durability of geopolymer binders. In this study there were used highly alkaline hydroxides, water glasses and granules, which are waste materials in a variety of processes taking place in chemical plants. As the substrate of geopolymer binders there were used fly ash which came from coal and high calcareous ash from the burning of lignite.
ENHANCED OIL RECOVERY USING LOCAL ALKALINE
African Journals Online (AJOL)
user
the discovery of new oil producing fields and the ever increasing ... followed by water flooding is between 35 to 50% of the ... involved and lack of scale up and is considered among ... carbonate alkaline chemical reacts with certain types of ... reservoirs because of the profusion of calcium and the ... damage the formation.
Electrochemical behaviour of alkaline copper complexes
Indian Academy of Sciences (India)
Abstract. A search for non-cyanide plating baths for copper resulted in the development of alkaline copper complex baths containing trisodium citrate [TSC] and triethanolamine [TEA]. Voltammetric studies were carried out on platinum to understand the electrochemical behaviour of these complexes. In TSC solutions, the.
Alkaline fuel cell technology in the lead
International Nuclear Information System (INIS)
Nor, J.K.
2004-01-01
The Alkaline Fuel Cell (AFC) was the first fuel cell successfully put into practice, a century after William Grove patented his 'hydrogen battery' in 1839. The space program provided the necessary momentum, and alkaline fuel cells became the power source for both the U.S. and Russian manned space flight. Astris Energi's mission has been to bring this technology down to earth as inexpensive, rugged fuel cells for everyday applications. The early cells, LABCELL 50 and LABCELL 200 were aimed at deployment in research labs, colleges and universities. They served well in technology demonstration projects such as the 1998 Mini Jeep, 2001 Golf Car and a series of portable and stationary fuel cell generators. The present third generation POWERSTACK MC250 poised for commercialization is being offered to AFC system integrators as a building block of fuel cell systems in numerous portable, stationary and transportation applications. It is also used in Astris' own E7 and E8 alkaline fuel cell generators. Astris alkaline technology leads the way toward economical, plentiful fuel cells. The paper highlights the progress achieved at Astris, improvements of performance, durability and simplicity of use, as well as the current and future thrust in technology development and commercialization. (author)
Biomass production on saline-alkaline soils
Energy Technology Data Exchange (ETDEWEB)
Chaturvedi, A.N.
1985-01-01
In a trial of twelve tree species (both nitrogen fixing and non-fixing) for fuel plantations on saline-alkaline soil derived from Gangetic alluvium silty clay, Leucaena leucocephala failed completely after showing rapid growth for six months. Results for other species at age two showed that Prosopis juliflora had the best productivity.
Partially melted zone cracking in AA6061 welds
International Nuclear Information System (INIS)
Prasad Rao, K.; Ramanaiah, N.; Viswanathan, N.
2008-01-01
Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043
Partially melted zone cracking in AA6061 welds
Energy Technology Data Exchange (ETDEWEB)
Prasad Rao, K. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai (India)], E-mail: kpr@iitm.ac.in; Ramanaiah, N. [Sri Kalahasteeswara Institute of Technology, Srikalahasti (India); Viswanathan, N. [Defence Research and Development Laboratory, Hyderabad (India)
2008-07-01
Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043.
INAA and flame AAS of various vegetable reference materials
International Nuclear Information System (INIS)
Djingova, R.; Arpadjan, S.; Kuleff, I.
1991-01-01
INAA and flame AAS have been used for the analysis of a large number of vegetable reference materials. Out of all determined elements (28 by INAA and 11 by AAS) nine are common for both methods (Ca, Cd, Co, Cu, Fe, Mg, Mn, Na, Zn) and for these the possibilities of the two methods have been compared. (orig.)
Failure analysis of fusion clad alloy system AA3003/AA6xxx sheet under bending
Energy Technology Data Exchange (ETDEWEB)
Shi, Y., E-mail: shiyh@mcmaster.ca [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Jin, H. [Novelis Global Technology Center, P.O. Box 8400, Kingston, Ontario, Canada K7L 5L9 (Canada); Wu, P.D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Lloyd, D.J. [Aluminum Materials Consultants, 106 Nicholsons Point Road, Bath, Ontario, Canada K0H 1G0 (Canada); Embury, D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada)
2014-07-29
An ingot of AA6xxx Al–Si–Mg–Cu alloy clad with AA3003 Al–Mn alloy was co-cast by Fusion technology. Bending tests and numerical modeling were performed to investigate the potential for sub-surface cracking for this laminate system. To simulate particle-induced crack initiation and growth, both random and stringer particles have been selected to mimic the particle distribution in the tested samples. The morphology of cracking in the model was similar to that observed in clad sheet tested in the Cantilever bend test. The crack initiated in the core close to the clad-core interface where the strain in the core is highest, between particles or near particles and propagates along local shear bands in the core, while the clad layer experiences extreme thinning before failure.
The householders' guide to radon
International Nuclear Information System (INIS)
1988-06-01
This guide is a follow-up to the leaflet Radon in Houses which was issued previously by the Department of the Environment. It is intended for people who live in areas with high levels of radon. It is written particularly for householders whose homes have already been tested and found to have an appreciable level of radon. It explains what radon is, how it gets into houses and what the effects on health may be. It also outlines some of the ways of reducing the level of radon and gives guidance both on how to get the work done and likely costs. (author)
Inhibitory effect of propolis on the development of AA amyloidosis.
Harata, Daichi; Tsuchiya, Yuya; Miyoshi, Tomoyuki; Yanai, Tokuma; Suzuki, Kazuhiko; Murakami, Tomoaki
2018-04-01
In the several types of amyloidoses, participation of oxidative stresses in the pathogenesis and the effect of antioxidants on amyloidosis have been reported. Meanwhile, the relationship between oxidative stresses and pathogenesis of amyloid A (AA) amyloidosis is still unclear. In this study, we used an antioxidant, Brazilian propolis, to investigate the inhibitory effects on AA amyloidosis. The results showed that AA deposition was inhibited by administration of propolis. Increased expression of antioxidant markers was detected in molecular biological examinations of mice treated with propolis. Although serum amyloid A (SAA) levels were strongly correlated with the immunoreactive area of AA deposits in the control group, the correlation was weaker in the propolis-treated groups. In addition, there were no changes in SAA levels between the control group and the propolis-treated groups. The results indicate that propolis, an antioxidant, may induce inhibitory effects against AA amyloidosis.
Production of alkaline proteases by alkalophilic Bacillus subtilis ...
African Journals Online (AJOL)
Tuoyo Aghomotsegin
2016-11-23
Nov 23, 2016 ... Key words: Production, alkaline protease, Bacillus subtilis, animal wastes, enzyme activity. ... Generally, alkaline proteases are produced using submerged fermentation .... biopolymer concentrations were reported to have an influence ... adding nitrogenous compounds stimulate microorganism growth and ...
Osteocalcin and bone-specific alkaline phosphatase in Sickle cell ...
African Journals Online (AJOL)
specific alkaline phosphatase (b-AP) total protein levels were evaluated as indicators of bone turnover in twenty patients with sickle cell haemoglobinopathies and in twenty normal healthy individuals. The serum bonespecific alkaline phosphatase ...
Lazarus, Sheryl S.; Edwards, Lynn M.; Thurlow, Martha L.; Hodgson, Jennifer R.
2014-01-01
All states have alternate assessments based on alternate achievement standards (AA-AAS) for students with the most significant cognitive disabilities. For accountability purposes, the Elementary and Secondary Education Act (ESEA) allows up to 1% of students to be counted as proficient with this assessment option. In 2011 the U.S. Department of…
A Green Approach to SNF Reprocessing: Are Common Household Reagents the Answer?
International Nuclear Information System (INIS)
Peper, Shane M.; McNamara, Bruce K.; O'Hara, Matthew J.; Douglas, Matthew
2008-01-01
It has been discovered that UO2, the principal component of spent nuclear fuel (SNF), can efficiently be dissolved at room temperature using a combination of common household reagents, namely hydrogen peroxide, baking soda, and ammonia. This rather serendipitous discovery opens up the possibility, for the first time, of considering a non-acidic process for recycling U from SNF. Albeit at the early stages of development, our unconventional dissolution approach possesses many attractive features that could make it a reality in the future. With dissolution byproducts of water and oxygen, our approach poses a minimal threat to the environment. Moreover, the use of common household reagents to afford actinide oxide dissolution suggests a certain degree of economic favorability. With the use of a ''closed'' digestion vessel as a reaction chamber, our approach has substantial versatility with the option of using either aqueous or gaseous reactant feeds or a combination of both. Our approach distinguishes itself from all existing reprocessing technologies in two important ways. First and foremost, it is an alkaline rather than an acidic process, using mild non-corrosive chemicals under ambient conditions to effect actinide separations. Secondly, it does not dissolve the entire SNF matrix, but rather selectively solubilizes U and other light actinides for subsequent separation, resulting in potentially faster head-end dissolution and fewer downstream separation steps. From a safeguards perspective, the use of oxidizing alkaline solutions to effect actinide separations also potentially offers a degree of inherent proliferation resistance, by allowing the U to be selectively removed from the remaining dissolver solution while keeping Pu grouped with the other minor actinides and fission products. This paper will describe the design and general experimental setup of a 'closed' digestion vessel for performing uranium oxide dissolutions under alkaline conditions using gaseous
A Green Approach to SNF Reprocessing: Are Common Household Reagents the Answer?
Energy Technology Data Exchange (ETDEWEB)
Peper, Shane M.; McNamara, Bruce K.; O' Hara, Matthew J.; Douglas, Matthew
2008-04-03
It has been discovered that UO2, the principal component of spent nuclear fuel (SNF), can efficiently be dissolved at room temperature using a combination of common household reagents, namely hydrogen peroxide, baking soda, and ammonia. This rather serendipitous discovery opens up the possibility, for the first time, of considering a non-acidic process for recycling U from SNF. Albeit at the early stages of development, our unconventional dissolution approach possesses many attractive features that could make it a reality in the future. With dissolution byproducts of water and oxygen, our approach poses a minimal threat to the environment. Moreover, the use of common household reagents to afford actinide oxide dissolution suggests a certain degree of economic favorability. With the use of a “closed” digestion vessel as a reaction chamber, our approach has substantial versatility with the option of using either aqueous or gaseous reactant feeds or a combination of both. Our approach distinguishes itself from all existing reprocessing technologies in two important ways. First and foremost, it is an alkaline rather than an acidic process, using mild non-corrosive chemicals under ambient conditions to effect actinide separations. Secondly, it does not dissolve the entire SNF matrix, but rather selectively solubilizes U and other light actinides for subsequent separation, resulting in potentially faster head-end dissolution and fewer downstream separation steps. From a safeguards perspective, the use of oxidizing alkaline solutions to effect actinide separations also potentially offers a degree of inherent proliferation resistance, by allowing the U to be selectively removed from the remaining dissolver solution while keeping Pu grouped with the other minor actinides and fission products. This paper will describe the design and general experimental setup of a “closed” digestion vessel for performing uranium oxide dissolutions under alkaline conditions using
Directory of Open Access Journals (Sweden)
Chetan Patil
2016-07-01
Full Text Available This paper reports hardness testing conducted on welded butt joints by FSW and TIG welding process on similar and dissimilar aluminium alloys. FSW joints were produced for similar alloys of AA7075T651 and dissimilar alloys of AA7075T651- AA6061T6. The Friction stir welds of AA7075 & AA6061 aluminium alloy were produced at different tool rotational speeds of 650,700, 800, 900, 1000 and transverse speed of 30, 35, 40 mm/min. TIG welding was conducted along the rolling direction of similar and dissimilar aluminium plates. The Brinell hardness testing techniques were employed to conduct the tests; these tests were conducted on the welds to ascertain the joint integrity before characterization to have an idea of the quality of the welds
Household energy transition in Hong Kong
Energy Technology Data Exchange (ETDEWEB)
Hills, Peter (Hong Kong Univ. (Hong Kong). Centre of Urban Planning and Environmental Management)
1994-05-01
A household energy survey in Hong Kong confirmed that domestic energy consumption is dominated by modern fuels. Household spending on fuels typically amounts to less than 3% of monthly income. Delivered energy use per household per month averages 1.77 GJ and per capita use 0.37 GJ. Electricity accounts for more than half of fuel expenditure and energy use. Patterns of fuel choice and use are quite consistent across income levels, although electricity use rises with higher household incomes. Many households use a combination of kerosene, gas and electricity (rice cookers) for cooking, which appears to reflect culinary practices more than fuel prices, perceived safety or availability. Electrical appliance saturation is high already, and air conditioning use is growing rapidly. Household electricity consumption may increase substantially during the 1990s as higher comfort levels lead to increased heating and cooling demand and space standards in public housing units improve. (Author)
Incomes and expenses of the households
Mirosław Gorczyca
2007-01-01
An analysis of the statistical spectrum of the incomes and expenses of the Polish households leads to the conclusion that the disposable incomes only slightly surpass the expenses of the households and, for a significant part of the households, are lower. There is a growing economic polarization of the society whose considerable part lives on incomes below the social minimum and even below the minimum of existence. The society, as a whole, only to a small extent enjoys the fruits of the econo...
NCBI nr-aa BLAST: CBRC-DMEL-02-0054 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0054 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-02-0048 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 1e-163 91% ...
NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0057 gb|AAS74196.1| 5-HT1A [Drosophila melanogaster] gb|AAS74220.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74309.1| 5-HT1A [Drosophila melanogaster] gb|AAS74310.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74335.1| 5-HT1A [Drosophila melanogaster] AAS74196.1 1e-176 97% ...
NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0057 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-177 97% ...
Energy Technology Data Exchange (ETDEWEB)
Kubota, Akira [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Bainy, Afonso C.D. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Departamento de Bioquímica, CCB, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Woodin, Bruce R.; Goldstone, Jared V. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States)
2013-10-01
The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with
International Nuclear Information System (INIS)
Kubota, Akira; Bainy, Afonso C.D.; Woodin, Bruce R.; Goldstone, Jared V.; Stegeman, John J.
2013-01-01
The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with
Smart Energy Management for Households
Directory of Open Access Journals (Sweden)
Sonja van Dam
2013-06-01
Full Text Available The aim of the research presented in this thesis was to infer design-related insights and guidelines to improve the use and effectiveness of home energy management systems (HEMS. This was done through an empirical evaluation of the longitudinal effectiveness of these devices and an exploration of factors that influence their use and effectiveness. Three case studies executed with three different HEMS in households, a life cycle assessment (LCA on those three HEMS, as well as a reflection on the challenges of both researching and implementing HEMS in existing housing gave a comprehensive picture of the opportunities and barriers for HEMS. The research revealed five typical use patterns that emerged amongst households. It also revealed average energy savings of 7.8%, which however decreased in the follow-up that was conducted, and factors that may influence the use and effectiveness of HEMS. Nonetheless, the LCA calculations divulged that the HEMS can achieve net energy savings when taking their embedded energy into account. Problem statement The goal of reducing the energy consumption of existing housing formed the basis for this research. There are many facets to this energy consumption, including the characteristics of the house, its appliances, and the behaviours of its inhabitants. Because of this complexity, addressing only one of these facets is not effective in substantially reducing the overall energy consumption of households. This called for an interdisciplinary approach, merging the domains of design for sustainability, sustainable housing transformation and environmental psychology. In this thesis, HEMS were chosen as the intervention to address the various elements that contribute to household energy consumption, thereby functioning as a pivot. By giving feedback and/or helping manage consumption they can assist households in changing their behaviour and help save energy. However, in analysing literature on HEMS, four critique points
Household energy consumption and expenditures, 1990
International Nuclear Information System (INIS)
1993-01-01
This report, Household Energy Consumption and Expenditures 1990, is based upon data from the 1990 Residential Energy Consumption Survey (RECS). Focusing on energy end-use consumption and expenditures of households, the 1990 RECS is the eighth in a series conducted since 1978 by the Energy Information Administration (EIA). Over 5,000 households were surveyed, providing information on their housing units, housing characteristics, energy consumption and expenditures, stock of energy-consuming appliances, and energy-related behavior. The information provided represents the characteristics and energy consumption of 94 million households nationwide
Householder transformations and optimal linear combinations
Decell, H. P., Jr.; Smiley, W., III
1974-01-01
Several theorems related to the Householder transformation and separability criteria are proven. Orthogonal transformations, topology, divergence, mathematical matrices, and group theory are discussed.
Study of niobium corrosion in alkaline medium
International Nuclear Information System (INIS)
Almeida, S.H. de.
1987-01-01
A comparative study of niobium electrochemical behaviour in NaOH and KOH solution, with concentrations between 0,5 and 6,1M is presented. The studies were done through electrochemicals assays, consisting in the corrosion potential and anodic and cathodic polarization curves, complemented by loss of mass experiments. The niobium anodic behaviour in alkaline medium is characterized by passivation occurrence, with a stable film formation. The Na oH solution in alkaline medium are more corrosible to niobium than the KOH solution. The loss of mass assays showed that the corrosion velocit is more dependente of hydroxide concentration in KOH medium than the NaOH medium. (C.G.C.) [pt
Hydrolysis of alkaline pretreated banana peel
Fatmawati, A.; Gunawan, K. Y.; Hadiwijaya, F. A.
2017-11-01
Banana peel is one of food wastes that are rich in carbohydrate. This shows its potential as fermentation substrate including bio-ethanol. This paper presented banana peel alkaline pretreatment and enzymatic hydrolysis. The pretreatment was intended to prepare banana peel in order to increase hydrolysis performance. The alkaline pretreatment used 10, 20, and 30% w/v NaOH solution and was done at 60, 70 and 80°C for 1 hour. The hydrolysis reaction was conducted using two commercial cellulose enzymes. The reaction time was varied for 3, 5, and 7 days. The best condition for pretreatment process was one conducted using 30% NaOH solution and at 80°C. This condition resulted in cellulose content of 90.27% and acid insoluble lignin content of 2.88%. Seven-day hydrolysis time had exhibited the highest reducing sugar concentration, which was7.2869 g/L.
Directory of Open Access Journals (Sweden)
Jaqueline Alves de Almeida Calábria
2017-11-01
Full Text Available Abstract The preferred option for disposal of short-lived low and intermediate level radioactive wastes is a near surface disposal facility in which soil is one of the barriers that avoid radionuclide migration outside the controlled area. For construction of that kind of facility, concrete is widely used, and its interaction with water induces its degradation, resulting in a high pH solution. The alkaline solution may affect the near-field environment of radioactive waste repositories, including the soil, promoting mineralogical alterations that result in significant changes in key properties of materials, compromising their performance as safety components. In this study, a sample of a Brazilian Typic Rhodudult soil, previously investigated concerning its performance for Cs sorption, was subjected to interaction with the alkaline solution for 24 h and for 7, 14, and 28 days in order to evaluate the impact on its chemical, mineralogical, and sorption properties. X-ray diffraction (XRD, energy dispersive X-ray spectroscopy (EDX, atomic absorption spectrometry (AAS, scanning electron microscopy (SEM, and electron microprobe analysis were performed before and after each alteration period. Results indicated dissolution of minerals, such as kaolinite and quartz, associated with incorporation of K and Ca from the alkaline solution, likely resulting in the formation of hydrated calcium silicate phases (CSH, which are expected to be worse sorbents for alkaline elements (e.g., Cs than the original minerals. The Kd values for Cs in the altered samples also decreased according to the alteration period, demonstrating that alkaline interaction effectively modifies the soil sorption properties for Cs.
Oxidation catalysts on alkaline earth supports
Mohajeri, Nahid
2017-03-21
An oxidation catalyst includes a support including particles of an alkaline earth salt, and first particles including a palladium compound on the support. The oxidation catalyst can also include precious metal group (PMG) metal particles in addition to the first particles intermixed together on the support. A gas permeable polymer that provides a continuous phase can completely encapsulate the particles and the support. The oxidation catalyst may be used as a gas sensor, where the first particles are chemochromic particles.
Steegmans, J.W.A.M.
2017-01-01
The dissertation studies the role of financial household characteristics in the determination of house prices and household mobility in the Dutch owner-occupied housing market. We investigate how various financial characteristics -- in particular income, wealth, housing equity, and prospective
Experimentale Study of Alkaline Precipitation on Thermal Process SeaWater Desalination Condition
International Nuclear Information System (INIS)
Sumijanto
2000-01-01
The experiment of alkaline precipitation by separated method has beencarry out. Experiment took please by heating sea water simulation with eachother consist of a).142 ppm bicarbonate and 400 ppm calcium ion b). 142 ppmbicarbonate and magnesium ion at temperature 40,50,60,70,80,90,100,110 and120 o C respectively by using autoclave. Sampling has been done periodicalfor 30 minute in interval 300 minute for each temperature. The calculation ofalkaline precipitation on each step calculated through the decreasing ofcalcium and magnesium concentration with analysis by AAS. From experimentdata have the information that alkaline precipitation have been formed since40 o C. From time variable have been the information that the precipitationformed at 30 th minute rapidly. Whether at further time the increasing ofprecipitation are not significant. This phenomena can explained that at eachheating step from 40 o C bicarbonate ion be come decomposition with theresult carbonate and hydroxide ion and react with calcium and magnesium formcalcium carbonate and magnesium hydroxide. From this information could beimplemented as base for avoiding using chemical material in desalinationthermal process. (author)
Heavy water production by alkaline water electrolysis
International Nuclear Information System (INIS)
Kamath, Sachin; Sandeep, K.C.; Bhanja, Kalyan; Mohan, Sadhana; Sugilal, G.
2014-01-01
Several heavy water isotope production processes are reported in literature. Water electrolysis in combination with catalytic exchange CECE process is considered as a futuristic process to increase the throughput and reduce the cryogenic distillation load but the application is limited due to the high cost of electricity. Any improvement in the efficiency of electrolyzers would make this process more attractive. The efficiency of alkaline water electrolysis is governed by various phenomena such as activation polarization, ohmic polarization and concentration polarization in the cell. A systematic study on the effect of these factors can lead to methods for improving the efficiency of the electrolyzer. A bipolar and compact type arrangement of the alkaline water electrolyzer leads to increased efficiency and reduced inventory in comparison to uni-polar tank type electrolyzers. The bipolar type arrangement is formed when a number of single cells are stacked together. Although a few experimental studies have been reported in the open literature, CFD simulation of a bipolar compact alkaline water electrolyzer with porous electrodes is not readily available.The principal aim of this study is to simulate the characteristics of a single cell compact electrolyzer unit. The simulation can be used to predict the Voltage-Current Density (V-I) characteristics, which is a measure of the efficiency of the process.The model equations were solved using COMSOL multi-physics software. The simulated V-I characteristic is compared with the experimental data
Effect of pressurized steam on AA1050 aluminium
DEFF Research Database (Denmark)
Jariyaboon, Manthana; Møller, Per; Ambat, Rajan
2012-01-01
Purpose - The purpose of this paper is to understand the effect of pressurized steam on surface changes, structures of intermetallic particles and corrosion behavior of AA1050 aluminium. Design/methodology/approach - Industrially pure aluminium (AA1050, 99.5 per cent) surfaces were exposed...... reactivities was observed due to the formation of the compact oxide layer. Originality/value - This paper reveals a detailed investigation of how pressurized steam can affect the corrosion behaviour of AA1050 aluminium and the structure of Fe-containing intermetallic particles....
Corrosion issues of powder coated AA6060 aluminium profiles
DEFF Research Database (Denmark)
Din, Rameez Ud; Valgarðsson, Smári; Jellesen, Morten Stendahl
2015-01-01
In this study detailed microstructural investigation of the reason for unexpected corrosion of powder coated aluminium alloy AA6060 windows profiles has been performed. The results from this study reveals that the failure of the window profiles was originated from the surface defects present...... on the extruded AA6060 aluminium profile after metallurgical process prior to powder coating. Surface defects are produced due to intermetallic particles in the alloy, which disturb the flow during the extrusion process. The corrosion mechanism leading to the failure of the powder coated AA6060 aluminium profiles...
National Alcohol Survey of households in Trinidad and Tobago (NASHTT: Alcohol use in households
Directory of Open Access Journals (Sweden)
R.G. Maharaj
2017-04-01
Full Text Available Abstract Background To determine the patterns of alcohol use among households in Trinidad and Tobago (T&T and to estimate the association between alcohol use and negative psychological, social, or physical events experienced by the household. Methods A convenience sample of 1837 households across T&T. We identified bivariate correlates of alcohol use, and heavy episodic drinking using chi-square and t-test analyses and used multivariable logistic regression to estimate adjusted associations between household alcohol use and experiences within the past 12 months adjusted for sociodemographic covariates. Results One thousand five hundred two households had complete data for all variables (82% response rate. Nearly two thirds (64% of households included alcohol users; 57% of household that consumed alcohol also reported heavy episodic drinking. Households that reported alcohol consumption were significantly more likely to report illnesses within the households, relationship problems, and behavioral and antisocial problems with children. Among households where a member was employed, those who consumed alcohol were nearly twice as likely (OR = 1.98; 95% confidence interval (CI 1.03, 3.82 to have a household member call in sick to work and 2.9 times as likely (OR = 2.9; CI 1.19, 7.04 to have a household member suffer work related problems compared with households who reported not consuming alcohol. Conclusions Approximately two thirds of households in T&T reported using alcohol. These households were more likely to report psychological, physical, and social problems. These findings would support efforts to enforce current policies, laws, and regulations as well as new strategies to reduce the impact of harmful alcohol consumption on households in T&T.
Essays on household time allocation decisions in a collective household model
Silvennoinen, Heidi
2008-01-01
This thesis considers the consequences of traditional division of labour in households in a setting where spouses are allowed to have distinct preferences. This approach leads to different results compared to the traditional unitary approach and is better equipped to take into consideration gender related issues of household decision making. The thesis consists of three theoretical essays where the household production theory is applied in the collective household model. The first essay ...
Processing Methods of Alkaline Hydrolysate from Rice Husk
Directory of Open Access Journals (Sweden)
Olga D. Arefieva
2017-07-01
Full Text Available This paper devoted to finding processing methods of alkaline hydrolysate produced from rice husk pre-extraction, and discusses alkaline hydrolysate processing schemed and disengagement of some products: amorphous silica of various quality, alkaline lignin, and water and alkaline extraction polysaccharides. Silica samples were characterized: crude (air-dried, burnt (no preliminary water treatment, washed in distilled water, and washed in distilled water and burnt. Waste water parameters upon the extraction of solids from alkaline hydrolysate dropped a few dozens or thousand times depending on the applied processing method. Color decreased a few thousand times, turbidity was virtually eliminated, chemical oxygen demanded about 20–136 times; polyphenols content might decrease 50% or be virtually eliminated. The most prospective scheme obtained the two following solid products from rice husk alkaline hydrolysate: amorphous silica and alkaline extraction polysaccharide. Chemical oxygen demand of the remaining waste water decreased about 140 times compared to the silica-free solution.
Households and food security: lessons from food secure households in East Africa.
Silvestri, Silvia; Douxchamps, Sabine; Kristjanson, Patti; Förch, Wiebke; Radeny, Maren; Mutie, Lanetta; Quiros, F.C.; Herrero, M.; Ndungu, Anthony; Claessens, L.F.G.
2015-01-01
Background
What are the key factors that contribute to household-level food security? What lessons can we learn from food secure households? What agricultural options and management strategies are likely to benefit female-headed households in particular? This paper addresses these questions
Energy Technology Data Exchange (ETDEWEB)
Ruiz-Santaquiteria, C., E-mail: ruiz.cs@ietcc.csic.es [Eduardo Torroja Institute (CSIC), c/Serrano Galvache, n Degree-Sign 4, 28033 Madrid (Spain); Skibsted, J. [Instrument Centre for Solid-State NMR Spectroscopy, Interdisciplinary Nanoscience Center (iNANO), Department of Chemistry, Aarhus University, DK-8000 Aarhus C (Denmark); Fernandez-Jimenez, A.; Palomo, A. [Eduardo Torroja Institute (CSIC), c/Serrano Galvache, n Degree-Sign 4, 28033 Madrid (Spain)
2012-09-15
This study investigates the effect of the alkaline solution/binder (S/B) ratio on the composition and nanostructure of the reaction products generated in the alkaline activation of aluminosilicates. The experiments used two mixtures of fly ash and dehydroxylated white clay and for each of these, varying proportions of the solution components. The alkali activator was an 8 M NaOH solution (with and without sodium silicate) used at three S/B ratios: 0.50, 0.75 and 1.25. The {sup 29}Si, {sup 27}Al MAS NMR and XRD characterisation of the reaction products reveal that for ratios nearest the value delivering suitable paste workability, the reaction-product composition and structure depend primarily on the nature and composition of the starting materials and the alkaline activator used. However, when an excess alkaline activator is present in the system, the reaction products tend to exhibit SiO{sub 2}/Al{sub 2}O{sub 3} ratios of approximately 1, irrespective of the composition of the starting binder or the alkaline activator.
Micro Econometric Modelling of Household Energy Use
DEFF Research Database (Denmark)
Leth-Petersen, Søren
2002-01-01
Presents a micro econometric analysis of household electricity and natural gas demand for Danish households observed in 1996. Dependence between demand for gas and demand for electricity; Separability of demand for gas from demand for electricity; Relation between energy consumption and the age...
Characterization of household waste in Greenland
International Nuclear Information System (INIS)
Eisted, Rasmus; Christensen, Thomas H.
2011-01-01
The composition of household waste in Greenland was investigated for the first time. About 2 tonnes of household waste was sampled as every 7th bag collected during 1 week along the scheduled collection routes in Sisimiut, the second largest town in Greenland with about 5400 inhabitants. The collection bags were sorted manually into 10 material fractions. The household waste composition consisted primarily of biowaste (43%) and the combustible fraction (30%), including anything combustible that did not belong to other clean fractions as paper, cardboard and plastic. Paper (8%) (dominated by magazine type paper) and glass (7%) were other important material fractions of the household waste. The remaining approximately 10% constituted of steel (1.5%), aluminum (0.5%), plastic (2.4%), wood (1.0%), non-combustible waste (1.8%) and household hazardous waste (1.2%). The high content of biowaste and the low content of paper make Greenlandic waste much different from Danish household waste. The moisture content, calorific value and chemical composition (55 elements, of which 22 were below detection limits) were determined for each material fraction. These characteristics were similar to what has been found for material fractions in Danish household waste. The chemical composition and the calorific value of the plastic fraction revealed that this fraction was not clean but contained a lot of biowaste. The established waste composition is useful in assessing alternative waste management schemes for household waste in Greenland.
Household fuels, direct combustion, public perception, fuel ...
African Journals Online (AJOL)
2005-07-10
Jul 10, 2005 ... household energy needs and should b e c onsidered as a v ia b le alternativ e sour c e o f energy w hen energy p olic ... consumption is dominated by industries and house- ..... support the predictions of household economics,.
Steps to design a household energy game
Fijnheer, J.D.L.; van Oostendorp, H.
2016-01-01
Research where gamification is used to influence household energy consumption is an emerging field. This paper reviews the design and effectiveness of ten games that aim to influence household energy consumption and presents a novel gamification approach in which real world activities are
Gamification in a Prototype Household Energy Game
Fijnheer, J.D.L.; van Oostendorp, H.; Veltkamp, R.C.
2016-01-01
Research where gamification is used to influence household energy consumption is an emerging field. This paper reviews design features of the prototype Powersaver Game. The aim of this game is to influence household energy consumption in the long-term. The evaluation of the design of the prototype,
Households' willingness to pay for public housing
van Ommeren, J.; van der Vlist, A.J.
2016-01-01
In the presence of price controls, nonmarket housing allocation mechanisms such as queueing prevent households from revealing their marginal willingness to pay for housing through market prices. We derive the households' marginal willingness to pay using the intuitive idea that the length of the
Supplementary household water sources to augment potable ...
African Journals Online (AJOL)
This paper addresses on-site supplementary household water sources with a focus on groundwater abstraction, rainwater harvesting and greywater reuse as available non-potable water sources to residential consumers. An end-use model is presented and used to assess the theoretical impact of household water sources ...
Religion, economic attitudes, and household finance
Renneboog, L.D.R.; Spaenjers, C.
2012-01-01
We investigate the differences in economic attitudes and financial decisions between religious and non-religious households. Using Dutch survey data, we find that religious households consider themselves more trusting, and have a stronger bequest motive and a longer planning horizon. Furthermore,
Spending Time and Money within the Household
DEFF Research Database (Denmark)
Browning, Martin; Gørtz, Mette
2012-01-01
We consider, both theoretically and empirically, the allocation of time and money within the household. The research question is whether a married person who enjoys more leisure than their partner also receives more consumption (which seems to indicate the outcome of power within the household...
Passenger transport and household activity patterns
DEFF Research Database (Denmark)
Jørgensen, Kaj
1997-01-01
Review of Danish passenger transport patterns and analysis of energy consumption, emissions and safety impacts for selected typical households' travelling......Review of Danish passenger transport patterns and analysis of energy consumption, emissions and safety impacts for selected typical households' travelling...
Power in Households: Disentangling Bargaining Power
R. Mabsout (Ramzi); I.P. van Staveren (Irene)
2009-01-01
textabstractIntroduction Within the household bargaining literature, bargaining power is generally understood in terms of economic resources, such as income or assets. Empirical analyses of women’s bargaining power in households in developed and developing countries find that, in general, higher
Formal demography of families and households
Willekens, F.J.; van Imhoff, E.; Wright, James D.
2015-01-01
‘Family and household demography’ differs from traditional demography in that it explicitly recognizes and studies relationships between individuals. Formal demography focuses on the definition and measurement of families and households, and modeling of types, number, and composition of families and
Inclusive cross sections in AA collisions at high energies
International Nuclear Information System (INIS)
Braun, M.A.
1988-01-01
Inclusive cross sections in AA collisions at high energies are considered in the Glauber multiple scattering theory taking into account many-nucleon collisions. Correspondence is found between the AA amplitude and the effective action of the two-dimensional quantum field theory with exponential interaction. The tree and one-loop contributions are calculated in this formalism. The rules are derived, which relate the absorption part of the AA-collision amplitudes associated with various inclusive cross sections to the absorption parts of NN amplitudes. These rules generalize the well-known Agranowsky-Gribov-Kanchelli rules for hh and hA collisions. Formulas are written for single and double inclusive cross sections in AA collisions
Characterization of household waste in Greenland
DEFF Research Database (Denmark)
Eisted, Rasmus; Christensen, Thomas Højlund
2011-01-01
The composition of household waste in Greenland was investigated for the first time. About 2tonnes of household waste was sampled as every 7th bag collected during 1week along the scheduled collection routes in Sisimiut, the second largest town in Greenland with about 5400 inhabitants....... The collection bags were sorted manually into 10 material fractions. The household waste composition consisted primarily of biowaste (43%) and the combustible fraction (30%), including anything combustible that did not belong to other clean fractions as paper, cardboard and plastic. Paper (8%) (dominated...... by magazine type paper) and glass (7%) were other important material fractions of the household waste. The remaining approximately 10% constituted of steel (1.5%), aluminum (0.5%), plastic (2.4%), wood (1.0%), non-combustible waste (1.8%) and household hazardous waste (1.2%). The high content of biowaste...
Capitalization of Local Products through Agro- Household
Directory of Open Access Journals (Sweden)
Ramona Ciolac
2010-10-01
Full Text Available In every household there are many family activities that provide the necessary income or living foods. Some activities are related to cultivation of land, others for breeding other means services provided by the vilagers. The products of the own household must cover 40% of meals offered to tourists. These products are produced by the householder work in their household, the tourist having the opportunity to observe how the products are produced and participate effectively in this production. Specific rural household products can be recovered through tourism by both indirect and direct ways. Both variants can generate increased profitability and interest of the tourist business activity and impose a sense of satisfaction for quality benefit, issues that may be, in turn, assumptions favorable to the extension of this work.
Household consumption and environment. 2011 edition
International Nuclear Information System (INIS)
2011-01-01
This report presents and comments numerous data and indicators concerning the constraints and impacts on the environment related to household consumption and behaviour. After a presentation of context indicators (household number and size, household consumption expenses) and of some global indicators (water and carbon footprint of household consumption), several specific aspects are addressed: housing (electric and electronic equipment, water, space and energy consumption, renewable energies, CO 2 emissions), transport (general statistics on travels, CO 2 and pollutant emissions related to motor cars), food (water print and carbon print related to household food, consumption of bio-agriculture products and of conditioned beverages), and wastes (production and composition, electronic and electric equipment wastes, waste treatment)
[Characterization of Mexican households with food insecurity].
Mundo-Rosas, Verónica; Méndez-Gómez Humarán, Ignacio; Shamah-Levy, Teresa
2014-01-01
To describe the sociodemographic and health characteristics associated with food insecurity (FI) in Mexican households. The study included information about 40 809 households from the National Health and Nutrition Survey 2012. The Latin American and Caribbean Scale Food Safety (ELCSA) was used to categorize households in terms of food insecurity. Classification and regression trees were used to identify the most significant characteristics in households with high prevalence of FI. The characteristics associated with higher prevalence of FI in homes were: lowest quintiles of welfare status, lack of education or walking or moving disability of household head, and not receiving money from social programmes, pension or remittances. Monitoring of the factors that favor the presence of FI is required to detect social groups being excluded from the right to food.
Household medical waste disposal policy in Israel.
Barnett-Itzhaki, Zohar; Berman, Tamar; Grotto, Itamar; Schwartzberg, Eyal
2016-01-01
Large amounts of expired and unused medications accumulate in households. This potentially exposes the public to hazards due to uncontrolled use of medications. Most of the expired or unused medications that accumulate in households (household medical waste) is thrown to the garbage or flushed down to the sewage, potentially contaminating waste-water, water resources and even drinking water. There is evidence that pharmaceutical active ingredients reach the environment, including food, however the risk to public health from low level exposure to pharmaceuticals in the environment is currently unknown. In Israel, there is no legislation regarding household medical waste collection and disposal. Furthermore, only less than 14 % of Israelis return unused medications to Health Maintenance Organization (HMO) pharmacies. In this study, we investigated world-wide approaches and programs for household medical waste collection and disposal. In many countries around the world there are programs for household medical waste collection. In many countries there is legislation to address the issue of household medical waste, and this waste is collected in hospitals, clinics, law enforcement agencies and pharmacies. Furthermore, in many countries, medication producers and pharmacies pay for the collection and destruction of household medical waste, following the "polluter pays" principle. Several approaches and methods should be considered in Israel: (a) legislation and regulation to enable a variety of institutes to collect household medical waste (b) implementing the "polluter pays" principle and enforcing medical products manufactures to pay for the collection and destruction of household medical waste. (c) Raising awareness of patients, pharmacists, and other medical health providers regarding the health and environmental risks in accumulation of drugs and throwing them to the garbage, sink or toilet. (d) Adding specific instructions regarding disposal of the drug, in the
Wood fuels consumption in households in Montenegro
Directory of Open Access Journals (Sweden)
Glavonjić Branko D.
2013-01-01
Full Text Available The paper presents the results of researching wood fuels consumption in households in Montenegro in the heating season 2011/2012. The research was conducted in the period October-November 2012 on the sample of 5% of the total number of households which stated to use solid fuels for heating purposes in the 2011 census. Results of the conducted researches on the presence and amounts of fuels consumed in households in Montenegro showed that total firewood consumption in the heating season 2011/2012 (both urban and rural households was 703,571 m3. Wood consumption is the lowest in the households in the municipalities in the coastal zone, it is somewhat higher in central zone and the highest in the zone on the north of Montenegro. Average wood consumption in households in the coastal zone municipalities is 3.79 m3, in the central zone it is 5.02 m3 and on the north of Montenegro it is 6.74 m3/household. Observed on the level of Montenegro, average firewood consumption per household was 5.49 m3 and as such it best represents relatively low consumption level in the coastal zone and high consumption level on the north of Montenegro. Compared to the neighboring countries, average firewood consumption per household in Montenegro in the amount of 5.49 m3 is significantly lower than the average consumption in Serbia which is 7.3 m3/household as well as in Slovenia in the amount of 6.5 m3.
Energy Technology Data Exchange (ETDEWEB)
Churchill, M.E.; Peak, J.G.; Peak, M.J. (Argonne National Lab., IL (USA))
1991-02-01
Cell survival parameters and the induction and repair of DNA single-strand breaks were measured in two Chinese hamster ovary cell lines after irradiation with monochromatic UVA radiation of wavelength 365 nm. The radiosensitive mutant cell line EM9 is known to repair ionizing-radiation-induced single-strand breaks (SSB) more slowly than the parent line AA8. EM9 was determined to be 1.7-fold more sensitive to killing by 365-nm radiation than AA8 at the 10% survival level, and EM9 had a smaller shoulder region on the survival curve ({alpha} = 1.76) than AA8 ({alpha} = 0.62). No significant differences were found between the cell lines in the initial yields of SSB induced either by {gamma}-radiation (as determined by alkaline sucrose gradient sedimentation) or by 365-nm UVA (as determined by alkaline elution). For measurement of initial SSB, cells were irradiated at 0.5{sup o}C to minimize DNA repair processes. Rejoining of 365-nm induced SSB was measured by irradiating cells at 0.5{sup o}C, allowing them to repair at 37{sup o}C in full culture medium, and then quantitating the remaining SSB by alkaline elution. The repair of these breaks followed biphasic kinetics in both cell lines. EM9 repaired the breaks more slowly (T{sub 1/2} values of 1.3 and 61.3 min) than did AA8 (T{sub 1/2} values of 0.9 and 53.3 min), and EM9 also left more breaks unrepaired 90 min after irradiation (24% vs 8% for AA8). Thus, the sensitivity of EM9 to 365-nm radiation correlated with its deficiency in repairing DNA lesions revealed as SSB in alkaline elution. These results suggest that DNA may be a critical target in 365-nm induced cellular lethality and that the ability of AA8 and EM9 cells to repair DNA strand breaks may be related to their ability to survive 365-nm radiation. (author).
Temperature Dependence of Mineral Solubility in Water. Part 2. Alkaline and Alkaline Earth Bromides
Krumgalz, B. S.
2018-03-01
Databases of alkaline and alkaline earth bromide solubilities in water at various temperatures were created using experimental data from publications over about the last two centuries. Statistical critical evaluation of the created databases was produced since there were enough independent data sources to justify such evaluation. The reliable experimental data were adequately described by polynomial expressions over various temperature ranges. Using the Pitzer approach for ionic activity and osmotic coefficients, the thermodynamic solubility products for the discussed bromide minerals have been calculated at various temperature intervals and also represented by polynomial expressions.
Bake hardening of nanograin AA7075 aluminum alloy
International Nuclear Information System (INIS)
Dehghani, Kamran
2011-01-01
Highlights: ► The bake hardening behavior of AA7075 was studied and compared with its coarse-grain counterpart. ► Nanograin AA7075 exhibited 88–100% increase in bake hardenability. ► Nanograin AA7075 exhibited 36–38% increase in final yield strength after baking. ► Maximum bake hardenability and final yield stress were about 185 MPa and 719 MPa. - Abstract: In the present work, the bake hardening of nanostructured AA7075 aluminum alloy was compared with that of its coarse-grain counterpart. Surface severe plastic deformation (SSPD) was used to produce nanograin layers on both surfaces of workpieces. The nanostructured layers were characterized using scanning electron microscopy (SEM) and atomic force microscopy (AFM) techniques. The thickness of nanostructured layer, having the grains of 50–110 nm, was about 75 μm on each side of workpiece. The bake hardenability of nanograin and coarse-grain AA7075 was then compared by pre-straining to 2, 4 and 6% followed by baking at 100 °C and 200 °C for 20 min. Comparing to coarse-grain case, there was about 88–100% increase in bake hardenability and about 36–38% increase in yield strength after the bake hardening of present nanograin AA7075. Such an increase in bake hardenability and strength was achieved when the thickness of two nanograin layers was about only one-tenth of the whole thickness.
Characteristics of AA amyloidosis patients in San Francisco.
Lejmi, Hiba; Jen, Kuang-Yu; Olson, Jean L; James, Sam H; Sam, Ramin
2016-04-01
AA amyloidosis due to subcutaneous injection of drugs of abuse has been described in the USA, but all the existing literature is from more than 20 years ago. There is more recent literature from Europe. We have observed a high incidence of AA amyloidosis in the county hospital in San Francisco. Here, we describe 24 patients who had kidney biopsy-proven AA amyloidosis from our hospital from 1998 to 2013. All the patients were thought to have AA amyloidosis from skin popping of illicit drugs after having exhausted the intravenous route. These patients with biopsy-proven AA amyloidosis were analysed further. All patients were found to have hepatitis C infection, hypertension was not common, most had advanced kidney failure, and acidosis was common as was tubulointerstitial involvement on the kidney biopsy. Other organ involvement included hepatomegaly and splenomegaly in a number of patients; direct myocardial involvement was not seen, but pulmonary hypertension, history of deep vein thrombosis and pulmonary embolism were common. The prognosis of these patients was poor. The mortality rate approached 50% 1 year after biopsy, and most of the patient needed dialysis shortly after diagnosis. Cessation of drug use seemed beneficial but rarely achievable. AA amyloidosis from skin popping is common in San Francisco. Most patients with renal involvement end up on dialysis, and mortality rates are exceedingly high. © 2015 Asian Pacific Society of Nephrology.
Net alkalinity and net acidity 2: Practical considerations
Kirby, C.S.; Cravotta, C.A.
2005-01-01
The pH, alkalinity, and acidity of mine drainage and associated waters can be misinterpreted because of the chemical instability of samples and possible misunderstandings of standard analytical method results. Synthetic and field samples of mine drainage having various initial pH values and concentrations of dissolved metals and alkalinity were titrated by several methods, and the results were compared to alkalinity and acidity calculated based on dissolved solutes. The pH, alkalinity, and acidity were compared between fresh, unoxidized and aged, oxidized samples. Data for Pennsylvania coal mine drainage indicates that the pH of fresh samples was predominantly acidic (pH 2.5-4) or near neutral (pH 6-7); ??? 25% of the samples had pH values between 5 and 6. Following oxidation, no samples had pH values between 5 and 6. The Standard Method Alkalinity titration is constrained to yield values >0. Most calculated and measured alkalinities for samples with positive alkalinities were in close agreement. However, for low-pH samples, the calculated alkalinity can be negative due to negative contributions by dissolved metals that may oxidize and hydrolyze. The Standard Method hot peroxide treatment titration for acidity determination (Hot Acidity) accurately indicates the potential for pH to decrease to acidic values after complete degassing of CO2 and oxidation of Fe and Mn, and it indicates either the excess alkalinity or that required for neutralization of the sample. The Hot Acidity directly measures net acidity (= -net alkalinity). Samples that had near-neutral pH after oxidation had negative Hot Acidity; samples that had pH mine drainage treatment can lead to systems with insufficient Alkalinity to neutralize metal and H+ acidity and is not recommended. The use of net alkalinity = -Hot Acidity titration is recommended for the planning of mine drainage treatment. The use of net alkalinity = (Alkalinitymeasured - Aciditycalculated) is recommended with some cautions
Incarceration and Household Asset Ownership.
Turney, Kristin; Schneider, Daniel
2016-12-01
A considerable literature documents the deleterious economic consequences of incarceration. However, little is known about the consequences of incarceration for household assets-a distinct indicator of economic well-being that may be especially valuable to the survival of low-income families-or about the spillover economic consequences of incarceration for families. In this article, we use longitudinal data from the Fragile Families and Child Wellbeing Study to examine how incarceration is associated with asset ownership among formerly incarcerated men and their romantic partners. Results, which pay careful attention to the social forces that select individuals into incarceration, show that incarceration is negatively associated with ownership of a bank account, vehicle, and home among men and that these consequences for asset ownership extend to the romantic partners of these men. These associations are concentrated among men who previously held assets. Results also show that post-incarceration changes in romantic relationships are an important pathway by which even short-term incarceration depletes assets.
RES Hydrogen: efficient pressurised alkaline electrolysers
DEFF Research Database (Denmark)
Bowen, Jacob R.; Bentzen, Janet Jonna; Jørgensen, Peter Stanley
The RESelyser project addresses issues associated with coupling alkaline electrolysis to renewable energy sources such as electrode stability and gas purity by implementing improved electrodes and a new separator membrane concept. The project aims to improve performance, operation pressure...... and reduce system cost. The project supports DTU Energy's activities on electrodes within the larger FCH-JU project. The overall project demonstrated: improved electrode efficiency also during cyclic operation, safe gas purity at a system pressure of 30 bar, 10 kW stack operation and estimated system costs...
Alkaline carbonates in blast furnace process
Directory of Open Access Journals (Sweden)
P. Besta
2014-10-01
Full Text Available The production of iron in blast furnaces is a complex of physical, chemical and mechanical processes. The input raw materials contain not only metallic components, but also a number of negative elements. The most important negative elements include alkaline carbonates. They can significantly affect the course of the blast furnace process and thus the overall performance of the furnace. As a result of that, it is essential to accurately monitor the alkali content in the blast furnace raw materials. The article analyzes the alkali content in input and output raw materials and their impact on the blast furnace process.
Persistently increased intestinal fraction of alkaline phosphatase
DEFF Research Database (Denmark)
Nathan, E; Baatrup, G; Berg, H
1984-01-01
Persistent elevation of the intestinal fraction of the alkaline phosphatase (API) as an isolated finding has to our knowledge not been reported previously. It was found in a boy followed during a period of 5.5 years. The only symptom was transient periodic fatigue observed at home, but not apparent...... during hospitalization. His blood type was O, RH+, Le (a-, b+) and he was a secretor of H-substance, which may be associated with rising API activity after fat-loading. In this case API was unchanged after fat-loading. Neither intestinal nor liver diseases were found, and no other cause for the elevated...
Alkaline erosion of CR 39 polymer surfaces
International Nuclear Information System (INIS)
Faiman, Laurence
2009-01-01
We have investigated the mechanism of erosion of CR 39 polymer in alkaline environments. We observed the kinetics of absorption of water and methanol into both unirradiated and γ-irradiated samples. We use a capillary model to interpret our results. We etched our samples in both KOH solutions, and KOH solutions doped with methanol. Etch rate was desensitizing to γ-irradiation when KOH concentration approached saturation, but KOH solutions doped with methanol were not desensitizing, unlike with nuclear tracks. We account for this difference
Electrochemistry of Some New Alkaline Battery Electrodes
1976-02-01
1NýT;7 ~~ AFAPI 4TR- 75)aI Electrochemistry of Somwý New Alkaline V CI RG, 0OTNME Dr/ David F., ’Pickett, IM Wayue ’,Hisb’q Mr. R ic ha rd A I Mid...adding ZnO to the electi-olyte (saturated) and usi .j the interc:ell conrec;tor d isr:ussed earlier ,itLh el4cc.roploated zinc ag inst. the silver fo
Household food insecurity and child health.
Schmeer, Kammi K; Piperata, Barbara A
2017-04-01
Food insecurity, the lack of consistent access to sufficient quality and quantity of food, affects an estimated 800 million people around the world. Although household food insecurity is generally associated with poor child nutrition and health in the USA, we know less about household food insecurity and child health in developing countries. Particularly lacking is research assessing how associations between household food insecurity and children's health outcomes may differ by child age and among children beyond age 5 years in low-income settings. We use data from a population-based sample of households with children ages 3-11 years (N = 431) in León, Nicaragua to consider how household food insecurity is associated with three measures of child health: illness, anaemia and low height-for-age. Our results provide new evidence that even mild household food insecurity is detrimental to children's health; and that child age conditions the associations between household food insecurity and child health. We find that food insecurity is especially harmful to health during early childhood, but continues to have significant associations with health into middle childhood (up to ages 7-8 years). We discuss the potential implications of these results for future child health research and policies in low-income countries. © 2016 John Wiley & Sons Ltd. © 2016 John Wiley & Sons Ltd.
Sources of household salt in South Africa.
Jooste, Pieter L
2005-01-01
Marketing of non-iodized salt through unconventional distribution channels is one of the factors weakening the national salt iodization program in South Africa. The aim of this study was therefore to quantify the various sources of household salt, and to relate this information to socio-economic status. Questionnaire information was collected by personal interview during home visits from a multistage, cluster, probability sample of 2164 adults representative of the adult population. Nationally 77.7% of households obtained their table salt from the typical food shops distributing iodized salt. However, in the nine different provinces between 8 and 37.3% of households used unconventional sources, distributing mainly non-iodized salt, to obtain their household salt. These alternative sources include distributors of agricultural salt, small general dealer shops called spaza shops, in peri-urban and rural townships, street vendors and salt saches placed in the packaging of maize meal bags. Country-wide around 30% of low socio-economic households obtained their salt from unconventional sources compared to less than 5% in high socio-economic households, emphasizing the vulnerability of low socio-economic groups to the use of non-iodized salt. Intervention strategies should mobilize all role players involved in unconventional marketing channels of household salt to provide only iodized salt to consumers, as required by law.
ASSESSMENT OF HOUSEHOLD CARBON FOOTPRINT REDUCTION POTENTIALS
Energy Technology Data Exchange (ETDEWEB)
Kramer, Klaas Jan; Homan, Greg; Brown, Rich; Worrell, Ernst; Masanet, Eric
2009-04-15
The term ?household carbon footprint? refers to the total annual carbon emissions associated with household consumption of energy, goods, and services. In this project, Lawrence Berkeley National Laboratory developed a carbon footprint modeling framework that characterizes the key underlying technologies and processes that contribute to household carbon footprints in California and the United States. The approach breaks down the carbon footprint by 35 different household fuel end uses and 32 different supply chain fuel end uses. This level of end use detail allows energy and policy analysts to better understand the underlying technologies and processes contributing to the carbon footprint of California households. The modeling framework was applied to estimate the annual home energy and supply chain carbon footprints of a prototypical California household. A preliminary assessment of parameter uncertainty associated with key model input data was also conducted. To illustrate the policy-relevance of this modeling framework, a case study was conducted that analyzed the achievable carbon footprint reductions associated with the adoption of energy efficient household and supply chain technologies.
Determinants of Vulnerability to Livelihood Insecurity at Household ...
African Journals Online (AJOL)
USER
Household Economic Approach of measuring vulnerability. The Household ... external and internal sides as proposed by Conway and Chambers (1989): ... education and occupation of the household head, dependency ratio, exposure.
households' choices of healthcare services in the north west region
African Journals Online (AJOL)
model. Households' characteristics such as sex and age of household heads, marital status of household heads and .... Based Financing (PBF) of healthcare in the North .... return from this capital in both market and non- ... Healthy Life Style.
Information content of household-stratified epidemics
Directory of Open Access Journals (Sweden)
T.M. Kinyanjui
2016-09-01
Full Text Available Household structure is a key driver of many infectious diseases, as well as a natural target for interventions such as vaccination programs. Many theoretical and conceptual advances on household-stratified epidemic models are relatively recent, but have successfully managed to increase the applicability of such models to practical problems. To be of maximum realism and hence benefit, they require parameterisation from epidemiological data, and while household-stratified final size data has been the traditional source, increasingly time-series infection data from households are becoming available. This paper is concerned with the design of studies aimed at collecting time-series epidemic data in order to maximize the amount of information available to calibrate household models. A design decision involves a trade-off between the number of households to enrol and the sampling frequency. Two commonly used epidemiological study designs are considered: cross-sectional, where different households are sampled at every time point, and cohort, where the same households are followed over the course of the study period. The search for an optimal design uses Bayesian computationally intensive methods to explore the joint parameter-design space combined with the Shannon entropy of the posteriors to estimate the amount of information in each design. For the cross-sectional design, the amount of information increases with the sampling intensity, i.e., the designs with the highest number of time points have the most information. On the other hand, the cohort design often exhibits a trade-off between the number of households sampled and the intensity of follow-up. Our results broadly support the choices made in existing epidemiological data collection studies. Prospective problem-specific use of our computational methods can bring significant benefits in guiding future study designs.
Information content of household-stratified epidemics.
Kinyanjui, T M; Pellis, L; House, T
2016-09-01
Household structure is a key driver of many infectious diseases, as well as a natural target for interventions such as vaccination programs. Many theoretical and conceptual advances on household-stratified epidemic models are relatively recent, but have successfully managed to increase the applicability of such models to practical problems. To be of maximum realism and hence benefit, they require parameterisation from epidemiological data, and while household-stratified final size data has been the traditional source, increasingly time-series infection data from households are becoming available. This paper is concerned with the design of studies aimed at collecting time-series epidemic data in order to maximize the amount of information available to calibrate household models. A design decision involves a trade-off between the number of households to enrol and the sampling frequency. Two commonly used epidemiological study designs are considered: cross-sectional, where different households are sampled at every time point, and cohort, where the same households are followed over the course of the study period. The search for an optimal design uses Bayesian computationally intensive methods to explore the joint parameter-design space combined with the Shannon entropy of the posteriors to estimate the amount of information in each design. For the cross-sectional design, the amount of information increases with the sampling intensity, i.e., the designs with the highest number of time points have the most information. On the other hand, the cohort design often exhibits a trade-off between the number of households sampled and the intensity of follow-up. Our results broadly support the choices made in existing epidemiological data collection studies. Prospective problem-specific use of our computational methods can bring significant benefits in guiding future study designs. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.
Household location choices: implications for biodiversity conservation.
Peterson, M Nils; Chen, Xiaodong; Liu, Jianguo
2008-08-01
Successful conservation efforts require understanding human behaviors that directly affect biodiversity. Choice of household location represents an observable behavior that has direct effects on biodiversity conservation, but no one has examined the sociocultural predictors of this choice relative to its environmental impacts. We conducted a case study of the Teton Valley of Idaho and Wyoming (U.S.A.) that (1) explored relationships between sociodemographic variables, environmental attitudes, and the environmental impact of household location choices, (2) assessed the potential for small household sizes in natural areas to multiply the environmental impacts of household location decisions, and (3) evaluated how length of residency predicted the environmental attitudes of people living in natural areas. We collected sociodemographic data, spatial coordinates, and land-cover information in a survey of 416 households drawn from a random sample of Teton Valley residents (95% compliance rate). Immigrants (respondents not born in the study area) with the lowest education levels and least environmentally oriented attitudes lived in previously established residential areas in disproportionately high numbers, and older and more educated immigrants with the most environmentally oriented attitudes lived in natural areas in disproportionately high numbers. Income was not a significant predictor of household location decisions. Those living in natural areas had more environmental impact per person because of the location and because small households (educated, and potentially growing more environmentally oriented, these patterns are troubling for biodiversity conservation. Our results demonstrate a need for environmentalists to make household location decisions that reflect their environmental attitudes and future research to address how interactions between education level, environmental attitudes, population aging, and household location choices influence biodiversity
NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-02-0049 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela
NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0053 gb|AAS74380.1| 5-HT1B [Drosophila melanogaster] gb|AAS74382.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74389.1| 5-HT1B [Drosophila melanogaster] gb|AAS74402.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74403.1| 5-HT1B [Drosophila melanogaster] gb|AAS74405.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74406.1| 5-HT1B [Drosophila melanogaster] gb|AAS74411.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74412.1| 5-HT1B [Drosophila melanogaster] gb|AAS74413.1| 5-HT1B [Drosophila mela
NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-02-0049 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela
NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0053 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela
NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-04-0001 gb|AAS74960.1| 5-HT2 [Drosophila melanogaster] gb|AAS74962.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74964.1| 5-HT2 [Drosophila melanogaster] gb|AAS74966.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74970.1| 5-HT2 [Drosophila melanogaster] gb|AAS74972.1| 5-HT2 [Drosophila melanogaster]... gb|AAS74976.1| 5-HT2 [Drosophila melanogaster] gb|AAS74978.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74979.1| 5-HT2 [Drosophila melanogaster] gb|AAS74980.1| 5-HT2 [Drosophila melanogaster
NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-156 96% ...
NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0056 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela
NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0057 gb|AAS74185.1| 5-HT1A [Drosophila melanogaster] gb|AAS74209.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74210.1| 5-HT1A [Drosophila melanogaster] gb|AAS74211.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74224.1| 5-HT1A [Drosophila melanogaster] gb|AAS74234.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74254.1| 5-HT1A [Drosophila melanogaster] gb|AAS74258.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74262.1| 5-HT1A [Drosophila melanogaster] gb|AAS74278.1| 5-HT1A [Drosophila mela
NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0056 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela
NCBI nr-aa BLAST: CBRC-DMEL-04-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-165 100% ...
International Nuclear Information System (INIS)
Delegard, C.H.; Peretrukhin, V.F.; Shilov, V.P.; Pikaev, A.K.
1995-05-01
Goal of this survey is to generalize the known data on fundamental physical-chemical properties of TRUs and Tc, methods for their isolation, and to provide recommendations that will be useful for partitioning them from alkaline high-level wastes
Energy Technology Data Exchange (ETDEWEB)
Delegard, C.H. [Westinghouse Hanford Co., Richland, WA (United States); Peretrukhin, V.F.; Shilov, V.P.; Pikaev, A.K. [Russian Academy of Sciences (Russian Federation). Inst. of Physical Chemistry
1995-05-01
Goal of this survey is to generalize the known data on fundamental physical-chemical properties of TRUs and Tc, methods for their isolation, and to provide recommendations that will be useful for partitioning them from alkaline high-level wastes.
Future Changes in Age and Household Patterns
DEFF Research Database (Denmark)
Højbjerg Jacobsen, Rasmus; Hougaard Jensen, Svend E.
2014-01-01
Using stochastic forecasting techniques, this paper assesses the consequences for public finances of changes in age and household structures in Denmark over the period 2008–2037. Focusing on components of welfare provisions and tax payments with noticeable differences across age and household...... status, we show that, based on a point forecast, the fiscal impact of changes in household structures amounts to an annual negative effect of 0.5% of GDP, and the effect of changes in age structures is forecast to worsen the public budget by 3.7% of GDP per year. While being subject to a considerable...
Raising household saving: does financial education work?
Gale, William G; Harris, Benjamin H; Levine, Ruth
2012-01-01
This article highlights the prevalence and economic outcomes of financial illiteracy among American households, and reviews previous research that examines how improving financial literacy affects household saving. Analysis of the research literature suggests that previous financial literacy efforts have yielded mixed results. Evidence suggests that interventions provided for employees in the workplace have helped increase household saving, but estimates of the magnitude of the impact vary widely. For financial education initiatives targeted to other groups, the evidence is much more ambiguous, suggesting a need for more econometrically rigorous evaluations.
Substitution between cars within the household
DEFF Research Database (Denmark)
De Borger, Bruno; Mulalic, Ismir; Rouwendal, Jan
The purpose of this paper is to study to what extent two-car households substitute the use of their less fuel efficient car by the use of their more fuel efficient car after an increase in fuel prices. Based on a simple theoretical framework we use a large sample of detailed Danish data on two-car...... households to estimate, for each car owned by the household, own and cross-price effects of increases in fuel costs per kilometer. The empirical results point at important substitution effects, so that models that estimate responses to fuel prices on the implicit or explicit assumption of one car per...
Household energy demand. Empirical studies concerning Sweden
Energy Technology Data Exchange (ETDEWEB)
Dargay, J; Lundin, A
1978-06-01
This paper investigates the effects of energy policy on households in Sweden and provides the material necessary for evaluation of current and proposed energy-conservation measures. Emphasis is placed on the impact of enery taxation or price changes on household demand for electricity, heating oil, and gasoline and the consequences of such measures for income distribution. The results of the Swedish studies of household demand for heating oil and gasoline indicate that price changes can have a considerable long run impact on fuel utilization. In the short run, price responsiveness is notably reduced, but it is nevertheless of consequence for energy demand.
Individual and Household Willingness to Pay for Public Goods
John Quiggin
1998-01-01
The issue of whether willingness to pay (WTP) for the benefits generated by a public good should be elicited on an individual or on a household basis is addressed. Differences between individual and household WTP may arise when members of the household are mutually altruistic. It is shown that, for general specifications of altruism, household WTP is less than the sum of household members' individual WTP. Implications for the choice between household and individual measures of WTP are conside...
Isotherms of ion exchange on titanates of alkaline metals
International Nuclear Information System (INIS)
Fillina, L.P.; Belinskaya, F.A.
1986-01-01
Present article is devoted to isotherms of ion exchange on titanates of alkaline metals. Therefore, finely dispersed hydrated titanates of alkaline metals (lithium, sodium, potassium) with ion exchange properties are obtained by means of alkaline hydrolysis of titanium chloride at high ph rates. Sorption of cations from salts solution of Li 2 SO 4 , NaNO 3 , Ca(NO 3 ) 2 , AgNO 3 by titanates is studied.
Acid transformation of bauxite residue: Conversion of its alkaline characteristics
Kong, X.; Li, M.; Xue, S.; Hartley, W.; Chen, C.; Wu, C.; Li, X.; Li, Y.
2016-01-01
Bauxite residue (BR) is a highly alkaline solid hazardous waste produced from bauxite processing for alumina production. Alkaline transformation appears to reduce the environmental risk of bauxite residue disposal areas (BRDAs) whilst potentially providing opportunities for the sustainable reuse and on-going management of BR. Mineral acids, a novel citric acid and a hybrid combination of acid-gypsum treatments were investigated for their potential to reduce residue pH and total alkalinity and...
Correlates of Intra-Household ITN Use in Liberia: A Multilevel Analysis of Household Survey Data.
Babalola, Stella; Ricotta, Emily; Awantang, Grace; Lewicky, Nan; Koenker, Hannah; Toso, Michael
2016-01-01
Malaria is a major cause of morbidity and mortality in Liberia. At the same time, insecticide-treated net (ITN) ownership and use remain low. Access is a key determinant of ITN use but it is not the only one; prior studies have identified factors that affect the use of ITNs in households with at least one ITN. These factors operate at the individual, household, and community levels. However, studies have generally not assessed the psychosocial or ideational determinants of ITN use. Using 2014 household survey data, this manuscript examines the socio-demographic, ideational, household, and community factors associated with household member use of ITNs in Liberia. Multilevel modeling was used to assess fixed effects at the individual, household, and community levels, and random effects at the household and cluster levels. The data showed significant residual clustering at the household level, indicating that there were unmeasured factors operating at this level that are associated with ITN use. The association of age with ITN use was moderated by sex such that men, older children, and teenagers were less likely to sleep under an ITN compared to women and children under five years old. Female caregivers' perceived severity of malaria, perceived self-efficacy to detect a complicated case of malaria, and exposure to the "Take Cover" communication campaign were positively associated with ITN use by members of her household. The association with household size was negative, while the relationship with the number of ITNs was positive. Programs should seek to achieve universal coverage (that is, one ITN for every two household members) and promote the notion that everyone needs to sleep under an ITN every night. Programs should also seek to strengthen perceived severity of malaria and educate intended audience groups on the signs of malaria complications. Given the significance of residual clustering at the household level, interventions that engage men as heads of
Activation of Alkaline Irrigation Fluids in Endodontics
Directory of Open Access Journals (Sweden)
Laurence J. Walsh
2017-10-01
Full Text Available In conventional endodontic treatment, alkaline solutions of sodium hypochlorite (NaOCl and ethylenediaminetetraacetic acid (EDTA are used in combination to disinfect the root canal system and to eliminate debris and smear layers. An important concept that has emerged over recent years is the use of active physical methods for agitating these fluids to improve their penetration within areas that are not reached by endodontic instruments and to accelerate the chemical actions of these alkaline fluids against planktonic microorganisms, biofilms, soft tissue remnants and smear layers. Ultrasonic agitation and more recently pulsed lasers have emerged as two promising methods for activating endodontic irrigation fluids. Ultrasonic agitation with piezoelectric devices employs a moving tip, while laser agitation uses a stationary tip. Both methods cause cavitation, followed by implosions and shear forces which assist with debridement. Fluid streaming further enhances the activity of the fluids. While agitation enhances performance of irrigants, extrusion of fluids from the root canal during activation is a hazard that must be controlled.
DNA DAMAGE QUANTITATION BY ALKALINE GEL ELECTROPHORESIS.
Energy Technology Data Exchange (ETDEWEB)
SUTHERLAND,B.M.; BENNETT,P.V.; SUTHERLAND, J.C.
2004-03-24
Physical and chemical agents in the environment, those used in clinical applications, or encountered during recreational exposures to sunlight, induce damages in DNA. Understanding the biological impact of these agents requires quantitation of the levels of such damages in laboratory test systems as well as in field or clinical samples. Alkaline gel electrophoresis provides a sensitive (down to {approx} a few lesions/5Mb), rapid method of direct quantitation of a wide variety of DNA damages in nanogram quantities of non-radioactive DNAs from laboratory, field, or clinical specimens, including higher plants and animals. This method stems from velocity sedimentation studies of DNA populations, and from the simple methods of agarose gel electrophoresis. Our laboratories have developed quantitative agarose gel methods, analytical descriptions of DNA migration during electrophoresis on agarose gels (1-6), and electronic imaging for accurate determinations of DNA mass (7-9). Although all these components improve sensitivity and throughput of large numbers of samples (7,8,10), a simple version using only standard molecular biology equipment allows routine analysis of DNA damages at moderate frequencies. We present here a description of the methods, as well as a brief description of the underlying principles, required for a simplified approach to quantitation of DNA damages by alkaline gel electrophoresis.
Outcomes From AAS Hack Day at the 227th AAS Meeting
Kohler, Susanna
2016-01-01
Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts
International Nuclear Information System (INIS)
Rodriguez, Sebastian A.; Haddad, Roberto; Lanzani, Liliana A.
2004-01-01
An experimental approach has been developed to study the corrosion behavior of artificial crevices manufactured with high purity aluminum and AA 6061 alloy, immersed in dematerialised water and sodium citrate solution (96,5 μS/cm). Alkaline attack was found on the surrounding of iron rich particles in the external zone of the crevice, as a result of localized oxygen reduction reaction on these sites. This attack was not observed in the zone inside the crevice. Study of the phase Mg 2 Si by EDS allowed establishing that there is not preferential dissolution inside the crevice. The formation of a stable and non-soluble complex between Al and citrate anion inhibited the production of Al(OH) 3 precipitate, which was observed on the surface of specimens immersed in pure water. Investigations of the aluminum oxide evolution on AA 6061 surfaces in water showed that it was composed by two layers: an internal one made of Bohemite and an external one in direct contact with the water, with a Bayerite structure. The surface analysis was accomplished using XR, OM and SEM techniques. (author) [es
Climate Change, Household Vulnerability and Smart Agriculture
International Development Research Centre (IDRC) Digital Library (Canada)
Marina
The cost benefits analysis was the main technique used to evaluate alternative adaptation strategies. .... Figure 7 Different vulnerability levels of households from Lambani and Alice . ...... practices and the maintenance of surface residues.
Substitution between cars within the household
DEFF Research Database (Denmark)
De Borger, Bruno; Mulalic, Ismir; Rouwendal, Jan
2016-01-01
In this paper we study the demand for car kilometres in two-car households, focusing on the substitution between cars of different fuel efficiency in response to fuel price changes. We use a large sample of detailed Danish data on two-car households to estimate – for each car owned by the household...... – own and cross-price effects of increases in fuel costs per kilometre. The empirical results show that failure to capture substitution between cars within the household can result in substantial misspecification biases. Ignoring substitution, the basic model yielded fuel price elasticities of 0.......98 and 1.41 for the primary and secondary cars, respectively. Accounting for substitution effects, these figures reduce to, respectively, 0.32 and 0.45. Consistent with substitution behaviour, we find that the fuel price elasticity of fuel demand exceeds the elasticity of kilometre demands with respect...
Substitution between Cars within the Household
DEFF Research Database (Denmark)
de Borger, Bruno; Mulalic, Ismir; Rouwendal, Jan
In this paper we study the demand for car kilometres in two-car households, focusing on the substitution between cars in response to fuel price changes. We use a large sample of detailed Danish data on two-car households to estimate—for each car owned by the household—own and cross-price effects...... of increases in fuel costs per kilometre. The empirical results show that failure to capture substitution between cars within the household can result in substantial misspecification biases. Ignoring substitution, we estimate fuel price elasticities of –0.81 and -0.65 for the primary and secondary cars...... efficient car, finding partial support for the underlying hypothesis. More importantly, the results of this extended model emphasize the importance of behavioural differences related to the position of the most fuel efficient car in the household, suggesting that households’ fuel efficiency choices...
Household wealth and child health in India.
Chalasani, Satvika; Rutstein, Shea
2014-03-01
Using data from the Indian National Family Health Surveys (1992-93, 1998-99, 2005-06), this study examined how the relationship between household wealth and child health evolved during a time of significant economic change in India. The main predictor was an innovative measure of household wealth that captures changes in wealth over time. Discrete-time logistic models (with community fixed effects) were used to examine mortality and malnutrition outcomes: infant, child, and under-5 mortality; stunting, wasting, and being underweight. Analysis was conducted at the national, urban/rural, and regional levels, separately for boys and girls. The results indicate that the relationship between household wealth and under-5 mortality weakened over time but this result was dominated by infant mortality. The relationship between wealth and child mortality stayed strong for girls. The relationship between household wealth and malnutrition became stronger over time for boys and particularly for girls, in urban and (especially) rural areas.
Community mobilization and household level waste management ...
International Development Research Centre (IDRC) Digital Library (Canada)
A baseline household survey was conducted and entomological and sociological surveys were carried out .... Research methods ... including the objectives and the methodology were .... tained both quantitative and qualitative assessments.
Household energy consumption and expenditures 1993
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-10-05
This presents information about household end-use consumption of energy and expenditures for that energy. These data were collected in the 1993 Residential Energy Consumption Survey; more than 7,000 households were surveyed for information on their housing units, energy consumption and expenditures, stock of energy-consuming appliances, and energy-related behavior. The information represents all households nationwide (97 million). Key findings: National residential energy consumption was 10.0 quadrillion Btu in 1993, a 9% increase over 1990. Weather has a significant effect on energy consumption. Consumption of electricity for appliances is increasing. Houses that use electricity for space heating have lower overall energy expenditures than households that heat with other fuels. RECS collected data for the 4 most populous states: CA, FL, NY, TX.
FOOD DEMAND PATTERNS IN GHANAIAN URBAN HOUSEHOLDS
Directory of Open Access Journals (Sweden)
Bernard SAKYIAMAH
2018-03-01
Full Text Available This paper analysed food consumption patterns in Ghanaian urban households by comparing food commodity budget shares and estimating price and expenditure elasticities for eleven food commodity groups across different income groups. The Linear Approximation Almost Ideal Demand System (LA/AIDS was applied to the data. Demand for most of the food commodity groups was found to be elastic. The study concluded that generally, across income groups, food commodities respond negatively to changes in food prices and that cereals/bread, roots/tubers, vegetables, meat and fish will remain an important component of urban household food expenditure. Generally, household demographic characteristics such as age, gender and household size had significant effects on urban food demand patterns.
Bangladesh Integrated Household Survey (BIHS) 2015
US Agency for International Development — This dataset is the second round of Bangladesh Integrated Household Survey (BIHS). The BIHS is the only nationally representative survey in Bangladesh that collects...
Macroeconomic Expectations of Households and Professional Forecasters
Christopher D Carroll
2002-01-01
Economists have long emphasized the importance of expectations in determining macroeconomic outcomes Yet there has been almost no recent effort to model actual empirical expectations data; instead macroeconomists usually simply assume expectations are rational This paper shows that while empirical household expectations are not rational in the usual sense expectational dynamics are well captured by a model in which households' views derive from news reports of the views of professional foreca...
Revealing household characteristics from smart meter data
International Nuclear Information System (INIS)
Beckel, Christian; Sadamori, Leyna; Staake, Thorsten; Santini, Silvia
2014-01-01
Utilities are currently deploying smart electricity meters in millions of households worldwide to collect fine-grained electricity consumption data. We present an approach to automatically analyzing this data to enable personalized and scalable energy efficiency programs for private households. In particular, we develop and evaluate a system that uses supervised machine learning techniques to automatically estimate specific “characteristics” of a household from its electricity consumption. The characteristics are related to a household's socio-economic status, its dwelling, or its appliance stock. We evaluate our approach by analyzing smart meter data collected from 4232 households in Ireland at a 30-min granularity over a period of 1.5 years. Our analysis shows that revealing characteristics from smart meter data is feasible, as our method achieves an accuracy of more than 70% over all households for many of the characteristics and even exceeds 80% for some of the characteristics. The findings are applicable to all smart metering systems without making changes to the measurement infrastructure. The inferred knowledge paves the way for targeted energy efficiency programs and other services that benefit from improved customer insights. On the basis of these promising results, the paper discusses the potential for utilities as well as policy and privacy implications. - Highlights: • Many household characteristics can be automatically inferred from smart meter data. • We develop a system to infer employment status and number of occupants, for instance. • We evaluate our system analyzing data collected from 4232 households in Ireland. • The insights enable personalized and scalable efficiency campaigns for utilities. • Energy efficiency measures must be complemented by privacy protection
Power in Households: Disentangling Bargaining Power
Mabsout, Ramzi; Staveren, Irene
2009-01-01
textabstractIntroduction Within the household bargaining literature, bargaining power is generally understood in terms of economic resources, such as income or assets. Empirical analyses of women’s bargaining power in households in developed and developing countries find that, in general, higher female incomes lead to higher bargaining power, which in turn tends to increase women’s relative wellbeing (Quisumbing, 2003). For assets, the empirical literature comes up with similar results, indic...
Domestic energy use and householders' energy behaviour
International Nuclear Information System (INIS)
Yohanis, Yigzaw Goshu
2012-01-01
This paper discusses domestic energy use and energy behaviour. It shows some improvement in domestic energy consumption and adoption of good energy practice. The survey conducted indicated that 35% of homes could improve their energy efficiency by improved tank insulation. In the last 5 years condensing boilers have been installed only in 3% of homes, indicating that householders are unaware of their advantages. Although 88% of surveyed homes had purchased a major appliance in the last 2 years, only 16% had any idea of the energy rating of their new appliances. Use of energy saving light bulbs is predominant in kitchens compared to other rooms. 70–80% of householders undertook some kind of day-to-day energy efficiency measures. 20–35% of householders would like to invest in energy-saving measures but found cost to be a key barrier. Approximately 84% of those surveyed were unaware of the energy rating of their household appliances. Price and brand were the most important factors determining the purchase of a new appliance. Significant energy-saving could be achieved by providing appropriate information to the general public regarding temperature control, efficiency of appliances and energy-saving heating systems. - Highlights: ▶ Good practice in household energy use is being adopted but actual use is rising. ▶ Cost is dominant in energy related decisions purchasing of household appliances. ▶ Energy behaviour is improving but level of awareness needs more work.
Income differentiation of households in the CR
Directory of Open Access Journals (Sweden)
Jana Stávková
2011-01-01
Full Text Available The Czech Republic has recently experienced phases of economic growth and periods of economic crisis, this fact affects the standard of living and household behaviour and affects the formation of life-style. This paper deals with the income situation of households. The main source of data is EU SILC survey from the years 2005 to 2008.The result of the enquiry and processing of primary data is information about the average income per household member, the poverty level and the number of households at risk of poverty. For the formulation of income differentiation is used Gini coefficient. Attention is paid to factors that affect income inequality (the number of household members, social group, age. Information, about the income situation of households, is amended by following indicators of material deprivation. The paper also analyses the impact of social transfers on income inequality. The analysis and subsequent solving of the problem of income inequality may be contributed with further analysis of empirical data of this type.
Household energy requirement and value patterns
International Nuclear Information System (INIS)
Vringer, Kees; Aalbers, Theo; Blok, Kornelis
2007-01-01
For an effective consumer energy policy, it is important to know why some households require more energy than others. The aim of the study described here was to examine whether there is a relationship between the total household energy requirement, on one hand, and value patterns, the motivation to save energy or the problem perception of climate change, on the other. To examine these relationships, we held a consumer survey among 2304 respondent households. We did not find significant differences in the energy requirement of groups of households with different value patterns, taking into account the differences in the socio-economic situation of households. Only for the 'motivation to save energy' we did find that the least motivated group requires 10 GJ more energy than the average and most motivated groups; this is about 4% of the total household energy requirement. This means that a self-regulating energy policy, solely based on the fact that a strategy of internalising environmental responsibility will not be effective in saving energy. There are indications that a social dilemma is one of the reasons why people's consumption patterns do not conform to their value patterns, problem perception or motivation to save energy
International Nuclear Information System (INIS)
Matsumoto, Shigeru
2016-01-01
Although both appliance ownership and usage patterns determine residential electricity consumption, it is less known how households actually use their appliances. In this study, we conduct conditional demand analyses to break down total household electricity consumption into a set of demand functions for electricity usage, across 12 appliance categories. We then examine how the socioeconomic characteristics of the households explain their appliance usage. Analysis of micro-level data from the Nation Survey of Family and Expenditure in Japan reveals that the family and income structure of households affect appliance usage. Specifically, we find that the presence of teenagers increases both air conditioner and dishwasher use, labor income and nonlabor income affect microwave usage in different ways, air conditioner usage decreases as the wife's income increases, and microwave usage decreases as the husband's income increases. Furthermore, we find that households use more electricity with new personal computers than old ones; this implies that the replacement of old personal computers increases electricity consumption. - Highlights: •We conduct conditional demand analyses to study household appliance usage. •Micro-level data from the National Survey of Family and Expenditure in Japan are analyzed. •We show how household characteristics determine appliance usage. •High-income households use specific appliances less intensively than low-income households. •The replacement of old TVs and PCs lead to greater electricity consumption.
Estimating household food waste in Denmark:case study of single family households
DEFF Research Database (Denmark)
Edjabou, Vincent Maklawe Essonanawe; Petersen, C.; Scheutz, Charlotte
and determine potential improvements. In Denmark, although many sorting campaigns involving household waste has been conducted, little attention has been placed on food waste. Comparison of recent studies made for examples in Austria, and the UK suggests that quantity and material composition of food waste vary...... waste and non-avoidable vegetable food waste. Furthermore, avoidable vegetable and animal food waste were the primary source of household food waste. Statistical analysis found a positive linear relationship between household size and the amount of the household food waste suggesting the amount...
Yield and flow properties of aluminum alloy AA 8001
International Nuclear Information System (INIS)
Lyons, J.S.; Johnson, H.W.; Han, E.G.
1995-01-01
Aluminum alloy AA 8001 is being used at the Westinghouse Savannah River Company (WSRC) for nuclear reactor fuel and target components. The objective of this research was to determine parameters for predictive models of the compressive flow properties of AA 8001. Seventy-five true strain-rate, hot compression tests were performed. New, quantitative information about the yield and flow behavior of aluminum alloy AA 8001 was determined. Parameters were determined to use in a hyperbolic sine constitutive law so that the yield stress, the peak stress, and the peak strain can be predicted from the temperature-compensated strain-rate, Z. It was found that the onset of strain softening was more strongly dependent on Z than the onset of yielding was
Hydrogen production by alkaline water electrolysis
Directory of Open Access Journals (Sweden)
Diogo M. F. Santos
2013-01-01
Full Text Available Water electrolysis is one of the simplest methods used for hydrogen production. It has the advantage of being able to produce hydrogen using only renewable energy. To expand the use of water electrolysis, it is mandatory to reduce energy consumption, cost, and maintenance of current electrolyzers, and, on the other hand, to increase their efficiency, durability, and safety. In this study, modern technologies for hydrogen production by water electrolysis have been investigated. In this article, the electrochemical fundamentals of alkaline water electrolysis are explained and the main process constraints (e.g., electrical, reaction, and transport are analyzed. The historical background of water electrolysis is described, different technologies are compared, and main research needs for the development of water electrolysis technologies are discussed.
Alkaline lixiviation of uranium in granitic pegmatite
International Nuclear Information System (INIS)
Jambor, S.
1980-06-01
The work described herein concerns the determination of the experimental optimum conditions for the alkaline lixiviation of uranium based on the following parameters: time, pH, temperature, density and grane size. The samples were obtained from the Supamo complex, near the Currupia river in the Piar District of the Bolivar State in Venezuela. They have a granitic composition and graphitic texture. The uranium was found in them as a secondary oxidized mineral of green-yellow colour localized in fractures fissures, intergranular spaces and also in the mica as. Secondary uranitite. The lixiviation process was carried out using Na 2 CO 3 /NaHCO 3 buffer solution and for 100 gr. samples the best values for an efficient process were found by using 170 mesh grane size and 500 ml of pH buffer at 70 0 C for a 24 hour time period. (author)
Ethylenediaminetetraacetates of neodymium and alkaline earth metals
International Nuclear Information System (INIS)
Barinov, A.V.; Pechurova, L.I.; Martynenko, K.I.; Popov, K.I.; Spitsyn, V.I.
1977-01-01
The possibilities have been studied of the formation of polynuclear complexonates of alkaline-earth metals (Ca, Sr, and Ba) based on neodymium derivatives EDTA of the composition NdA - . By pH-metry, electron spectroscopy, and derivatography it has been shown that the structure of complexes M 2 (NdA) 2 (where M- Ca, Sr, or Ba; A- EDTA) in the solution is not polynuclear. Hydroxopolynuclear complexes do not form under conditions studied. The data obtained agree with an assumption about polynuclear structure of the solid complex Ca(NdA) 2 x17 H 2 O and gradual weakening of the polynuclear nature upon substitution of Ca 2+ with Sr 2+ and Ba 2+
Corrosion of copper in alkaline chloride environments
International Nuclear Information System (INIS)
King, F.
2002-08-01
The available literature information on the corrosion and electrochemical behaviour of copper in alkaline environments has been reviewed. The purpose of the review was to assess the impact of an alkaline plume from cementitious material on the corrosion behaviour of a copper canister in an SKB-3 type repository. The effect of the evolution of the environmental conditions within the repository have been considered, including the effects of temperature, redox conditions, pore-water salinity and pH. If the pore-water pH increases prior to the establishment of anoxic conditions, the canister surface will passivate as the pore-water pH exceeds a value of ∼ pH 9. Passivation will result from the formation of a duplex Cu 2 O/Cu(OH) 2 film. The corrosion potential will be determined by the equilibrium potential for the Cu 2 O/Cu(OH) 2 couple under oxic conditions, or by the Cu/Cu 2 O redox couple under anoxic conditions (in the absence of sulphide). Pitting corrosion is only likely to occur early in the evolution of the repository environment, whilst the canister is still relatively cool ( 2 available to support localised corrosion, and prior to the increase in pore-water pH and salinity. The subsequent increase in canister surface temperature, pore-water pH and salinity, and decrease in O 2 will make pit initiation less likely, although the canister will remain passive provided the pore-water pH is maintained above pH 9. The higher the pore-water pH, the more strongly the canister is passivated and the less likely the surface is to undergo localised attack. If the pore-water salinity increases prior to the increase in pH, there could be a period of active canister corrosion before passivation occurs.Under these circumstances, the corrosion potential will be a true mixed potential, determine by the relative kinetics of Cu dissolution as CuCl 2 - and of the reduction of O 2 . The development of anoxic conditions and an increase in pore-water sulphide concentration will
Retention of alkaline earth elements in man
International Nuclear Information System (INIS)
Newton, D.
1990-06-01
The data on human metabolism and long-term retention of alkaline earth elements ( 133 Ba injected into six healthy male volunteers at age 25-81 y and 45 Ca and 85 Sr received by one healthy male volunteer) are presented. Excreta were collected for 2-3 weeks after injection of the tracer into an antecubital vein. Activity in urine, ashed faeces and early samples of blood plasma was determined by gamma-ray scintillation spectrometry. Whole body retention has been assessed through serial measurements of body radioactivity. The injected 133 Ba apparently became mainly skeletal within several days, much earlier than predicted by the ICRP model. The whole-body retention at 32 d ranged from 5 to 14%, the rate of loss correlating with the excretory plasma clearance rate. No age-related trends were identified in the metabolism of Ca and Sr. 2 refs, 2 figs
Properties of cathode materials in alkaline cells
International Nuclear Information System (INIS)
Salkind, A.J.; McBreen, J.; Freeman, R.; Parkhurst, W.A.
1985-01-01
Conventional and new cathode materials in primary and secondary alkaline cells were investigated for stability, structure, electrochemical reversibility and efficiency. Included were various forms of AgO for reserve-type silver-zinc batteries, a new material - AgNiO/sub 2/ - and several nickel electrodes for nickel-cadmium and nickel-hydrogen cells for aerospace applications. A comparative study was made of the stability of electroformed and chemically prepared AgO. Stability was correlated with impurities detected by XPS and SAM. After the first discharge AgNiO/sub 2/ can be recharged to the monovalent level. The discharge product is predominantly silver. Plastic-bonded nickel electrodes display a second plateau on discharge. Additions of Co(OH)/sub 2/ largely eliminate this
Alkaline pulping of some eucalypts from Sudan.
Khristova, P; Kordsachia, O; Patt, R; Dafaalla, S
2006-03-01
Four eucalypts (Eucalyptus camaldulensis, Eucalyptus microtheca, Eucalyptus tereticornis and Eucalyptus citriodora) grown in Sudan were examined for their suitability for pulping and papermaking with different alkaline methods. Their physical, morphological and chemical characteristics are reported. The pulping trials with E. citriodora and E. tereticornis were carried out using the kraft-AQ, soda-AQ, modified AS/AQ (ASA), ASAM and kraft methods. For the other two species, only the ASAM and the kraft process were applied. ASAM pulping gave the best results in terms of yield, degree of delignification, mechanical and optical pulp properties. The best pulps, obtained in kraft and ASAM cooking of E. citriodora, were bleached to 88% ISO brightness in a totally chlorine free bleaching sequence (OQ1O/PQ2P). The bleached pulps, especially the ASAM pulp, showed good papermaking properties and would be suitable for manufacture of writing and printing grades of paper.
Corrosion of copper in alkaline chloride environments
Energy Technology Data Exchange (ETDEWEB)
King, F. [Integrity Corrosion Consulting Ltd., Calgary (Canada)
2002-08-01
The available literature information on the corrosion and electrochemical behaviour of copper in alkaline environments has been reviewed. The purpose of the review was to assess the impact of an alkaline plume from cementitious material on the corrosion behaviour of a copper canister in an SKB-3 type repository. The effect of the evolution of the environmental conditions within the repository have been considered, including the effects of temperature, redox conditions, pore-water salinity and pH. If the pore-water pH increases prior to the establishment of anoxic conditions, the canister surface will passivate as the pore-water pH exceeds a value of {approx} pH 9. Passivation will result from the formation of a duplex Cu{sub 2}O/Cu(OH){sub 2} film. The corrosion potential will be determined by the equilibrium potential for the Cu{sub 2}O/Cu(OH){sub 2} couple under oxic conditions, or by the Cu/Cu{sub 2}O redox couple under anoxic conditions (in the absence of sulphide). Pitting corrosion is only likely to occur early in the evolution of the repository environment, whilst the canister is still relatively cool (<40 deg C), whilst there is still O{sub 2} available to support localised corrosion, and prior to the increase in pore-water pH and salinity. The subsequent increase in canister surface temperature, pore-water pH and salinity, and decrease in O{sub 2} will make pit initiation less likely, although the canister will remain passive provided the pore-water pH is maintained above pH 9. The higher the pore-water pH, the more strongly the canister is passivated and the less likely the surface is to undergo localised attack. If the pore-water salinity increases prior to the increase in pH, there could be a period of active canister corrosion before passivation occurs.Under these circumstances, the corrosion potential will be a true mixed potential, determine by the relative kinetics of Cu dissolution as CuCl{sub 2} - and of the reduction of O{sub 2}. The development
Alkaline batteries for hybrid and electric vehicles
Haschka, F.; Warthmann, W.; Benczúr-Ürmössy, G.
Forced by the USABC PNGV Program and the EZEV regulation in California, the development of hybrid vehicles become more strong. Hybrids offer flexible and unrestricted mobility, as well as pollution-free driving mode in the city. To achieve these requirements, high-power storage systems are demanded fulfilled by alkaline batteries (e.g., nickel/cadmium, nickel/metal hydride). DAUG has developed nickel/cadmium- and nickel/metal hydride cells in Fibre Technology of different performance types (up to 700 W/kg peak power) and proved in electric vehicles of different projects. A special bipolar cell design will meet even extreme high power requirements with more than 1000 W/kg peak power. The cells make use of the Recom design ensuring high power charge ability at low internal gas pressure. The paper presents laboratory test results of cells and batteries.
Alkaline batteries for hybrid and electric vehicles
Energy Technology Data Exchange (ETDEWEB)
Haschka, F.; Warthmann, W.; Benczur-Uermoessy, G. [DAUG Deutsche Automobilgesellschaft, Esslingen (Germany)
1998-03-30
Forced by the USABC PNGV Program and the EZEV regulation in California, the development of hybrid vehicles become more strong. Hybrids offer flexible and unrestricted mobility, as well as pollution-free driving mode in the city. To achieve these requirements, high-power storage systems are demanded fulfilled by alkaline batteries (e.g. nickel/cadmium, nickel/metal hydride). DAUG has developed nickel/cadmium- and nickel/metal hydride cells in Fibre Technology of different performance types (up to 700 W/kg peak power) and proved in electric vehicles of different projects. A special bipolar cell design will meet even extreme high power requirements with more than 1000 W/kg peak power. The cells make use of the Recom design ensuring high power charge ability at low internal gas pressure. The paper presents laboratory test results of cells and batteries. (orig.)
Dissimilar friction stir welds in AA5083-AA6082: The effect of process parameters on residual stress
International Nuclear Information System (INIS)
Steuwer, A.; Peel, M.J.; Withers, P.J.
2006-01-01
The effect of tool traverse and rotation speeds on the residual stresses are quantified for welds between non-age-hardening AA5083 and age-hardening AA6082 and compared to single alloy joints made from each of the two constituents. The residual stresses have been characterised non-destructively by neutron diffraction and synchrotron X-ray diffraction. The region around the weld line was characterised by significant tensile residual stress fields which are balanced by compressive stresses in the parent material. The rotation speed of the tool has been found to have a substantially greater influence than the transverse speed on the properties and residual stresses in the welds, particularly on the AA5083 side where the location of the peak stress moves from the stir zone to beyond the edge of the tool shoulder. The changes in residual stress are related to microstructural and hardness changes as determined in a previous study . In particular the larger stresses under the weld tool on the AA5083 side compared to the AA6082 side are related to a transient reduction in yield stress due to dissolution of the hardening precipitates during welding prior to natural aging after welding
Enzymatic Hydrolysis of Alkaline Pretreated Coconut Coir
Directory of Open Access Journals (Sweden)
Akbarningrum Fatmawati
2013-06-01
Full Text Available The purpose of this research is to study the effect of concentration and temperature on the cellulose and lignin content, and the reducing sugars produced in the enzymatic hydrolysis of coconut coir. In this research, the coconut coir is pretreated using 3%, 7%, and 11% NaOH solution at 60oC, 80oC, and 100oC. The pretreated coir were assayed by measuring the amount of cellulose and lignin and then hydrolysed using Celluclast and Novozyme 188 under various temperature (30oC, 40oC, 50oC and pH (3, 4, 5. The hydrolysis results were assayed for the reducing sugar content. The results showed that the alkaline delignification was effective to reduce lignin and to increase the cellulose content of the coir. The best delignification condition was observed at 11% NaOH solution and 100oC which removed 14,53% of lignin and increased the cellulose content up to 50,23%. The best condition of the enzymatic hydrolysis was obtained at 50oC and pH 4 which produced 7,57 gr/L reducing sugar. © 2013 BCREC UNDIP. All rights reservedReceived: 2nd October 2012; Revised: 31st January 2013; Accepted: 6th February 2013[How to Cite: Fatmawati, A., Agustriyanto, R., Liasari, Y. (2013. Enzymatic Hydrolysis of Alkaline Pre-treated Coconut Coir. Bulletin of Chemical Reaction Engineering & Catalysis, 8 (1: 34-39 (doi:10.9767/bcrec.8.1.4048.34-39[Permalink/DOI: http://dx.doi.org/10.9767/bcrec.8.1.4048.34-39] | View in |
Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease
Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi
2008-01-01
AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were different from those of the liver with regard to molecular weight and shape and had greater transmissibility. The infectious activity of fecal AA amyloid fibrils was reduced or abolished by the protein denaturants 6 M guanidine·HCl and formic acid or by AA immunodepletion. Thus, we propose that feces are a vehicle of transmission that may accelerate AA amyloidosis in captive cheetah populations. These results provide a pathogenesis for AA amyloidosis and suggest possible measures for rescuing cheetahs from extinction. PMID:18474855
NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0057 gb|AAS74195.1| 5-HT1A [Drosophila melanogaster] gb|AAS74276.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74292.1| 5-HT1A [Drosophila melanogaster] gb|AAS74298.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74303.1| 5-HT1A [Drosophila melanogaster] gb|AAS74304.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74321.1| 5-HT1A [Drosophila melanogaster] gb|AAS74359.1| 5-HT1A [Drosophila melanogaster] AAS74195.1 1e-176 97% ...
Application of alkaline waterflooding to a high acidity crude oil
Energy Technology Data Exchange (ETDEWEB)
Sayyouh, M.H. (King Sand Univ., Riyadh (SA). Petroleum Engineering Dept.); Abdel-Waly, A.; Osman, A. (Cairo Univ. (EG). Petroleum Engineering Dept.); Awara, A.Z. (Geisum Oil Company, Cairo (EG))
The enhanced recovery of a high acidity crude oil (South Geisum crude) by alkaline solutions is studied. Acidity, interfacial tension, and contact angle, were investigated. Displacement tests were carried out to study the effect of alkaline slug concentration, slug size, oil alkali type, temperature and viscosity on recovery. The interfacial tension between crude oil and formation water decreases with increasing alkaline concentration until a minimum, after which it increases again. Contact angle measurements indicated oil-wetting conditions that increase by the addition of alkaline solutions. At the early stages of displacement, oil recovery increases with increasing alkaline concentration until a maximum at 4% by weight NaOH concentration. Also, at such early stages, an excessive increase in alkaline concentration results in lower oil recovery. On the other hand, after the injection of many pore volumes of water, oil recovery is almost the same regardless of the alkaline concentration. Oil recovery increases with increasing alkaline slug size until a maximum at 15% PV. Sodium hydroxide slugs produce more oil recovery than sodium carbonate slugs. Oil recovery increases with increasing temperature (from 25 to 55{sup 0}C) and decreasing oil viscosity.
Alkaline protease production on date waste by an alkalophilic ...
African Journals Online (AJOL)
STORAGESEVER
2008-05-16
May 16, 2008 ... After 72 h incubation in a shaker incubator ... different incubation times (0 to 72 h) were investigated. Alkaline .... of alkaline protease (75%) and 24% of total protein is precipitated. ... starches and wheat flour as carbon source on protease production .... JP 395, method of making and detergent composition.
A generally applicable sequential alkaline phosphatase immunohistochemical double staining
van der Loos, Chris M.; Teeling, Peter
2008-01-01
A universal type of sequential double alkaline phosphatase immunohistochemical staining is described that can be used for formalin-fixed, paraffin-embedded and cryostat tissue sections from human and mouse origin. It consists of two alkaline phosphatase detection systems including enzymatic
Increased river alkalinization in the Eastern U.S.
Kaushal, Sujay S; Likens, Gene E; Utz, Ryan M; Pace, Michael L; Grese, Melissa; Yepsen, Metthea
2013-09-17
The interaction between human activities and watershed geology is accelerating long-term changes in the carbon cycle of rivers. We evaluated changes in bicarbonate alkalinity, a product of chemical weathering, and tested for long-term trends at 97 sites in the eastern United States draining over 260,000 km(2). We observed statistically significant increasing trends in alkalinity at 62 of the 97 sites, while remaining sites exhibited no significant decreasing trends. Over 50% of study sites also had statistically significant increasing trends in concentrations of calcium (another product of chemical weathering) where data were available. River alkalinization rates were significantly related to watershed carbonate lithology, acid deposition, and topography. These three variables explained ~40% of variation in river alkalinization rates. The strongest predictor of river alkalinization rates was carbonate lithology. The most rapid rates of river alkalinization occurred at sites with highest inputs of acid deposition and highest elevation. The rise of alkalinity in many rivers throughout the Eastern U.S. suggests human-accelerated chemical weathering, in addition to previously documented impacts of mining and land use. Increased river alkalinization has major environmental implications including impacts on water hardness and salinization of drinking water, alterations of air-water exchange of CO2, coastal ocean acidification, and the influence of bicarbonate availability on primary production.
Increasing the alkaline protease activity of Bacillus cereus and ...
African Journals Online (AJOL)
User
2011-05-09
May 9, 2011 ... cereus and Bacillus polymyxa simultaneously with the start of sporulation phase as a ... microbial forms to inactivation by chemical or physical agents. .... alkaline pH, 9, 10 and 11 and the pH of the culture media was optimized with .... incubation temperature for alkaline protease production by Bacillus ...
Production of alkaline protease by Teredinobacter turnirae cells ...
African Journals Online (AJOL)
The conditions for immobilizing the new alkaline protease-producing bacteria strain Teredinobacter turnirae by entrapment in calcium alginate gel were investigated. The influence of alginate concentration (20, 25 and 30 g/l) and initial cell loading (ICL) on enzyme production were studied. The production of alkaline ...
Production of alkaline proteases by alkalophilic Bacillus subtilis ...
African Journals Online (AJOL)
Tuoyo Aghomotsegin
2016-11-23
Nov 23, 2016 ... A new strain of Bacillus sp. was isolated from alkaline soil, which was able to produce extracellular alkaline ... rice and dates (Khosravi-Darani et al., 2008), protein by- products from lather ..... Pigeon pea waste as a novel ...
Comparative Detection of Alkaline Protease Production in Exiguobacterium acetylicum
International Nuclear Information System (INIS)
Gomaa, O.M.; EI Shafey, H.M.
2009-01-01
Alkaline protease is one of the most important enzymes in industry, medicine, and research. In the present work, a comparative detection for alkaline protease activity was established for instant detection of enzyme activity. Eight different alkalophilic bacterial isolates were compared based on the clear zone they produced on skim milk agar. One strain gave an absolute clear zone in 16 hours and was used for alkaline protease detection. The result of Phenotypic identification using Biology Microlog 3 identified the isolate as Exiguobacterium acetylicum. The isolate under study showed slightly different characteristics from a known Exiguobacterium acetylicum strain. The isolate tolerated alkaline conditions up to ph 11, while good growth was evident at ph 7, the maximum alkaline protease activity was observed at ph 9 which reached up to 109.01 U/ml. The alkaline activity assay using alkaline protease enzyme assay were coordinating with those obtained by conductivity; there was a relevant decrease in conductivity at the maximum increase in enzyme activity, which proved the cell membrane conductivity has a close relation to alkaline protease production. This isolate has tolerated gamma radiation, the increase in dose (up to 4 Gy) gave wider clear zones in terms of diameter and this was relevant to the conductivity measurements
Partial purification and characterization of alkaline proteases from ...
African Journals Online (AJOL)
Alkaline proteases from the digestive tract of anchovy were partially purified by ammonium sulfate fractionation, dialysis and Sephadex G-75 gel filtration. The purification fold and yield were 6.23 and 4.49%, respectively. The optimum activities of partially purified alkaline proteases were observed at 60°C and at pH 11.0.
The natural gas - alternative decision for households consumption
International Nuclear Information System (INIS)
Manoilova, T.; Tzaleva, E.; Boshnakova, V.
2002-01-01
Some expectations for households future fuel and energy consumption changes have been presented. The main reasons, motivating the households gasification implementation and its influence over the sectors energy consumption have been analysed. Some improvements of household consumption structure expectation are developed with the view to environment harmful emissions decrease. An example of household natural gas consumption structure by processes is developed. (authors)
Financial accounting as a method of household finance capacity valuation
A. B. Untanov
2017-01-01
The article presents existing household finance capacity investigations. Comparison conducting allowed to determinate collisions and flaws of previous works. That substantiates to find a new approach in household finance capacity valuation necessity. The article contains theoretical research of household finance fundamental categories. In particular, it notes significant difference between domestic and foreign experience of household finance determination. Although emphasizing key similaritie...
Yuan, Zhaoyang; Wen, Yangbing; Kapu, Nuwan Sella
2018-01-01
A sequential two-stage pretreatment process comprising alkaline pre-extraction and alkaline hydrogen peroxide pretreatment (AHP) was investigated to convert bamboo carbohydrates into bioethanol. The results showed that mild alkaline pre-extraction using 8% (w/w) sodium hydroxide (NaOH) at 100°C for 180min followed by AHP pretreatment with 4% (w/w) hydrogen peroxide (H 2 O 2 ) was sufficient to generate a substrate that could be efficiently digested with low enzyme loadings. Moreover, alkali pre-extraction enabled the use of lower H 2 O 2 charges in AHP treatment. Two-stage pretreatment followed by enzymatic hydrolysis with only 9FPU/g cellulose led to the recovery of 87% of the original sugars in the raw feedstock. The use of the pentose-hexose fermenting Saccharomyces cerevisiae SR8u strain enabled the utilization of 95.7% sugars in the hydrolysate to reach 4.6%w/v ethanol titer. The overall process also enabled the recovery of 62.9% lignin and 93.8% silica at high levels of purity. Copyright © 2017 Elsevier Ltd. All rights reserved.
Watanabe, K; Uchida, K; Chambers, J K; Tei, M; Shoji, A; Ushio, N; Nakayama, H
2015-05-01
The incidence of AA amyloidosis is high in humans with rheumatoid arthritis and several animal species, including cats and cattle with prolonged inflammation. AA amyloidosis can be experimentally induced in mice using severe inflammatory stimuli and a coinjection of AA amyloid; however, difficulties have been associated with transmitting AA amyloidosis to a different animal species, and this has been attributed to the "species barrier." The interleukin-1 receptor antagonist knockout (IL-1raKO) mouse, a rodent model of human rheumatoid arthritis, has been used in the transmission of AA amyloid. When IL-1raKO and BALB/c mice were intraperitoneally injected with mouse AA amyloid together with a subcutaneous pretreatment of 2% AgNO3, all mice from both strains that were injected with crude or purified murine AA amyloid developed AA amyloidosis. However, the amyloid index, which was determined by the intensity of AA amyloid deposition, was significantly higher in IL-1raKO mice than in BALB/c mice. When IL-1raKO and BALB/c mice were injected with crude or purified bovine AA amyloid together with the pretreatment, 83% (5/6 cases) and 38% (3/8 cases) of IL-1raKO mice and 17% (1/6 cases) and 0% (0/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. Similarly, when IL-1raKO and BALB/c mice were injected with crude or purified feline AA amyloid, 33% (2/6 cases) and 88% (7/8 cases) of IL-1raKO mice and 0% (0/6 cases) and 29% (2/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. These results indicated that IL-1raKO mice are a useful animal model for investigating AA amyloidogenesis. © The Author(s) 2014.
The effect of irrigated rice cropping on the alkalinity of two alkaline rice soils in the Sahel
Asten, van P.J.A.; Zelfde, van 't J.A.; Zee, van der S.E.A.T.M.; Hammecker, C.
2004-01-01
Irrigated rice cropping is practiced to reclaim alkaline-sodic soils in many parts of the world. This practice is in apparent contrast with earlier studies in the Sahel, which suggests that irrigated rice cropping may lead to the formation of alkaline-sodic soils. Soil column experiments were done
Household Transmission of Vibrio cholerae in Bangladesh.
Directory of Open Access Journals (Sweden)
Jonathan D Sugimoto
2014-11-01
Full Text Available Vibrio cholerae infections cluster in households. This study's objective was to quantify the relative contribution of direct, within-household exposure (for example, via contamination of household food, water, or surfaces to endemic cholera transmission. Quantifying the relative contribution of direct exposure is important for planning effective prevention and control measures.Symptom histories and multiple blood and fecal specimens were prospectively collected from household members of hospital-ascertained cholera cases in Bangladesh from 2001-2006. We estimated the probabilities of cholera transmission through 1 direct exposure within the household and 2 contact with community-based sources of infection. The natural history of cholera infection and covariate effects on transmission were considered. Significant direct transmission (p-value<0.0001 occurred among 1414 members of 364 households. Fecal shedding of O1 El Tor Ogawa was associated with a 4.9% (95% confidence interval: 0.9%-22.8% risk of infection among household contacts through direct exposure during an 11-day infectious period (mean length. The estimated 11-day risk of O1 El Tor Ogawa infection through exposure to community-based sources was 2.5% (0.8%-8.0%. The corresponding estimated risks for O1 El Tor Inaba and O139 infection were 3.7% (0.7%-16.6% and 8.2% (2.1%-27.1% through direct exposure, and 3.4% (1.7%-6.7% and 2.0% (0.5%-7.3% through community-based exposure. Children under 5 years-old were at elevated risk of infection. Limitations of the study may have led to an underestimation of the true risk of cholera infection. For instance, available covariate data may have incompletely characterized levels of pre-existing immunity to cholera infection. Transmission via direct exposure occurring outside of the household was not considered.Direct exposure contributes substantially to endemic transmission of symptomatic cholera in an urban setting. We provide the first estimate of
Household activity-travel behavior : implementation of within-household interactions
Anggraini, R.
2009-01-01
Although the importance of households as a decision making unit has been recognized in seminal work in activity-based analysis of transport demand, most comprehensivemodels have relied on individual activity-travel patterns. The transformation of thesemodels to household level models and the
Linnekamp, F.; Koedam, A.; Baud, I.S.A.
2011-01-01
The article examines household perceptions of flooding as part of climate change in two low elevation coastal zone cities in the Caribbean. The research examines differences in vulnerability of households as the combined results of socio-economic inequalities in entitlements and exposure to natural
HOUSEHOLD EXPENDITURE IN RESPONSE TO NATURAL DISASTERS
Directory of Open Access Journals (Sweden)
Eny Sulistyaningrum
2015-09-01
Full Text Available Natural disasters have increased in their frequency, and the intensity of their destruction over the last ten years in Indonesia. Households usually respond to these difficulties by cutting their consump-tion, especially for non-essential goods. Arguably natural disasters are exogenous events, so this paper uses the exogenous variation from natural disasters as a natural experiment design to estimate the effect of disasters on household expenditure. When a certain group is exposed to the causal variable of interest, such as a disaster, and other groups are not, the Difference In Difference model (DID can be used for estimation. Using a micro level survey data set from the Indonesian Family Life Survey (IFLS which covers approximately 83 percent of the Indonesian population within the survey area, this paper examines the effects of natural disasters on household expenditure. This paper also examines whether there are any different impacts from different types of disasters. The finding is there are no significant effects of disasters on total household expenditure for households living in disaster regions, whether they are affected directly or not by the disaster.
Exploring the link between household debt and income inequality
DEFF Research Database (Denmark)
Fasianos, Apostolos; Raza, Hamid; Kinsella, Stephen
2017-01-01
We investigate the relationship between household debt and income inequality in the USA, allowing for asymmetry, using data over the period 1913–2008. We find evidence of an asymmetric cointegration between household debt and inequality for different regimes. Our results indicate household debt...... only responds to positive changes in income inequality, while there is no evidence of falling inequality significantly affecting household debt. The presence of this asymmetry provides further empirical insights into the emerging literature on household debt and inequality....
Churg-Strauss syndrome associated with AA amyloidosis: a case ...
African Journals Online (AJOL)
Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/μL), positive ...
Slot-type pickup/kicker for AA stochastic cooling
CERN PhotoLab
1979-01-01
A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. See also 7906190, 7906193.
Systemic AA amyloidosis in the red fox (Vulpes vulpes).
Rising, Anna; Cederlund, Ella; Palmberg, Carina; Uhlhorn, Henrik; Gaunitz, Stefan; Nordling, Kerstin; Ågren, Erik; Ihse, Elisabet; Westermark, Gunilla T; Tjernberg, Lars; Jörnvall, Hans; Johansson, Jan; Westermark, Per
2017-11-01
Amyloid A (AA) amyloidosis occurs spontaneously in many mammals and birds, but the prevalence varies considerably among different species, and even among subgroups of the same species. The Blue fox and the Gray fox seem to be resistant to the development of AA amyloidosis, while Island foxes have a high prevalence of the disease. Herein, we report on the identification of AA amyloidosis in the Red fox (Vulpes vulpes). Edman degradation and tandem MS analysis of proteolyzed amyloid protein revealed that the amyloid partly was composed of full-length SAA. Its amino acid sequence was determined and found to consist of 111 amino acid residues. Based on inter-species sequence comparisons we found four residue exchanges (Ser31, Lys63, Leu71, Lys72) between the Red and Blue fox SAAs. Lys63 seems unique to the Red fox SAA. We found no obvious explanation to how these exchanges might correlate with the reported differences in SAA amyloidogenicity. Furthermore, in contrast to fibrils from many other mammalian species, the isolated amyloid fibrils from Red fox did not seed AA amyloidosis in a mouse model. © 2017 The Protein Society.
Making ET AAS Determination Less Dependent on Vapourization ...
African Journals Online (AJOL)
NICO
The quantification of the analytes in ET AAS is normally attained by the measurement and integration of transient absorbance. High degree of atomization and constant vapour transportation rate for the analyte atoms in the absorption volume are considered to be crucial to grant correctness of the measurements. However ...
Three body abrasion of laser surface alloyed aluminium AA1200
CSIR Research Space (South Africa)
Mabhali, Luyolo AB
2012-06-01
Full Text Available Laser surface alloying of aluminium AA1200 was performed with a 4 kW Nd:YAG laser to improve the abrasion wear resistance. Aluminium surfaces reinforced with metal matrix composites and intermetallic phases were achieved. The phases present depended...
Contribution to comprehensive study of aluminium alloy Aa 5083 ...
African Journals Online (AJOL)
PROMOTING ACCESS TO AFRICAN RESEARCH ... Corrosion induced by elemental mercury in aqueous media of industrial Aluminium alloys AA5083 used in heat exchanger industries of natural gas liquefaction has been studied by linear sweep voltammétry on ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
The effect of atmospheric corona treatment on AA1050 aluminium
DEFF Research Database (Denmark)
Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.
2010-01-01
The effect of atmospheric corona discharge on AM 050 aluminium surface was investigated using electrochemical polarization, SEM-EDX, FIB-SEM. and XPS. The corona treatment was performed with varying time (1, 5, and 15 min) in atmospheric air. A 200 nm oxide layer was generated on AA1050 after...
Backend solutions for AA in the MUSE network supporting FMC
Neerbos, A.N.R. van; Prins, M.; Melander, B.; Pimilla Larrucea, I.; Thakur, M.J.; Fredricx, F.
2007-01-01
The European MUSE project investigated fixed-mobile convergence from the perspective of an unbundled fixed network. A major part of the work consisted of finding solutions for the authentication and authorisation of users who roam from their home network to a visited network. This paper shows how AA
Naghipour, Dariush; Ashrafi, Seyed Davoud; Mojtahedi, Ali; Vatandoost, Masoud; Hosseinzadeh, Loghman; Roohbakhsh, Esmail
2018-02-01
In this research, we measured various parameters related to drinking water quality include turbidity, temperature, pH, EC, TDS, Alkalinity, fecal and total coliform, heterotrophic plate count (HPC), free chlorine, Mn, Ca, Mg, Fe, Na, Cl - , F - , HCO 3 , in the inlet and outlet of household water treatment devices according to the standard methods for the examination of water and wastewater (W.E. Federation and Association and A.P.H., 2005) [1]. Sixty four inlet and outlet water samples were taken from thirty two household water treatment devices from eight different residential blocks in Golsar town of Rasht, Iran. The data obtained from experiments were analyzed using the software Special Package for Social Sciences (SPSS 24) and MS-Excel.
Stock Market Expectations of Dutch Households.
Hurd, Michael; van Rooij, Maarten; Winter, Joachim
2011-04-01
Despite its importance for the analysis of life-cycle behavior and, in particular, retirement planning, stock ownership by private households is poorly understood. Among other approaches to investigate this puzzle, recent research has started to elicit private households' expectations of stock market returns. This paper reports findings from a study that collected data over a two-year period both on households' stock market expectations (subjective probabilities of gains or losses) and on whether they own stocks. We document substantial heterogeneity in financial market expectations. Expectations are correlated with stock ownership. Over the two years of our data, stock market prices increased, and expectations of future stock market price changes also increased, lending support to the view that expectations are influenced by recent stock gains or losses.
Electricity savings in households with everyday IT
DEFF Research Database (Denmark)
Kibsgaard, Kaj; Larsen, Anders; leth, Søren
This paper analyzes the effect of supplying online feedback by SMS-text messages and email about electricity consumption on the level of total household electricity consumption. An experiment was conducted where 1,452 households were randomly allocated to three experimental groups and two control...... groups. Feedback was supplied throughout 2007 to members of the experiment groups who accepted the invitation, and data on consumption of electricity for 2006 and 2007 collected for all participants and control group members. 30% of the households invited to receive feedback accepted the invitation....... The estimated effects of the feedback on consumption of electricity are estimated to be in the range of 2-3%. The feedback technology is cheap to implement and therefore likely to be cost-effective...
Household food waste in Nordic countries
DEFF Research Database (Denmark)
Gjerris, Mickey; Gaiani, Silvia
2013-01-01
such as climate change and unjust distribution of food resources, needs to be based on an appreciative and relational understanding of nature and food and not only on economic and moralizing arguments. This is done by drawing on an ecocentric perspective where food is seen as one of the areas where new narratives......This study focuses on food waste generated by households in four Nordic countries: Finland, Denmark, Norway, and Sweden. Based on existing literature we present (A) comparable data on amounts and monetary value of food waste; (B) explanations for food waste at household level; (C) a number...... of public and private initiatives at national levels aiming to reduce food waste; and (D) a discussion of ethical issues related to food waste with a focus on possible contributions from ecocentric ethics. We argue that reduction of food waste at household level, which has an impact on issues...
Household's use of information and communication technologies
DEFF Research Database (Denmark)
Jensen, Jesper Ole; Gram-Hanssen, Kirsten; Røpke, Inge
2009-01-01
of theories of domestication of technologies, it is argued that aspects such as consumers' creativity in technology use and their non-adaption are relevant aspects to include in policy and regulation discussions on how to limit the escalating electricity consumption from household ICT use.......Increasing consumption of electricity due to a growing number of information and communication technology (ICT) appliances in households is a major challenge to reducing energy consumption. Several studies have predicted escalating ICT-related energy consumption, but relatively little has been said...... and done about possible initiatives to curb this increase. This paper presents results of a research project focusing on how dynamics of consumption influence household energy consumption on ICT. Results of the project include scenarios on how electricity consumption on ICT is expected to grow, suggesting...
Household batteries: Evaluation of collection methods
Energy Technology Data Exchange (ETDEWEB)
Seeberger, D.A.
1992-12-31
While it is difficult to prove that a specific material is causing contamination in a landfill, tests have been conducted at waste-to-energy facilities that indicate that household batteries contribute significant amounts of heavy metals to both air emissions and ash residue. Hennepin County, MN, used a dual approach for developing and implementing a special household battery collection. Alternative collection methods were examined; test collections were conducted. The second phase examined operating and disposal policy issues. This report describes the results of the grant project, moving from a broad examination of the construction and content of batteries, to a description of the pilot collection programs, and ending with a discussion of variables affecting the cost and operation of a comprehensive battery collection program. Three out-of-state companies (PA, NY) were found that accept spent batteries; difficulties in reclaiming household batteries are discussed.
Household batteries: Evaluation of collection methods
Energy Technology Data Exchange (ETDEWEB)
Seeberger, D.A.
1992-01-01
While it is difficult to prove that a specific material is causing contamination in a landfill, tests have been conducted at waste-to-energy facilities that indicate that household batteries contribute significant amounts of heavy metals to both air emissions and ash residue. Hennepin County, MN, used a dual approach for developing and implementing a special household battery collection. Alternative collection methods were examined; test collections were conducted. The second phase examined operating and disposal policy issues. This report describes the results of the grant project, moving from a broad examination of the construction and content of batteries, to a description of the pilot collection programs, and ending with a discussion of variables affecting the cost and operation of a comprehensive battery collection program. Three out-of-state companies (PA, NY) were found that accept spent batteries; difficulties in reclaiming household batteries are discussed.
Organic household waste - incineration or recycling
International Nuclear Information System (INIS)
2003-01-01
The Danish Environmental Protection Agency has carried out a cost benefit analysis of the consequences of increasing recycling of organic household waste. In the cost benefit analysis both the economic consequences for the affected parties and the welfare-economic consequences for the society as a whole have been investigated. In the welfare-economic analysis the value of the environmental effects has been included. The analysis shows that it is more expensive for the society to recycle organic household waste by anaerobic digestion or central composting than by incineration. Incineration is the cheapest solution for the society, while central composting is the most expensive. Furthermore, technical studies have shown that there are only small environmental benefits connected with anaerobic digestion of organic waste compared with incineration of the waste. The primary reason for recycling being more expensive than incineration is the necessary, but cost-intensive, dual collection of the household waste. Treatment itself is cheaper for recycling compared to incinerating. (BA)
A Status Report on the AAS Astronomy Ambassadors Program
Fienberg, Richard Tresch; Fraknoi, Andrew; Gurton, Suzanne; Hurst, Anna; Schatz, Dennis L.
2014-06-01
The American Astronomical Society, in partnership with the Astronomical Society of the Pacific (ASP), has launched a series of professional-development workshops and a community of practice designed to improve early-career astronomers’ ability to communicate effectively with students and the public. Called AAS Astronomy Ambassadors, the program provides training and mentoring for young astronomers, from advanced undergraduates to beginning faculty; it also provides them access to resources and a network of contacts within the astronomy education and public outreach (EPO) community. Ambassadors are provided with a library of outreach activities and resource materials suitable for a range of venues and audiences. For much of this library we are using resources developed by organizations such as the ASP, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. After a period of evaluation and revision, the program’s “Menu of Outreach Opportunities for Science Education” (MOOSE) is now posted on the AAS website at http://aas.org/outreach/moose-menu-outreach-opportunities-science-education.The first two Astronomy Ambassadors workshops were held at AAS meetings in January 2013 and January 2014; each served 30 young astronomers chosen from about twice that many applicants. Web-based follow-up activities are being provided through a website at the ASP designed to keep cohorts of educators trained in their programs in touch with one another. The AAS is exploring ways to fund additional workshops at future winter meetings; suggestions are most welcome. Meanwhile, the Astronomy Ambassadors trained to date have logged more than 150 outreach events, reaching many thousands of children and adults across the U.S. and Canada.
Targeting antibiotics to households for trachoma control.
Directory of Open Access Journals (Sweden)
Isobel M Blake
2010-11-01
Full Text Available Mass drug administration (MDA is part of the current trachoma control strategy, but it can be costly and results in many uninfected individuals receiving treatment. Here we explore whether alternative, targeted approaches are effective antibiotic-sparing strategies.We analysed data on the prevalence of ocular infection with Chlamydia trachomatis and of active trachoma disease among 4,436 individuals from two communities in The Gambia (West Africa and two communities in Tanzania (East Africa. An age- and household-structured mathematical model of transmission was fitted to these data using maximum likelihood. The presence of active inflammatory disease as a marker of infection in a household was, in general, significantly more sensitive (between 79% [95%CI: 60%-92%] and 86% [71%-95%] across the four communities than as a marker of infection in an individual (24% [16%-33%]-66% [56%-76%]. Model simulations, under the best fit models for each community, showed that targeting treatment to households has the potential to be as effective as and significantly more cost-effective than mass treatment when antibiotics are not donated. The cost (2007US$ per incident infection averted ranged from 1.5 to 3.1 for MDA, from 1.0 to 1.7 for household-targeted treatment assuming equivalent coverage, and from 0.4 to 1.7 if household visits increased treatment coverage to 100% in selected households. Assuming antibiotics were donated, MDA was predicted to be more cost-effective unless opportunity costs incurred by individuals collecting antibiotics were included or household visits improved treatment uptake. Limiting MDA to children was not as effective in reducing infection as the other aforementioned distribution strategies.Our model suggests that targeting antibiotics to households with active trachoma has the potential to be a cost-effective trachoma control measure, but further work is required to assess if costs can be reduced and to what extent the approach
Childbirth in aristocratic households of Heian Japan.
Andreeva, Anna
2014-01-01
This paper focuses on childbirth in Japan's aristocratic households during the Heian period (794-1185). Drawing on various sources, including court diaries, visual sources, literary records, and Japan's first medical collection, with its assortment of gynaecological and obstetric prescriptions, as well as Buddhist and other ritual texts, this short excursion into the cultural history of childbirth offers an insight into how childbirth was experienced and managed in Heian Japan. In particular, it addresses the variety of ideas, knowledge systems and professionals involved in framing and supporting the process of childbirth in elite households. In so doing, it casts light on the complex background of early Japanese medicine and healthcare for women.
Energy consumption characteristics of Guatemalan households
International Nuclear Information System (INIS)
Mansilla, C.; Moscoso, M.R.
1991-01-01
The sectoral consumption pattern in Guatemala has shown that the residential sector is the major energy consumer. It accounts for 68.9 per cent of total consumption, followed by the transportation sector with 16.6 per cent, and the industrial sector with 9.3 per cent. Because of the importance of the household sector in the national energy balance, the Energy Planning Project carried out a nationwide household survey in 1985 to estimate energy-use patterns. This paper focusses on the findings from the analysis of the 2,500 forms completed during that survey. 4 figs, 1 tab
Recent advances of pyrethroids for household use.
Ujihara, Kazuya; Mori, Tatsuya; Matsuo, Noritada
2012-01-01
Development of pyrethroids for household use and recent advances in the syntheses of (1R)-trans-chrysanthemic acid, the acid moiety of most of the household pyrethroids, are reviewed. As another important acid moiety, we discovered norchrysanthemic acid to have a significant vapor action at room temperature when esterified with fluorobenzyl alcohols. In particular, 2,3,5,6-tetrafluoro-4-methoxymethylbenzyl (1R)-trans-norchrysanthemate (metofluthrin) exhibits the highest potency in mosquito coil formulations as well as the vapor action at room temperature against various mosquitoes. Structure-activity relationships of norchrysanthemic acid esters and synthetic studies of norchrysanthemic acid are discussed.
Individual welfare analysis for collective households
DEFF Research Database (Denmark)
Cherchye, Laurens; Cosaert, Sam; de Rock, Bram
We propose novel tools for the analysis of individual welfare on the basis of aggregate household demand behavior. The method assumes a collective model of household consumption with the public and private nature of goods specified by the empirical analyst. A main distinguishing feature of our......-to-pay for public consumption (i.e. Lindahl prices). The method is easy to use in practice and yields informative empirical results, which we demonstrate through a simulation analysis and an empirical application to labor supply data....
Household and Small Business Across the Disciplines
Directory of Open Access Journals (Sweden)
Nicoletta Stame
2015-08-01
Full Text Available Households, which are seen as income pooling units (Wallerstein, Martin, Dickinson 1982, play a crucial role in the world-system analysis. Individuals enjoy income that accrues to their households, a unit embedded in a network of different social relationships among people, kin or not kin, living under the same roof or sharing some important living function. Thus, social relations are seen as ways of obtaining different types of income (wages, rent, pro?t, social exchange, gifts and ways of ensuring different welfare services.
2nd Generation alkaline electrolysis. Final report
Energy Technology Data Exchange (ETDEWEB)
Yde, L. [Aarhus Univ. Business and Social Science - Centre for Energy Technologies (CET), Aarhus (Denmark); Kjartansdottir, C.K. [Technical Univ. of Denmark. DTU Mechanical Engineering, Kgs. Lyngby (Denmark); Allebrod, F. [Technical Univ. of Denmark. DTU Energy Conversion, DTU Risoe Campus, Roskilde (Denmark)] [and others
2013-03-15
The overall purpose of this project has been to contribute to this load management by developing a 2{sup nd} generation of alkaline electrolysis system characterized by being compact, reliable, inexpensive and energy efficient. The specific targets for the project have been to: 1) Increase cell efficiency to more than 88% (according to the higher heating value (HHV)) at a current density of 200 mA /cm{sup 2}; 2) Increase operation temperature to more than 100 degree Celsius to make the cooling energy more valuable; 3) Obtain an operation pressure more than 30 bar hereby minimizing the need for further compression of hydrogen for storage; 4) Improve stack architecture decreasing the price of the stack with at least 50%; 5) Develop a modular design making it easy to customize plants in the size from 20 to 200 kW; 6) Demonstrating a 20 kW 2{sup nd} generation stack in H2College at the campus of Arhus University in Herning. The project has included research and development on three different technology tracks of electrodes; an electrochemical plating, an atmospheric plasma spray (APS) and finally a high temperature and pressure (HTP) track with operating temperature around 250 deg. C and pressure around 40 bar. The results show that all three electrode tracks have reached high energy efficiencies. In the electrochemical plating track a stack efficiency of 86.5% at a current density of 177mA/cm{sup 2} and a temperature of 74.4 deg. C has been shown. The APS track showed cell efficiencies of 97%, however, coatings for the anode side still need to be developed. The HTP cell has reached 100 % electric efficiency operating at 1.5 V (the thermoneutral voltage) with a current density of 1. 1 A/cm{sup 2}. This track only tested small cells in an externally heated laboratory set-up, and thus the thermal loss to surroundings cannot be given. The goal set for the 2{sup nd} generation electrolyser system, has been to generate 30 bar pressure in the cell stack. An obstacle to be
Alkaline fuel cell with nitride membrane
Sun, Shen-Huei; Pilaski, Moritz; Wartmann, Jens; Letzkus, Florian; Funke, Benedikt; Dura, Georg; Heinzel, Angelika
2017-06-01
The aim of this work is to fabricate patterned nitride membranes with Si-MEMS-technology as a platform to build up new membrane-electrode-assemblies (MEA) for alkaline fuel cell applications. Two 6-inch wafer processes based on chemical vapor deposition (CVD) were developed for the fabrication of separated nitride membranes with a nitride thickness up to 1 μm. The mechanical stability of the perforated nitride membrane has been adjusted in both processes either by embedding of subsequent ion implantation step or by optimizing the deposition process parameters. A nearly 100% yield of separated membranes of each deposition process was achieved with layer thickness from 150 nm to 1 μm and micro-channel pattern width of 1μm at a pitch of 3 μm. The process for membrane coating with electrolyte materials could be verified to build up MEA. Uniform membrane coating with channel filling was achieved after the optimization of speed controlled dip-coating method and the selection of dimethylsulfoxide (DMSO) as electrolyte solvent. Finally, silver as conductive material was defined for printing a conductive layer onto the MEA by Ink-Technology. With the established IR-thermography setup, characterizations of MEAs in terms of catalytic conversion were performed successfully. The results of this work show promise for build up a platform on wafer-level for high throughput experiments.
Reduction of proteinuria through podocyte alkalinization.
Altintas, Mehmet M; Moriwaki, Kumiko; Wei, Changli; Möller, Clemens C; Flesche, Jan; Li, Jing; Yaddanapudi, Suma; Faridi, Mohd Hafeez; Gödel, Markus; Huber, Tobias B; Preston, Richard A; Jiang, Jean X; Kerjaschki, Dontscho; Sever, Sanja; Reiser, Jochen
2014-06-20
Podocytes are highly differentiated cells and critical elements for the filtration barrier of the kidney. Loss of their foot process (FP) architecture (FP effacement) results in urinary protein loss. Here we show a novel role for the neutral amino acid glutamine in structural and functional regulation of the kidney filtration barrier. Metabolic flux analysis of cultured podocytes using genetic, toxic, and immunologic injury models identified increased glutamine utilization pathways. We show that glutamine uptake is increased in diseased podocytes to couple nutrient support to increased demand during the disease state of FP effacement. This feature can be utilized to transport increased amounts of glutamine into damaged podocytes. The availability of glutamine determines the regulation of podocyte intracellular pH (pHi). Podocyte alkalinization reduces cytosolic cathepsin L protease activity and protects the podocyte cytoskeleton. Podocyte glutamine supplementation reduces proteinuria in LPS-treated mice, whereas acidification increases glomerular injury. In summary, our data provide a metabolic opportunity to combat urinary protein loss through modulation of podocyte amino acid utilization and pHi. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.
Alkaline phosphatase activity of rumen bacteria.
Cheng, K J; Costerton, J W
1977-11-01
Of the 54 strains of rumen bacteria examined for alkaline phosphatase (APase) production, 9 of 33 gram-negative strains and none of 21 gram-positive strains produced the enzyme. The APase of the cells of the three strains of Bacteroides ruminicola that produced significant amounts of the enzyme was located in the periplasmic area of the cell envelope, whereas the enzyme was located in the strains of Selenomonas ruminantium and Succinivibrio dextrinosolvens was associated with the outer membrane. The localization of APase production in the cells of natural populations of rumen bacteria from hay-fed sheep was accomplished by reaction product deposition, and both the proportion of APase-producing bacteria and the location of the enzyme in the cell envelope of the producing cells could be determined. We suggest that this procedure is useful in detecting shifts in the bacterial population and the release of cell-bound APase that accompany feedlot bloat and other sequelae of dietary manipulation in ruminants.
Identification of human pulmonary alkaline phosphatase isoenzymes.
Capelli, A; Cerutti, C G; Lusuardi, M; Donner, C F
1997-04-01
An increase of alkaline phosphatase (ALP) activity has been observed in the bronchoalveolar lavage fluid (BALF) of patients affected by pulmonary fibrosis in chronic interstitial lung disorders. To characterize the ALP isoenzymes in such cases, we used gel filtration, agarose gel electrophoresis, heat and amino acid inhibition assays, wheat-germ agglutinin (WGA) precipitation, and an immunoassay specific for the bone-isoform of ALP. Only one anodic band representing a high-molecular-weight isoform of ALP (Mr approximately 2,000 kDa) was observed on electrophoresis of BALF. The inhibition assay results were consistent for a tissue-nonspecific isoenzyme sensitive to a temperature of 56 degrees C (71.9 +/- 2.5% inhibition) and to homoarginine (65.7 +/- 1.9%), and resistant to L-phenylalanine and L-leucine. Less than 13% of ALP activity was heat-stable. After incubation of BALF specimens with glycosyl-phosphatidylinositol-phospholipase D plus Nonidet P-40, or with phosphatidylinositol-phospholipase C alone, an electrophoretic cathodic band (Mr approximately 220 kDa) appeared near the bone band of a standard serum. With the WGA assay, 84.4 +/- 3.3% of ALP precipitated and the band disappeared. After immunoassay for the bone isoform, a mean of less than 5% enzyme activity was measured. We conclude that the ALP found in BALF is a pulmonary isoform of a tissue nonspecific isoenzyme.
Response of Desulfovibrio vulgaris to Alkaline Stress
Energy Technology Data Exchange (ETDEWEB)
Stolyar, S.; He, Q.; He, Z.; Yang, Z.; Borglin, S.E.; Joyner, D.; Huang, K.; Alm, E.; Hazen, T.C.; Zhou, J.; Wall, J.D.; Arkin, A.P.; Stahl, D.A.
2007-11-30
The response of exponentially growing Desulfovibrio vulgarisHildenborough to pH 10 stress was studied using oligonucleotidemicroarrays and a study set of mutants with genes suggested by microarraydata to be involved in the alkaline stress response deleted. The datashowed that the response of D. vulgaris to increased pH is generallysimilar to that of Escherichia coli but is apparently controlled byunique regulatory circuits since the alternative sigma factors (sigma Sand sigma E) contributing to this stress response in E. coli appear to beabsent in D. vulgaris. Genes previously reported to be up-regulated in E.coli were up-regulated in D. vulgaris; these genes included three ATPasegenes and a tryptophan synthase gene. Transcription of chaperone andprotease genes (encoding ATP-dependent Clp and La proteases and DnaK) wasalso elevated in D. vulgaris. As in E. coli, genes involved in flagellumsynthesis were down-regulated. The transcriptional data also identifiedregulators, distinct from sigma S and sigma E, that are likely part of aD. vulgaris Hildenborough-specific stress response system.Characterization of a study set of mutants with genes implicated inalkaline stress response deleted confirmed that there was protectiveinvolvement of the sodium/proton antiporter NhaC-2, tryptophanase A, andtwo putative regulators/histidine kinases (DVU0331 andDVU2580).
Solubility of pllutonium in alkaline salt solutions
International Nuclear Information System (INIS)
Hobbs, D.T.; Edwards, T.B.
1993-01-01
Plutonium solubility data from several studies have been evaluated. For each data set, a predictive model has been developed where appropriate. In addition, a statistical model and corresponding prediction intervals for plutonium solubility as a quadratic function of the hydroxide concentration have been developed. Because of the wide range of solution compositions, the solubility of plutonium can vary by as much as three orders of magnitude for any given hydroxide concentration and still remain within the prediction interval. Any nuclear safety assessments that depend on the maximum amount of plutonium dissolved in alkaline salt solutions should use concentrations at least as great as the upper prediction limits developed in this study. To increase the confidence in the prediction model, it is recommended that additional solubility tests be conducted at low hydroxide concentrations and with all of the other solution components involved. To validate the model for application to actual waste solutions, it is recommended that the plutonium solubilities in actual waste solutions be determined and compared to the values predicted by the quadratic model
Alkaline Materials and Regenerative Endodontics: A Review
Directory of Open Access Journals (Sweden)
Bill Kahler
2017-12-01
Full Text Available Periapical health is the primary goal of endodontic treatment in mature and immature teeth. In addition, the goals of treatment of immature teeth with arrested root development include root growth to length and maturation of the apex, as well as thickening of the canal wall. These goals are valid for immature teeth that have been subjected to trauma and dental caries or that are the result of developmental anomalies that expose the tooth to the risk of pulp necrosis and consequently result in the cessation of root maturation. Regenerative endodontic procedures (REPs have been described as a “paradigm shift” in the treatment of immature teeth with pulp necrosis and underdeveloped roots, as there is the potential for further root maturation and return of vitality. Treatment with REPs is advocated as the treatment of choice for immature teeth with pulp necrosis. REP protocols involve the use of alkaline biomaterials, primarily sodium hypochlorite, calcium hydroxide, mineral trioxide aggregates and Biodentine, and are the essential components of a successful treatment regimen.
Alkaline Phosphatase, an Unconventional Immune Protein
Directory of Open Access Journals (Sweden)
Bethany A. Rader
2017-08-01
Full Text Available Recent years have seen an increase in the number of studies focusing on alkaline phosphatases (APs, revealing an expanding complexity of function of these enzymes. Of the four human AP (hAP proteins, most is known about tissue non-specific AP (TNAP and intestinal AP (IAP. This review highlights current understanding of TNAP and IAP in relation to human health and disease. TNAP plays a role in multiple processes, including bone mineralization, vitamin B6 metabolism, and neurogenesis, is the genetic cause of hypophosphatasia, influences inflammation through regulation of purinergic signaling, and has been implicated in Alzheimer’s disease. IAP regulates fatty acid absorption and has been implicated in the regulation of diet-induced obesity and metabolic syndrome. IAP and TNAP can dephosphorylate bacterial-derived lipopolysaccharide, and IAP has been identified as a potential regulator of the composition of the intestinal microbiome, an evolutionarily conserved function. Endogenous and recombinant bovine APs and recombinant hAPs are currently being explored for their potential as pharmacological agents to treat AP-associated diseases and mitigate multiple sources of inflammation. Continued research on these versatile proteins will undoubtedly provide insight into human pathophysiology, biochemistry, and the human holobiont.
Dynamic Response and Microstructure Evolution of AA2219-T4 and AA2219-T6 Aluminum Alloys
Olasumboye, A.; Owolabi, G.; Odeshi, A.; Zeytinci, A.; Yilmaz, N.
2018-02-01
In this study, the dynamic deformation behavior of AA2219 aluminum alloy was investigated in two different temper conditions: T4 and T6, with a view to determining the effect of heat treatment on the microstructure and flow behavior of the material under high strain rates. Split Hopkinson pressure bar experiment was used in determining the dynamic response of the alloy while a digital image correlation system was employed in visualizing and tracking the surface deformation of the specimens. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. The results obtained showed heterogeneous deformation of the alloy in the two temper conditions. It was observed that the dynamic mechanical behavior of each sample preparation was dependent on its strength properties due to aging type, which in turn controls the metamorphosis of the strengthening precipitates and the initial microstructure. At the maximum strain rate of 3500 s-1, transformed bands leading to crack nucleation was observed in the AA2219-T4 aluminum alloy while AA2219-T6 had fractured at the same strain rate. The modes of crack formation and growth in the two alloys were found to be similar: nucleation, growth and coalescence of voids. However, shear band bifurcation phenomenon was observed only in the AA2219-T6 alloy.
Study of the corrosion of AA 6061 in spent fuel materials
International Nuclear Information System (INIS)
Rodriguez, Sebastian; Haddad, Roberto; Lanzani, Liliana A.
2003-01-01
Localized attack induced by dust or other particles deposited on alloy AA 6061 surface under water has been addressed as a matter of concern after completion of an IAEA Coordinated Research Program (CRP) on the corrosion of aluminum clad spent fuel during storage in water basins. This attack has been observed in all kinds of waters, although it is more pronounced in those of higher conductivity. In these cases a strong attack (similar to pitting corrosion) up to several hundred microns in depth and about a millimeter in length has been found beneath the aluminum hydroxide blister formed in those places where specks had seated on. As this problem could seriously affect the fission product containing capacity of stored spent fuel even in well maintained high quality water, it is important to learn about the involved mechanism of attack and find out about the influence of particle composition, in order to establish the convenience or disapproval of the use of materials and procedures in storage basins. With this objective, an experimental approach has been developed to study the mechanism of corrosion attack linked with the deposition of particles of different composition on aluminum surfaces; this include two kinds of iron flakes, concrete powder, and sand particles. Immersion tests of up to 40 days have been conducted in nuclear grade demineralized water and sodium citrate solutions of several conductivities. The position of sediments was marked and followed through the process and the final state of the aluminum surfaces was assessed by optical and electron microscopy and other microanalysis techniques. Other complementary activities carried on in relation with this work are: through characterization of intermetallic particles in AA 6061, and the study of the electrochemical behavior of precipitates in high purity water. Mg 2 Si particles perform very actively, dissolving even in high pure water at open circuit potential, leaving a small hole on the surface. Iron
The aluminum chemistry and corrosion in alkaline solutions
International Nuclear Information System (INIS)
Zhang Jinsuo; Klasky, Marc; Letellier, Bruce C.
2009-01-01
Aluminum-alkaline solution systems are very common in engineering applications including nuclear engineering. Consequently, a thorough knowledge of the chemistry of aluminum and susceptibility to corrosion in alkaline solutions is reviewed. The aluminum corrosion mechanism and corrosion rate are examined based on current experimental data. A review of the phase transitions with aging time and change of environment is also performed. Particular attention is given to effect of organic and inorganic ions. As an example, the effect of boron is examined in detail because of the application in nuclear reactor power systems. Methods on how to reduce the corrosion rate of aluminum in alkaline solutions are also highlighted
ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GTGMKSFLEKLDEATKEFETQYKKWINDRREAIKKQRENEKLQKWNEISNIFKSDGVELNRDAQTPCIPEHLVEGFEESNESEDLSEIDQIEQVMLNPKGRLNFV* ... ch_oct10_gene_aa_db Chro.50191 >Chro.50191 hypothetical protein MSNSFLRDLKFVGVSSFL
Food waste from Danish households: Generation and composition
DEFF Research Database (Denmark)
Edjabou, Maklawe Essonanawe; Petersen, Claus; Scheutz, Charlotte
2016-01-01
Sustainable solutions for reducing food waste require a good understanding of food waste generation and composition, including avoidable and unavoidable food waste. We analysed 12 tonnes of residual household waste collected from 1474 households, without source segregation of organic waste. Food...... waste was divided into six fractions according to avoidability, suitability for home-composting and whether or not it was cooked, prepared or had been served within the household. The results showed that the residual household waste generation rate was 434 ± 18 kg per household per year, of which 183...... ± 10 kg per year was food waste. Unavoidable food waste amounted to 80 ± 6 kg per household per year, and avoidable food waste was 103 ± 9 kg per household per year. Food waste mass was influenced significantly by the number of occupants per household (household size) and the housing type. The results...
NCBI nr-aa BLAST: CBRC-DDIS-01-0111 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-01-0111 ref|NP_060837.2| phytoceramidase, alkaline [Homo sapiens] ref|XP_...001175032.1| PREDICTED: phytoceramidase, alkaline isoform 3 [Pan troglodytes] sp|Q9NUN7|APHC_HUMAN Alkaline ...phytoceramidase (aPHC) (Alkaline ceramidase) (Alkaline dihydroceramidase SB89) gb|AAK71923.1|AF214454_1 alkali...ne phytoceramidase [Homo sapiens] gb|AAL56013.1|AF327353_1 alkaline dihydrocera...midase SB89 [Homo sapiens] gb|AAH73853.1| Phytoceramidase, alkaline [Homo sapiens] gb|EAW75010.1| phytoceramidase, alkaline, isoform CRA_b [Homo sapiens] NP_060837.2 3e-23 29% ...
Energy Technology Data Exchange (ETDEWEB)
Bigum, Marianne, E-mail: mkkb@env.dtu.dk [Technical University of Denmark, Department of Environmental Engineering, Miljøvej 113, 2500 Kgs. Lyngby (Denmark); Petersen, Claus, E-mail: claus_petersen@econet.dk [Econet A/S, Strandboulevarden 122, 5, 2100 København Ø (Denmark); Christensen, Thomas H., E-mail: thho@env.dtu.dk [Technical University of Denmark, Department of Environmental Engineering, Miljøvej 113, 2500 Kgs. Lyngby (Denmark); Scheutz, Charlotte, E-mail: chas@env.dtu.dk [Technical University of Denmark, Department of Environmental Engineering, Miljøvej 113, 2500 Kgs. Lyngby (Denmark)
2013-11-15
Highlights: • We analyse 26.1 Mg of residual waste from 3129 Danish households. • We quantify and characterise misplaced WEEE and portable batteries. • We compare misplaced WEEE and batteries to collection through dedicated schemes. • Characterisation showed that primarily small WEEE and light sources are misplaced. • Significant amounts of misplaced batteries were discarded as built-in WEEE. - Abstract: A total of 26.1 Mg of residual waste from 3129 households in 12 Danish municipalities was analysed and revealed that 89.6 kg of Waste Electrical and Electronic Equipment (WEEE), 11 kg of batteries, 2.2 kg of toners and 16 kg of cables had been wrongfully discarded. This corresponds to a Danish household discarding 29 g of WEEE (7 items per year), 4 g of batteries (9 batteries per year), 1 g of toners and 7 g of unidentifiable cables on average per week, constituting 0.34% (w/w), 0.04% (w/w), 0.01% (w/w) and 0.09% (w/w), respectively, of residual waste. The study also found that misplaced WEEE and batteries in the residual waste constituted 16% and 39%, respectively, of what is being collected properly through the dedicated special waste collection schemes. This shows that a large amount of batteries are being discarded with the residual waste, whereas WEEE seems to be collected relatively successfully through the dedicated special waste collection schemes. Characterisation of the misplaced batteries showed that 20% (w/w) of the discarded batteries were discarded as part of WEEE (built-in). Primarily alkaline batteries, carbon zinc batteries and alkaline button cell batteries were found to be discarded with the residual household waste. Characterisation of WEEE showed that primarily small WEEE (WEEE directive categories 2, 5a, 6, 7 and 9) and light sources (WEEE directive category 5b) were misplaced. Electric tooth brushes, watches, clocks, headphones, flashlights, bicycle lights, and cables were items most frequently found. It is recommended that these
Displaying Now-Understanding: The Finnish Change-of-State Token "aa"
Koivisto, Aino
2015-01-01
This article discusses the use of the Finnish change-of-state token "aa" that has previously not been identified. The central claim is that even though "aa" indicates a cognitive shift experienced by the speaker, it does not function as a receipt of new information. Instead, the token "aa" indicates that the speaker…
An Analysis of the Rise and Fall of the AA-MAS Policy
Lazarus, Sheryl S.; Thurlow, Martha L.; Ysseldyke, James E.; Edwards, Lynn M.
2015-01-01
In 2005, to address concerns about students who might fall in the "gap" between the regular assessment and the alternate assessment based on alternate achievement standards (AA-AAS), the U.S. Department of Education announced that states could develop alternate assessments based on modified achievement standards (AA-MAS). This article…
Sotnikova, Irina; Vladykin, Nikolai
2015-04-01
Burpalinsky rare metal alkaline massif in the Northern Baikal folded zone in southern margin of Siberian Platform, is a of intrusion central type, created 287 Ma covering area of about 250 km2. It is composed of nepheline syenites and pulaskites grading to quartz syenites in the contacts. Veines and dykes are represented by shonkinites, sodalite syenite, leucocratic granophyres, alkali granites and numerous rare metal alkaline syenite pegmatites and two dykes of carbonatites. All rocks except for granites are cut by a large apatite-fluorite dyke rocks with mica and magnetite, which in turn is cut by alaskite granites dyke. The massif has been studied by A.M. Portnov, A.A. Ganzeev et al. (1992) Burpalinsky massif is highly enriched with trace elements, which are concentrated in pegmatite dykes. About 70 rare-metal minerals we found in massif. Zr-silicates: zircon, eudialyte, lovenite, Ti-lovenite, velerite, burpalite, seidozerite, Ca- seidozerite, Rosenbuschite, vlasovite, katapleite, Ca-katapleite, elpidite. Ti- minerals:- sphene, astrophyllite, ramsaite, Mn-neptunite bafertisite, chevkinite, Mn-ilmenite, pirofanite, Sr-perrerit, landauite, rutile, anatase, brookite; TR- minerals - loparite, metaloparite, britolite, rinkolite, melanocerite, bastnesite, parisite, ankilite, monazite, fluocerite, TR-apatite; Nb- minerals - pyrochlore, loparite. Other rare minerals leucophanite, hambergite, pyrochlore, betafite, torite, thorianite, tayniolite, brewsterite, cryolite and others. We have proposed a new scheme massif: shonkinites - nepheline syenites - alkaline syenite - quartz syenites - veined rocks: mariupolites, rare-metal pegmatites, apatite, fluorite rock alyaskite and alkaline granites and carbonatites (Sotnikova, 2009). Apatite-fluorite rocks are found in the central part of massif. This is a large vein body of 2 km length and a 20 m width cutting prevailing pulaskites. Previously, these rocks were regarded as hydrothermal low-temperature phase. New geological and
User Behavior Assessment of Household Electric Usage
Directory of Open Access Journals (Sweden)
Nur Budi Mulyono
2014-02-01
Full Text Available Abstract. Energy resilience is one of the famous issues among researchers and practitioners in energy sector. With enabling new technologies in power engineering for smart grid such as distributed generation, distributed storage, and intelligent information and management, each household community can establish a resilience energy production, distribution, and consumption. A household in smart grid system behaves as a customer and producer at the same time. This condition enabled them to reduce the power shortage in the peak hours, reduce CO2 pollution using renewable electricity, and minimizing electricity usage by changing life style. In developing countries, the amount of electricity supply is less than its demand. Most of the demand comes from the household that has peak load on nighttime. Keywords: User behavior, Game theory, Smart grid, Heating and cooling appliances, Energy resilientdoi:10.12695/ajtm.2013.6.2.1 How to cite this article:Mulyono, N. B. (2013. User Behavior Assessment of Household Electric Usage. The Asian Journal of Technology Management 6 (2: 65-71. Print ISSN: 1978-6956; Online ISSN: 2089-791X. doi:10.12695/ajtm.2013.6.2.1
Household portfolios and implicit risk aversion
Bucciol, A.; Miniaci, R.
2008-01-01
We derive from a sample of US households the distribution of the risk aversion implicit in their portfolio choice. Our estimate minimizes the distance between the certainty equivalent return generated with observed portfolios and portfolios that are optimal in a mean-variance framework. Taking into
Prospects and Constraints of Household Irrigation Practices ...
African Journals Online (AJOL)
Constraints and prospects of hand dug wells related to household irrigation were assessed in Hayelom watershed (~1045 ha), by evaluating groundwater suitability for irrigation, soil quality and impact of intervention. 181 hand dug wells have come into existence in the watershed due to intervention and benefiting about ...
Essays in banking and household finance
Diepstraten, Maaike
2018-01-01
The thesis consists of four chapters in banking and household finance. The first chapter examines the joint impact of bank size and scope on banks’ exposure to systemic risk. It shows that the dark side of diversification dominates for small banks, whereas the bright side effects of diversification
Household and kin provisioning by Hadza men.
Wood, Brian M; Marlowe, Frank W
2013-09-01
We use data collected among Hadza hunter-gatherers between 2005 and 2009 to examine hypotheses about the causes and consequences of men's foraging and food sharing. We find that Hadza men foraged for a range of food types, including fruit, honey, small animals, and large game. Large game were shared not like common goods, but in ways that significantly advantaged producers' households. Food sharing and consumption data show that men channeled the foods they produced to their wives, children, and their consanguineal and affinal kin living in other households. On average, single men brought food to camp on 28% of days, married men without children at home on 31% of days, and married men with children at home on 42% of days. Married men brought fruit, the least widely shared resource, to camp significantly more often than single men. A model of the relationship between hunting success and household food consumption indicates that the best hunters provided 3-4 times the amount of food to their families than median or poor hunters. These new data fill important gaps in our knowledge of the subsistence economy of the Hadza and uphold predictions derived from the household and kin provisioning hypotheses. Key evidence and assumptions backing prior claims that Hadza hunting is largely a form of status competition were not replicated in our study. In light of this, family provisioning is a more viable explanation for why good hunters are preferred as husbands and have higher fertility than others.
Sustainable reverse logistics for household plastic waste
Bing, X.
2014-01-01
Summary of the thesis titled “Sustainable Reverse Logistics for Household Plastic Waste”
PhD Candidate: Xiaoyun Bing
Recycled plastic can be used in the manufacturing of plastic products to reduce the use of virgin plastics material. The cost of recycled plastics is usually lower
Human Capital Diversification within the Household
DEFF Research Database (Denmark)
Lilleør, Helene Bie
Lack of primary schooling among rural children in developing countries is often attributed to credit constraints and household demand for child labour, implying that direct and indirect costs of schooling are high. Surprisingly few studies have considered the importance of parents' expected returns...
Domestic abuse in the household of God
African Journals Online (AJOL)
p1243322
long term effects of my father's physical, verbal, emotional and financial abuse of my mother along ... are astonishingly similar to my childhood experiences in an abusive household ..... An over labelling of any type of negative affectivity as anger is likely. Self- ... divorce has physical abuse as its root cause. More difficult to ...
Cassava household expenditure and anthropometric indices of ...
African Journals Online (AJOL)
In an attempt to verify the myth associated with cassava, that high consumption causes malnutrition, anthropometric measurements of 445 preschool children aged 0 - 5 years in 90 randomly selected farm households of cassava growing areas of Imo State were undertaken. Growth deviations (Z – scores) were calculated ...
Household energy isn't all stoves
Clancy, Joy S.
1998-01-01
When people talk about 'household energy', most people automatically think of stoves. A lot of attention has been paid to improving stoves to make them more energy efficient and to reduce their pollution. This is one side of the 'stoves' approach, whilst others look at the 'supply' side of the
HOUSEHOLDS WILLINGNESS TO PAY FOR IMPROVED WATER ...
African Journals Online (AJOL)
None
Maun, as a tourist centre and the North-West District headquarters is the centre of many .... the above parameters were the main determinant for WTP for private water ... For individuals who were sharing, that was treated as two households. .... The majority (73.9 percent) reported that they experience water shortages all year.
Steps to Design a Household Energy Game
Directory of Open Access Journals (Sweden)
Jan Dirk Fijnheer
2016-09-01
Full Text Available Research where gamification is used to influence household energy consumption is an emerging field. This paper reviews the design and effectiveness of ten games that aim to influence household energy consumption and presents a novel gamification approach in which real world activities are implemented in a game design. From the review suggestions for the design of a new game have been identified, such as including real life missions in order to optimize the transfer between the game world and the real world, feedback from monitoring the electricity meter, the presence of a strong storyline, personalized game characters, social interaction, etc. Based on this comparative analysis, the new game 'Powersaver Game' focused on reducing energy consumption has been designed and its prototype is described. In the next stage of iterative design, end-users evaluated the match between in-game scenes and household energy saving activities. This considerate user-centered design process should allow us to build a serious game that is potentially effective in reducing household energy consumption.
Increasing Household Protein Consumption Through Minilivestock ...
African Journals Online (AJOL)
Mini-livestock production can be a major contributor of a more balanced diet for both rural and urban settlements. The attributes of mini-livestock gives it the potential of increasing household protein consumption as well as being a source of income. Mini-livestock production can be practiced in rural and urban settlements ...
Industrialization and Household Complexity in Rural Taiwan.
Lavely, William
1990-01-01
In 274 Taiwanese townships, farm household complexity in 1960 and 1970 was positively related to the proportion of the labor force in nonagricultural occupations. The close proximity of industry to family farms in Taiwan has reduced rural to urban migration usually associated with industrialization. Contains 46 references. (Author/SV)
A semiparametric model of household gasoline demand
Energy Technology Data Exchange (ETDEWEB)
Wadud, Zia [Department of Civil Engineering, Bangladesh University of Engineering and Technology, Dhaka 1000 (Bangladesh); Noland, Robert B. [Alan M. Voorhees Transportation Center, Edward J. Bloustein School of Planning and Public Policy, Rutgers University, New Brunswick, NJ 08901 (United States); Graham, Daniel J. [Centre for Transport Studies, Dept of Civil and Environmental Engineering, Imperial College London, London, SW7 2AZ (United Kingdom)
2010-01-15
Gasoline demand studies typically generate a single price and income elasticity for a country. It is however possible that these elasticities may differ among various socio-economic groups. At the same time, parametric gasoline demand models may not be flexible enough to capture the changes in price elasticities with different levels of income. This paper models US gasoline demand using more flexible semiparametric techniques, accommodating the possibility of differences in responses among households. The econometric model employs a non-parametric bivariate smoothing for price and income and a parametric representation of other explanatory variables. Possible heterogeneity in price and income elasticities is modelled through interacting price and income with demographic variables. Results show that price responses do vary with demographic variables such as income, multiple vehicle holding, presence of multiple wage earners or rural or urban residential locations. Households' responses to a price change decrease with higher income. Multiple vehicle and multiple earner households also show higher sensitivity to a price change. Households located in urban areas reduce consumption more than those in rural areas in response to an increase in price. Comparison of the flexible semiparametric model with a parametric translog model, however, reveals no significant differences between results, and the parametric models have the advantage of lower computational requirements and better interpretability. (author)
Inattention and Inertia in Household Finance
DEFF Research Database (Denmark)
Andersen, Steffen; Campbell, John Y.; Meisner Nielsen, Kasper
This paper studies inattention to mortgage refinancing incentives among Danish households. Danish data are particularly suitable for this purpose because there are minimal barriers to refinancing, yet many borrowers fail to refinance optimally, and the characteristics of these borrowers can be ac...
Essays in environmental policy and household economics
Motavasseli, Ali
2016-01-01
This dissertation addresses several issues regarding the consequences of environmental policy and its optimal level, as well as household's decisions on energy consumption and labor supply. In chapter two, a theoretical analysis investigates whether fossil fuel taxation or a consumption cap is
Multivariate Analysis of Household Decision Making, Contraceptive ...
African Journals Online (AJOL)
Nneka Umera-Okeke
contraceptives and fertility behaviour of ever-married men in Nigeria. ... exposure. The study concluded that women empowerment in decision ... through the prevention of unwanted and unplanned births is one of the most effective .... visitors who slept in the household the previous night before the survey) were eligible ...
Household Water Treatments in Developing Countries
Smieja, Joanne A.
2011-01-01
Household water treatments (HWT) can help provide clean water to millions of people worldwide who do not have access to safe water. This article describes four common HWT used in developing countries and the pertinent chemistry involved. The intent of this article is to inform both high school and college chemical educators and chemistry students…
Revealed preference tests for collective household behavior
Cherchye, L.J.H.; de Rock, B.; Vermeulen, F.M.P.; Verriest, E.; Molina, J.A.
2011-01-01
This chapter contains a state of the art of revealed preference tests for consistency of observed household behavior with Pareto efficiency. These tests are entirely nonparametric, since they do not require any assumptions regarding the parametric form of individual preferences or the intrahousehold
AA amyloidosis complicating the hereditary periodic fever syndromes.
Lane, Thirusha; Loeffler, Jutta M; Rowczenio, Dorota M; Gilbertson, Janet A; Bybee, Alison; Russell, Tonia L; Gillmore, Julian D; Wechalekar, Ashutosh D; Hawkins, Philip N; Lachmann, Helen J
2013-04-01
AA amyloidosis is a life-threatening complication of the hereditary periodic fever syndromes (HPFS), which are otherwise often compatible with normal life expectancy. This study was undertaken to determine the characteristics, presentation, natural history, and response to treatment in 46 patients who had been referred for evaluation at the UK National Amyloidosis Centre. Disease activity was monitored by serial measurement of serum amyloid A. Renal function was assessed by measurement of serum creatinine and albumin levels, the estimated glomerular filtration rate, and proteinuria from 24-hour urine collections. The amyloid load was measured by serum amyloid P scintigraphy. Twenty-four patients had familial Mediterranean fever, 12 patients had tumor necrosis factor receptor-associated periodic syndrome, 6 patients had cryopyrin-associated periodic syndromes, and 4 patients had mevalonate kinase deficiency. The median age at onset of HPFS was 5 years; median age at presentation with AA amyloidosis was 38 years. Diagnosis of an HPFS had not been considered prior to presentation with AA amyloidosis in 23 patients (50%). Eleven patients (24%) had end-stage renal failure (ESRF) at presentation; of these, 3 had received transplants prior to referral. A further 13 patients developed ESRF over the followup period, with 10 undergoing renal transplantation. The median time to progression to ESRF from onset of AA amyloidosis was 3.3 years (interquartile range [IQR] 2-8), with a median time to transplant of 4 years (IQR 3-6). Eleven patients (24%) died. The median survival in the entire cohort was 19 years from diagnosis of AA amyloidosis. Of the 37 patients who were treated successfully, or in whom at least partial suppression of the underlying HPFS was achieved, 17 (46%) showed amyloid regression, 14 (38%) showed a stable amyloid load, and 2 (5%) showed increased amyloid deposition over the followup period. AA amyloidosis remains a challenging and serious late complication
Microbial alkaline proteases: Optimization of production parameters and their properties
Directory of Open Access Journals (Sweden)
Kanupriya Miglani Sharma
2017-06-01
Full Text Available Proteases are hydrolytic enzymes capable of degrading proteins into small peptides and amino acids. They account for nearly 60% of the total industrial enzyme market. Proteases are extensively exploited commercially, in food, pharmaceutical, leather and detergent industry. Given their potential use, there has been renewed interest in the discovery of proteases with novel properties and a constant thrust to optimize the enzyme production. This review summarizes a fraction of the enormous reports available on various aspects of alkaline proteases. Diverse sources for isolation of alkaline protease producing microorganisms are reported. The various nutritional and environmental parameters affecting the production of alkaline proteases in submerged and solid state fermentation are described. The enzymatic and physicochemical properties of alkaline proteases from several microorganisms are discussed which can help to identify enzymes with high activity and stability over extreme pH and temperature, so that they can be developed for industrial applications.
Spectroscopic characterization of manganese-doped alkaline earth ...
Indian Academy of Sciences (India)
The shapes of spectra are also changed with varying alkaline earth ions content. ... of manganese ion and electrical properties of glass contain- ing mobile ions like .... octahedral crystal field are located above the ground 6S state. Figure 2.
Optimization of alkaline protease production and its fibrinolytic ...
African Journals Online (AJOL)
Optimization of alkaline protease production and its fibrinolytic activity from the ... nitrogen sources and sodium chloride concentration for protease production by the ... exploited to assist in protein degradation in various industrial processes.
Guest–host interactions in the alkaline bleaching of ...
Indian Academy of Sciences (India)
Administrator
cyclodextrin on the bleaching rates of triphenylmethane dyes crystal violet (CV), malachite green (MG) and rosaniline. (RA) have been investigated in alkaline medium with a view to understand the guest–host interaction in these system. 2.
The Estimation Formation Alkaline In The Proses Desalination MSF
International Nuclear Information System (INIS)
Latiffah, Siti Nurul
2000-01-01
Already to go on estimation phenomena formation alkaline scale of a seawater. In desalination system seawater on MSF to go on scale by a thermal decomposition HCO sub.3- ion and hydrolysis carbonate ion with water on the temperature operation. The varieties alkaline scale in attached on tube surface, while reduced efficiency heat transfer and to raise corrosion attack to structure material is caused all this high cost. Estimation to take please which a sum step by step decomposition ion bicarbonate from then information scale which carbonate and hydroxyl ion. The various scale maximal is alkaline form is a calcium carbonate = 116,5 gram per meter cubic the various sedimentation is alkaline and magnesium hydroxide = 67,57 gram per meter cubic
Economic Nature of Monetary Funds of Households
Directory of Open Access Journals (Sweden)
Vladimir Vladimirovich Glukhov
2015-12-01
Full Text Available In a market economy, household is characterized by the situation in which its members become owners of their tangible and intangible assets or are only declared to be them. Many provisions of the macroeconomy could change significantly if the issues of household and family finances were paid as much attention as economic problems of the state and entities. Finance households are an economic basis for the state and for business entities of different ownership forms, because they are managed by people who are part of families representing the interests of certain individuals. The issues of formation and distribution of Russian households’ intra-cash assets, including shadow ones, are now one of the most topical issues, not only in theory but also in practice of economic science. And at the same time these issues remain virtually unexplored. Social risk of intra-family shadow funds consists in the fact that the models of economic behavior acquired by the individual in the household are transferred to an external social field, and implemented according to the occupied power status. Shadow monetary funds created in the household represent part of the money which is derived from the family budget, and they imply the existence of latent side of financial relations among its members. The purpose of this article is studying the mеchanisms of decision-making on the establishment of both collective and individual monetary funds within the family budget, including the shadow funds (so-called “zanachkа” of individuals, not accounted for in the family budget.
[Health services access survey for Colombian households].
Arrivillaga, Marcela; Aristizabal, Juan Carlos; Pérez, Mauricio; Estrada, Victoria Eugenia
The aim of this study was to design and validate a health services access survey for households in Colombia to provide a methodological tool that allows the country to accumulate evidence of real-life access conditions experienced by the Colombian population. A validation study with experts and a pilot study were performed. It was conducted in the municipality of Jamundi, located in the department of Valle del Cauca, Colombia. Probabilistic, multistage and stratified cluster sampling was carried out. The final sample was 215 households. The survey was composed of 63 questions divided into five modules: socio-demographic profile of the head of the household or adult informant, household socioeconomic profile, access to preventive services, access to curative and rehabilitative services and household out of pocket expenditure. In descriptive terms, the promotion of preventive services only reached 44%; the use of these services was always highest among children younger than one year old and up to the age of ten. The perceived need for emergency medical care and hospitalisation was between 82% and 85%, but 36% perceived the quality of care to be low or very low. Delays were experienced in medical visits with GPs and specialists. The designed survey is valid, relevant and representative of access to health services in Colombia. Empirically, the pilot showed institutional weaknesses in a municipality of the country, indicating that health coverage does not in practice mean real and effective access to health services. Copyright © 2016 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.
Economic Analysis of Improved Alkaline Water Electrolysis
International Nuclear Information System (INIS)
Kuckshinrichs, Wilhelm; Ketelaer, Thomas; Koj, Jan Christian
2017-01-01
Alkaline water electrolysis (AWE) is a mature hydrogen production technology and there exists a range of economic assessments for available technologies. For advanced AWEs, which may be based on novel polymer-based membrane concepts, it is of prime importance that development comes along with new configurations and technical and economic key process parameters for AWE that might be of interest for further economic assessments. This paper presents an advanced AWE technology referring to three different sites in Europe (Germany, Austria, and Spain). The focus is on financial metrics, the projection of key performance parameters of advanced AWEs, and further financial and tax parameters. For financial analysis from an investor’s (business) perspective, a comprehensive assessment of a technology not only comprises cost analysis but also further financial analysis quantifying attractiveness and supply/market flexibility. Therefore, based on cash flow (CF) analysis, a comprehensible set of metrics may comprise levelised cost of energy or, respectively, levelized cost of hydrogen (LCH) for cost assessment, net present value (NPV) for attractiveness analysis, and variable cost (VC) for analysis of market flexibility. The German AWE site turns out to perform best in all three financial metrics (LCH, NPV, and VC). Though there are slight differences in investment cost and operation and maintenance cost projections for the three sites, the major cost impact is due to the electricity cost. Although investment cost is slightly lower and labor cost is significantly lower in Spain, the difference can not outweigh the higher electricity cost compared to Germany. Given the assumption that the electrolysis operators are customers directly and actively participating in power markets, and based on the regulatory framework in the three countries, in this special case electricity cost in Germany is lowest. However, as electricity cost is profoundly influenced by political decisions as
Basic study of alkaline water electrolysis
International Nuclear Information System (INIS)
Manabe, A.; Kashiwase, M.; Hashimoto, T.; Hayashida, T.; Kato, A.; Hirao, K.; Shimomura, I.; Nagashima, I.
2013-01-01
In order to realize future hydrogen society, hydrogen production systems must meet the large demand of hydrogen usage. Alkaline water electrolysis (AWE) would be one of the candidate technologies to produce hydrogen on a large scale from renewable energy. We have conducted basic research into AWE, trying to reveal technical issues under zero gap system in new cell technology. The zero gap system contributes lower cell voltage without causing any major operating problems compared with conventional finite gap cell. However, it was observed that Ni base electrodes showed corrosion phenomena in a number of test trials including steady operating conditions and several shut-downs. Activated Raney Ni alloy coating for anode material had an advantage for oxygen overvoltage. It showed a saving of around 100 mV at 40 A/dm 2 (0.4 A/cm 2 ) against Ni bare anodes. In the Chlor–Alkali (C/A) industry, thermal decomposition coating of mixed noble metal on Ni substrate is commonly used for advanced activated cathodes. It showed very low hydrogen over-potential of around 100 mV in AWE. To achieve better cell performance, separator selection is very important. We evaluated several separators including ion exchange membrane (IEM) to understand the basic function in AWE. IEM for C/A electrolysis showed high cell voltage (over 2.2 V) but low O 2 impurity in H 2 gas. Hydrogen purity was over 99.95%. Porous separators made of polypropylene showed 1.76 V at 40 A/dm 2 (0.4 A/cm 2 ), 80 °C. But there was a weakness on the durability for continuous operation. Proper selection of separator is important in an actual plant for effective and safe cell operation. The concept of safety operation is referred to by diffusion coefficient of hydrogen
Photovoltaic hydrogen production with commercial alkaline electrolysers
Energy Technology Data Exchange (ETDEWEB)
Ursua, A.; Lopez, J.; Gubia, E.; Marroyo, L.; Sanchis, P. [Public Univ. of Navarra, Pamplona (Spain). Dept. of Electric and Electronic Engineering
2010-07-01
Renewable energy sources and Electrolysis generate the so-called green Hydrogen, a zero-emission and potentially fossil fuel independent energy source. However, the inherent variability of the renewable energy sources implies a mode of operation for which most current electrolysers have not been designed. This paper analyses the operation of a water electrolyser fed with photovoltaic (PV) generator electric profile. The system, Integrated by a 1 Nm{sup 3}/h Hydrogenics alkaline electrolyser and a 5100 W PV generator with 60 BP585 modules, is installed at the Public University of Navarra (Spain). The PV generator profile fed to the electrolyser is emulated by a custom-made apparatus designed and built by the authors of this paper. The profile is designed according to real irradiance data measured by a calibration cell. The irradiance data are converted to the electric power profile that the PV generator would have delivered in case of having been connected to the electrolyser by means of a DC/DC converter with maximum power point tracking (MPPT). Finally, from previously measured power-current electrolyser characteristic curves, the current profile to be delivered to the electrolyser is obtained and programmed to the electronic device. The electrolyser was tested for two types of days. During the first day, the irradiance was very stable, whereas during the second day, the irradiance was very variable. The experimental results show an average power consumption rate and an efficiency of 4908 Wh/Nm{sup 3} and 72.1%, on the first day, and 4842 Wh/Nm{sup 3} and 73.3% on the second day. The electrolyser performance was particularly good in spite of the high variability of the electric supply of the second day. (orig.)
Alkaline Peroxide Delignification of Corn Stover
Energy Technology Data Exchange (ETDEWEB)
Mittal, Ashutosh [Biosciences; Katahira, Rui [National; Donohoe, Bryon S. [Biosciences; Black, Brenna A. [National; Pattathil, Sivakumar [Complex; Stringer, Jack M. [National; Beckham, Gregg T. [National
2017-05-30
Selective biomass fractionation into carbohydrates and lignin is a key challenge in the conversion of lignocellulosic biomass to fuels and chemicals. In the present study, alkaline hydrogen peroxide (AHP) pretreatment was investigated to fractionate lignin from polysaccharides in corn stover (CS), with a particular emphasis on the fate of the lignin for subsequent valorization. The influence of peroxide loading on delignification during AHP pretreatment was examined over the range of 30-500 mg H2O2/g dry CS at 50 degrees C for 3 h. Mass balances were conducted on the solid and liquid fractions generated after pretreatment for each of the three primary components, lignin, hemicellulose, and cellulose. AHP pretreatment at 250 mg H2O2/g dry CS resulted in the pretreated solids with more than 80% delignification consequently enriching the carbohydrate fraction to >90%. Two-dimensional nuclear magnetic resonance (2D-NMR) spectroscopy of the AHP pretreated residue shows that, under high peroxide loadings (>250 mg H2O2/g dry CS), most of the side chain structures were oxidized and the aryl-ether bonds in lignin were partially cleaved, resulting in significant delignification of the pretreated residues. Gel permeation chromatography (GPC) analysis shows that AHP pretreatment effectively depolymerizes CS lignin into low molecular weight (LMW) lignin fragments in the aqueous fraction. Imaging of AHP pretreated residues shows a more granular texture and a clear lamellar pattern in secondary walls, indicative of layers of varying lignin removal or relocalization. Enzymatic hydrolysis of this pretreated residue at 20 mg/g of glucan resulted in 90% and 80% yields of glucose and xylose, respectively, after 120 h. Overall, AHP pretreatment is able to selectively remove more than 80% of the lignin from biomass in a form that has potential for downstream valorization processes and enriches the solid pulp into a highly digestible material.
Economic Analysis of Improved Alkaline Water Electrolysis
Energy Technology Data Exchange (ETDEWEB)
Kuckshinrichs, Wilhelm, E-mail: w.kuckshinrichs@fz-juelich.de; Ketelaer, Thomas; Koj, Jan Christian [Forschungszentrum Juelich, Institute for Energy and Climate Research – Systems Analysis and Technology Evaluation (IEK-STE), Juelich (Germany)
2017-02-20
Alkaline water electrolysis (AWE) is a mature hydrogen production technology and there exists a range of economic assessments for available technologies. For advanced AWEs, which may be based on novel polymer-based membrane concepts, it is of prime importance that development comes along with new configurations and technical and economic key process parameters for AWE that might be of interest for further economic assessments. This paper presents an advanced AWE technology referring to three different sites in Europe (Germany, Austria, and Spain). The focus is on financial metrics, the projection of key performance parameters of advanced AWEs, and further financial and tax parameters. For financial analysis from an investor’s (business) perspective, a comprehensive assessment of a technology not only comprises cost analysis but also further financial analysis quantifying attractiveness and supply/market flexibility. Therefore, based on cash flow (CF) analysis, a comprehensible set of metrics may comprise levelised cost of energy or, respectively, levelized cost of hydrogen (LCH) for cost assessment, net present value (NPV) for attractiveness analysis, and variable cost (VC) for analysis of market flexibility. The German AWE site turns out to perform best in all three financial metrics (LCH, NPV, and VC). Though there are slight differences in investment cost and operation and maintenance cost projections for the three sites, the major cost impact is due to the electricity cost. Although investment cost is slightly lower and labor cost is significantly lower in Spain, the difference can not outweigh the higher electricity cost compared to Germany. Given the assumption that the electrolysis operators are customers directly and actively participating in power markets, and based on the regulatory framework in the three countries, in this special case electricity cost in Germany is lowest. However, as electricity cost is profoundly influenced by political decisions as
Energy Technology Data Exchange (ETDEWEB)
Gallegos, María V., E-mail: plapimu@yahoo.com.ar [Pla.Pi.Mu-Planta Piloto Multipropósito, (CICPBA-UNLP) Cno. Centenario y 505, M.B. Gonnet, Buenos Aires (Argentina); Falco, Lorena R., E-mail: mlfalco@quimica.unlp.edu.ar [Pla.Pi.Mu-Planta Piloto Multipropósito, (CICPBA-UNLP) Cno. Centenario y 505, M.B. Gonnet, Buenos Aires (Argentina); Peluso, Miguel A., E-mail: apelu@quimica.unlp.edu.ar [Centro de Investigación y Desarrollo en Ciencias Aplicadas, “Dr. J. Ronco” CINDECA (CONICET CCT La Plata), 47 N°257, La Plata, Buenos Aires (Argentina); Sambeth, Jorge E., E-mail: sambeth@quimica.unlp.edu.ar [Centro de Investigación y Desarrollo en Ciencias Aplicadas, “Dr. J. Ronco” CINDECA (CONICET CCT La Plata), 47 N°257, La Plata, Buenos Aires (Argentina); Thomas, Horacio J. [Pla.Pi.Mu-Planta Piloto Multipropósito, (CICPBA-UNLP) Cno. Centenario y 505, M.B. Gonnet, Buenos Aires (Argentina)
2013-06-15
Highlights: • Manganese oxides were synthesized using spent batteries as raw materials. • Spent alkaline and zinc–carbon size AA batteries were used. • A biohydrometallurgical process was employed to bio-lixiviate batteries. • Manganese oxides were active in the oxidation of VOCs (ethanol and heptane). - Abstract: Manganese, in the form of oxide, was recovered from spent alkaline and zinc–carbon batteries employing a biohydrometallurgy process, using a pilot plant consisting in: an air-lift bioreactor (containing an acid-reducing medium produced by an Acidithiobacillus thiooxidans bacteria immobilized on elemental sulfur); a leaching reactor (were battery powder is mixed with the acid-reducing medium) and a recovery reactor. Two different manganese oxides were recovered from the leachate liquor: one of them by electrolysis (EMO) and the other by a chemical precipitation with KMnO{sub 4} solution (CMO). The non-leached solid residue was also studied (RMO). The solids were compared with a MnO{sub x} synthesized in our laboratory. The characterization by XRD, FTIR and XPS reveal the presence of Mn{sub 2}O{sub 3} in the EMO and the CMO samples, together with some Mn{sup 4+} cations. In the solid not extracted by acidic leaching (RMO) the main phase detected was Mn{sub 3}O{sub 4}. The catalytic performance of the oxides was studied in the complete oxidation of ethanol and heptane. Complete conversion of ethanol occurs at 200 °C, while heptane requires more than 400 °C. The CMO has the highest oxide selectivity to CO{sub 2}. The results show that manganese oxides obtained using spent alkaline and zinc–carbon batteries as raw materials, have an interesting performance as catalysts for elimination of VOCs.
Net alkalinity and net acidity 1: Theoretical considerations
International Nuclear Information System (INIS)
Kirby, Carl S.; Cravotta, Charles A.
2005-01-01
Net acidity and net alkalinity are widely used, poorly defined, and commonly misunderstood parameters for the characterization of mine drainage. The authors explain theoretical expressions of 3 types of alkalinity (caustic, phenolphthalein, and total) and acidity (mineral, CO 2 , and total). Except for rarely-invoked negative alkalinity, theoretically defined total alkalinity is closely analogous to measured alkalinity and presents few practical interpretation problems. Theoretically defined 'CO 2 -acidity' is closely related to most standard titration methods with an endpoint pH of 8.3 used for determining acidity in mine drainage, but it is unfortunately named because CO 2 is intentionally driven off during titration of mine-drainage samples. Using the proton condition/mass-action approach and employing graphs to illustrate speciation with changes in pH, the authors explore the concept of principal components and how to assign acidity contributions to aqueous species commonly present in mine drainage. Acidity is defined in mine drainage based on aqueous speciation at the sample pH and on the capacity of these species to undergo hydrolysis to pH 8.3. Application of this definition shows that the computed acidity in mgL -1 as CaCO 3 (based on pH and analytical concentrations of dissolved Fe II , Fe III , Mn, and Al in mgL -1 ):acidity calculated =50{1000(10 -pH )+[2(Fe II )+3(Fe III )]/56+2(Mn) /55+3(Al)/27}underestimates contributions from HSO 4 - and H + , but overestimates the acidity due to Fe 3+ and Al 3+ . However, these errors tend to approximately cancel each other. It is demonstrated that 'net alkalinity' is a valid mathematical construction based on theoretical definitions of alkalinity and acidity. Further, it is shown that, for most mine-drainage solutions, a useful net alkalinity value can be derived from: (1) alkalinity and acidity values based on aqueous speciation (2) measured alkalinity minus calculated acidity, or (3) taking the negative of the
Net alkalinity and net acidity 1: Theoretical considerations
Kirby, C.S.; Cravotta, C.A.
2005-01-01
Net acidity and net alkalinity are widely used, poorly defined, and commonly misunderstood parameters for the characterization of mine drainage. The authors explain theoretical expressions of 3 types of alkalinity (caustic, phenolphthalein, and total) and acidity (mineral, CO2, and total). Except for rarely-invoked negative alkalinity, theoretically defined total alkalinity is closely analogous to measured alkalinity and presents few practical interpretation problems. Theoretically defined "CO 2-acidity" is closely related to most standard titration methods with an endpoint pH of 8.3 used for determining acidity in mine drainage, but it is unfortunately named because CO2 is intentionally driven off during titration of mine-drainage samples. Using the proton condition/mass- action approach and employing graphs to illustrate speciation with changes in pH, the authors explore the concept of principal components and how to assign acidity contributions to aqueous species commonly present in mine drainage. Acidity is defined in mine drainage based on aqueous speciation at the sample pH and on the capacity of these species to undergo hydrolysis to pH 8.3. Application of this definition shows that the computed acidity in mg L -1 as CaCO3 (based on pH and analytical concentrations of dissolved FeII, FeIII, Mn, and Al in mg L -1):aciditycalculated=50{1000(10-pH)+[2(FeII)+3(FeIII)]/56+2(Mn)/ 55+3(Al)/27}underestimates contributions from HSO4- and H+, but overestimates the acidity due to Fe3+ and Al3+. However, these errors tend to approximately cancel each other. It is demonstrated that "net alkalinity" is a valid mathematical construction based on theoretical definitions of alkalinity and acidity. Further, it is shown that, for most mine-drainage solutions, a useful net alkalinity value can be derived from: (1) alkalinity and acidity values based on aqueous speciation, (2) measured alkalinity minus calculated acidity, or (3) taking the negative of the value obtained in a
Processes determining the marine alkalinity and carbonate saturation distributions
B. R. Carter; J. R. Toggweiler; R. M. Key; J. L. Sarmiento
2014-01-01
We introduce a composite tracer, Alk*, that has a global distribution primarily determined by CaCO3 precipitation and dissolution. Alk* also highlights riverine alkalinity plumes that are due to dissolved calcium carbonate from land. We estimate the Arctic receives approximately twice the riverine alkalinity per unit area as the Atlantic, and 8 times that of the other oceans. Riverine inputs broadly elevate Alk* in the Arctic surface and particularly near ri...
Block Copolymers for Alkaline Fuel Cell Membrane Materials
2014-07-30
temperature fuel cells including proton exchange membrane fuel cell ( PEMFC ) and alkaline fuel cell (AFC) with operation temperature usually lower than 120...advantages over proton exchange membrane fuel cells ( PEMFCs ) resulting in the popularity of AFCs in the US space program.[8-11] The primary benefit AFC...offered over PEMFC is better electrochemical kinetics on the anode and cathode under the alkaline environment, which results in the ability to use
Directory of Open Access Journals (Sweden)
Rafiza Abdul Razak
2015-05-01
Full Text Available This paper presents the mechanical function and characterization of an artificial lightweight geopolymer aggregate (ALGA using LUSI (Sidoarjo mud and alkaline activator as source materials. LUSI stands for LU-Lumpur and SI-Sidoarjo, meaning mud from Sidoarjo which erupted near the Banjarpanji-1 exploration well in Sidoarjo, East Java, Indonesia on 27 May 2006. The effect of NaOH molarity, LUSI mud/Alkaline activator (LM/AA ratio, and Na2SiO3/NaOH ratio to the ALGA are investigated at a sintering temperature of 950 °C. The results show that the optimum NaOH molarity found in this study is 12 M due to the highest strength (lowest AIV value of 15.79% with lower water absorption and specific gravity. The optimum LUSI mud/Alkaline activator (LM/AA ratio of 1.7 and the Na2SiO3/NaOH ratio of 0.4 gives the highest strength with AIV value of 15.42% with specific gravity of 1.10 g/cm3 and water absorption of 4.7%. The major synthesized crystalline phases were identified as sodalite, quartz and albite. Scanning Electron Microscope (SEM image showed more complete geopolymer matrix which contributes to highest strength of ALGA produced.
Abdul Razak, Rafiza; Abdullah, Mohd Mustafa Al Bakri; Hussin, Kamarudin; Ismail, Khairul Nizar; Hardjito, Djwantoro; Yahya, Zarina
2015-01-01
This paper presents the mechanical function and characterization of an artificial lightweight geopolymer aggregate (ALGA) using LUSI (Sidoarjo mud) and alkaline activator as source materials. LUSI stands for LU-Lumpur and SI-Sidoarjo, meaning mud from Sidoarjo which erupted near the Banjarpanji-1 exploration well in Sidoarjo, East Java, Indonesia on 27 May 2006. The effect of NaOH molarity, LUSI mud/Alkaline activator (LM/AA) ratio, and Na2SiO3/NaOH ratio to the ALGA are investigated at a sintering temperature of 950 °C. The results show that the optimum NaOH molarity found in this study is 12 M due to the highest strength (lowest AIV value) of 15.79% with lower water absorption and specific gravity. The optimum LUSI mud/Alkaline activator (LM/AA) ratio of 1.7 and the Na2SiO3/NaOH ratio of 0.4 gives the highest strength with AIV value of 15.42% with specific gravity of 1.10 g/cm3 and water absorption of 4.7%. The major synthesized crystalline phases were identified as sodalite, quartz and albite. Scanning Electron Microscope (SEM) image showed more complete geopolymer matrix which contributes to highest strength of ALGA produced. PMID:26006238
Household income differences in food sources and food items purchased.
French, Simone A; Wall, Melanie; Mitchell, Nathan R
2010-10-26
The present study examined income-related household food purchases among a sample of 90 households from the community. Annotated food purchase receipts were collected for a four-week period by the primary household shopper. Receipt food source and foods items were classified into specific categories, and food quantities in ounces were recorded by research staff. For home sources, a limited number of food/beverage categories were recorded. For eating out sources, all food/beverage items were recorded. Median monthly per person dollars spent and per person ounces purchased were computed. Food sources and food categories were examined by household income tertile. A community-based sample of 90 households. Higher income households spent significantly more dollars per person per month from both home and eating out sources compared with lower income households ($163 versus $100, p income households, higher income households spent significantly more home source dollars on both fruits/vegetables (21.5 versus 10.2, p income households (45% versus 26%, p sources, lower income households spent a significantly greater percent of dollars per person at carry out places (54% versus 37%, p income differences were observed for dollars spent at discount grocery stores, small grocery stores or convenience stores. Higher income households spent more money on both healthy and less healthy foods from a wide range of sources. Lower income households spent a larger proportion of their eating out dollars at carry out places, and a larger proportion of their home beverage purchases were sugar sweetened beverages.
The household energy transition in India and China
International Nuclear Information System (INIS)
Pachauri, Shonali; Jiang, Leiwen
2008-01-01
Both India and China are countries in energy transition. This paper compares the household energy transitions in these nations through the analysis of both aggregate statistics and nationally representative household surveys. The two countries differ sharply in several respects. Residential energy consumption in China is twice that in India, in aggregate terms. In addition, Chinese households have almost universal access to electricity, while in India almost half of rural households and 10% of urban households still lack access. On aggregate, urban households in China also derive a larger share of their total energy from liquid fuels and grids (77%) as compared to urban Indian households (65%). Yet, at every income level, Indians derive a slightly larger fraction of their total household energy needs from liquid and grid sources of energy than Chinese with comparable incomes. Despite these differences, trends in energy use and the factors influencing a transition to modern energy in both nations are similar. Compared with rural households, urban households in both nations consume a disproportionately large share of commercial energy and are much further along in the transition to modern energy. However, total energy consumption in rural households exceeds that in urban households, because of a continued dependence on inefficient solid fuels, which contribute to over 85% of rural household energy needs in both countries. In addition to urbanisation, key drivers of the transition in both nations include income, energy prices, energy access and local fuel availability. (author)
Overexpression of Human Bone Alkaline Phosphatase in Pichia Pastoris
Karr, Laurel; Malone, Christine, C.; Rose, M. Franklin (Technical Monitor)
2000-01-01
The Pichiapastoris expression system was utilized to produce functionally active human bone alkaline phosphatase in gram quantities. Bone alkaline phosphatase is a key enzyme in bone formation and biomineralization, yet important questions about its structural chemistry and interactions with other cellular enzymes in mineralizing tissues remain unanswered. A soluble form of human bone alkaline phosphatase was constructed by deletion of the 25 amino acid hydrophobic C-terminal region of the encoding cDNA and inserted into the X-33 Pichiapastoris strain. An overexpression system was developed in shake flasks and converted to large-scale fermentation. Alkaline phosphatase was secreted into the medium to a level of 32mgAL when cultured in shake flasks. Enzyme activity was 12U/mg measured by a spectrophotometric assay. Fermentation yielded 880mgAL with enzymatic activity of 968U/mg. Gel electrophoresis analysis indicates that greater than 50% of the total protein in the fermentation is alkaline phosphatase. A purification scheme has been developed using ammonium sulfate precipitation followed by hydrophobic interaction chromatography. We are currently screening crystallization conditions of the purified recombinant protein for subsequent X-ray diffraction analyses. Structural data should provide additional information on the role of alkaline phosphatase in normal bone mineralization and in certain bone mineralization anomalies.
Acid transformation of bauxite residue: Conversion of its alkaline characteristics.
Kong, Xiangfeng; Li, Meng; Xue, Shengguo; Hartley, William; Chen, Chengrong; Wu, Chuan; Li, Xiaofei; Li, Yiwei
2017-02-15
Bauxite residue (BR) is a highly alkaline solid hazardous waste produced from bauxite processing for alumina production. Alkaline transformation appears to reduce the environmental risk of bauxite residue disposal areas (BRDAs) whilst potentially providing opportunities for the sustainable reuse and on-going management of BR. Mineral acids, a novel citric acid and a hybrid combination of acid-gypsum treatments were investigated for their potential to reduce residue pH and total alkalinity and transform the alkaline mineral phase. XRD results revealed that with the exception of andradite, the primary alkaline solid phases of cancrinite, grossular and calcite were transformed into discriminative products based on the transformation used. Supernatants separated from BR and transformed bauxite residue (TBR) displayed distinct changes in soluble Na, Ca and Al, and a reduction in pH and total alkalinity. SEM images suggest that mineral acid transformations promote macro-aggregate formation, and the positive promotion of citric acid, confirming the removal or reduction in soluble and exchangeable Na. NEXAFS analysis of Na K-edge revealed that the chemical speciation of Na in TBRs was consistent with BR. Three acid treatments and gypsum combination had no effect on Na speciation, which affects the distribution of Na revealed by sodium STXM imaging. Copyright © 2016 Elsevier B.V. All rights reserved.
Cation exchange properties of zeolites in hyper alkaline aqueous media.
Van Tendeloo, Leen; de Blochouse, Benny; Dom, Dirk; Vancluysen, Jacqueline; Snellings, Ruben; Martens, Johan A; Kirschhock, Christine E A; Maes, André; Breynaert, Eric
2015-02-03
Construction of multibarrier concrete based waste disposal sites and management of alkaline mine drainage water requires cation exchangers combining excellent sorption properties with a high stability and predictable performance in hyper alkaline media. Though highly selective organic cation exchange resins have been developed for most pollutants, they can serve as a growth medium for bacterial proliferation, impairing their long-term stability and introducing unpredictable parameters into the evolution of the system. Zeolites represent a family of inorganic cation exchangers, which naturally occur in hyper alkaline conditions and cannot serve as an electron donor or carbon source for microbial proliferation. Despite their successful application as industrial cation exchangers under near neutral conditions, their performance in hyper alkaline, saline water remains highly undocumented. Using Cs(+) as a benchmark element, this study aims to assess the long-term cation exchange performance of zeolites in concrete derived aqueous solutions. Comparison of their exchange properties in alkaline media with data obtained in near neutral solutions demonstrated that the cation exchange selectivity remains unaffected by the increased hydroxyl concentration; the cation exchange capacity did however show an unexpected increase in hyper alkaline media.
Rural household income mobility in transitional China: Evidence from China Household Income Project
Yang, Sui
2015-01-01
Based on China Household Income Project rural data, this paper aims to study the changes of rural household income mobility in transitional China. The results show that with the economic reform and development, income mobility between 2007 and 2009 was much stronger than before. Regarding the structure of income mobility, the 'exchange mobility' is generally the major source, followed by the 'growth mobility'. The comparison with income inequality indicated that the low degree of mobility is ...
Nichols, Emily Bever; Loper, Ann Booker
2012-11-01
The United States has the highest incarceration rate in the world, yet there is relatively little information on how the removal of these adults from households impacts the youth who are left behind. This study used a child-centered lens to examine the impact of incarceration on the school outcomes of youth who resided with a family member or family associate who was incarcerated prior to the youth's 18th birthday. We used data from 11 waves of the National Longitudinal Survey of Youth: Child and Young Adult (n = 3,338, 53 % female). Initial analyses indicated that youth who experienced a household members' incarceration evidenced more socioeconomic challenges, more frequent home adversities, and lower cognitive skills relative to youth who did not experience a household members' incarceration. Results also revealed that youth who had experienced a household member's incarceration were more likely to report extended absence from school and were less likely to graduate from high school relative to those youth who did not experience a household members' incarceration. Counter to our hypotheses, results revealed the incarceration of an extended family member being in the household was the only relation significantly associated with worse school outcomes. Plausibly, families who allow non-immediate criminally involved individuals to reside in the household are experiencing a more pervasive chaotic home environment than those with a parent or sibling incarcerated. Our study suggests that efforts to address the needs of children with incarcerated parents need to be widened to those who experience the loss of any household member due to incarceration.
Household Factors Associated with Self-Harm in Johannesburg, South African Urban-Poor Households.
Directory of Open Access Journals (Sweden)
Nisha Naicker
Full Text Available Low and middle income countries bear the majority burden of self-harm, yet there is a paucity of evidence detailing risk-factors for self-harm in these populations. This study aims to identify environmental, socio-economic and demographic household-level risk factors for self-harm in five impoverished urban communities in Johannesburg, South Africa.Annual serial cross-sectional surveys were undertaken in five impoverished urban communities in Johannesburg for the Health, Environment and Development (HEAD study. Logistic regression analysis using the HEAD study data (2006-2011 was conducted to identify household-level risk factors associated with self-harm (defined as a self-reported case of a fatal or non-fatal suicide attempt within the household during the preceding year. Stepwise multivariate logistic regression analysis was employed to identify factors associated with self-harm.A total of 2 795 household interviews were conducted from 2006 to 2011. There was no significant trend in self-harm over time. Results from the final model showed that self-harm was significantly associated with households exposed to a violent crime during the past year (Adjusted Odds Ratio (AOR 5.72; 95% CI 1.64-19.97; that have a member suffering from a chronic medical condition (AOR 8.95; 95% 2.39-33.56 and households exposed to indoor smoking (AOR 4.39; CI 95% 1.14-16.47.This study provides evidence on household risk factors of self-harm in settings of urban poverty and has highlighted the potential for a more cost-effective approach to identifying those at risk of self-harm based on household level factors.
Evolutionary status of AA Doradus: still an enigma?
International Nuclear Information System (INIS)
Sarna, M.J.
1985-01-01
The evolutionary scenarios for AA Dor are reconsidered using new contraction times for degenerate red dwarfs. It is found that both types of models considered by Paczynski (1980) with the primary being either an hydrogen shell burning helium white dwarf or a double shell burning carbon-oxygen white dwarf are consistent with the available data. The second model requires a very narrow range of the initial parameters of the binary system. 26 refs. (author)
Slot-type pickup/kicker for AA stochastic cooling
1979-01-01
A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning, in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. View down the centre of a pickup or kicker. See also 7906189, 7906190, 7906583.
Slot-type pickup/kicker for AA stochastic cooling
CERN PhotoLab
1979-01-01
A "slotted transmission line" was used for both pickups and kickers of the cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. Here we see the slotted electrodes partly pulled out of the outer casing. See also 7906189, 7906581X, 7896193.
Long-term biases in geomagnetic K and aa indices
Love, J.J.
2011-01-01
Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0-2009.0, solar cycles 11-23. The K data show persistent biases, especially for high (low) K-activity levels at British (Australian) observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4. ?? 2011 Author(s).
Long-term biases in geomagnetic K and aa indices
Directory of Open Access Journals (Sweden)
J. J. Love
2011-08-01
Full Text Available Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0–2009.0, solar cycles 11–23. The K data show persistent biases, especially for high (low K-activity levels at British (Australian observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4.
Cell volume regulation in hemoglobin CC and AA erythrocytes
International Nuclear Information System (INIS)
Berkowitz, L.R.; Orringer, E.P.
1987-01-01
Swelling hemoglobin CC erythrocytes stimulates a ouabain-insensitive K flux that restores original cell volume. Studies were performed with the K analog, 86 Rb. This volume regulatory pathway was characterized for its anion dependence, sensitivity to loop diuretics, and requirement for Na. The swelling-induced K flux was eliminated if intracellular chloride was replaced by nitrate and both swelling-activated K influx and efflux were partially inhibited by 1 mM furosemide or bumetanide. K influx in swollen hemoglobin CC cells was not diminished when Na in the incubation medium was replaced with choline, indicating Na independence of the swelling-induced flux. Identical experiments with hemoglobin AA cells also demonstrated a swelling-induced increase in K flux, but the magnitude and duration of this increase were considerably less than that seen with hemoglobin CC cells. The increased K flux in hemoglobin AA cells was likewise sensitive to anion replacement and to loop diuretics and did not require the presence of Na. These data indicate that a volume-activated K pathway with similar transport characteristics exists in both hemoglobin CC and AA red cells
Household factors influencing participation in bird feeding activity
DEFF Research Database (Denmark)
Davies, Zoe G.; Fuller, Richard A.; Dallimer, Martin
2012-01-01
whether and how the socioeconomic background of a household influences participation in food provision for wild birds, the most popular and widespread form of human-wildlife interaction. A majority of households feed birds (64% across rural and urban areas in England, and 53% within five British study...... cities). House type, household size and the age of the head of the household were all important predictors of bird feeding, whereas gross annual household income, the occupation of the head of the household, and whether the house is owned or rented were not. In both surveys, the prevalence of bird...... a week. The proportion of households regularly feeding birds was positively related to the age of the head of the household, but declined with gross annual income. As concerns grow about the lack of engagement between people and the natural environment, such findings are important if conservation...
Assessment of expenditure on food among urban households and ...
African Journals Online (AJOL)
... on food among urban households and it's implication for food security: Evidence from ... of the sample for the study involved a three-stage sampling technique. ... of enhancing their income to improve the household and economic conditions.
TRANSFER EFFICIENCIES OF PESTICIDES FROM HOUSEHOLD FLOORING SURFACES TO FOODS
The transfer of pesticides from household surfaces to foods was measured to determine if excess dietary exposure potentially occurs when children's foods contact contaminated surfaces prior to being. Three common household surfaces (ceramic tile, hardwood flooring, and carpet) w...
Impact of Weather Index Insurance on Household Demand for ...
African Journals Online (AJOL)
EJBE
confidence about the compensation for expected loss from future weather condition .... found in western zone of Tigray, where the dominant crops are barley and teff. ... (such as age and sex of the household head, schooling level of household.
Gender-specific constraints affecting technology use and household ...
African Journals Online (AJOL)
Gender-specific constraints affecting technology use and household food security in western ... African Journal of Food, Agriculture, Nutrition and Development ... on household food security among smallholders in Western Province of Kenya.
Linking smallholder agriculture and water to household food security ...
African Journals Online (AJOL)
Linking smallholder agriculture and water to household food security and nutrition. ... Promoting household food security and reducing malnutrition rates of a growing population with the same amount of water is ... AJOL African Journals Online.
Acidity and alkalinity in mine drainage: Theoretical considerations
Kirby, Carl S.; Cravotta,, Charles A.
2004-01-01
Acidity, net acidity, and net alkalinity are widely used parameters for the characterization of mine drainage, but these terms are not well defined and are often misunderstood. Incorrect interpretation of acidity, alkalinity, and derivative terms can lead to inadequate treatment design or poor regulatory decisions. We briefly explain derivations of theoretical expressions of three types of alkalinities (caustic, phenolphthalein, and total) and acidities (mineral, CO2, and total). Theoretically defined total alkalinity is closely analogous to measured alkalinity and presents few practical interpretation problems. Theoretically defined “CO2- acidity” is closely related to most standard titration methods used for mine drainage with an endpoint pH of 8.3, but it presents numerous interpretation problems, and it is unfortunately named because CO2 is intentionally driven off during titration of mine-drainage samples. Using the proton condition/massaction approach and employing graphs for visualization, we explore the concept of principal components and how to assign acidity contributions to solution species, including aqueous complexes, commonly found in mine drainage. We define a comprehensive theoretical definition of acidity in mine drainage on the basis of aqueous speciation at the sample pH and the capacity of these species to undergo hydrolysis to pH 8.3. This definition indicates the computed acidity in milligrams per liter (mg L-1 ) as CaCO3 (based on pH and analytical concentrations of dissolved FeIII , FeII , Mn, and Al in mg L-1 ): Aciditycomputed = 50. (10(3-pH) + 3.CFeIII/55.8 + 2.CFeII/55.8 + 2.CMn/54.9 + 3.CAl/27.0) underestimates contributions from HSO4 - and H+ , but overestimates the acidity due to Fe3+. These errors tend to approximately cancel each other. We demonstrate that “net alkalinity” is a valid mathematical construction based on theoretical definitions of alkalinity and acidity. We demonstrate that, for most mine-drainage solutions, a
Fang, Wei; Zhang, Panyue; Zhang, Guangming; Jin, Shuguang; Li, Dongyi; Zhang, Meixia; Xu, Xiangzhe
2014-09-01
To improve anaerobic digestion efficiency, combination pretreatment of alkaline and high pressure homogenization was applied to pretreat sewage sludge. Effect of alkaline dosage on anaerobic sludge digestion was investigated in detail. SCOD of sludge supernatant significantly increased with the alkaline dosage increase after the combined pretreatment because of sludge disintegration. Organics were significantly degraded after the anaerobic digestion, and the maximal SCOD, TCOD and VS removal was 73.5%, 61.3% and 43.5%, respectively. Cumulative biogas production, methane content in biogas and biogas production rate obviously increased with the alkaline dosage increase. Considering both the biogas production and alkaline dosage, the optimal alkaline dosage was selected as 0.04 mol/L. Relationships between biogas production and sludge disintegration showed that the accumulative biogas was mainly enhanced by the sludge disintegration. The methane yield linearly increased with the DDCOD increase as Methane yield (ml/gVS)=4.66 DDCOD-9.69. Copyright © 2014 Elsevier Ltd. All rights reserved.
Acidic minespoil reclamation with alkaline biosolids
International Nuclear Information System (INIS)
Drill, C.; Lindsay, B.J.; Logan, T.L.
1998-01-01
The effectiveness of an alkaline stabilized biosolids product, N-Viro Soil (NVS), was studied at a wild animal preserve in Cumberland, OH. The preserve occupies land that was strip mined for high-sulfur coal. While most of the land has been conventionally reclaimed, several highly acidic hot spots remain. Two of these hot spots were studied through concurrent field, greenhouse, and laboratory projects. In April 1995, NVS was applied at rates ranging from 0--960 mt/ha (wet wt.) to plots at the two sites. The plots were seeded using a standard reclamation mix and soil samples were analyzed for chemical characteristics before and after application and also in 1996 and 1997. Soil pH increased from 3.5 to about 11 in the amended plots and soil EC values increased from 21.0 mmho/cm to a maximum of 6.0 mmho/cm in the amended plots immediately after application. Soil Cu and Zn concentrations also increased in the NVS amended plots, but this did not affect plant germination or growth. By the summer of 1996, soil pH values had decreased to 7.3--8.7 and EC values decreased to 0.34--1.36 mmho/cm to the amended plots. Soil samples were collected in September 1995 for physical analyses. N-Viro Soil improved the moisture retention and water conductivity properties of the spoil. The plots were monitored for growth during the summer of 1995 and plant biomass and soil samples were taken in 1996 and 1997 for trace element and nutrient analysis. NVS did not significantly increase trace element concentrations in the biomass. The addition of NVS to acid mine spoil improves the chemical and physical properties of the spoil material thus aiding vegetative establishment and growth. NVS improves the chemical nature of the spoil by increasing pH and providing micro and macronutrients and improves the physical properties of the spoil with the addition of organic matter
Determinants of Household Poverty: Empirical Evidence from Pakistan
Majeed, Muhammad Tariq; Malik, Muhammad Nauman
2014-01-01
This study examines household characteristics and personal characteristics of the household head as the determinants of poverty in Pakistan. The study decomposes education of the household into different levels: primary, middle, matriculation, intermediate, bachelors and higher studies and finds evidence that poverty is greatest among the less literate households and declines as education level increases. The role of remittances appeared significant in reducing probability of being poor and t...
The existence and persistence of household financial hardship
Brown, S.; Ghosh, P.; Taylor, K.
2012-01-01
We investigate the existence and persistence of financial hardship at the household level using data from the British Household Panel Survey. Our modelling strategy makes three important contributions to the existing literature on household finances. Firstly, we model nine different types of household financial problems within a joint framework, allowing for correlation in the random effects across the nine equations. Secondly, we develop a dynamic framework in order to model the persistence ...
Srinivas, B.; Cheepu, Muralimohan; Sivaprasad, K.; Muthupandi, V.
2018-03-01
The present study focuses on a sheet thickness of 4 mm using different laser power and welding rate by the laser beam welding (LBW) at a beam size180 μm. The observations on the weldments are showing that thermal conductivity of the materials plays a major role on microstructural changes. The as-welded mechanical properties were studied by correlation with its microstructures. Due to the steeper temperature gradient during the laser beam welding AA6061 was showing the greater variation compares with AA5083 side in the micro hardness studies.Also, the tensile strength of 241 MPa has been reported as highest with the welds made of laser powerat 3.5 kW and welding rate at 3.5 mmin-1.
International Nuclear Information System (INIS)
Sagai Francis Britto, A.; Raj, R. Edwin; Mabel, M. Carolin
2017-01-01
Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.
Energy Technology Data Exchange (ETDEWEB)
Sagai Francis Britto, A. [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Raj, R. Edwin, E-mail: redwinraj@gmail.com [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Mabel, M. Carolin [Department of Electrical and Electronics Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India)
2017-04-24
Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.
Directory of Open Access Journals (Sweden)
Hülya KAÇAR DURMUŞ
2003-01-01
Full Text Available Mechanical properties of some aluminum alloys can be changed with precipitation hardening. This intermetallic precipitates are incoherent with the main structure and increased mechanical properties. Cooling rates after solid solution process effects properties after precipitation. In applications, however this is not taken into consideration. In this study, AA 2014 and AA 2024 Aluminium Alloy specimens were hold for one hour at 495±3 0C and formed a solid solution. Specimens were quenched at this temperature with different cooling rtes . later artificial aging was applied at 150 0C and 180 0C. The hardness and microstructure variations of the specimens were investigated depending on the cooling rates and artificial aging temperatures.
Household market participation and stunting in preschool children in ...
African Journals Online (AJOL)
2011-03-26
Mar 26, 2011 ... by George Mason University (USA) and the Malawi National Health ... Only two participating households had electricity. None of the households had running water in the home. Although HIV/acquired immune deficiency syndrome .... households.3 Tobacco is Malawi's largest export, accounting for 6%.
Factors Influencing Household Solid Waste Management in Urban ...
African Journals Online (AJOL)
The main objective of this study was to determine factors that influence household solid waste management practices in urban Nyeri Municipality. Descriptive cross- sectional ... Results from the survey showed that 26.2% of households practiced correct methods of household solid waste management. The percentage of ...
50 CFR 36.36 - Sled dogs and household pets.
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Sled dogs and household pets. 36.36... Sled dogs and household pets. The general trespass provisions of 50 CFR 26.21 shall not apply to household pets and sled, work, or pack dogs under the direct control of their owners or handlers, but such...
Household Expenditures on Private Tutoring: Emerging Evidence from Malaysia
Kenayathulla, Husaina Banu
2013-01-01
Private tutoring has been a burgeoning phenomenon in Malaysia for decades. This study examines the determinants of private tutoring expenditures in Malaysia using the 2004/2005 Household Expenditures Survey and applies hurdle regression models to the data. The results indicate that total household expenditures, household head's level of education,…
Taxation and the household saving rate: evidence from OECD countries
Directory of Open Access Journals (Sweden)
Vito Tanzi
2000-03-01
Full Text Available This paper analyzes anew the relationship between taxation and the household saving rate. On the basis of standard savings and tax revenue data from a sample of OECD countries, it provides compelling empirical evidence of a powerful impact of taxes on household savings. In particular, income taxes are shown to affect negatively the household saving rate much more than consumption taxes.
Microfinance Programs in Uganda: An Analysis of Household ...
African Journals Online (AJOL)
This paper identifies a model of low-income household participation in microfinance credit programs and the effects on investment behavior from repeated access to these institutions using evidence from household survey data. The primary focus is on changes in household investment behavior, not the assessment of ...
Breakup of New Orleans Households after Hurricane Katrina
Rendall, Michael S.
2011-01-01
Theory and evidence on disaster-induced population displacement have focused on individual and population-subgroup characteristics. Less is known about impacts on households. I estimate excess incidence of household breakup resulting from Hurricane Katrina by comparing a probability sample of pre-Katrina New Orleans resident adult household heads…
7 CFR 2902.48 - General purpose household cleaners.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false General purpose household cleaners. 2902.48 Section... PROCUREMENT Designated Items § 2902.48 General purpose household cleaners. (a) Definition. Products designed... procurement preference for qualifying biobased general purpose household cleaners. By that date, Federal...
Retirement adequacy goals for South African households | Butler ...
African Journals Online (AJOL)
South African Actuarial Journal ... Household wealth–earnings ratio goals were estimated to be between 10,5 and 18,2 times annual salary depending on retirement age, household composition, income, location, age, education, household income distribution, home ownership and salary support. Considering current ...
Food waste from Danish households: Generation and composition
DEFF Research Database (Denmark)
Edjabou, Maklawe Essonanawe; Petersen, Claus; Scheutz, Charlotte
2016-01-01
waste was divided into six fractions according to avoidability, suitability for home-composting and whether or not it was cooked, prepared or had been served within the household. The results showed that the residual household waste generation rate was 434 ± 18 kg per household per year, of which 183...
Market participation among rice producing households in Abia state ...
African Journals Online (AJOL)
Estimates of the determinants of market participation among households in the study area showed that the coefficients of household size, output, farm size, extension contact, distance from farm to market, membership of societies were significant in influencing market participation among rice producing households. Among ...
Household time allocation model based on a group utility function
Zhang, J.; Borgers, A.W.J.; Timmermans, H.J.P.
2002-01-01
Existing activity-based models typically assume an individual decision-making process. In household decision-making, however, interaction exists among household members and their activities during the allocation of the members' limited time. This paper, therefore, attempts to develop a new household
Distributions of households by size: differences and trends.
Kuznets, S
1982-01-01
"This article deals with the distributions of households by size, that is, by number of persons, as they are observed in international comparisons, and for fewer countries, over time." The contribution of differentials in household size to inequality in income distribution among persons and households is discussed. Data are for both developed and developing countries. excerpt
Towards sustainable household energy use in the Netherlands
van der Wal, J; Moll, H.C.
2001-01-01
Households consume direct energy, using natural gas, heating oil, gasoline and electricity, and consume indirect energy, the energy related to the production of goods and the delivery of services for the households. Past trends and present-day household energy use (direct and indirect) are analysed
Household burden of chronic diseases in Ghana | Togoe | Ghana ...
African Journals Online (AJOL)
Conclusion: The relatively high direct cost of illness among households with person(s) living with NCDs and the associated high indirect burden of illness places undue stress on households. Research requires better measurement of the indirect burden with focus on the household. These findings suggest the necessity of ...
Household size and composition as correlates of child labour in ...
African Journals Online (AJOL)
We provide a comprehensive overview of the household factors and residential dynamics through which child labour evolves. Our findings demonstrate the usefulness of the household production theory in explaining the socio-economic ramifications and household context of child labour. Our findings indicate that although ...
Determinants of food security among cocoa producing households ...
African Journals Online (AJOL)
The study was set out to analyse the determinants of food security among the cocoa producing households in Abia state, Nigeria. The specific objectives are to: determine the food security status of the households and estimate the determinants of food security among the cocoa producing households in the study area.
Determinants of Household Socio-economic Status in an Urban ...
African Journals Online (AJOL)
2016-05-01
May 1, 2016 ... tended to correspond with high income status of the households. ... figures to describe household socio-economic status remains a gap that ... Accra because it is skills, knowledge and the abilities which enable ... the city) that people rely on to achieve their livelihood objectives. ..... Gender of household.
The dynamics of Chinese rural households' participation in labor markets
Brosig, S.; Glauben, T.; Herzfeld, T.; Rozelle, S.; Wang, X.
2007-01-01
The work is devoted to the dynamics of labor market participation of Chinese rural households. Based on a theoretical farm household framework the choice between four distinct labor market participation states is empirically analyzed. Using household data over the period 1995¿2002 from the province
INDIGENOUS HOUSEHOLDS, REMITTANCES AND LIFE QUALITY
Directory of Open Access Journals (Sweden)
Ignacio César Cruz Islas
2014-07-01
Full Text Available Mexican migration to other countries, primarily United States, is a phenomenon that has been studied from different approaches. It is an important flow of people who, for decades, has left Mexico in search of employment opportunities and higher income. This is due to the weakness of opportunities structure present in Mexico, predominantly in rural areas, as well as budget constraints that prevent households to improve their living conditions. Remittances from other countries, in turn, are an alternative for families to address the lack of employment opportunities and income in their homeland, as well as life-deficit conditions. To see how remittances impact on living conditions of indigenous population, in this paper we analyze living conditions of indigenous households.
Bacterial Zoonoses Transmitted by Household Pets
DEFF Research Database (Denmark)
Damborg, Peter Panduro; Broens, E.M.; Chomel, B.B.
2016-01-01
The close contact between household pets and people offers favourable conditions for bacterial transmission. In this article, the aetiology, prevalence, transmission, impact on human health and preventative measures are summarized for selected bacterial zoonoses transmissible by household pets. Six...... zoonoses representing distinct transmission routes were selected arbitrarily based on the available information on incidence and severity of pet-associated disease caused by zoonotic bacteria: bite infections and cat scratch disease (physical injuries), psittacosis (inhalation), leptospirosis (contact...... with urine), and campylobacteriosis and salmonellosis (faecal–oral ingestion). Antimicrobial resistance was also included due to the recent emergence of multidrug-resistant bacteria of zoonotic potential in dogs and cats. There is a general lack of data on pathogen prevalence in the relevant pet population...
Household Classification Using Smart Meter Data
Directory of Open Access Journals (Sweden)
Carroll Paula
2018-03-01
Full Text Available This article describes a project conducted in conjunction with the Central Statistics Office of Ireland in response to a planned national rollout of smart electricity metering in Ireland. We investigate how this new data source might be used for the purpose of official statistics production. This study specifically looks at the question of determining household composition from electricity smart meter data using both Neural Networks (a supervised machine learning approach and Elastic Net Logistic regression. An overview of both classification techniques is given. Results for both approaches are presented with analysis. We find that the smart meter data alone is limited in its capability to distinguish between household categories but that it does provide some useful insights.
Determinants of household energy consumption in India
International Nuclear Information System (INIS)
Ekholm, Tommi; Krey, Volker; Pachauri, Shonali; Riahi, Keywan
2010-01-01
Improving access to affordable modern energy is critical to improving living standards in the developing world. Rural households in India, in particular, are almost entirely reliant on traditional biomass for their basic cooking energy needs. This has adverse effects on their health and productivity, and also causes environmental degradation. This study presents a new generic modelling approach, with a focus on cooking fuel choices, and explores response strategies for energy poverty eradication in India. The modelling approach analyzes the determinants of fuel consumption choices for heterogeneous household groups, incorporating the effect of income distributions and traditionally more intangible factors such as preferences and private discount rates. The methodology is used to develop alternate future scenarios that explore how different policy mechanisms such as fuel subsidies and micro-financing can enhance the diffusion of modern, more efficient, energy sources in India.
Determinants of household energy consumption in India
Energy Technology Data Exchange (ETDEWEB)
Ekholm, Tommi [VTT Technical Research Centre of Finland, P.O. Box 1000, FIN-02044 VTT (Finland); TKK Helsinki University of Technology, Espoo (Finland); Krey, Volker; Pachauri, Shonali; Riahi, Keywan [International Institute for Applied Systems Analysis, Laxenburg (Austria)
2010-10-15
Improving access to affordable modern energy is critical to improving living standards in the developing world. Rural households in India, in particular, are almost entirely reliant on traditional biomass for their basic cooking energy needs. This has adverse effects on their health and productivity, and also causes environmental degradation. This study presents a new generic modelling approach, with a focus on cooking fuel choices, and explores response strategies for energy poverty eradication in India. The modelling approach analyzes the determinants of fuel consumption choices for heterogeneous household groups, incorporating the effect of income distributions and traditionally more intangible factors such as preferences and private discount rates. The methodology is used to develop alternate future scenarios that explore how different policy mechanisms such as fuel subsidies and micro-financing can enhance the diffusion of modern, more efficient, energy sources in India. (author)
Energy Technology Data Exchange (ETDEWEB)
Verstraete, K., E-mail: kevin.verstraete@u-psud.fr [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Helbert, A.L. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Brisset, F. [Université Paris-Sud, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Benoit, A.; Paillard, P. [Institut des Matériaux Jean Rouxel (IMN), UMR 6502, Polytech’Nantes, Nantes Cedex (France); Baudin, T. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France)
2015-07-29
AA6061 alloy is a widely used material in the automotive and aerospace industries, but is prone to hot cracking, which limits its weldability. To prevent this phenomenon, the AA6061/AA5754 composite was formed using a severe plastic deformation technique, Cross Accumulative Roll Bonding (CARB), at an elevated temperature (350 °C) to ensure good bonding between layers. This technique was efficient to maintain a small grain size, even under the process temperature conditions, and consequently, preserve good mechanical properties. The composite had better mechanical properties than the initial aluminium alloys. Microstructure and texture remained stable after two cycles and yield stress tended towards an equal value in the rolling and the transverse directions. After two cycles, the main component was the {001}〈110〉 rotated Cube, which was maintained for up to 10 cycles. Diffusion was more effective as the strain increased. Finally, a tungsten inert gas (TIG) welding process was performed on the composite and confirmed resistance to hot cracking.
Tamura, Hiroaki; Hasegawa, Kiminori
2009-02-01
AA amyloidosis is a life threatening clinical complication of chronic inflammatory diseases such as rheumatoid arthritis. It has been demonstrated biochemically that amyloidosis resulted from abnormal folding of proteins, which are deposited as insoluble fibrils in extracellular tissue, leading to the disruption of their normal function. In this regard, amyloidosis has been recognized as a conformation disorder. Interestingly, genetic polymorphisms of amyloid precursor protein (SAA) have been reported to associate with increased risk for AA amyloidosis. Also recent biochemical research revealed that SAA is synthesized under the influence of the proinflammatory cytokines, such as IL-6, TNF-alpha, IL-1. Additionally, it was suggested that amyloid deposits in extracellular tissue could reflect to the serum level of SAA in the reversible fashion, leading to the hypothesis that the control of the SAA synthesis could be beneficial to the treatment of amyloidosis. In this context, anti-cytokine therapies may be most effective. Especially the inhibition of IL-6 is critical to suppression of SAA production, so treatment with a humanized monoclonal antibody against human IL-6 receptor may not only ameliorate RA disease activity but also pave the way for the treatment of AA amyloidosis.
Serum alkaline phosphatase screening for vitamin D deficiency states
International Nuclear Information System (INIS)
Shaheen, S.; Barrakzai, Q.
2012-01-01
Objective: To determine whether serum vitamin D levels are correlated with serum levels of alkaline phosphatase or not. Study Design: Cross-sectional, observational study. Place and Duration of Study: Multi-centre study, conducted at Liaquat National Hospital and Medical College, National Medical Centre and Medicare Hospital, Karachi, from January to October 2009. Methodology: Patients attending the Orthopaedic OPDs with complaints of pain in different body regions and serum vitamin D/sub 3/ levels of greater or equal to 30 ng/ml were included in the study. Patients with vitamin D deficiency were further categorized into mild deficiency or insufficiency (vit. D/sub 3/ = 20-29 ng/ml), moderate deficiency (vit. D/sub 3/ = 5 - 19 ng/ml) and severe deficiency forms (vit. D/sub 3/ < 5 ng/ml). Pearson correlation was applied to test the correlation of serum alkaline phosphatase levels with serum vitamin D/sub 3/ levels. P-value < 0.05 was considered to be significant. Results: Out of 110 samples, 26 had mild (23%), 61 had moderate (55%) and 21 had severe (19.1%) vitamin D deficiencies. All of the patients in the three groups had alkaline phosphatase with in normal limits and the total mean value of the enzyme was 135.97 +- 68.14I U/L. The inter group comparison showed highest values of alkaline phosphatase in the moderate vitamin D deficiency group. The correlation coefficient of alkaline phosphatase and serum vitamin D/sub 3/ levels was r =0.05 (p =0.593). Conclusion: Serum vitamin D/sub 3/ levels may not be correlated with increased serum alkaline phosphatase levels. Therefore, alkaline phosphatase may not be used as a screening test to rule out vitamin D deficiency. (author)
Evaluation of some bean lines tolerance to alkaline soil
Directory of Open Access Journals (Sweden)
Abeer A. Radi
2012-01-01
Full Text Available Introduction: In less arid climates, salts are less concentrated and sodium dominates in carbonate and bicarbonate forms, which enhance the formation of alkaline soils. The development and identification of salt-tolerant crop cultivars or lines would complement salt management programs to improve the productivity and yields of salt stressed plants.Materials and methods: This work was to study the evaluation of alkalinity tolerance of some bean lines grown under different levels of sodium carbonate (Na2CO3 to select the most alkalinity tolerant lines versus the most-sensitive ones out of 6 lines of the test plants.Results: The symptoms induced by alkalinity included reduction in root, shoot growth, and leaf area which were more severe in some bean lines. Potassium leakage was severely affected by alkalinity in some lines at all tested levels, while in some others a moderate damage was manifested only at the higher levels. The increase in Na2CO3 level was associated with a gradual fall in chlorophyll a and b biosynthesis of all the test bean lines. However, alkalinity at low and moderate levels had a favorable effect on the biosynthesis of carotenoids in all the test bean lines. The increase in Na2CO3 supply had a considerable stimulatory effect on sodium accumulation, while potassium accumulation fluctuated in organs of bean lines.Conclusion: Assiut 1104 out of all the different lines investigated was found to display the lowest sensitivity to alkalinity stress, while Assiut 12/104 was the most sensitive one.
Rural Household Demographics, Livelihoods and the Environment
de Sherbinin, Alex; VanWey, Leah; McSweeney, Kendra; Aggarwal, Rimjhim; Barbieri, Alisson; Henry, Sabina; Hunter, Lori M.; Twine, Wayne
2008-01-01
This paper reviews and synthesizes findings from scholarly work on linkages among rural household demographics, livelihoods and the environment. Using the livelihood approach as an organizing framework, we examine evidence on the multiple pathways linking environmental variables and the following demographic variables: fertility, migration, morbidity and mortality, and lifecycles. Although the review draws on studies from the entire developing world, we find the majority of micro-level studie...
THE DETERMINANTS OF HOUSEHOLD DEBT DEFAULT
ALFARO, RODRIGO; GALLARDO, NATALIA
2012-01-01
In this paper, we study household debt default behavior in Chile using survey data. Previous research in this area suggests financial and personal variables help estimate individual and group probabilities of default. We study mortgage and consumer default separately, as the default decisions and overall borrower behavior are different for each type of debt. Our study finds that income and income-related variables are the only significant and robust variables that explain default for both typ...
Occurrence of Legionella in UK household showers.
Collins, Samuel; Stevenson, David; Bennett, Allan; Walker, Jimmy
2017-04-01
Household water systems have been proposed as a source of sporadic, community acquired Legionnaires' disease. Showers represent a frequently used aerosol generating device in the domestic setting yet little is known about the occurrence of Legionella spp. in these systems. This study has investigated the prevalence of Legionella spp. by culture and qPCR in UK household showers. Ninety nine showers from 82 separate properties in the South of England were sampled. Clinically relevant Legionella spp. were isolated by culture in 8% of shower water samples representing 6% of households. Legionella pneumophila sg1 ST59 was isolated from two showers in one property and air sampling demonstrated its presence in the aerosol state. A further 31% of showers were positive by Legionella spp. qPCR. By multi-variable binomial regression modelling Legionella spp. qPCR positivity was associated with the age of the property (p=0.02), the age of the shower (p=0.01) and the frequency of use (p=0.09). The concentration of Legionella spp. detected by qPCR was shown to decrease with increased frequency of use (p=0.04) and more frequent showerhead cleaning (p=0.05). There was no association between Legionella spp. qPCR positivity and the cold water supply or the showerhead material (p=0.65 and p=0.71, respectively). Household showers may be important reservoirs of clinically significant Legionella and should be considered in source investigations. Simple public health advice may help to mitigate the risk of Legionella exposure in the domestic shower environment. Crown Copyright © 2016. Published by Elsevier GmbH. All rights reserved.
Intra-Household Allocation of Parental Leave
Gobbi, Paula Eugenia; Parys, Juliane; Schwerhoff, Gregor
2015-01-01
We introduce childcare sharing in a collective model of household behavior to investigate which factors make spouses increase or decrease their share of parental leave. The concern about future consumption motivates parents to invest in their human capital and to limit their leave duration. Using relative income and the age difference between spouses as distribution factors, we cannot reject Pareto efficiency in childcare sharing. Higher relative incomes and larger age differences shift the c...
An Empirical Investigation of Household Dynamics
Vicky Barham; Rose Anne Devlin
2003-01-01
Using a Canadian micro data set, this paper uses econometric techniques to investigate the impact of public goods and public policy on the decisions to marry and divorce. Among other things, we find that public goods (home ownership, presence of children in the home, shiftwork) have a clear impact on the probability of divorce. From a policy perspective, we examine how the introduction of the 1997 Child Support Guidelines affects household formation and dissolution. While their impact on marr...
Child Benefit Payments and Household Wealth Accumulation
Melvin Stephens Jr.; Takashi Unayama
2014-01-01
Using the life-cycle/permanent income hypothesis, we theoretically and empirically assess the impact of child benefit payments on household wealth accumulation. Consistent with the predictions of the model, we find that higher cumulative benefits received increase current assets, higher future benefit payments lower asset holding, and that these effects systematically vary over the life-cycle. We find different wealth responses to child benefit payments for liquidity constrained and unconstra...
Female relative wages, household specialization and fertility
Siegel, Christian
2017-01-01
Falling fertility rates have often been linked to rising female wages. However, over the last 40 years the US total fertility rate has been rather stable while female wages have continued to grow. Over the same period, women's hours spent on housework have declined, but men's have increased. I propose a model in which households are not perfectly specialized, but both men and women contribute to home production. As the gender wage gap narrows, the time allocations of men and women converge, a...
Ubiquitous Monitoring of Electrical Household Appliances
Lloret, Jaime; Macías, Elsa; Suárez, Alvaro; Lacuesta, Raquel
2012-01-01
The number of appliances at home is increasing continuously, mainly because they make our lives easier. Currently, technology is integrated in all objects of our daily life. TCP/IP let us monitor our home in real time and check ubiquitously if something is happening at home. Bearing in mind this idea, we have developed a low-cost system, which can be used in any type of electrical household appliance that takes information from the appliance and posts the information to the Twitter Social network. Several sensors placed in the household appliances gather the sensed data and send them wired or wirelessly, depending on the case, using small and cheap devices to a gateway located in the home. This gateway takes decisions, based on the received data, and sends notifications to Twitter. We have developed a software application that takes the values and decides when to issue an alarm to the registered users (Twitter friends of our smart home). The performance of our system has been measured taking into account the home network (using IEEE 802.3u and IEEE 802.11g) and the data publishing in Twitter. As a result, we have generated an original product and service for any electrical household appliance, regardless of the model and manufacturer, that helps home users improve their quality of life. The paper also shows that there is no system with the same innovative features like the ones presented in this paper. PMID:23202205
Radioactivity of household water in Finland
International Nuclear Information System (INIS)
Salonen, L.; Saxen, R.
1991-01-01
A nationwide study on artificial and natural radioactivity in household water has been under way in Finland since the 1960s. The occurrence of artificial radionuclides in the surface water of drainage basins has been monitored extensively. The proportion of household water derived from surface waters in Finland is currently 48 %, but its usage is decreasing whereas that of groundwater is increasing at an annual rate of 1 - 2 %. The natural radioactivity of household water has been studied in almost all of the waters distributed by public waterworks and in 5400 private ground water wells. The downward trend in 90 Sr, 137 Cs and 3 H concentrations in surface water continued from the middle 1960s until the Chernobyl accident. After the accident ten different radionuclides were detected in surface waters, but only 137 Cs made a minor contribution the radiation dose. The maximum effective dose via ingestion of water was about 0.001 mSv in 1986, and considerably lower in the following years
Household hazardous waste management: a review.
Inglezakis, Vassilis J; Moustakas, Konstantinos
2015-03-01
This paper deals with the waste stream of household hazardous waste (HHW) presenting existing management systems, legislation overview and other relevant quantitative and qualitative information. European Union legislation and international management schemes are summarized and presented in a concise manner by the use of diagrams in order to provide crucial information on HHW. Furthermore, sources and types, numerical figures about generation, collection and relevant management costs are within the scope of the present paper. The review shows that the term used to refer to hazardous waste generated in households is not clearly defined in legislation, while there is absence of specific acts regulating the management of HHW. The lack of obligation to segregate HHW from the household waste and the different terminology used makes it difficult to determine the quantities and composition of this waste stream, while its generation amount is relatively small and, therefore, is commonly overlooked in waste statistics. The paper aims to cover the gap in the related literature on a subject that is included within the crucial waste management challenges at world level, considering that HHW can also have impact on other waste streams by altering the redox conditions or causing direct reactions with other non hazardous waste substances. Copyright © 2014 Elsevier Ltd. All rights reserved.
Ubiquitous monitoring of electrical household appliances.
Lloret, Jaime; Macías, Elsa; Suárez, Alvaro; Lacuesta, Raquel
2012-11-07
The number of appliances at home is increasing continuously, mainly because they make our lives easier. Currently, technology is integrated in all objects of our daily life. TCP/IP let us monitor our home in real time and check ubiquitously if something is happening at home. Bearing in mind this idea, we have developed a low-cost system, which can be used in any type of electrical household appliance that takes information from the appliance and posts the information to the Twitter Social network. Several sensors placed in the household appliances gather the sensed data and send them wired or wirelessly, depending on the case, using small and cheap devices to a gateway located in the home. This gateway takes decisions, based on the received data, and sends notifications to Twitter. We have developed a software application that takes the values and decides when to issue an alarm to the registered users (Twitter friends of our smart home). The performance of our system has been measured taking into account the home network (using IEEE 802.3u and IEEE 802.11g) and the data publishing in Twitter. As a result, we have generated an original product and service for any electrical household appliance, regardless of the model and manufacturer, that helps home users improve their quality of life. The paper also shows that there is no system with the same innovative features like the ones presented in this paper.
NCBI nr-aa BLAST: CBRC-DDIS-01-0111 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-01-0111 ref|XP_636760.1| alkaline dihydroceramidase [Dictyostelium discoi...deum AX4] gb|AAQ98884.1| alkaline dihydroceramidase [Dictyostelium discoideum] gb|EAL63276.1| alkaline dihydroceramidase [Dictyostelium discoideum AX4] XP_636760.1 7e-59 45% ...
Anticipatory child fostering and household economic security in Malawi
Directory of Open Access Journals (Sweden)
Lauren Bachan
2014-04-01
Full Text Available Background: While there is a rich literature on the practice of child fostering in sub-Saharan Africa, little is known about how fostering impacts receiving households, as few studies consider household conditions both before and after fostering. Despite the fact that circumstancessurrounding fostering vary, the literature's key distinction of fostering is often drawn along the simple line of whether or not a household is fostering a child. This paper argues that anticipation of fostering responsibilities, in particular, is a useful dimension to distinguish fostering experiences for receiving households. Objective: This paper examines the relationship between receiving a foster child and subsequent changes in household wealth. Particular emphasis is placed on how these changes are conditioned by differing levels of anticipation of the fostering event. Methods: This study uses data from Tsogolo la Thanzi (TLT, a longitudinal survey in Balaka, Malawi. Using data from 1754 TLT respondents, fixed effects pooled time-series models are estimated to assess whether and how receiving a foster child changes household wealth. Results: This paper demonstrates the heterogeneity of fostering experiences for receiving households.The results show that households that anticipate fostering responsibilities experience a greater increase in household wealth than both households that do not foster and those that are surprised by fostering. Conclusions: Households that anticipate fostering responsibilities exhibit the greatest increase in householdwealth. While fostering households that do not anticipate fostering responsibilities may not experience these gains, there is no evidence to indicate that such households are negatively impacted relative to households that do not foster. This finding suggests that additional childcare responsibilities may not be as detrimental to African households as some researchers have feared.
Impact of Osteoarthritis on Household Catastrophic Health Expenditures in Korea.
Kim, Hyoungyoung; Cho, Soo-Kyung; Kim, Daehyun; Kim, Dalho; Jung, Sun-Young; Jang, Eun Jin; Sung, Yoon-Kyoung
2018-05-21
Osteoarthritis (OA) is a disease of old age whose prevalence is increasing. This study explored the impact of OA on household catastrophic health expenditure (CHE) in Korea. We used data on 5,200 households from the Korea Health Panel Survey in 2013 and estimated annual living expenses and out-of-pocket (OOP) payments. Household CHE was defined when a household's total OOP health payments exceeded 10%, 20%, 30%, or 40% of the household's capacity to pay. To compare the OOP payments of households with OA individuals and those without OA, OA households were matched 1:1 with households containing a member with other chronic disease such as neoplasm, hypertension, heart disease, cerebrovascular disease, diabetes, or osteoporosis. The impact of OA on CHE was determined by multivariable logistic analysis. A total of 1,289 households were included, and households with and without OA patients paid mean annual OOP payments of $2,789 and $2,607, respectively. The prevalence of household CHE at thresholds of 10%, 20%, 30%, and 40% were higher in households with OA patients than in those without OA patients ( P < 0.001). The presence of OA patients in each household contributed significantly to CHE at thresholds of 10% (odds ratio [OR], 1.48; 95% confidence interval [CI], 1.16-1.87), 20% (OR, 1.29; 95% CI, 1.01-1.66), and 30% (OR, 1.37; 95% CI, 1.05-1.78), but not of 40% (OR, 1.17; 95% CI, 0.87-1.57). The presence of OA patients in Korean households is significantly related to CHE. Policy makers should try to reduce OOP payments in households with OA patients.
76 FR 6794 - 30-Day Submission Period for Requests for ONC-Approved Accreditor (ONC-AA) Status
2011-02-08
... Accreditor (ONC-AA) Status AGENCY: Office of the National Coordinator for Health Information Technology... submission of requests for ONC-Approved Accreditor (ONC-AA) status. Authority: 42 U.S.C. 300jj-11. DATES: The... for ONC-AA status may be submitted. The 30-day period for submission of requests for ONC-AA status...
Investigating Mechanisms of Alkalinization for Reducing Primary Breast Tumor Invasion
Directory of Open Access Journals (Sweden)
Ian F. Robey
2013-01-01
Full Text Available The extracellular pH (pHe of many solid tumors is acidic as a result of glycolytic metabolism and poor perfusion. Acidity promotes invasion and enhances metastatic potential. Tumor acidity can be buffered by systemic administration of an alkaline agent such as sodium bicarbonate. Tumor-bearing mice maintained on sodium bicarbonate drinking water exhibit fewer metastases and survive longer than untreated controls. We predict this effect is due to inhibition of tumor invasion. Reducing tumor invasion should result in fewer circulating tumor cells (CTCs. We report that bicarbonate-treated MDA-MB-231 tumor-bearing mice exhibited significantly lower numbers of CTCs than untreated mice (. Tumor pHe buffering may reduce optimal conditions for enzymes involved in tumor invasion such as cathepsins and matrix metalloproteases (MMPs. To address this, we tested the effect of transient alkalinization on cathepsin and MMP activity using enzyme activatable fluorescence agents in mice bearing MDA-MB-231 mammary xenografts. Transient alkalinization significantly reduced the fluorescent signal of protease-specific activatable agents in vivo (. Alkalinization, however, did not affect expression of carbonic anhydrase IX (CAIX. The findings suggest a possible mechanism in a live model system for breast cancer where systemic alkalinization slows the rate of invasion.
Characterization of Human Bone Alkaline Phosphatase in Pichia Pastoris
Malone, Christine C.; Ciszak, Eva; Karr, Laurel J.
1999-01-01
A soluble form of human bone alkaline phosphatase has been expressed in a recombinant strain of the methylotrophic yeast Pichia pastoris. We constructed a plasmid containing cDNA encoding for human bone alkaline phosphatase, with the hydrophobic carboxyl terminal portion deleted. Alkaline phosphatase was secreted into the medium to a level of 32mg/L when cultured in shake flasks, and enzyme activity was 12U/mg, as measured by a spectrophotometric assay. By conversion to a fermentation system, a yield of 880mg/L has been achieved with an enzyme activity of 968U/mg. By gel electrophoresis analysis, it appears that greater than 50% of the total protein in the fermentation media is alkaline phosphatase. Although purification procedures are not yet completely optimized, they are expected to include filtration, ion exchange and affinity chromatography. Our presentation will focus on the purification and crystallization results up to the time of the conference. Structural data should provide additional information on the role of alkaline phosphatase in normal bone mineralization and in certain bone mineralization anomalies.
Elevated Serum Level of Human Alkaline Phosphatase in Obesity
International Nuclear Information System (INIS)
Khan, A. R.; Awan, F. R.; Najam, S. S.; Islam, M.; Siddique, T.; Zain, M.
2015-01-01
Objective: To investigate a correlation between serum alkaline phosphatase level and body mass index in human subjects. Methods: The comparative cross-sectional study was carried out at the National Institute for Biotechnology and Genetic Engineering, Faisalabad, Pakistan, from April 2012 to June 2013. Blood serum alkaline phosphatase levels were estimated and the subjects were divided into three sub-groups on the basis of their body mass index: normal weight (<25kg/m2), overweight (25-27kg/m2) and obese (>27kg/m2) subjects. The serum samples were used for the estimation of clinically important biochemical parameters, using commercial kits on clinical chemistry analyser. Results: Of the 197 subjects, 97(49 percent) were obese and 100(51 percent) were non-obese. The serum alkaline phosphatase level increased in obese (214±6.4 IU/L) compared to the non-obese subjects (184.5±5 IU/L). Furthermore, a significant linear relationship (r=0.3;p-0.0001) was found between serum alkaline phosphatase and body mass index. Other biochemical variables were not correlated to the body mass index. Conclusion: Over activity and higher amounts of alkaline phosphatase were linked to the development of obesity. (author)
[AA amyloidosis: a little-known complication of chronic leg ulcer].
Waton, J; Fays-Michel, S; Chandeclerc, M L; Corby, S; Cuny, J F; Barbaud, A; Schmutz, J-L
2008-02-01
AA amyloidosis, secondary to inflammatory chronic diseases like rheumatoid arthritis, is often complicated by renal failure. Chronic inflammatory dermatoses constitute rare causes of AA amyloidosis. We describe two cases of AA amyloidosis discovered after renal failure in patients presenting leg ulcers for several years. AL amyloidosis was suspected in both cases because of a history of monoclonal gammopathy in one patient and of plasmocytoma in the other. The diagnosis of AA amyloidosis was confirmed on renal histology through the detection of AA antibodies in amyloid deposits. No extrarenal amyloidosis was seen in either patient and there were no inflammatory diseases other than chronic leg ulcers. AA amyloidosis is caused by serum amyloid protein A (SAA), a reactive inflammatory protein. AA amyloidosis is thus caused by chronic inflammatory diseases, but only rarely by cutaneous inflammatory diseases. To our knowledge, the literature contains only seven other published cases of AA amyloidosis secondary to chronic leg ulcers. A review of the literature does not indicate whether cure of ulcers has any effect on the accompanying renal failure. We imagine that AA amyloidosis secondary to leg ulcer is in fact under-diagnosed. However, since the first specific treatment for AA amyloidosis is currently being evaluated by the Food and Drug Administration, it is essential that this serious complication of chronic leg ulcers be widely recognised.
Core–corona PSt/P(BA–AA) composite particles by two-stage emulsion polymerization
Energy Technology Data Exchange (ETDEWEB)
Xie, Delong; Ren, Xiaolin; Zhang, Xinya, E-mail: cexyzh@scut.edu.cn; Liao, Shijun [South China University of Technology, School of Chemistry and Chemical Engineering (China)
2016-03-15
Raspberry-shaped composite particles with polystyrene (PSt) as core and poly(n-butyl acrylate-co-acrylic acid) (P(BA–AA)) as corona were synthesized via emulsion polymerization. The random copolymer, P(BA–AA), was pre-prepared and used as a polymeric surfactant, its emulsifying properties adjusted by changing the mass ratio of BA and AA. The morphology of the resulting core–corona composite particles, P(St/P(BA–AA)), could be regulated and controlled by varying the concentrations of P(BA–AA) or the mass ratio of BA:AA in P(BA–AA). The experimental results indicate that 3.0–6.0 wt% of P(BA–AA) is required to obtain stable composite emulsions, and P(BA–AA) with a mass ratio of BA:AA = 1:2 is able to generate distinct core–corona structures. A mechanism of composite particle formation is proposed based on the high affinity between the PSt core and the hydrophobic segments of P(BA–A). The regular morphology of the colloidal film is expected to facilitate potential application of core–corona particles in the field of light scattering. Furthermore, the diversity of core–corona particles can be expanded by replacing P(BA–AA) corona particles with other amphiphilic particles.
AA Attendance and Abstinence for Dually Diagnosed Patients: A Meta-Analytic Review.
Scott Tonigan, J; Pearson, Matthew R; Magill, Molly; Hagler, Kylee J
2018-05-29
There is consensus that best clinical practice for dual diagnosis (DD) is integrated mental health and substance use treatment augmented with Alcoholics Anonymous (AA) attendance. This is the first quantitative review of the direction and magnitude of the association between AA attendance and alcohol abstinence for DD patients. A systematic literature search (1993-2017) identified 22 studies yielding 24 effect sizes that met our inclusion criteria (8,075 patients). Inverse-variance weighting of correlation coefficients (r) was used to aggregate sample-level findings and study aims were addressed using random and mixed effect models. Sensitivity and publication bias analyses were conducted to assess the likelihood of bias in the overall estimate of AA-related benefit. AA exposure and abstinence for DD patients were significantly and positively associated (r w =.249; 95% CI.203-.293; Tau=.097). There was also significant heterogeneity in the distribution of effect sizes, (Q(23)=90.714, pAA-related benefit did not differ between 6 (k=7) and 12 (k=12) month follow-up, (Q=.068, pAA benefit was not adversely or substantively impacted by pooling RCT and observational samples (Q=.763, pAA (Q=.023, pAA) is common and, in many cases, DD patients who attend AA will report higher rates of alcohol abstinence relative to DD patients who do not attend AA. This article is protected by copyright. All rights reserved.
Role and mechanism of AT1-AA in the pathogenesis of HELLP syndrome.
Bu, Shurui; Wang, Yuxian; Sun, Shuqing; Zheng, Yanqian; Jin, Zhu; Zhi, Jianming
2018-01-10
HELLP syndrome remains a leading cause of maternal and neonatal mortality and morbidity worldwide, which symptoms include hemolysis, elevated liver enzymes and low platelet count. The objective of this study was to determine whether HELLP is associated with AT1-AA. The positive rate and titer of AT1-AA in plasma from pregnant women were determined, and the correlation of AT1-AA titer with the grade of HELLP was analyzed. A HELLP rat model established by intravenous injection of AT1-AA. Our experimental results show the AT1-AA titer and positive rate were significantly higher in HELLP group, and AT1-AA titer were positively correlated with the level of TNF-α and ET-1 in plasma and the grade of HELLP syndrome. The results of animal experiments showed that the typical features of HELLP in the pregnant rats after AT1-AA injection. The levels of TNF-α and ET-1 in plasma and liver tissue were significantly increased in AT1-AA-treated rats compared with control rats. The HELLP syndrome induced by AT1-AA was attenuated markedly after administration of losartan. These data support the hypothesis that one the potential pathway that AT1-AA induce damage to capillary endothelial cells and liver during pregnancy is through activation of TNF-α and ET-1.
Vorona, Elena; Nieschlag, Eberhard
2018-02-19
Despite the fact that sports organizations and legislators have introduced various mechanisms to discourage athletes from using performance and appearance enhancing substances a high percentage of athletes admits to their unabated application. In competitive athletics, bodybuilding and in recreational sports anabolic androgenic steroids (AAS) continue to be the substances most abused. This review summarizes the side effects of AAS abuse on organs and system functions in both sexes. High doses of AAS cause a significant increase of erythrocytes und haemoglobin concentration, which may lead to thromboembolism, intracardiac thrombosis and stroke. Long-term AAS abusers have a higher incidence of arrhythmias, atherosclerosis, concentric left-ventricular myocardial hypertrophy with impaired diastolic function and also sudden cardiac death. Changes of liver function and structure, up to hepatocellular carcinoma, have been described, mainly in cases of chronic misuse of 17α-alkylated AAS. Sleeplessness, increased irritability, depressive mood status are often observed in AAS abuse. In former AAS abusers depression, anxiety and melancholy may persist for many years. Due to negative feedback in the regulation of the hypothalamic-pituitary-gonadal axis AAS can cause reversible suppression of spermatogenesis up to azoospermia. In women the changes most often caused by AAS abuse are hirsutism, irreversible deepening of voice, dysmenorrhoea, secondary amenorrhoea with anovulation and infertility. AAS abuse notwithstanding, under clinical conditions testosterone remains the most important hormone for substitution therapy of male hypogonadism.
Effects of household dynamics on resource consumption and biodiversity.
Liu, Jianguo; Daily, Gretchen C; Ehrlich, Paul R; Luck, Gary W
2003-01-30
Human population size and growth rate are often considered important drivers of biodiversity loss, whereas household dynamics are usually neglected. Aggregate demographic statistics may mask substantial changes in the size and number of households, and their effects on biodiversity. Household dynamics influence per capita consumption and thus biodiversity through, for example, consumption of wood for fuel, habitat alteration for home building and associated activities, and greenhouse gas emissions. Here we report that growth in household numbers globally, and particularly in countries with biodiversity hotspots (areas rich in endemic species and threatened by human activities), was more rapid than aggregate population growth between 1985 and 2000. Even when population size declined, the number of households increased substantially. Had the average household size (that is, the number of occupants) remained static, there would have been 155 million fewer households in hotspot countries in 2000. Reduction in average household size alone will add a projected 233 million additional households to hotspot countries during the period 2000-15. Rapid increase in household numbers, often manifested as urban sprawl, and resultant higher per capita resource consumption in smaller households pose serious challenges to biodiversity conservation.
Financial accounting as a method of household finance capacity valuation
Directory of Open Access Journals (Sweden)
A. B. Untanov
2017-01-01
Full Text Available The article presents existing household finance capacity investigations. Comparison conducting allowed to determinate collisions and flaws of previous works. That substantiates to find a new approach in household finance capacity valuation necessity. The article contains theoretical research of household finance fundamental categories. In particular, it notes significant difference between domestic and foreign experience of household finance determination. Although emphasizing key similarities allows identifying household finance capacity composition. Moreover, the article provides a public and corporate finance sectors experience, which contains a huge knowledge of finance capacity investigations. Used research allows classify finance capacity not only as a resource valuation, but also as an economic entity’s ability to generate financial result. In terms of resource valuation, the paper suggests assessing both financial resources in classical meaning and any other property, which participating household economic activity and could be evaluated. The author’s position in terms of household finance capacity valuation is suggested. A broad definition of finance capacity causes applying conceptually different approach in this paper. Thus, comparative analysis method is suggested to substantiate household and corporate firm similarities. Used method allows forming household financial accounting, which leads to clear determination of household finance capacity composition and structure. Specificity forming household financial accounting is considered. An author’s position in regards existing contradictions with early research is suggested.
Determinants of Household Food Security in Urban Areas
Directory of Open Access Journals (Sweden)
Sarah Ayu Mutiah
2017-03-01
Full Text Available Food security at household level is a very important precondition to foster the national and regional food security. Many people migrate to urban areas in the hope of improving their welfare. Generally people think that in the city there are more opportunities, but the opposite is true. The problem is more complex in the city especially for people who do not have adequate skills and education. This study aims to address whether age of household head, household size, education level of household head, income, and distribution of subsidized rice policy affect the food security of urban poor households in Purbalingga district. A hundred respondents were selected from four top villages in urban areas of Purbalingga with the highest level of poverty. Using binary logistic regression, this study finds significant positive effect of education of household head and household income and significant negative effect of household size and raskin on household food security, while age of household head has no significant effect on household food security. The results imply the need for increased awareness of family planning, education, improved skills, and increased control of the implementation of subsidized rice for the poor.
Effect of precipitates on mechanical properties of AA2195
International Nuclear Information System (INIS)
Kim, Jae-Hee; Jeun, Jeong-Hoon; Chun, Hyun-Jin; Lee, Ye Rim; Yoo, Joon-Tae; Yoon, Jong-Hoon; Lee, Ho-Sung
2016-01-01
Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al_2Cu), ß′ (Al_3Zr), and T (Al_xLi_yCu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al_2Cu), ß′ (Al_3Zr), and T_1 (Al_2LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.
Introducing the AAS Working Group on Astroinformatics and Astrostatistics
Ivezic, Zeljko
2014-01-01
In response to two White Papers submitted to the Astro2010 Decadal Survey (1,2), a new AAS Working Group on Astroinformatics and Astrostatistics (WGAA) has been approved by the AAS Council at the 220th Meeting, June 2012, in Anchorage. The motivation for this WG is the growing importance of the interface between astronomy and various branches of applied mathematics, computer science and the emerging field of data science. With the new data-intensive projects envisioned for the coming decade, the need for advice derived from the focused attention of a group of AAS members who work in these areas is bound to increase. The Working Group is charged with spreading awareness of rapidly advancing computational techniques, sophsticated statistical methods, and highly capble software to further the goals of astronomical and astrophysical research. The three main strategic goals adopted by the WGAA Steering Committee for the next few years are to: (i) develop, organize and maintain methodological resources (such as software tools, papers, books, and lectures); (ii) enhance human resources (such as foster the creation of career paths, establish a Speakers' Bureau, establish and maintain an archived discussion forum, enable periodic news distribution); and (iii) organize topical meetings. The WGAA Steering Committee at this time includes twelve members: Kirk Borne, George Djorgovski, Eric Feigelson, Eric Ford, Alyssa Goodman, Joe Hilbe, Zeljko Ivezic (chair), Ashish Mahabal, Aneta Siemiginowska, Alex Szalay, Rick White, and Padma Yanamandra-Fisher. I will summarize our accomplishments since July 2012. (1) Astroinformatics: A 21st Century Approach to Astronomy (Borne & 90 coauthors), (2) The Astronomical Information Sciences: A Keystone for 21st-Century Astronomy (Loredo & 72 coauthors)
Effect of precipitates on mechanical properties of AA2195
Energy Technology Data Exchange (ETDEWEB)
Kim, Jae-Hee [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Jeun, Jeong-Hoon [Department of Materials Science and Engineering, Seoul National University, Seoul (Korea, Republic of); Chun, Hyun-Jin [Southeast University, Nanjing (China); Lee, Ye Rim [Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Yoo, Joon-Tae [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Yoon, Jong-Hoon [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Lee, Ho-Sung, E-mail: hslee@kari.re.kr [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of)
2016-06-05
Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T (Al{sub x}Li{sub y}Cu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T{sub 1} (Al{sub 2}LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.
Increasing Alkalinity Export from Large Russian Arctic Rivers
Drake, T.; Zhulidov, A. V.; Gurtovaya, T. Y.; Spencer, R. G.
2017-12-01
Riverine carbonate alkalinity (HCO3- and CO32-) sourced from chemical weathering of minerals on land represents a significant sink for atmospheric CO2 over geologic timescales. The flux of alkalinity from rivers in the Arctic depends on precipitation, permafrost extent and thaw, groundwater flow paths, and surface vegetation, all of which are changing under a warming climate. Here we show that over the past four decades, the export of alkalinity from the Ob' and Yenisei Rivers has more than doubled. The increase is likely due to a combination of increasing precipitation and permafrost thaw in the watersheds, which lengthens hydrologic flow paths and increases residence time in soils. These trends have broad implications for the rate of carbon sequestration on land and the delivery of buffering capacity to the Arctic Ocean.