WorldWideScience

Sample records for aa hd patients

  1. Seismic analysis of HD 43587Aa, a solar-like oscillator in a multiple system

    NARCIS (Netherlands)

    Boumier, P.; Benomar, O.; Baudin, F.; Verner, G.; Appourchaux, T.; Lebreton, Y.; Gaulme, P.; Chaplin, W.; García, R.A.; Hekker, S.; Regulo, C.; Salabert, D.; Stahn, T.; Elsworth, Y.; Gizon, L.; Hall, M.; Mathur, S.; Michel, E.; Morel, T.; Mosser, B.; Poretti, E.; Rainer, M.; Roxburgh, I.; do Nascimento Jr., J.D.; Samadi, R.; Auvergne, M.; Chaintreuil, S.; Baglin, A.; Catala, C.

    2014-01-01

    Context. The object HD 43587Aa is a G0V star observed during the 145-day LRa03 run of the COnvection, ROtation and planetary Transits space mission (CoRoT), for which complementary High Accuracy Radial velocity Planet Searcher (HARPS) spectra with S/N > 300 were also obtained. Its visual magnitude

  2. Characteristics of AA amyloidosis patients in San Francisco.

    Science.gov (United States)

    Lejmi, Hiba; Jen, Kuang-Yu; Olson, Jean L; James, Sam H; Sam, Ramin

    2016-04-01

    AA amyloidosis due to subcutaneous injection of drugs of abuse has been described in the USA, but all the existing literature is from more than 20 years ago. There is more recent literature from Europe. We have observed a high incidence of AA amyloidosis in the county hospital in San Francisco. Here, we describe 24 patients who had kidney biopsy-proven AA amyloidosis from our hospital from 1998 to 2013. All the patients were thought to have AA amyloidosis from skin popping of illicit drugs after having exhausted the intravenous route. These patients with biopsy-proven AA amyloidosis were analysed further. All patients were found to have hepatitis C infection, hypertension was not common, most had advanced kidney failure, and acidosis was common as was tubulointerstitial involvement on the kidney biopsy. Other organ involvement included hepatomegaly and splenomegaly in a number of patients; direct myocardial involvement was not seen, but pulmonary hypertension, history of deep vein thrombosis and pulmonary embolism were common. The prognosis of these patients was poor. The mortality rate approached 50% 1 year after biopsy, and most of the patient needed dialysis shortly after diagnosis. Cessation of drug use seemed beneficial but rarely achievable. AA amyloidosis from skin popping is common in San Francisco. Most patients with renal involvement end up on dialysis, and mortality rates are exceedingly high. © 2015 Asian Pacific Society of Nephrology.

  3. Plasma ascorbic acid concentrations in prevalent patients with end-stage renal disease on hemodialysis.

    Science.gov (United States)

    Sirover, William D; Liu, Yuguan; Logan, Amanda; Hunter, Krystal; Benz, Robert L; Prasad, Deepali; Avila, Jose; Venkatchalam, Thaliga; Weisberg, Lawrence S; Handelman, Garry J

    2015-05-01

    To determine the prevalence of vitamin C (ascorbic acid [AA]) deficiency in patients with end-stage renal disease, the effect of supplemental AA on plasma AA concentrations, and the extrinsic and intrinsic factors that affect plasma AA concentrations in this patient population. In study 1, we compared the effect of hemodialysis (HD) on plasma AA concentrations between patients with low and high pre-HD AA concentrations. In study 2, we analyzed kinetic and nonkinetic factors for their association with increased plasma AA concentrations in patients on maintenance HD. Study 1 was performed in a single outpatient HD clinic in Cherry Hill, New Jersey. Study 2 was performed in 4 outpatient HD clinics in Southern New Jersey. In study 1, we collected plasma samples from 8 adult patients on maintenance HD at various time points around their HD treatment and assayed them for AA concentration. In study 2, we enrolled 203 adult patients and measured pre-HD plasma AA concentrations. We ascertained supplemental AA use and assessed dietary AA intake. In study 1, plasma AA concentrations were compared during the intradialytic and interdialytic period. In study 2, pre-HD plasma AA concentrations were correlated with supplement use and demographic factors. Study 1 showed that over the course of a single HD treatment, the plasma AA concentration decreased by a mean (±standard deviation) of 60% (±6.6). In study 2, the median pre-HD plasma AA concentration was 15.7 μM (interquartile range, 8.7-66.8) in patients who did not take a supplement and 50.6 μM (interquartile range, 25.1-88.8) in patients who did take a supplement (P HD plasma AA concentration ≥30 μM. HD depletes plasma AA concentrations, and AA supplementation allows patients to achieve higher plasma AA concentrations. Copyright © 2015 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  4. AA Attendance and Abstinence for Dually Diagnosed Patients: A Meta-Analytic Review.

    Science.gov (United States)

    Scott Tonigan, J; Pearson, Matthew R; Magill, Molly; Hagler, Kylee J

    2018-05-29

    There is consensus that best clinical practice for dual diagnosis (DD) is integrated mental health and substance use treatment augmented with Alcoholics Anonymous (AA) attendance. This is the first quantitative review of the direction and magnitude of the association between AA attendance and alcohol abstinence for DD patients. A systematic literature search (1993-2017) identified 22 studies yielding 24 effect sizes that met our inclusion criteria (8,075 patients). Inverse-variance weighting of correlation coefficients (r) was used to aggregate sample-level findings and study aims were addressed using random and mixed effect models. Sensitivity and publication bias analyses were conducted to assess the likelihood of bias in the overall estimate of AA-related benefit. AA exposure and abstinence for DD patients were significantly and positively associated (r w =.249; 95% CI.203-.293; Tau=.097). There was also significant heterogeneity in the distribution of effect sizes, (Q(23)=90.714, pAA-related benefit did not differ between 6 (k=7) and 12 (k=12) month follow-up, (Q=.068, pAA benefit was not adversely or substantively impacted by pooling RCT and observational samples (Q=.763, pAA (Q=.023, pAA) is common and, in many cases, DD patients who attend AA will report higher rates of alcohol abstinence relative to DD patients who do not attend AA. This article is protected by copyright. All rights reserved.

  5. Renal AA amyloidosis in a patient with hereditary complete complement C4 deficiency

    Directory of Open Access Journals (Sweden)

    Imed Helal

    2011-01-01

    Full Text Available Hereditary complete C4 deficiency has until now been reported in 30 cases only. A disturbed clearance of immune- complexes probably predisposes these individuals to systemic lupus erythematosus, other immune- complex diseases and recurrent microbial infections. We present here a 20- year- old female with hereditary complete C4 deficiency. Renal biopsy demonstrated renal AA amyloidosis. This unique case further substantiates that deficiency of classical pathway components predisposes to the development of recurrent microbial infections and that the patients may develop AA amyloidosis. Furthermore, in clinical practice, the nephrotic syndrome occurring in a patient with hereditary complete complement C4 deficiency should lead to the suspicion of renal AA amyloidosis.

  6. Effects of Biologic Agents in Patients with Rheumatoid Arthritis and Amyloidosis Treated with Hemodialysis

    OpenAIRE

    Kuroda, Takeshi; Tanabe, Naohito; Nozawa, Yukiko; Sato, Hiroe; Nakatsue, Takeshi; Kobayashi, Daisuke; Wada, Yoko; Saeki, Takako; Nakano, Masaaki; Narita, Ichiei

    2016-01-01

    Objective Our objective was to examine the safety and effects of therapy with biologics on the prognosis of rheumatoid arthritis (RA) patients with reactive amyloid A (AA) amyloidosis on hemodialysis (HD). Methods Twenty-eight patients with an established diagnosis of reactive AA amyloidosis participated in the study. The survival was calculated from the date of HD initiation until the time of death, or up to end of June 2015 for the patients who were still alive. HD initiation was according ...

  7. Two distinct clinical courses of renal involvement in rheumatoid patients with AA amyloidosis.

    Science.gov (United States)

    Uda, Hiroshi; Yokota, Akira; Kobayashi, Kumiko; Miyake, Tadao; Fushimi, Hiroaki; Maeda, Akira; Saiki, Osamu

    2006-08-01

    We conducted a prospective study to investigate whether a correlation exists between the clinical course of renal involvement and the pathological findings of renal amyloidosis in patients with rheumatoid arthritis (RA). Patients with RA of more than 5 years' duration and who did not show renal manifestations were selected and received a duodenal biopsy for the diagnosis of amyloidosis. After the diagnosis of AA amyloidosis, patients received a renal biopsy, and patterns of amyloid deposition were examined. We followed the renal functions (serum levels of blood urea nitrogen and creatinine) of patients diagnosed with AA amyloidosis for 5 years. We diagnosed 53 patients with AA amyloidosis and monitored the renal function of 38 of them for > 5 years. The histological patterns were examined; in the 38 patients there were appreciable variations in the patterns of amyloid deposition. In 27 patients, amyloid deposits were found exclusively in the glomerulus (type 1). In the other 11 patients, however, amyloid deposits were found selectively around blood vessels and were totally absent in the glomerulus (type 2). In type 1 patients with glomerular involvement, renal function deteriorated rapidly regardless of disease state; most patients received hemodialysis. In type 2 patients with purely vascular involvement, however, renal function did not deteriorate significantly. In patients with RA and AA amyloidosis, 2 distinct clinical courses in terms of renal involvement were identified. It is suggested that renal function does not deteriorate when amyloid deposition is totally lacking in the glomerulus.

  8. Efficacy of etanercept in patients with AA amyloidosis secondary to rheumatoid arthritis.

    Science.gov (United States)

    Nakamura, T; Higashi, S; Tomoda, K; Tsukano, M; Baba, S

    2007-01-01

    The efficacy of biological therapies in rheumatoid arthritis (RA) is well known, but their hypothetical benefit in amyloid A (AA) amyloidosis secondary to RA still remains to be considered. We evaluated the efficacy and safety of etanercept in serum amyloid A (SAA) 1.3 allele Japanese patients with AA amyloidosis secondary to RA. Seven RA patients with histologically confirmed AA amyloidosis and renal involvement who were treated with etanercept were enrolled. They all had the SAA1.3 allele, which has been shown to be a risk factor not only for the association of AA amyloidosis but also for a poor prognosis in Japanese RA patients. Efficacy was assessed as a sustained decrease in RA inflammation and an amelioration of renal function. RA inflammation and AA amyloidosis were improved and stabilized after 43.4 +/- 16.5 weeks. At week 20 the number of tender (p = 0.017) and swollen (p = 0.017) joints, and levels of serum C-reactive protein (p = 0.018) and albumin (p = 0.045) had improved. The values for SAA, serum creatinine, calculated creatinine clearance, and proteinuria also ameliorated. No severe adverse events were observed. One patient eventually had to go on hemodialysis but her tolerance of etanercept remained stable. Etanercept can be used safely and effectively in AA amyloidosis secondary to RA with renal involvement, and is of clinical benefit in the short-term, even in patients on hemodialysis. It appears that SAA1.3 allele may be used as a clinical parameter for the introduction of etanercept in Japanese RA with AA amyloidosis.

  9. Impact of the Number of Anti-Thrombosis Agents in Hemodialysis Patients: BOREAS-HD2 Study

    Directory of Open Access Journals (Sweden)

    Marenao Tanaka

    2017-09-01

    Full Text Available Background/Aims: Relationships between the number of anti-thrombosis agents, clinical benefits and adverse events in hemodialysis (HD patients are unclear. Methods: All patients on HD in 22 institutes (n = 1,071 were enrolled and followed up for 3 years. After exclusion of patients with missing data, kidney transplantation or retraction of consent during the follow-up period (n = 204, mortality rate and ischemic and hemorrhagic events were compared between different regimens of anti-thrombosis agents. Results: The use of dual or triple antiplatelet (AP agents (HR:2.03, 95% CI:1.01-4.13, p = 0.04 and the combination of an AP agent and warfarin (WF (HR:4.84, 95%CI 1.96-11.96, p < 0.001 were associated with an increase in hemorrhagic events compared with no use of anti-thrombosis agents. No anti-thrombosis regimen was associated with a significant change in risk of ischemic stroke. The use of dual or triple AP agents, but not WF, was associated with an increase in cardiovascular mortality (HR:2.48, 95% CI:1.24-4.76, p = 0.01. Conclusion: A significant increase in hemorrhagic events by the use of dual or more AP agents and by co-administration of an AP agent and WF in patients on HD should be considered in planning their anti-thrombosis regimen.

  10. Therapeutic Benefits of Tocilizumab Vary in Different Organs of a Patient with AA Amyloidosis

    Directory of Open Access Journals (Sweden)

    Masaru Matsui

    2014-01-01

    Full Text Available Systemic reactive AA amyloidosis is a life-threatening complication of chronic inflammatory diseases. Anti-interleukin-6 receptor, tocilizumab (TCZ, has been shown to improve clinical symptoms of patients with AA amyloidosis, accompanied with regression of the amyloid deposition. We report a case of AA amyloidosis evaluated by histology of multiple organs before and after TCZ treatment. A woman in her 60s with rheumatoid arthritis was referred to our hospital because of cardiac and renal dysfunction. A gastric and renal biopsy revealed the deposition of AA amyloid, and echocardiography revealed concentric left ventricular hypertrophy. Her estimated glomerular filtration rate was decreased to 8.6 mL/min/1.73 m2, and B-type natriuretic peptide, C-reactive protein, and serum amyloid A protein were significantly elevated. TCZ treatments markedly decreased her serum amyloid A protein and C-reactive protein levels, but hemodialysis was required 1 year later. Endoscopic gastric rebiopsy 3 years after initiation of TCZ treatments revealed the regression of amyloid deposition and echocardiography revealed improvement of her left ventricular hypertrophy. However, a renal rebiopsy revealed that the amyloid deposition had not regressed. In conclusion, these observations suggest that the therapeutic effects of TCZ can vary among organs in patients with AA amyloidosis.

  11. Identifying Motor, Emotional-Behavioral, and Cognitive Deficits that Comprise the Triad of HD Symptoms from Patient, Caregiver, and Provider Perspectives

    Directory of Open Access Journals (Sweden)

    David Victorson

    2014-04-01

    Full Text Available Background: The objective of this study was to identify important attributes associated with the triad of symptoms (cognition, emotional–behavioral, and motor of Huntington's disease (HD from patient, caregiver, and medical provider perspectives to facilitate development of a new disease‐specific, health‐related quality of life (HRQOL instrument. Methods: We conducted a targeted literature review of HD and HRQOL instruments, expert surveys, and patient and caregiver phone‐based interviews to extract information on the symptoms and issues most relevant to the HD symptom triad (HD triad. The data collected from these sources were used to generate themes and subdomains and to develop an integrated schema that highlights the key dimensions of the triad. Results: The search identified the following areas: emotional functioning/behavioral changes (e.g., positive emotions, sadness/depression; cognitive functioning (e.g., memory/learning, attention/comprehension; physical functioning (e.g., motor functioning, medication; social functioning (e.g., leisure, interpersonal relationships; end‐of‐life concerns/planning; and gene testing. Fifteen individuals diagnosed with HD and 16 HD caregivers, recruited from several Huntington's Disease Society of America support group networks, completed phone interviews. Nineteen US medical providers who specialize in HD completed the online survey. Twenty‐six subdomains of the HD symptom triad (seven cognition, 12 emotional–behavioral, and seven motor emerged relatively consistently across patient, caregiver, and provider samples. These included movements/chorea, memory impairment, depression, and anxiety. Discussion: Based on an integrated, mixed‐methods approach, important HD triad symptom were identified and organized into a guiding schema. These patient‐, caregiver‐, and provider‐triangulated data served as the basis for development of a HD‐specific HRQOL instrument, the HD‐PRO‐TRIAD™.

  12. HD5980

    Science.gov (United States)

    Koenigsberger, C.

    HD5980 is a multiple system containing at least 3 very massive and luminous stars. Located in the Small Magellanic Cloud, it is an ideal system for studying the massive star structure and evolutionary processes in low-metallicity environments. Intensely observed over the past few decades, HD5980 is a treasure trove of information on stellar wind structure, on wind-wind collisions and on the formation of wind-blown circumstellar structures. In addition, its characteristics suggest that the eclipsing WR+LBV stars of the system are the product of quasihomogeneous chemical evolution, thus making them candidate pair production supernovae or GRB progenitors. This paper summarizes some of the outstanding results derived from half a century of observations and recent theoretical studies.

  13. Clinical outcomes and survival in AA amyloidosis patients

    Directory of Open Access Journals (Sweden)

    Yavuz Ayar

    Full Text Available Abstract Aim Amyloid A amyloidosis is a rare complication of chronic inflammatory conditions. Most patients with amyloid A amyloidosis present with nephropathy and it leads to renal failure and death. We studied clinical characteristics and survival in patients with amyloid A amyloidosis. Methods: A total of 81 patients (51 males, 30 females with renal biopsy proven amyloid A amyloidosis were analyzed retrospectively. The patients were divided into good and poor outcomes groups according to survival results. Results: Most of the patients (55.6% had nephrotic range proteinuria at diagnosis. Most frequent underlying disorders were familial Mediterranean fever (21.2% and rheumatoid arthritis (10.6% in the good outcome group and malignancy (20% in the poor outcome group. Only diastolic blood pressure in the good outcome group and phosphorus level in the poor outcome group was higher. Serum creatinine levels increased after treatment in both groups, while proteinuria in the good outcome group decreased. Increase in serum creatinine and decrease in estimated glomerular filtration rate of the poor outcome group were more significant in the good outcome group. At the time of diagnosis 18.5% and 27.2% of all patients had advanced chronic kidney disease (stage 4 and 5, respectively. Median duration of renal survival was 65 ± 3.54 months. Among all patients, 27.1% were started dialysis treatment during the follow-up period and 7.4% of all patients underwent kidney transplantation. Higher levels of systolic blood pressure [hazard ratios 1.03, 95% confidence interval: 1-1.06, p = 0.036], serum creatinine (hazard ratios 1.25, 95% confidence interval: 1.07-1.46, p = 0.006 and urinary protein excretion (hazard ratios 1.08, 95% confidence interval: 1.01-1.16, p = 0.027 were predictors of end-stage renal disease. Median survival of patients with organ involvement was 50.3 ± 16 months. Conclusion Our study indicated that familial Mediterranean fever constituted

  14. The Efficacy of MAG-DHA for Correcting AA/DHA Imbalance of Cystic Fibrosis Patients

    Directory of Open Access Journals (Sweden)

    Caroline Morin

    2018-05-01

    Full Text Available Omega-3 polyunsaturated fatty acid (n-3 PUFA supplementations are thought to improve essential fatty acid deficiency (EFAD as well as reduce inflammation in Cystic Fibrosis (CF, but their effectiveness in clinical studies remains unknown. The aim of the study was to determine how the medical food containing docosahexaenoic acid monoglyceride (MAG-DHA influenced erythrocyte fatty acid profiles and the expression levels of inflammatory circulating mediators. We conducted a randomized, double blind, pilot trial including fifteen outpatients with Cystic Fibrosis, ages 18–48. The patients were divided into 2 groups and received MAG-DHA or a placebo (sunflower oil for 60 days. Patients took 8 × 625 mg MAG-DHA softgels or 8 × 625 mg placebo softgels every day at bedtime for 60 days. Lipid analyses revealed that MAG-DHA increased docosahexaenoic acid (DHA levels and decrease arachidonic acid (AA ratio (AA/DHA in erythrocytes of CF patients following 1 month of daily supplementation. Data also revealed a reduction in plasma human leukocyte elastase (pHLE complexes and interleukin-6 (IL-6 expression levels in blood samples of MAG-DHA supplemented CF patients. This pilot study indicates that MAG-DHA supplementation corrects erythrocyte AA/DHA imbalance and may exert anti-inflammatory properties through the reduction of pHLE complexes and IL6 in blood samples of CF patients. Trial registration: Pro-resolving Effect of MAG-DHA in Cystic Fibrosis (PREMDIC, NCT02518672.

  15. Quality of life of patients with graft-versus-host disease (GvHD post-hematopoietic stem cell transplantation

    Directory of Open Access Journals (Sweden)

    Sibéli de Fátima Ferraz Simão Proença

    Full Text Available Abstract OBJECTIVE Assessing the quality of life of adult patients with hematological cancer in the 100 days after transplantation of hematopoietic stem cells and verifying whether the variable graft-versus-host disease (GvHD is predictive of worse results. METHOD An observational correlational and quantitative study with 36 adult participants diagnosed with hematologic cancer who underwent hematopoietic stem cell transplantation from September 2013 to June 2015. RESULT The mean age was 37 years, 52.78% were female, and 61.11% were diagnosed with leukemia. Quality of life scores showed a significant impact between pre-transplantation and pre-hospital discharge, and also within the 100 days post-transplantation. The statistical analysis between the scores for the groups with and without GvHD showed a significant difference between the presence of the complication and worse results. CONCLUSION Quality of life is altered as a result of hematopoietic stem cells transplantation, especially in patients who have graft-versus-host disease.

  16. Clinical implications of eicosapentaenoic acid/arachidonic acid ratio (EPA/AA) in adult patients with congenital heart disease.

    Science.gov (United States)

    Kanoh, Miki; Inai, Kei; Shinohara, Tokuko; Tomimatsu, Hirofumi; Nakanishi, Toshio

    2017-12-01

    Recent studies showed that a low ratio between the levels of eicosapentaenoic acid and those of arachidonic acid (EPA/AA) is associated with higher incidence of coronary artery disease and poor prognosis of heart failure, arrhythmia, and cardiac sudden death. However, the clinical implications of EPA/AA in adult patients with congenital heart disease remain unclear. We aimed to assess the prognostic value of EPA/AA regarding cardiac events in adult patients with congenital heart disease. We measured the serum levels of eicosapentaenoic acid and arachidonic acid in 130 adult patients (median age, 31 years) stratified into two groups according to their EPA/AA (low, ≤0.22; high, >0.22). We prospectively analyzed the association between EPA/AA and incidence of cardiac events during a mean observation period of 15 months, expressed in terms of hazard ratio (HR) with 95% confidence interval (95% CI). In the subgroup of patients with biventricular circulation (2VC) (n = 76), we analyzed the same clinical endpoints. In our study population, EPA/AA was not associated with the incidence of arrhythmic events (HR, 1.52; 95% CI, 0.82-2.85; p = 0.19), but low EPA/AA was a predictor of heart failure hospitalization (HR, 2.83; 95% CI, 1.35-6.30; p AA of ≤0.25 was associated with a significantly higher risk of arrhythmic events (HR, 2.55; 95% CI, 1.11-6.41; p = 0.03) and heart failure hospitalization (HR, 5.20; 95% CI, 1.78-18.1; p AA represents a useful predictor of cardiac events in adult patients with congenital heart disease.

  17. Plasma oxalate levels in prevalent hemodialysis patients and potential implications for ascorbic acid supplementation.

    Science.gov (United States)

    Liu, Yuguan; Weisberg, Lawrence S; Langman, Craig B; Logan, Amanda; Hunter, Krystal; Prasad, Deepali; Avila, Jose; Venkatchalam, Thaliga; Berns, Jeffrey S; Handelman, Garry J; Sirover, William D

    2016-10-01

    Ascorbic acid (AA) supplementation may increase hemoglobin levels and decrease erythropoiesis-stimulating agent dose requirement in patients with end stage renal disease (ESRD). While plasma AA levels >100μM may be supratherapeutic, levels of at least 30μM may be needed to improve wound healing and levels may need to reach 70μM to optimize erythropoiesis. Of concern, oxalate (Ox), an AA metabolite, can accumulate in ESRD. Historically, if plasma Ox levels remain ≥30μM, oxalosis was of concern. Contemporary hemodialysis (HD) efficiencies may decrease the risk of oxalosis by maintaining pre-HD Ox levels HD patients. A prospective, observational study of 197 HD patients with pre-HD AA levels and pre-HD and post-HD Ox levels. Mean plasma Ox levels decreased 71% during the intradialytic period (22.3±11.1μM to 6.4±3.2μM, PHD plasma AA levels ≤100μM were not associated with a pre-HD plasma Ox level≥30μM, even if ferritin levels were increased. Pre-HD plasma Ox levels ≥20 or ≥30μM were not associated with lower cumulative 4-year survival. Pre-HD plasma AA levels up to 100μM in HD patients do not appear to be associated with an increased risk of developing secondary oxalosis, as the corresponding pre-HD plasma Ox level appears to be maintained at tolerable levels. Copyright © 2016 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  18. Relapse Analysis of Irradiated Patients Within the HD15 Trial of the German Hodgkin Study Group

    Energy Technology Data Exchange (ETDEWEB)

    Kriz, Jan; Reinartz, Gabriele [Department of Radiation Oncology, University of Münster, Münster (Germany); Dietlein, Markus; Kobe, Carsten; Kuhnert, Georg [Department of Nuclear Medicine, University of Cologne, Cologne (Germany); Haverkamp, Heinz [First Department of Internal Medicine, University of Cologne, Cologne (Germany); Haverkamp, Uwe [Department of Radiation Oncology, University of Münster, Münster (Germany); Engenhart-Cabillic, Rita [Department of Radiation Oncology, University of Marburg, Marburg (Germany); Herfarth, Klaus [Department of Radiation Oncology, University Heidelberg, Heidelberg (Germany); Lukas, Peter [Department of Radiation Oncology, University of Innsbruck, Innsbruck (Austria); Schmidberger, Heinz [Department of Radiation Oncology, University of Mainz, Mainz (Germany); Staar, Susanne [Department of Radiation Oncology, Klinikum Bremen-Mitte, Bremen (Germany); Hegerfeld, Kira [Department of Radiation Oncology, University of Münster, Münster (Germany); Baues, Christian [Department of Radiation Oncology, University of Cologne, Cologne (Germany); Engert, Andreas [First Department of Internal Medicine, University of Cologne, Cologne (Germany); Eich, Hans Theodor, E-mail: hans.eich@ukmuenster.de [Department of Radiation Oncology, University of Münster, Münster (Germany)

    2015-05-01

    Purpose: To determine, in the setting of advanced-stage of Hodgkin lymphoma (HL), whether relapses occur in the irradiated planning target volume and whether the definition of local radiation therapy (RT) used by the German Hodgkin Study Group (GHSG) is adequate, because there is no harmonization of field and volume definitions among the large cooperative groups in the treatment of advanced-stage HL. Methods and Materials: All patients with residual disease of ≥2.5 cm after multiagent chemotherapy (CTX) were evaluated using additional positron emission tomography (PET), and those with a PET-positive result were irradiated with 30 Gy to the site of residual disease. We re-evaluated all sites of disease before and after CTX, as well as the PET-positive residual tumor that was treated in all relapsed patients. Documentation of radiation therapy (RT), treatment planning procedures, and portal images were carefully analyzed and compared with the centrally recommended RT prescription. The irradiated sites were compared with sites of relapse using follow-up computed tomography scans. Results: A total of 2126 patients were enrolled, and 225 patients (11%) received RT. Radiation therapy documents of 152 irradiated patients (68%) were analyzed, with 28 irradiated patients (11%) relapsing subsequently. Eleven patients (39%) had an in-field relapse, 7 patients (25%) relapsed outside the irradiated volume, and an additional 10 patients (36%) showed mixed in- and out-field relapses. Of 123 patients, 20 (16%) with adequately performed RT relapsed, compared with 7 of 29 patients (24%) with inadequate RT. Conclusions: The frequency and pattern of relapses suggest that local RT to PET-positive residual disease is sufficient for patients in advanced-stage HL. Insufficient safety margins of local RT may contribute to in-field relapses.

  19. Nutrition and hydration status improve with exercise training using stationary cycling during hemodialysis (HD) in patients with end-stage renal disease (ESRD).

    Science.gov (United States)

    Załuska, Alicja; Załuska, Wojciech T; Bednarek-Skublewska, Anna; Ksiazek, Andrzej

    2002-01-01

    Patients with end-stage renal disease (ESRD) undergoing hemodialysis and peritoneal dialysis are functionally limited as a consequence of their physical, emotional, and social problems. Exercise intolerance is a major problem in chronic renal failure. Stationary cycle training during hemodialysis is recommended as safe, effective, and practical in ESRD patients treated on hemodialysis. The aim of the present study was to evaluate the effect of cycling exercises in 10 HD patients during 6-month period (including each of dialysis sessions) on nutrition, dialysis adequacy, and fluid parameters as measured by biochemical, and bioimpedance parameters. A significant increase in serum albumin concentration, Kt/V, and nPCR, and decrease in serum CRP have been observed after 6 months of regular stationary cycling during hemodialysis. Relative changes (pre-post HD) in extracellular water compartment and ECW/TBW ratio have significantly increased after 6 months of observation period.

  20. Effect of different types of blood purification treatment (HD and HDF) on the serum PTH, leptin and Hcy levels in patients with chronic renal failure

    International Nuclear Information System (INIS)

    Yao Yongliang

    2009-01-01

    Objective: To investigate the effect of different type of blood purification treatment (hemodialysis and hemodiafiltration) on the serum PTH, Leptin and Hcy levels in patients with chronic renal failure(CRF). Methods: Serum levels of PTH(with ECLIA), Leptin(with RIA) and Hcy(with biochemistry) were measured in 30 patients treated with hemodialysis(HD) and 30 patients treated with hemodiafiltration(HDF) both before and after treatment. Results: The concentration of PTH decreased significantly from 60.8±32.5pmol/L to 28.2±17.2pmol/L in patients treated with HDF(P 0.05). Yet the concentration of Hcy also decreased significantly from 31.5μ10.5μmol/L to 20.4±8.5μmol/L(P<0.01) in patients treated HD. Conclusion: HDF can eliminate serum PTH, leptin and Hcy better than HD does. (authors)

  1. Prevalence and patterns of cognitive impairment in adult hemodialysis patients: the COGNITIVE-HD study.

    Science.gov (United States)

    van Zwieten, Anita; Wong, Germaine; Ruospo, Marinella; Palmer, Suetonia C; Barulli, Maria Rosaria; Iurillo, Annalisa; Saglimbene, Valeria; Natale, Patrizia; Gargano, Letizia; Murgo, Marco; Loy, Clement T; Tortelli, Rosanna; Craig, Jonathan C; Johnson, David W; Tonelli, Marcello; Hegbrant, Jörgen; Wollheim, Charlotta; Logroscino, Giancarlo; Strippoli, Giovanni F M

    2017-11-22

    Mounting evidence indicates an increased risk of cognitive impairment in adults with end-stage kidney disease on dialysis, but the extent and pattern of deficits across the spectrum of cognitive domains are uncertain. We conducted a cross-sectional study of 676 adult hemodialysis patients from 20 centers in Italy, aiming to evaluate the prevalence and patterns of cognitive impairment across five domains of learning and memory, complex attention, executive function, language and perceptual-motor function. We assessed cognitive function using a neuropsychological battery of 10 tests and calculated test and domain z-scores using population norms (age or age/education). We defined cognitive impairment as a z-score  ≤ -1.5. Participants' median age was 70.9 years (range 21.6-94.1) and 262 (38.8%) were women. Proportions of impairment on each domain were as follows: perceptual-motor function 31.5% (150/476), language 41.2% (273/662), executive function 41.7% (281/674), learning and memory 42.2% (269/638), complex attention 48.8% (329/674). Among 474 participants with data for all domains, only 28.9% (n  =  137) were not impaired on any domain, with 25.9% impaired on a single domain (n  =  123), 17.3% on two (n  =  82), 13.9% on three (n  =  66), 9.1% on four (n  =  43) and 4.9% (n  =  23) on all five. Across patients, patterns of impairment combinations were diverse. In conclusion, cognitive impairment is extremely common in hemodialysis patients, across numerous domains, and patients often experience multiple deficits simultaneously. Clinical care should be tailored to meet the needs of patients with different types of cognitive impairment and future research should focus on identifying risk factors for cognitive decline. © The Author 2017. Published by Oxford University Press on behalf of ERA-EDTA. All rights reserved.

  2. [Changes of CD34(+) and CD71(+)CD45(-) cell levels in bone marrow of MDS and AA patients].

    Science.gov (United States)

    Yan, Zhen-Yu; Tian, Xu; Li, Ying; Yang, Mei-Rong; Zhang, Song; Wang, Xie-Ming; Zhang, Hai-Xia; Cheng, Nai-Yao

    2014-04-01

    This study was aimed to investigate the changes of CD34(+) and CD71(+)CD45(-) cell levels in MDS and AA patients. A total of 25 cases MDS and 43 cases of AA (18 cases SAA and 25 cases of NSAA) from January 2010 to October 2013 in the Department of Hematology, affiliated hospital of Hebei United University were enrolled in this study. The complete blood count, bone marrow smears, bone marrow biopsy, karyotype analysis and bone marrow blood cell immune genotyping (mainly the proportion of CD34(+) cells, CD71(+)CD45(-) cells in nucleated cells) were carried out for all patients; the changes of CD34(+) and CD71(+)CD45(-) cell levels in patients with MDS and AA (SAA NSAA) were compared; the differences of white blood cell count, platelet count and hemoglobin concentration in patients with count of CD71(+)CD45(-) ≥ 15% or MDS group was higher than that in AA (NSAA and SAA) group (P MDS group was higher than that in SAA (P MDS group. In MDS group with CD71(+)CD45(-) ≥ 15%, the platelet count was significantly higher than that in NSAA group (P MDS and NSAA group with CD71(+)CD45(-) 0.05). It is concluded that the count of CD34(+) cells in MDS patients is significantly higher than that in AA and SAA patients. The count of CD71(+)CD45(-) cells in MDS group is significantly higher than that of SAA group. The platelet count in MDS patients with CD71(+)CD45(-) cells ≥ 15% is significantly higher than that of the NSAA group.

  3. Comparisons of amino acids, body constituents and antioxidative response between long-time HD and normal HD.

    Science.gov (United States)

    Torigoe, Akira; Sato, Emiko; Mori, Takefumi; Ieiri, Norio; Takahashi, Chika; Ishida, Yoko; Hotta, Osamu; Ito, Sadayoshi

    2016-10-01

    Introduction Oxidative stress is one of the main mediators of progression of chronic kidney diseases (CKD). Nuclear factor E2-related factor 2 (Nrf2) is the transcription factor of antioxidant and detoxifying enzymes and related proteins which play an important role in cellular defense. Long-time hemodialysis (HD) therapy (8 hours) has been considered to be more beneficial compared to normal HD therapy (4 hours). We investigated oxidative response related to Nrf2 in peripheral blood mononuclear cells (PBMCs) of long-time HD and normal HD patients. Methods Eight adult long-time HD therapy patients (44.5 ± 3.0 years) and 10 normal HD therapy patients (68.1 ± 2.7 years) were enrolled. PBMCs were isolated and processed for expression of Nrf2 and its related genes by qRT-PCR. Plasma indoxyl sulfate, amino acids, and body constituents were measured. Findings Plasma indoxyl sulfate was significantly low after long-time HD therapy compare to that of normal HD therapy. Although, skeletal muscle mass, lean body mass, mineral and protein were significantly decreased 2 months in normal HD patients, those in long-time HD patients were significantly increased after 2 months. Almost of amino acids were significantly decreased after HD therapy in both HD therapies. Plasma amino acids were significantly low in long-time HD patients compared to normal HD patients. In PBMCs, the expression of Nrf2 was significantly decreased and hemooxygenase-1 expression was significantly increased in long-time HD compared to normal HD. Conclusion These observations indicate the beneficial effects of in long-time HD in improving oxidative stress in patients. © 2016 International Society for Hemodialysis.

  4. Fundamental parameters of massive stars in multiple systems: The cases of HD 17505A and HD 206267A

    Science.gov (United States)

    Raucq, F.; Rauw, G.; Mahy, L.; Simón-Díaz, S.

    2018-06-01

    Context. Many massive stars are part of binary or higher multiplicity systems. The present work focusses on two higher multiplicity systems: HD 17505A and HD 206267A. Aims: Determining the fundamental parameters of the components of the inner binary of these systems is mandatory to quantify the impact of binary or triple interactions on their evolution. Methods: We analysed high-resolution optical spectra to determine new orbital solutions of the inner binary systems. After subtracting the spectrum of the tertiary component, a spectral disentangling code was applied to reconstruct the individual spectra of the primary and secondary. We then analysed these spectra with the non-LTE model atmosphere code CMFGEN to establish the stellar parameters and the CNO abundances of these stars. Results: The inner binaries of these systems have eccentric orbits with e 0.13 despite their relatively short orbital periods of 8.6 and 3.7 days for HD 17505Aa and HD 206267Aa, respectively. Slight modifications of the CNO abundances are found in both components of each system. The components of HD 17505Aa are both well inside their Roche lobe, whilst the primary of HD 206267Aa nearly fills its Roche lobe around periastron passage. Whilst the rotation of the primary of HD 206267Aa is in pseudo-synchronization with the orbital motion, the secondary displays a rotation rate that is higher. Conclusions: The CNO abundances and properties of HD 17505Aa can be explained by single star evolutionary models accounting for the effects of rotation, suggesting that this system has not yet experienced binary interaction. The properties of HD 206267Aa suggest that some intermittent binary interaction might have taken place during periastron passages, but is apparently not operating anymore. Based on observations collected with the TIGRE telescope (La Luz, Mexico), the 1.93 m telescope at Observatoire de Haute Provence (France), the Nordic Optical Telescope at the Observatorio del Roque de los

  5. Marine n-3 polyunsaturated fatty acids in patients with end-stage renal failure and in subjects without kidney disease: a comparative study.

    Science.gov (United States)

    Madsen, Trine; Christensen, Jeppe H; Svensson, My; Witt, Petra M; Toft, Egon; Schmidt, Erik B

    2011-03-01

    Patients with end-stage renal disease treated with chronic hemodialysis (HD) are reported to have low levels of marine n-3 polyunsaturated fatty acids (PUFA) in plasma and cell membranes compared with healthy subjects. The aim of this study was to investigate whether n-3 PUFA levels in plasma and cells are lower in HD patients as compared with subjects without kidney disease. A comparative study was carried out. This study was carried out at the Departments of Nephrology and Cardiology, Aalborg Hospital, Aarhus University Hospital, Denmark. This study consisted of 2 study populations comprising HD patients and 5 study populations comprising subjects without kidney disease. The fatty acid distribution in plasma phospholipids and platelet phospholipids was measured using gas chromatography. Eicosapentaenoic acid (EPA), docosahexaenoic acid (DHA), and arachidonic acid (AA) levels in plasma or serum phospholipids and platelet phospholipids in HD patients were compared with n-3 PUFA levels in subjects without kidney disease. EPA and DHA were lower and AA/EPA was higher in plasma/serum phospholipids in HD patients than in subjects without kidney disease. Similarly, higher AA and AA/EPA and lower EPA and DHA levels were found in platelet phospholipids of HD patients. Adjustment for gender, age, and habitual intake of fish and fish oil supplements did not change these results. HD patients have lower n-3 PUFA levels in plasma and cells compared with subjects without kidney disease. Copyright © 2011 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  6. Pro Tools HD

    CERN Document Server

    Camou, Edouard

    2013-01-01

    An easy-to-follow guide for using Pro Tools HD 11 effectively.This book is ideal for anyone who already uses ProTools and wants to learn more, or is new to Pro Tools HD and wants to use it effectively in their own audio workstations.

  7. AA Index

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa index provides a long climatology of global geomagnetic activity using 2 antipodal observatories at Greenwich and Melbourne- IAGA Bulletin 37,...

  8. Studies of FCAPT uvby Photometry with Period04: The mCP Stars HD 5797, HD 36792, HD 27309, HD 47913, HD 74521, HD 120198, HD 171263, and HD 215441

    Science.gov (United States)

    Dukes, Robert J., Jr.; Adelman, Saul J.

    2018-04-01

    We present differential Strömgren uvby Four College Automated Photometric Telescope (FCAPT) observations of eight magnetic chemically peculiar stars: HD 5797, HD 26792, HD 27309, HD 49713, HD 74521, HD 120198, HD 171263, and HD 215441. Our data sets are larger than those of most mCP stars in the literature. These are the first FCAPT observations of HD 5797, HD 26792, HD 49713, and HD 171263. Those for the other four stars substantially extend published FCAPT data sets. The FCAPT has observed some stars for a longer time range and with greater accuracy than other optical region telescopes. We determine very accurate periods and u, v, b, and y amplitudes, as well as if there are any long-term periods. Further, we compare our results with those of magnetic field measurements, when they exist, to help interpret the light curves. For each star, we used the Period04 computer program to analyze the uvby light curves. This program provides errors for the derived quantities. Our derived periods of 68.0457 ± 0.0200 days for HD 5797, 3.80205 ± 0.00015 days for HD 26792, 1.5688908 ± 0.0000046 days for HD 27309, 2.135361 ± 0.000031 days for HD 49713, 7.05053 ± 0.00024 for days HD 74521, 1.3857690 ± 0.0000058 days for HD 120198, 3.99744 ± 0.00015 days for HD 171263, and 9.487792 ± 0.000049 days for HD 215441 are refinements of the last determinations in the literature. We also found a low-frequency term for HD 49713 in all four filters.

  9. Sevelamer is cost effective versus calcium carbonate for the first-line treatment of hyperphosphatemia in new patients to hemodialysis: a patient-level economic evaluation of the INDEPENDENT-HD study.

    Science.gov (United States)

    Ruggeri, Matteo; Bellasi, Antonio; Cipriani, Filippo; Molony, Donald; Bell, Cynthia; Russo, Domenico; Di Iorio, Biagio

    2015-10-01

    The recent multicenter, randomized, open-label INDEPENDENT study demonstrated that sevelamer improves survival in new to hemodialysis (HD) patients compared with calcium carbonate. The objective of this study was to determine the cost-effectiveness of sevelamer versus calcium carbonate for patients new to HD, using patient-level data from the INDEPENDENT study. Cost-effectiveness analysis. Adult patients new to HD in Italy. A patient-level cost-effectiveness analysis was conducted from the perspective of the Servizio Sanitario Nazionale, Italy's national health service. The analysis was conducted for a 3-year time horizon. The cost of dialysis was excluded from the base case analysis. Sevelamer was compared to calcium carbonate. Total life years (LYs), total costs, and the incremental cost per LY gained were calculated. Bootstrapping was used to estimate confidence intervals around LYs, costs, and cost-effectiveness and to calculate the cost-effectiveness acceptability curve. Sevelamer was associated with a gain of 0.26 in LYs compared to calcium carbonate, over the 3-year time horizon. Total drug costs were €3,282 higher for sevelamer versus calcium carbonate, while total hospitalization costs were €2,020 lower for sevelamer versus calcium carbonate. The total incremental cost of sevelamer versus calcium carbonate was €1,262, resulting in a cost per LY gained of €4,897. The bootstrap analysis demonstrated that sevelamer was cost effective compared with calcium carbonate in 99.4 % of 10,000 bootstrap replicates, assuming a willingness-to-pay threshold of €20,000 per LY gained. Data on hospitalizations was taken from a post hoc retrospective chart review of the patients included in the INDEPENDENT study. Patient quality of life or health utility was not included in the analysis. Sevelamer is a cost-effective alternative to calcium carbonate for the first-line treatment of hyperphosphatemia in new to HD patients in Italy.

  10. Relationship between patient-reported outcomes and clinical outcomes in metastatic castration-resistant prostate cancer: post hoc analysis of COU-AA-301 and COU-AA-302.

    Science.gov (United States)

    Cella, D; Traina, S; Li, T; Johnson, K; Ho, K F; Molina, A; Shore, N D

    2018-02-01

    Patient-reported outcomes (PROs) are used to assess benefit-risk in drug development. The relationship between PROs and clinical outcomes is not well understood. We aim to elucidate the relationships between changes in PRO measures and clinical outcomes in metastatic castration-resistant prostate cancer (mCRPC). We investigated relationships between changes in self-reported fatigue, pain, functional well-being (FWB), physical well-being (PWB) and prostate cancer-specific symptoms with overall survival (OS) and radiographic progression-free survival (rPFS) after 6 and 12 months of treatment in COU-AA-301 (N = 1195) or COU-AA-302 (N = 1088). Eligible COU-AA-301 patients had progressed after docetaxel and had Eastern Cooperative Oncology Group performance status (ECOG PS) ≤ 2. Eligible COU-AA-302 patients had no prior chemotherapy and ECOG PS 0 or 1. Patients were treated with abiraterone acetate (1000 mg/day) plus prednisone (10 mg/day) or prednisone alone daily. Association between self-reported fatigue, pain and functional status, and OS and/or rPFS, using pooled data regardless of treatment, was assessed. Cox proportional hazard regression modeled time to death or radiographic progression. In COU-AA-301 patients, PRO improvements were associated with longer OS and longer time to radiographic progression versus worsening or stable PROs (P AA-302 patients, worsening PROs were associated with higher likelihood of radiographic progression (P ≤ 0.025) compared with improved or stable PROs. In multivariate models, worsening PWB remained associated with worse rPFS. The 12-month analysis confirmed the 6-month results. PROs are significantly associated with clinically relevant time-to-event efficacy outcomes in clinical trials and may complement and help predict traditional clinical practice methods for monitoring patients for disease progression. © The Author 2017. Published by Oxford University Press on behalf of the European Society for

  11. Treatment with biologic agents improves the prognosis of patients with rheumatoid arthritis and amyloidosis.

    Science.gov (United States)

    Kuroda, Takeshi; Tanabe, Naohito; Kobayashi, Daisuke; Sato, Hiroe; Wada, Yoko; Murakami, Shuichi; Saeki, Takako; Nakano, Masaaki; Narita, Ichiei

    2012-07-01

    Reactive amyloid A (AA) amyloidosis is a serious and life-threatening systemic complication of rheumatoid arthritis (RA). We evaluated the safety of therapy with anti-tumor necrosis factor and anti-interleukin 6 biologic agents in RA patients with reactive AA amyloidosis, together with prognosis and hemodialysis (HD)-free survival, in comparison with patients with AA amyloidosis without such therapy. One hundred thirty-three patients with an established diagnosis of reactive AA amyloidosis participated in the study. Clinical data were assessed from patient records at the time of amyloid detection and administration of biologics. Survival was calculated from the date when amyloid was first demonstrated histologically or the date when biologic therapy was started until the time of death or to the end of 2010 for surviving patients. Patients who had started HD were selected for inclusion only after the presence of amyloid was demonstrated. Fifty-three patients were treated with biologic agents (biologic group) and 80 were not (nonbiologic group). Survival rate was significantly higher in the biologic group than in the nonbiologic group. Nine patients in the biologics group and 33 in the nonbiologic group started HD. Biologic therapy had a tendency for reduced risk of initiation of HD without any statistical significance. Patients with amyloidosis have a higher mortality rate, but the use of biologic agents can reduce risk of death. The use of biologics may not significantly influence the HD-free survival rate.

  12. Abia, AA

    African Journals Online (AJOL)

    Abia, AA. Vol 4, No 6 (2010) - Articles Studies on the kinetics and intraparticle diffusivities of BOD, colour and TSS reduction from palm oil mill effluent (POME) using boiler fly ash. Abstract PDF. ISSN: 1996-0786. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  13. Bone mineral content (BMC) of the lumbar vertebrae (L2-L4) measured by quantitative computed tomography (QCT) and dual energy X-ray absorptiometry (DXA) in 21 hemodialysis (HD) patients

    International Nuclear Information System (INIS)

    Takahashi, Nobuyoshi; Suzuki, Tadashi; Sato, Motoaki; Oh, Songchol; Sato, Atsushi; Saito, Hisao; Funyu, Tomihisa.

    1996-01-01

    BMC of lumbar vertebrae (L2-L4) was measured by QCT and DXA in 21 HD patients. The effect of sex, aging, HD duration, postmenopausal years and various blood parameters of bone metabolism on BMC was assessed statistically. BMC showed a good positive correlation not only with DXA and QCT (trabecular and cortical bone), but with QCT (trabecular bone) and QCT (cortical bone). A significant age-related decrease in BMC, particularly by QCT (trabecular bone), was found in both sexes. BMC measured by QCT (trabecular bone) increased with the duration of HD in male patients. A negative relationship between postmenopausal years and BMC measured by QCT (trabecular and cortical bone) was prominent. BMC was not found to be correlated with various blood parameters of bone metabolism. Thus, measurement of BMC (L2-L4) by QCT has the advantage of allowing more precise examination of changes in cortical and trabecular bone. (author)

  14. Subsequent Chemotherapy and Treatment Patterns After Abiraterone Acetate in Patients with Metastatic Castration-resistant Prostate Cancer: Post Hoc Analysis of COU-AA-302.

    Science.gov (United States)

    de Bono, Johann S; Smith, Matthew R; Saad, Fred; Rathkopf, Dana E; Mulders, Peter F A; Small, Eric J; Shore, Neal D; Fizazi, Karim; De Porre, Peter; Kheoh, Thian; Li, Jinhui; Todd, Mary B; Ryan, Charles J; Flaig, Thomas W

    2017-04-01

    Treatment patterns for metastatic castration-resistant prostate cancer (mCRPC) have changed substantially in the last few years. In trial COU-AA-302 (chemotherapy-naïve men with mCRPC), abiraterone acetate plus prednisone (AA) significantly improved radiographic progression-free survival and overall survival (OS) when compared to placebo plus prednisone (P). This post hoc analysis investigated clinical responses to docetaxel as first subsequent therapy (FST) among patients who progressed following protocol-specified treatment with AA, and characterized subsequent treatment patterns among older (≥75 yr) and younger (AA arm received subsequent treatment with one or more agents approved for mCRPC. Efficacy analysis was performed for patients for whom baseline and at least one post-baseline prostate-specific antigen (PSA) values were available. Baseline and at least one post-baseline PSA values were available for 100 AA patients who received docetaxel as FST. While acknowledging the limitations of post hoc analyses, 40% (40/100) of these patients had an unconfirmed ≥50% PSA decline with first subsequent docetaxel therapy, and 27% (27/100) had a confirmed ≥50% PSA decline. The median docetaxel treatment duration among these 100 patients was 4.2 mo. Docetaxel was the most common FST among older and younger patients from each treatment arm. However, 43% (79/185) of older patients who progressed on AA received no subsequent therapy for mCRPC, compared with 17% (60/361) of younger patients. Patients with mCRPC who progress with AA treatment may still derive benefit from subsequent docetaxel therapy. These data support further assessment of treatment patterns following AA treatment for mCRPC, particularly among older patients. ClinicalTrials.gov NCT00887198. Treatment patterns for advanced prostate cancer have changed substantially in the last few years. This additional analysis provides evidence of clinical benefit for subsequent chemotherapy in men with advanced

  15. Datablock: hd141

    Indian Academy of Sciences (India)

    2016-01-15

    Jan 15, 2016 ... checkCIF/PLATON page 2 http://checkcif.iucr.org/cgibin/checkcif_hkl.pl. 1/3. checkCIF (basic structural check) running. checkCIF/PLATON (basic structural check). Structure factors have been supplied for datablock(s) hd141. THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW.

  16. Effects of dialysate to serum sodium (Na+) alignment in chronic hemodialysis (HD) patients: retrospective cohort study from a quality improvement project.

    Science.gov (United States)

    Raimann, Jochen G; Ficociello, Linda H; Usvyat, Len A; Zhang, Hanjie; Pacelli, Lisa; Moore, Sandi; Sheppard, Penny; Xiao, Qingqing; Wang, Yuedong; Mullon, Claudy; Balter, Paul; Sullivan, Terry; Kotanko, Peter

    2018-04-02

    Evidence indicates favorable effects of dialysate (DNa + ) to serum sodium concentration (SNa + ) alignment, however, results from larger sample populations are needed. For this reason, we conducted a retrospective propensity score-matched cohort study from a quality improvement project to investigate the effects of alignment on population of maintenance hemodialysis patients. At 4 participating hemodialysis (HD) clinics, patients with SNa + lower than the standard DNa + of 137 mEq/L who received HD with DNa + aligned to the average of the last 4 SNa + measurements were evaluated (clinicaltrials.gov # NCT01825590 ). In this retrospective data analysis, an intention-to-treat (primary) and an as-treated "intervention" (secondary) cohort were created. "Aligned" patients from both cohorts (N = 163 for the primary and N = 137 for the secondary) were then propensity-score matched in a 1:1 fashion to "unaligned" patients from the Renal Research Institute database. The propensity score was generated based on age, gender, white race, Hispanic ethnicity, absence or presence of diabetes, hemodialysis vintage, interdialytic weight gain (IDWG; as a percentage of postdialysis body weight), catheter as primary dialysis access, predialysis systolic blood pressure, serum sodium concentration, hospitalization count during baseline. T-Test was employed for group comparisons of changes to the primary (volume-related and hemodynamic parameters) and tertiary outcomes. All-cause and fluid overload-related hospitalization admission rates were compared using Wilcoxon Rank Sum test and Cox regression analysis for repeated events. In the primary analysis, aligned and unaligned subjects showed comparable demographics at baseline. Treatment effects were significant for IDWG [-0.12 (95% CI -0.24 to 0) L] and showed decreasing non-significant trends for pre-dialysis hemodynamic parameters. Count comparison and Cox regression analysis showed no clear advantage of alignment in terms of

  17. HD 285507b

    DEFF Research Database (Denmark)

    Quinn, Samuel N.; White, Russel J.; Latham, David W.

    2014-01-01

    We report the discovery of the first hot Jupiter in the Hyades open cluster. HD 285507b orbits a V = 10.47 K4.5V dwarf (M * = 0.734 M ☉; R * = 0.656 R ☉) in a slightly eccentric () orbit with a period of days. The induced stellar radial velocity corresponds to a minimum companion mass of M Psin i...... timescale for HD 285507b to be larger than the age of the Hyades, which may indicate that this planet's non-zero eccentricity is the result of migration via interactions with a third body. We also demonstrate a significant difference between the eccentricity distributions of hot Jupiters that have had time...... to tidally circularize and those that have not, which we interpret as evidence against Type II migration in the final stages of hot Jupiter formation. Finally, the dependence of the circularization timescale on the planetary tidal quality factor, Q P, allows us to constrain the average value for hot Jupiters to be ....

  18. Obesity is a significant susceptibility factor for idiopathic AA amyloidosis.

    Science.gov (United States)

    Blank, Norbert; Hegenbart, Ute; Dietrich, Sascha; Brune, Maik; Beimler, Jörg; Röcken, Christoph; Müller-Tidow, Carsten; Lorenz, Hanns-Martin; Schönland, Stefan O

    2018-03-01

    To investigate obesity as susceptibility factor in patients with idiopathic AA amyloidosis. Clinical, biochemical and genetic data were obtained from 146 patients with AA amyloidosis. Control groups comprised 40 patients with long-standing inflammatory diseases without AA amyloidosis and 56 controls without any inflammatory disease. Patients with AA amyloidosis had either familial Mediterranean fever (FMF) or long-standing rheumatic diseases as underlying inflammatory disease (n = 111, median age 46 years). However, in a significant proportion of patients with AA amyloidosis no primary disease was identified (idiopathic AA; n = 37, median age 60 years). Patients with idiopathic AA amyloidosis were more obese and older than patients with AA amyloidosis secondary to FMF or rheumatic diseases. Serum leptin levels correlated with the body mass index (BMI) in all types of AA amyloidosis. Elevated leptin levels of more than 30 µg/l were detected in 18% of FMF/rheumatic + AA amyloidosis and in 40% of patients with idiopathic AA amyloidosis (p = .018). Finally, the SAA1 polymorphism was confirmed as a susceptibility factor for AA amyloidosis irrespective of the type of the disease. Obesity, age and the SAA1 polymorphism are susceptibility factors for idiopathic AA amyloidosis. Recent advances in treatment of FMF and rheumatic disorders will decrease the incidence of AA amyloidosis due to these diseases. Idiopathic AA, however, might be an emerging problem in the ageing and increasingly obese population.

  19. Effects of Biologic Agents in Patients with Rheumatoid Arthritis and Amyloidosis Treated with Hemodialysis.

    Science.gov (United States)

    Kuroda, Takeshi; Tanabe, Naohito; Nozawa, Yukiko; Sato, Hiroe; Nakatsue, Takeshi; Kobayashi, Daisuke; Wada, Yoko; Saeki, Takako; Nakano, Masaaki; Narita, Ichiei

    Objective Our objective was to examine the safety and effects of therapy with biologics on the prognosis of rheumatoid arthritis (RA) patients with reactive amyloid A (AA) amyloidosis on hemodialysis (HD). Methods Twenty-eight patients with an established diagnosis of reactive AA amyloidosis participated in the study. The survival was calculated from the date of HD initiation until the time of death, or up to end of June 2015 for the patients who were still alive. HD initiation was according to the program of HD initiation for systemic amyloidosis patients associated with RA. Results Ten patients had been treated with biologics before HD initiation for a mean of 28.2 months (biologic group), while 18 had not (non-biologic group). HD was initiated in patients with similar characteristics except for the tender joint count, swollen joint count, and disease activity score (DAS)28-C-reactive protein (CRP). History of biologics showed that etanercept was frequently used for 8 patients as the first biologic. There was no significant difference in the mortality rate according to a Kaplan-Meier analysis (p=0.939) and or associated risk of death in an age-adjusted Cox proportional hazards model (p=0.758) between both groups. Infections were significantly more frequent causes of death in the biologic group than in the non-biologic group (p=0.021). However, treatment with biologics improved the DAS28-CRP score (p=0.004). Conclusion Under the limited conditions of AA amyloidosis treated with HD, the use of biologics might affect infection and thus may not improve the prognosis. Strict infection control is necessary for the use of biologics with HD to improve the prognosis.

  20. [High frequency of dyslipidemia in VIH-infected patients in aa peruvian public hospital].

    Science.gov (United States)

    Rondan, Paola L; Flores-Flores, Oscar; Doria, Nicole A; Valencia-Mesias, Gustavo; Chávez-Pérez, Víctor; Soria, Jaime

    2017-01-01

    The objective of the study was to determine the frequency and characteristics of dyslipidemia in patients with HIV in highly active antiretroviral therapy (HAART) in a Peruvian public hospital. A cross-sectional study was carried out in patients with complete lipid profile after receiving at least six months of HAART. Dyslipidemia was defined according to the criteria of the NCEP-ATP III. We reviewed 2 975 clinical histories, and included 538 (18.1%) in the analysis. The frequency of dyslipidemia was 74.7%. HAART regimens which include protease inhibitors (PI) (odds ratio [OR]: 1.22; confidence interval at 95% [CI 95%]: 1.11-1.33) and to be older than 40 years (OR: 1.17; CI 95%: 1.05-1.28) were associated with dyslipidemia, adjusted by viral load, CD4 lymphocyte level and gender. In conclusion, dyslipidemia was very common in our sample and was mainly associated with the use of PI. It is necessary to promote the dyslipidemia control as part of the comprehensive care of the patient with HIV.

  1. HLA-inferred extended haplotype disparity level is more relevant than the level of HLA mismatch alone for the patients survival and GvHD in T cell-replate hematopoietic stem cell transplantation from unrelated donor.

    Science.gov (United States)

    Nowak, Jacek; Nestorowicz, Klaudia; Graczyk-Pol, Elzbieta; Mika-Witkowska, Renata; Rogatko-Koros, Marta; Jaskula, Emilia; Koscinska, Katarzyna; Madej, Sylwia; Tomaszewska, Agnieszka; Nasilowska-Adamska, Barbara; Szczepinski, Andrzej; Halaburda, Kazimierz; Dybko, Jaroslaw; Kuliczkowski, Kazimierz; Czerw, Tomasz; Giebel, Sebastian; Holowiecki, Jerzy; Baranska, Malgorzata; Pieczonka, Anna; Wachowiak, Jacek; Czyz, Anna; Gil, Lidia; Lojko-Dankowska, Anna; Komarnicki, Mieczyslaw; Bieniaszewska, Maria; Kucharska, Agnieszka; Hellmann, Andrzej; Gronkowska, Anna; Jedrzejczak, Wieslaw W; Markiewicz, Miroslaw; Koclega, Anna; Kyrcz-Krzemien, Slawomira; Mielcarek, Monika; Kalwak, Krzysztof; Styczynski, Jan; Wysocki, Mariusz; Drabko, Katarzyna; Wojcik, Beata; Kowalczyk, Jerzy; Gozdzik, Jolanta; Pawliczak, Daria; Gwozdowicz, Slawomir; Dziopa, Joanna; Szlendak, Urszula; Witkowska, Agnieszka; Zubala, Marta; Gawron, Agnieszka; Warzocha, Krzysztof; Lange, Andrzej

    2018-06-01

    Serious risks in unrelated hematopoietic stem cell transplantation (HSCT) including graft versus host disease (GvHD) and mortality are associated with HLA disparity between donor and recipient. The increased risks might be dependent on disparity in not-routinely-tested multiple polymorphisms in genetically dense MHC region, being organized in combinations of two extended MHC haplotypes (Ehp). We assessed the clinical role of donor-recipient Ehp disparity levels in N = 889 patients by the population-based detection of HLA allele phase mismatch. We found increased GvHD incidences and mortality rates with increasing Ehp mismatch level even with the same HLA mismatch level. In multivariate analysis HLA mismatch levels were excluded from models and Ehp disparity level remained independent prognostic factor for high grade acute GvHD (p = 0.000037, HR = 10.68, 95%CI 5.50-32.5) and extended chronic GvHD (p < 0.000001, HR = 15.51, CI95% 5.36-44.8). In group with single HLA mismatch, patients with double Ehp disparity had worse 5-year overall survival (45% vs. 56%, p = 0.00065, HR = 4.05, CI95% 1.69-9.71) and non-relapse mortality (40% vs. 31%, p = 0.00037, HR = 5.63, CI95% 2.04-15.5) than patients with single Ehp disparity. We conclude that Ehp-linked factors contribute to the high morbidity and mortality in recipients given HLA-mismatched unrelated transplant and Ehp matching should be considered in clinical HSCT. Copyright © 2018. Published by Elsevier Inc.

  2. Chemical analysis of three barium stars: HD 51959, HD 88035, and HD 121447

    Science.gov (United States)

    Karinkuzhi, Drisya; Goswami, Aruna; Sridhar, Navin; Masseron, Thomas; Purandardas, Meenakshi

    2018-05-01

    We present elemental abundance results from high-resolution spectral analysis of three nitrogen-enhanced barium stars. The analysis is based on spectra obtained with the fibre-fed extended range optical spectrograph attached to 1.52 m telescope at European Southern Observatory, Chile. The spectral resolution is R ˜ 48,000 and the spectral coverage spans from 3500 to 9000Å . For the objects HD 51959 and HD 88035, we present the first-time abundance analyses results. Although a few studies are available in literature on the object HD 121447, the results are significantly different from each other. We have therefore carried out a detailed chemical composition study for this object based on a high-resolution spectrum with high S/N ratio, for a better understanding of the origin of the abundance patterns observed in this star. Stellar atmospheric parameters, the effective temperature, surface gravity, microturbulence, and metallicity of the stars are determined from the local thermodynamic equilibrium analysis using model atmospheres. The metallicities of HD 51959 and HD 88035 are found to be near-solar; they exhibit enhanced abundances of neutron-capture elements. HD 121447 is found to be moderately metal-poor with [Fe/H] = -0.65. While carbon is near-solar in the other two objects, HD 121447 shows carbon enhancement at a level, [C/Fe] = 0.82. Neutron-capture elements are highly enhanced with [X/Fe] > 2 (X: Ba, La, Pr, Nd, Sm) in this object. The α- and iron-peak elements show abundances very similar to field giants with the same metallicity. From kinematic analysis all the three objects are found to be members of thin disc population with a high probability of 0.99, 0.99, and 0.92 for HD 51959, HD 88035, and HD 121447, respectively.

  3. AAS 227: Day 3

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    many orbits has made it a powerhouse for learning about the temperatures, atmospheres, and orbits of exoplanets. The list of examples that Fazio provided included the first global temperature map of an exoplanet (HD 189733b), the detection of the closest transiting exoplanet (HD 219134b), and the measurement of thermal emission from a super-Earth (55 Cnc e). Spitzers large distance from the Earth (specifically, the ground-based telescopes on Earth) even allowed astronomers to observe an exoplanet via gravitational microlensing using a special technique called space-based parallax.Spitzer has also been extremely useful for observing everything from Solar System scales (such as the enormous infrared dust ring around Saturn) to galactic structures. Comparing images of galaxies observed at visible wavelengths with Spitzer images of the same galaxies at infrared wavelengths has allowed us to probe the structure and composition of galaxies at a new level.Astronomers have also used Spitzer to explore the evolution of stars. Thanks to its infrared detectors, Spitzer can look through large clouds of dust that are opaque at visible wavelengths, and observe young stellar objects in their birth environments. Cosmologists can use Spitzer to study the early universe and the formation of galaxies over twelve billion years ago. Fazio used all of these examples and more to demonstrate that Spitzer has truly changed our understanding of the universe.Climate Change for Astronomers (Meredith Rawls)Every astronomer at #aas227 wants to learn about climate change! WOW this room is ridiculously full. pic.twitter.com/ud9an0gLJG Meredith Rawls (@merrdiff) January 7, 2016The second half of the session was a presentation by Doug Duncan featuring an activity from his 101-level college course. He uses climate change as a way to teach critical thinking and scientific reasoning. Members of the audience were walked through an exercise that included interpreting plots of changing surface temperatures

  4. The massive multiple system HD 64315

    Science.gov (United States)

    Lorenzo, J.; Simón-Díaz, S.; Negueruela, I.; Vilardell, F.; Garcia, M.; Evans, C. J.; Montes, D.

    2017-10-01

    Context. The O6 Vn star HD 64315 is believed to belong to the star-forming region known as NGC 2467, but previous distance estimates do not support this association. Moreover, it has been identified as a spectroscopic binary, but existing data support contradictory values for its orbital period. Aims: We explore the multiple nature of this star with the aim of determining its distance, and understanding its connection to NGC 2467. Methods: A total of 52 high-resolution spectra have been gathered over a decade. We use their analysis, in combination with the photometric data from All Sky Automated Survey and Hipparcos catalogues, to conclude that HD 64315 is composed of at least two spectroscopic binaries, one of which is an eclipsing binary. We have developed our own program to fit four components to the combined line shapes. Once the four radial velocities were derived, we obtained a model to fit the radial-velocity curves using the Spectroscopic Binary Orbit Program (SBOP). We then implemented the radial velocities of the eclipsing binary and the light curves in the Wilson-Devinney code iteratively to derive stellar parameters for its components. We were also able to analyse the non-eclipsing binary, and to derive minimum masses for its components which dominate the system flux. Results: HD 64315 contains two binary systems, one of which is an eclipsing binary. The two binaries are separated by 0.09 arcsec (or 500 AU) if the most likely distance to the system, 5 kpc, is considered. The presence of fainter companions is not excluded by current observations. The non-eclipsing binary (HD 64315 AaAb) has a period of 2.70962901 ± 0.00000021 d. Its components are hotter than those of the eclipsing binary, and dominate the appearance of the system. The eclipsing binary (HD 64315 BaBb) has a shorter period of 1.0189569 ± 0.0000008 d. We derive masses of 14.6 ± 2.3 M⊙ for both components of the BaBb system. They are almost identical; both stars are overfilling their

  5. Study on diagnosis of HD

    International Nuclear Information System (INIS)

    Chen Shuran; Yang Yumei; Zhang Guangli

    1994-01-01

    The study suggests a three-step diagnostic method for diagnosing HD. The first step is to make TgA, TmA examination; the second step is to make differential diagnosis for the cases of negative TgA, TmA through FNAB examination; the third step is to make TgA, TmA and FNAB examination for dynamic observation of controversial cases left over in the former two steps to achieve accurate diagnosis. Differential diagnosis has been made with the method in 87 cases of HD (clinical diagnosis only). The result shows that 7 cases have been diagnosed as thyropathy through comprehensive evaluation; definite diagnosis of HD has been made in 62 cases through TgA, TmA and in 77 cases through FNAB; 3 cases of negative TgA and TmA failed to accept FNAB examination, and were later diagnosed as HD through operation pathology or clinical treatment

  6. Detection of AA76, a Common Form of Amyloid A Protein, as a Way of Diagnosing AA Amyloidosis.

    Science.gov (United States)

    Sato, Junji; Okuda, Yasuaki; Kuroda, Takeshi; Yamada, Toshiyuki

    2016-01-01

    Reactive amyloid deposits consist of amyloid A (AA) proteins, the degradation products of serum amyloid A (SAA). Since the most common species of AA is the amino terminal portion produced by cleavage between residues 76 and 77 of SAA (AA76), the presence of AA76 in tissues could be a consequence of AA amyloid deposition. This study assessed the diagnostic significance of the detection of AA76 for AA amyloidosis using two different approaches. Biopsy specimens (n=130 from 54 subjects) from gastroduodenal mucosa or abdominal fat (n=9 from 9 subjects) of patients who had already been diagnosed with or were suspected of having AA amyloidosis were used. Fixed mucosal sections were subjected to immunohistochemistry using a newly developed antibody recognizing the carboxyl terminal end of AA76 (anti-AA76). The non-fixed materials from gastroduodenal mucosa or abdominal fat were subjected to immunoblotting for detection of the size of AA76. Among the gastroduodenal specimens (n=115) from already diagnosed patients, the positive rates of Congo red staining, immunohistochemistry using anti-AA76, and immunoblotting were 68.4%, 73.0%, and 92.2%, respectively. The anti-AA76 did not stain the supposed SAA in the blood or leakage, which was stained by anti-SAA antibody. AA76 was not detected either by immunohistochemistry or by immunoblot in the materials from patients in whom AA amyloidosis had been ruled out. In the abdominal fat, the immunoblot detected AA76 in 8 materials from 8 already diagnosed patients and did not in 1 patient whose gastroduodenal mucosa was negative. In conclusion, the detection of AA76 may alter the ability to diagnose AA amyloidosis. In immunohistochemistry for fixed specimens, the new anti-AA76 antibody can improve the specificity. Immunoblot for non-fixed materials, which can considerably improve the sensitivity, should be beneficial for small materials like abdominal fat. © 2016 by the Association of Clinical Scientists, Inc.

  7. Further investigation of the role of HLA-DPB1 in adult Hodgkin's disease (HD) suggests an influence on susceptibility to different HD subtypes.

    OpenAIRE

    Taylor, G.M.; Gokhale, D.A.; Crowther, D.; Woll, P.J.; Harris, M.; Ryder, D.; Ayres, M.; Radford, J.A.

    1999-01-01

    It has been suggested in a number of studies that susceptibility to adult Hodgkin's disease (HD) is influenced by the HLA class II region, and specifically by alleles at the HLA-DPB1 locus. Since HD is diagnostically complex, it is not clear whether different HLA-DPB1 alleles confer susceptibility to different HD subtypes. To clarify this we have extended a previous study to type DPB1 alleles in 147 adult HD patients from a single centre. We have analysed patients with nodular sclerosing (NS)...

  8. Aa Ah Nak

    Science.gov (United States)

    Tha, Na Gya; Wus, Thay

    2017-01-01

    In this article, Aa Ah Nak, the authors' methodology presents not only various reflections but also diverse contradictions about the Aa Nii language as well as language revitalization. This article explores language foundation and how the Aa Nii language revitalization is inextricably linked to the genocide and resulting historic trauma pervasive…

  9. Serial measurements of serum PDGF-AA, PDGF-BB, FGF2, and VEGF in multiresistant ovarian cancer patients treated with bevacizumab

    Directory of Open Access Journals (Sweden)

    Madsen Christine

    2012-09-01

    Full Text Available Abstract Introduction Anti-VEGF treatment has proven effective in recurrent ovarian cancer. However, the identification of the patients most likely to respond is still pending. It is well known that the angiogenesis is regulated by several other pro-angiogenic proteins, e.g. the platelet - derived growth factor (PDGF system and the fibroblast growth factor (FGF system. These other signaling pathways may remain active or become upregulated during anti-VEGF treatment. The aim of the present study was to investigate if potential changes of PDGF-BB, PDGF-AA, and FGF2 before and during bevacizumab treatment had predictive value for early progression or survival. Furthermore, we wanted to investigate the importance of serum VEGF in the same cohort. Methods This study included 106 patients with chemotherapy-resistant epithelial ovarian cancer who were treated with single agent bevacizumab as part of a biomarker protocol. Patients were evaluated for response by the Response Evaluation Criteria In Solid Tumors (RECIST and/ or Gynecologic Cancer Intergroup (GCIG CA125 criteria. Serum samples were collected at baseline and prior to each treatment. FGF2, PDGF-BB, PDGF-AA were quantified simultaneously using the Luminex system, and VEGF-A was measured by ELISA. Eighty-eight baseline samples were avaliable for FGF2, PDGF-BB, PDGF-AA analysis, and 93 baseline samples for VEGF. Results High baseline serum VEGF was related to poor overall survival. Furthermore, high serum PDGF-BB and FGF2 was of prognostic significance. None of the markers showed predictive value, neither at baseline level nor during the treatment.

  10. PBSCT is associated with poorer survival and increased chronic GvHD than BMT in Japanese paediatric patients with acute leukaemia and an HLA-matched sibling donor.

    Science.gov (United States)

    Shinzato, Aki; Tabuchi, Ken; Atsuta, Yoshiko; Inoue, Masami; Inagaki, Jiro; Yabe, Hiromasa; Koh, Katsuyoshi; Kato, Koji; Ohta, Hideaki; Kigasawa, Hisato; Kitoh, Toshiyuki; Ogawa, Atsushi; Takahashi, Yoshiyuki; Sasahara, Yoji; Kato, Shun-Ichi; Adachi, Souichi

    2013-09-01

    Peripheral blood stem cells (PBSC) may be used as an alternative to bone marrow (BM) for allogeneic transplantation. Since peripheral blood stem cell bank from unrelated volunteer donor has been started in Japan, use of PBSC allografts may be increased. Therefore we surveyed the outcomes of Japanese leukemia children after PBSC and BM transplantation. This retrospective study compared the outcomes of 661 children (0-18 years) with acute lymphoblastic leukaemia (ALL) or acute myeloid leukaemia (AML) who received their first allogeneic peripheral blood stem cell transplantation (PBSCT; n = 90) or bone marrow transplantation (BMT; n = 571) from HLA-matched siblings between January 1996 and December 2007. Neutrophil recovery was faster after PBSCT than after BMT (ALL: P vs. 9.9%, P = 0.0066; AML: 41.6% vs. 11.1%, P vs. 57.1%, P = 0.0257). The 5-year overall survival (OS) was lower after PBSCT than after BMT for ALL (42.4% vs. 63.7%, P = 0.0032) and AML (49.8% vs. 71.8%, P = 0.0163). Multivariate analysis revealed the use of PBSC was a significant risk factor for DFS and OS. PBSCT and BMT did not differ in relapse rate, acute GvHD for ALL and AML, or in DFS for AML. PBSC allografts in Japanese children engraft faster but are associated with poorer survival and increased chronic GvHD. Copyright © 2013 Wiley Periodicals, Inc.

  11. Stress-related salivary alpha-amylase (sAA) activity in alcohol dependent patients with and without a history of childhood maltreatment.

    Science.gov (United States)

    Muehlhan, Markus; Höcker, Anja; Höfler, Michael; Wiedemann, Klaus; Barnow, Sven; Schäfer, Ingo

    2017-06-01

    Alcohol-dependent (AD) patients with a history of childhood maltreatment (CM) have shown a more severe clinical profile and a higher risk of relapse than those without CM. It was hypothesized that stress responsivity plays an important role in moderating the relationship between CM and AD. Surprisingly, systematic investigations about the stress responsivity in AD patients with CM are rare. This study compared physiological and subjective stress responses in AD patients with and without CM as well as in healthy controls with and without CM. A total of 130 participants performed the Trier Social Stress Test (TSST). Physiological stress reactivity related to the noradrenergic system was assessed by salivary alpha-amylase (sAA) activity. Subjective ratings of anxiety, nervousness, distress, and mood were rated on visual analogue scales. AD patients showed significantly lower stress-related sAA activity than healthy controls (p ≤ 0.024; z ≥ 1.97). A different pattern was found in the subjective ratings. In particular, anticipatory anxiety revealed a clear effect of CM (p ≤ 0.005; z ≥ 2.43) but no difference between AD patients and healthy controls (p > 0.05). After the TSST, distress ratings differed between AD patients with CM and AD patients without CM (p ≤ 0.009; z ≥ 2.61). The discrepancy between physiological responsivity and subjective stress experiences may account for an increased inability to cope with stressful situations, which in turn might explain the enhanced risk of relapse in AD patients with a history of CM during early abstinence.

  12. The AA genotype of the regulatory BCL2 promoter polymorphism ( 938C>A) is associated with a favorable outcome in lymph node negative invasive breast cancer patients.

    Science.gov (United States)

    Bachmann, Hagen S; Otterbach, Friedrich; Callies, Rainer; Nückel, Holger; Bau, Maja; Schmid, Kurt W; Siffert, Winfried; Kimmig, Rainer

    2007-10-01

    Expression of the antiapoptotic and antiproliferative protein Bcl-2 has been repeatedly shown to be associated with better clinical outcome in breast cancer. We recently showed a novel regulatory (-938C>A) single-nucleotide polymorphism (SNP) in the inhibitory P2 BCL2 gene promoter generating significantly different BCL2 promoter activities. Paraffin-embedded neoplastic and nonneoplastic tissues from 274 patients (161 still alive after a follow-up period of at least 80 months) with primary unilateral invasive breast carcinoma were investigated. Bcl-2 expression of tumor cells was shown by immunohistochemistry; nonneoplastic tissues were used for genotyping. Both the Bcl-2 expression and the (-938C>A) genotypes were correlated with the patients' survival. Kaplan-Meier curves revealed a significant association of the AA genotype with increased survival (P = 0.030) in lymph node-negative breast cancer patients, whereas no genotype effect could be observed in lymph node-positive cases. Ten-year survival rates were 88.6% for the AA genotype, 78.4% for the AC genotype, and 65.8% for the CC genotype. Multivariable Cox regression identified the BCL2 (-938CC) genotype as an independent prognostic factor for cancer-related death in lymph node-negative breast carcinoma patients (hazard ratio, 3.59; P = 0.032). Immunohistochemical Bcl-2 expression was significantly associated with the clinical outcome of lymph node-positive but not of lymph node-negative breast cancer patients. In lymph node-negative cases, the (-938C>A) SNP was both significantly related with the immunohistochemically determined level of Bcl-2 expression (P = 0.044) and the survival of patients with Bcl-2-expressing carcinomas (P = 0.006). These results suggest the (-938C>A) polymorphism as a survival prognosticator as well as indicator of a high-risk group within patients with lymph node-negative breast cancer.

  13. Detection of planet candidates around K giants. HD 40956, HD 111591, and HD 113996

    Science.gov (United States)

    Jeong, G.; Lee, B.-C.; Han, I.; Omiya, M.; Izumiura, H.; Sato, B.; Harakawa, H.; Kambe, E.; Mkrtichian, D.

    2018-02-01

    Aims: The purpose of this paper is to detect and investigate the nature of long-term radial velocity (RV) variations of K-type giants and to confirm planetary companions around the stars. Methods: We have conducted two planet search programs by precise RV measurement using the 1.8 m telescope at Bohyunsan Optical Astronomy Observatory (BOAO) and the 1.88 m telescope at Okayama Astrophysical Observatory (OAO). The BOAO program searches for planets around 55 early K giants. The OAO program is looking for 190 G-K type giants. Results: In this paper, we report the detection of long-period RV variations of three K giant stars, HD 40956, HD 111591, and HD 113996. We investigated the cause of the observed RV variations and conclude the substellar companions are most likely the cause of the RV variations. The orbital analyses yield P = 578.6 ± 3.3 d, m sin i = 2.7 ± 0.6 MJ, a = 1.4 ± 0.1 AU for HD 40956; P = 1056.4 ± 14.3 d, m sin i = 4.4 ± 0.4 MJ, a = 2.5 ± 0.1 AU for HD 111591; P = 610.2 ± 3.8 d, m sin i = 6.3 ± 1.0 MJ, a = 1.6 ± 0.1 AU for HD 113996. Based on observations made with the BOES at BOAO in Korea and HIDES at OAO in Japan.Tables 3-5 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/610/A3

  14. Antiproton Accumulator (AA)

    CERN Multimedia

    Photographic Service

    1980-01-01

    The AA in its final stage of construction, before it disappeared from view under concrete shielding. Antiprotons were first injected, stochastically cooled and accumulated in July 1980. From 1981 on, the AA provided antiprotons for collisions with protons, first in the ISR, then in the SPS Collider. From 1983 on, it also sent antiprotons, via the PS, to the Low-Energy Antiproton Ring (LEAR). The AA was dismantled in 1997 and shipped to Japan.

  15. AA magnet measurement team

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    Quickly improvised measurement equipment for the AA (Antiproton Accumulator) was all the tight schedule permitted, but the high motivation of the team made up for the lack of convenience. From left to right: Roy Billinge (Joint AA Project Leader, the other one was Simon van der Meer); Bruno Autin, Brian Pincott, Colin Johnson.

  16. AA under construction

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The AA at an early stage of construction, in the newly built AA-Hall. Cable-trays already outline the shape of the accumulator ring. To the right are huge cable-drums for the pulse-forming-network (PFN) of the injection kicker. Seeing this picture, can one imagine that only 8 months later beams were circulating in the completed accumulator ring ?

  17. Quality control of involved field radiotherapy in the HD 13 and HD 14 trials. Report of the radiotherapy panel of the German Hodgkin Study Group (GHSG)

    Energy Technology Data Exchange (ETDEWEB)

    Kriz, J.; Haverkamp, U.; Eich, H.T. [University of Muenster, Department of Radiation Oncology, Muenster (Germany); Baues, C. [University of Cologne, Department of Radiation Oncology, Cologne (Germany); Engenhart-Cabillic, R. [University of Marburg, Department of Radiation Oncology, Marburg (Germany); Herfarth, K. [University of Heidelberg, Department of Radiation Oncology, Heidelberg (Germany); Lukas, P. [University of Innsbruck, Department of Radiation Oncology, Innsbruck (Austria); Pluetschow, A.; Fuchs, M.; Engert, A. [University of Cologne, Department of Internal Medicine, Cologne (Germany); Schmidberger, H. [University of Mainz, Department of Radiation Oncology, Mainz (Germany); Staar, S. [Bremen Mitte, Department of Radiation Oncology, Bremen (Germany)

    2017-02-15

    As part of the foundation of the German Hodgkin Study Group (GHSG) in 1978, a central radiotherapy (RT) reference centre was established to evaluate and to improve the quality of treatment. During the study generations, the quality assurance programs (QAP) were continued and adapted to the demands of each study. The purpose of this article is to demonstrate the results of the fifth study generation and to compare them to the previous findings. With the start of the fourth GHSG study generation (HD10-12), a central prospective review of all diagnostic images was established to create an individual treatment plan for each early stage study patient. The quality of involved field RT was retrospectively evaluated by an expert panel of radiation oncologists. In the fifth study generation (HD13-15), the retrospective review of radiotherapy performed was refined and the results were compared with the findings of the fourth generation. The expert panel analyzed the RT planning and application of 1037 (28 %) patients (HD13 n = 465, HD14 n = 572). Simulation films were available in 85 % of cases and verification films in 87 %. RT was assessed as major violation in 46 % (HD13 = 38 %, HD14 = 52 %), minor violation in 9 % (HD13 = 9 %, HD14 = 9 %) and according to the protocol in 45 % (HD13 = 52 %, HD14 = 38 %). The value for QAP of RT within the GHSG trials is well known. Still there were several protocol violations. In the future, the QAP program has to be adapted to the requirements of ''modern RT'' in malignant lymphoma. (orig.) [German] Seit Gruendung der German Hodgkin Study Group (GHSG) im Jahr 1978 wurde ein zentrales Qualitaetssicherungsprogramm (QAP) der Radiotherapie (RT) etabliert, um die Qualitaet der RT sicherzustellen. Waehrend der fortlaufenden Studiengenerationen wurde dieses QAP kontinuierlich weiterentwickelt. In dieser Auswertung werden die Ergebnisse der fuenften Studiengeneration (HD13-15) praesentiert und mit frueheren Ergebnissen

  18. Quality control of involved field radiotherapy in the HD 13 and HD 14 trials. Report of the radiotherapy panel of the German Hodgkin Study Group (GHSG)

    International Nuclear Information System (INIS)

    Kriz, J.; Haverkamp, U.; Eich, H.T.; Baues, C.; Engenhart-Cabillic, R.; Herfarth, K.; Lukas, P.; Pluetschow, A.; Fuchs, M.; Engert, A.; Schmidberger, H.; Staar, S.

    2017-01-01

    As part of the foundation of the German Hodgkin Study Group (GHSG) in 1978, a central radiotherapy (RT) reference centre was established to evaluate and to improve the quality of treatment. During the study generations, the quality assurance programs (QAP) were continued and adapted to the demands of each study. The purpose of this article is to demonstrate the results of the fifth study generation and to compare them to the previous findings. With the start of the fourth GHSG study generation (HD10-12), a central prospective review of all diagnostic images was established to create an individual treatment plan for each early stage study patient. The quality of involved field RT was retrospectively evaluated by an expert panel of radiation oncologists. In the fifth study generation (HD13-15), the retrospective review of radiotherapy performed was refined and the results were compared with the findings of the fourth generation. The expert panel analyzed the RT planning and application of 1037 (28 %) patients (HD13 n = 465, HD14 n = 572). Simulation films were available in 85 % of cases and verification films in 87 %. RT was assessed as major violation in 46 % (HD13 = 38 %, HD14 = 52 %), minor violation in 9 % (HD13 = 9 %, HD14 = 9 %) and according to the protocol in 45 % (HD13 = 52 %, HD14 = 38 %). The value for QAP of RT within the GHSG trials is well known. Still there were several protocol violations. In the future, the QAP program has to be adapted to the requirements of ''modern RT'' in malignant lymphoma. (orig.) [de

  19. Late Thyroid Sequlae after Treatment of Hodgkin's Disease (HD)

    International Nuclear Information System (INIS)

    Abaza, A.

    2012-01-01

    To identify the late effects of radio- chemotherapy (CTH) on thyroid gland in long-term survivors (LTS) HD patients regularly attending the pediatric oncology clinic of National Cancer Institute (NCI), 42 LTS (33 males and 9 females) were studied, together with 26 newly-diagnosed (ND) HD patients (15 males and 11 females) and 28 healthy controls. During 3 years period, all patients subjected to through clinical history/ examination. Files of LTS were revised for date of diagnoses, original site (s), stage, histopathological subtypes and dose/ duration of therapy. Clinical examination was done with laying stress on neck examination for thyroid swelling and lymphadenopathy. Lab investigations include hormonal assay of thyroid and parathyroid (T3, T4, TSH, Thyroglobin, and parathormone). In LTS the mean age was 14.9±3.4 yrs. versus 9.5±3.7 yrs. in ND patients. In LTS, treatment modalities included radiotherapy (RT) alone (2.4%), CTH alone (26.2%) or combination chemo-RT (71.4%). The mean followup time was 7.47±2.19 yrs. The incidence of hyper-/hypo-thyroidism was significantly higher in LTS. High TSH was found only among patients who received chemo-RT (11/26) with thyroid irradiation (IR) in the whole neck field. Finally, the study documented that the hyper-/hypo-thyroidism was one of the long-term complication of radio-CTH in HD patients. Recommendations regarding the follow-up of therapy for HD were discussed. New strategies and evidence based surveillance of the long-term effects are needed for dealing with HD, especially in children

  20. Geomagnetic aa Indices

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa indices are the continuation of the series beginning in the year 1868. A full description of these indices is given in the International...

  1. Accurate effective temperatures of the metal-poor benchmark stars HD 140283, HD 122563, and HD 103095 from CHARA interferometry

    Science.gov (United States)

    Karovicova, I.; White, T. R.; Nordlander, T.; Lind, K.; Casagrande, L.; Ireland, M. J.; Huber, D.; Creevey, O.; Mourard, D.; Schaefer, G. H.; Gilmore, G.; Chiavassa, A.; Wittkowski, M.; Jofré, P.; Heiter, U.; Thévenin, F.; Asplund, M.

    2018-03-01

    Large stellar surveys of the Milky Way require validation with reference to a set of `benchmark' stars whose fundamental properties are well determined. For metal-poor benchmark stars, disagreement between spectroscopic and interferometric effective temperatures has called the reliability of the temperature scale into question. We present new interferometric measurements of three metal-poor benchmark stars, HD 140283, HD 122563, and HD 103095, from which we determine their effective temperatures. The angular sizes of all the stars were determined from observations with the PAVO beam combiner at visible wavelengths at the CHARA array, with additional observations of HD 103095 made with the VEGA instrument, also at the CHARA array. Together with photometrically derived bolometric fluxes, the angular diameters give a direct measurement of the effective temperature. For HD 140283, we find θLD = 0.324 ± 0.005 mas, Teff = 5787 ± 48 K; for HD 122563, θLD = 0.926 ± 0.011 mas, Teff = 4636 ± 37 K; and for HD 103095, θLD = 0.595 ± 0.007 mas, Teff = 5140 ± 49 K. Our temperatures for HD 140283 and HD 103095 are hotter than the previous interferometric measurements by 253 and 322 K, respectively. We find good agreement between our temperatures and recent spectroscopic and photometric estimates. We conclude some previous interferometric measurements have been affected by systematic uncertainties larger than their quoted errors.

  2. PHOTOELECTRIC OBSERVATIONS OF HD 8358

    Directory of Open Access Journals (Sweden)

    Woo-Baik Lee

    1989-06-01

    Full Text Available UBV photoelectric observations of RS CVn type variable star HD 8358 were made using the 61cm reflector at Sobaeksan Astronomical Observatory. The data were obtained on 15 nights from October 1987 to December 1988. Double peaks of maximum light is seen from the light curve and continuous change of phase in notified from the times of maximum lights. The colors of October, 1987 - January, 1988 observations are bluer in ∆(b-u, but redder in ∆(u-b, than those of November -December, 1988 observations.

  3. HD 101065, the Most Peculiar Star

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... In this paper we discuss the prospects for asteroseismology with spatial resolution and motivate studies of the most chemically peculiar roAp star HD 101065. We present the first results from a high-precision radial velocity (RV) study of HD 101065 based on data spanning four nights that were acquired ...

  4. Cognitive-behavioural therapy (CBT) for renal fatigue (BReF):a feasibility randomised-controlled trial of CBT for the management of fatigue in haemodialysis (HD) patients

    OpenAIRE

    Picariello, Federica; Moss-Morris, Rona; Macdougall, Iain C.; Norton, Sam; Da Silva-Gane, Maria; Farrington, Ken; Clayton, Hope; Chilcot, Joseph

    2018-01-01

    Introduction Fatigue is one of the most common and disabling symptoms in end-stage kidney disease, particularly among in-centre haemodialysis patients. This two-arm parallel group feasibility randomised controlled trial will determine whether a fully powered efficacy trial is achievable by examining the feasibility of recruitment, acceptability and potential benefits of a cognitive-behavioural therapy (CBT)-based intervention for fatigue among in-centre haemodialysis patients.Methods We aim t...

  5. Thalassemia intermedia as a result of heterozygosis for ß0-thalassemia and aaaanti-3.7/aa genotype in a Brazilian patient

    Directory of Open Access Journals (Sweden)

    Kimura E.M.

    2003-01-01

    Full Text Available We report a case in which the interaction of heterozygosis for both the ß0-IVS-II-1 (G->A mutation and the aaaanti-3.7 allele was the probable cause for the clinical occurrence of thalassemia intermedia. The propositus, a 6-year-old Caucasian Brazilian boy of Portuguese descent, showed a moderately severe chronic anemia in spite of having the ß-thalassemia trait. Investigation of the alpha-globin gene status revealed heterozygosis for alpha-gene triplication (aaa/aa. The patient's father, also presenting mild microcytic and hypochromic anemia, had the same alpha and ß genotypes as his son, while the mother, not related to the father and hematologically normal, was also a carrier of the aaaanti-3.7 allele. The present case emphasizes the need for considering the possibility of alpha-gene triplication in ß-thalassemia heterozygotes who display an unexpected severe phenotype. The ß-thalassemia mutation found here is being described for the first time in Brazil.

  6. Polarized Disk Emission from Herbig Ae/Be Stars Observed Using Gemini Planet Imager: HD 144432, HD 150193, HD 163296, and HD 169142

    Energy Technology Data Exchange (ETDEWEB)

    Monnier, John D.; Aarnio, Alicia; Adams, Fred C.; Calvet, Nuria; Hartmann, Lee [Astronomy Department, University of Michigan, Ann Arbor, MI 48109 (United States); Harries, Tim J.; Hinkley, Sasha; Kraus, Stefan [University of Exeter, Exeter (United Kingdom); Andrews, Sean; Wilner, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 91023 (United States); Espaillat, Catherine [Boston University, Boston, MA (United States); McClure, Melissa [European Southern Observatory, Garching (Germany); Oppenheimer, Rebecca [American Museum of Natural History, New York (United States); Perrin, Marshall [Space Telescope Science Institute, Baltimore, MD (United States)

    2017-03-20

    In order to look for signs of ongoing planet formation in young disks, we carried out the first J -band polarized emission imaging of the Herbig Ae/Be stars HD 150193, HD 163296, and HD 169142 using the Gemini Planet Imager, along with new H band observations of HD 144432. We confirm the complex “double ring” structure for the nearly face-on system HD 169142 first seen in H -band, finding the outer ring to be substantially redder than the inner one in polarized intensity. Using radiative transfer modeling, we developed a physical model that explains the full spectral energy distribution and J - and H -band surface brightness profiles, suggesting that the differential color of the two rings could come from reddened starlight traversing the inner wall and may not require differences in grain properties. In addition, we clearly detect an elongated, off-center ring in HD 163296 (MWC 275), locating the scattering surface to be 18 au above the midplane at a radial distance of 77 au, co-spatial with a ring seen at 1.3 mm by ALMA linked to the CO snow line. Lastly, we report a weak tentative detection of scattered light for HD 150193 (MWC 863) and a non-detection for HD 144432; the stellar companion known for each of these targets has likely disrupted the material in the outer disk of the primary star. For HD 163296 and HD 169142, the prominent outer rings we detect could be evidence for giant planet formation in the outer disk or a manifestation of large-scale dust growth processes possibly related to snow-line chemistry.

  7. Polarized Disk Emission from Herbig Ae/Be Stars Observed Using Gemini Planet Imager: HD 144432, HD 150193, HD 163296, and HD 169142

    International Nuclear Information System (INIS)

    Monnier, John D.; Aarnio, Alicia; Adams, Fred C.; Calvet, Nuria; Hartmann, Lee; Harries, Tim J.; Hinkley, Sasha; Kraus, Stefan; Andrews, Sean; Wilner, David; Espaillat, Catherine; McClure, Melissa; Oppenheimer, Rebecca; Perrin, Marshall

    2017-01-01

    In order to look for signs of ongoing planet formation in young disks, we carried out the first J -band polarized emission imaging of the Herbig Ae/Be stars HD 150193, HD 163296, and HD 169142 using the Gemini Planet Imager, along with new H band observations of HD 144432. We confirm the complex “double ring” structure for the nearly face-on system HD 169142 first seen in H -band, finding the outer ring to be substantially redder than the inner one in polarized intensity. Using radiative transfer modeling, we developed a physical model that explains the full spectral energy distribution and J - and H -band surface brightness profiles, suggesting that the differential color of the two rings could come from reddened starlight traversing the inner wall and may not require differences in grain properties. In addition, we clearly detect an elongated, off-center ring in HD 163296 (MWC 275), locating the scattering surface to be 18 au above the midplane at a radial distance of 77 au, co-spatial with a ring seen at 1.3 mm by ALMA linked to the CO snow line. Lastly, we report a weak tentative detection of scattered light for HD 150193 (MWC 863) and a non-detection for HD 144432; the stellar companion known for each of these targets has likely disrupted the material in the outer disk of the primary star. For HD 163296 and HD 169142, the prominent outer rings we detect could be evidence for giant planet formation in the outer disk or a manifestation of large-scale dust growth processes possibly related to snow-line chemistry.

  8. Fred-Jaiyesimi, AA

    African Journals Online (AJOL)

    Fred-Jaiyesimi, AA. Vol 12 (2008) - Articles Hypoglycaemic And Alpha-Amylase Inhibitory Activities Of Fermented Seeds Of Parkia Biglobosa (Jacq) Benth Abstract. ISSN: 1118-6267. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  9. Differences in clinical outcome between docetaxel and abiraterone acetate as the first-line treatment in chemo-naïve metastatic castration-resistant prostate cancer patients with or without the ineligible clinical factors of the COU-AA-302 study.

    Science.gov (United States)

    Poon, Darren M C; Chan, Kuen; Lee, Siu H; Chan, Tim W; Sze, Henry; Lee, Eric K C; Lam, Daisy; Chan, Michelle F T

    2018-03-01

    This study aimed to compare the efficacy of abiraterone acetate (AA) versus docetaxel (T) as first-line treatment in chemo-naïve metastatic castration-resistant prostate cancer (mCRPC) patients with or without the ineligible factors of the COU-AA-302 study (presence of visceral metastases, symptomatic disease, and/or Eastern Cooperative Oncology Group performance status ≥ 2). The clinical records of chemo-naïve mCRPC patients who received AA in six public oncology centers or T in two of these centers between 2003 and 2014 were reviewed. The survival time was compared among four subgroups of patients: those with ineligible factors administered AA (Group Ineligible-AA) or T (Group Ineligible-T), and those without ineligible factors and administered AA (Group Eligible-AA) or T (Group Eligible-T). During the study period, we identified 115 mCRPC patients who received AA or T, among whom 29, 36, 29, and 21 patients were classified as Groups Ineligible-AA, Ineligible-T, Eligible-AA, and Eligible-T, respectively. Both Group Ineligible-AA and Group Eligible-AA had significantly longer progression-free survival (PFS) and similar overall survival (OS) as Group Ineligible-T and Group Eligible-T (Ineligible, PFS: 6.3 vs. 5.9 months, P  = 0.0234, OS: 7.8 vs. 15.7 months, P  = 0.1601; Eligible, PFS: 9.8 vs. 5.6 months, P  = 0.0437, OS: 20.5 vs. 18.2 months, P  = 0.7820). Compared to T, AA treatment resulted in longer PFS and similar OS in chemo-naïve mCRPC patients, irrespective of the presence of ineligible factors, suggesting that the initial treatment by AA may still be beneficial to those with the aforementioned ineligible factors.

  10. Infrared absorption spectra of gaseous HD. II. Collision-induced fundamental band of HD in HD--Ne and HD--Ar mixtures at room temperature

    International Nuclear Information System (INIS)

    Prasad, R.D.G.; Reddy, S.P.

    1976-01-01

    The collision-induced infrared absorption spectra of the fundamental band of HD in binary mixtures of HD with Ne and Ar at room temperature have been studied with an absorption path length of 105.2 cm for different base densities of HD in the range 8--20 amagat and a number of total gas densities up to 175 amagat. The observed features of the profiles of the enhancement of absorption in these mixtures resemble closely those of the corresponding profiles of the fundamental band of H 2 in binary mixtures with Ne and Ar. The binary absorption coefficients of the band obtained from the measured integrated intensities are (1.84 +- 0.06) x 10 -35 and (4.41 +- 0.06) x 10 -35 cm 6 s -1 for HD--Ne and HD--Ar, respectively. The characteristic half-width parameters, delta/subd/ and delta/subc/ of the overlap transitions and delta/subq/ (and delta/subq//sub prime/) of the quadrupolar transitions, are obtained from an analysis of the profiles of the enhancement of absorption in both these mixtures. The quantity delta/subc/ which is the half-width of the intercollisional interference dip of the Q branch increases with the density of the perturbing gas Ne or Ar, and for HD--Ne it varies in a manner similar to that for HD--He as described in Paper I of this series

  11. Identification of GAD65 AA 114-122 reactive 'memory-like' NK cells in newly diagnosed Type 1 diabetic patients by HLA-class I pentamers.

    Science.gov (United States)

    Perri, Valentina; Gianchecchi, Elena; Cifaldi, Loredana; Pellegrino, Marsha; Giorda, Ezio; Andreani, Marco; Cappa, Marco; Fierabracci, Alessandra

    2017-01-01

    Type 1 diabetes is an autoimmune disease, in which pancreatic β cells are destroyed by autoreactive T cells in genetically predisposed individuals. Serum beta cell autoantibody specificities have represented the mainstay for classifying diabetes as autoimmune-mediated and for stratifying risk in first-degree relatives. In recent years, approaches were attempted to solve the difficult issue of detecting rare antigen-specific autoreactive T cells and their significance to etiopathogenesis such as the use of the MHC multimer technology. This tool allowed the specific detection of increased percentages of GAD65 autoreactive T cells by means of HLA A*02:01 GAD65 AA 114-122 pentamers in newly diagnosed diabetics. Here we provide evidence that GAD65 AA 114-122 pentamers can depict a GAD65 AA114-122 peptide expandable population of functionally and phenotypically skewed, preliminary characterized CD3-CD8dullCD56+ 'memory-like' NK cells in PBMC of newly diagnosed diabetics. Our data suggest that the NK cell subset could bind the HLA class I GAD65 AA 114-122 pentamer through ILT2 inhibitory receptor. CD107a expression revealed increased degranulation of CD3-CD8dullCD56+ NK cells in GAD65 AA 114-122 and FLU peptide expanded peripheral blood mononuclear cells of diabetics following GAD65 AA 114-122 peptide HLA A*02:01 presentation in respect to the unpulsed condition. CD107a expression was enriched in ILT2 positive NK cells. As opposite to basal conditions where similar percentages of CD3-CD56+ILT2+ cells were detected in diabetics and controls, CD3-CD56+CD107a+ and CD3-CD56+ILT2+CD107a+ cells were significantly increased in T1D PBMC either GAD65 AA 114-122 or FLU peptides stimulated after co-culture with GAD65 AA 114-122 pulsed APCs. As control, healthy donor NK cells showed similar degranulation against both GAD65 AA 114-122 pulsed and unpulsed APCs. The pathogenetic significance of the CD3-CD8dullCD56+ 'memory-like NK cell subset' with increased response upon secondary

  12. Weekly infusional high-dose fluorouracil (HD-FU), HD-FU plus folinic acid (HD-FU/FA), or HD-FU/FA plus biweekly cisplatin in advanced gastric cancer: randomized phase II trial 40953 of the European Organisation for Research and Treatment of Cancer Gastrointestinal Group and the Arbeitsgemeinschaft Internistische Onkologie.

    Science.gov (United States)

    Lutz, Manfred P; Wilke, Hansjochen; Wagener, D J Theo; Vanhoefer, Udo; Jeziorski, Krzysztof; Hegewisch-Becker, Susanna; Balleisen, Leopold; Joossens, Eric; Jansen, Rob L; Debois, Muriel; Bethe, Ullrich; Praet, Michel; Wils, Jacques; Van Cutsem, Eric

    2007-06-20

    This multicentric, randomized, two-stage phase II trial evaluated three simplified weekly infusional regimens of fluorouracil (FU) or FU plus folinic acid (FA) and cisplatin (Cis) with the aim to select a regimen for future phase III trials. A total of 145 patients with advanced gastric cancer where randomly assigned to weekly FU 3,000 mg/m2/24 hours (HD-FU), FU 2,600 mg/m2/24 hours plus dl-FA 500 mg/m2 or l-FA 250 mg/m2 (HD-FU/FA), or FU 2000 mg/m2/24 hours plus FA plus biweekly Cis 50 mg/m2, each administered for 6 weeks with a 1-week rest. The primary end point was the response rate. Confirmed responses were observed in 6.1% (two of 33) of the eligible patients treated with HD-FU, in 25% (12 of 48, including one complete remission [CR]) with HD-FU/FA, and in 45.7% (21 of 46, including four CRs) with HD-FU/FA/Cis. The HD-FU arm was closed after stage 1 because the required minimum number of responses was not met. The median progression-free survival of all patients in the HD-FU, HD-FU/FA, and HD-FU/FA/Cis arm was 1.9, 4.0, and 6.1 months, respectively. The median overall survival was 7.1, 8.9, and 9.7 months, and the survival rate at 1 year was 24.3%, 30.3%, and 45.3%, respectively. Grade 4 toxicities were rare. The most relevant grade 3/4 toxicities were neutropenia in 1.9%, 5.4%, and 19.6%, and diarrhea in 2.7%, 1.9%, and 3.9% of the cycles in the HD-FU, HD-FU/FA, and HD-/FU/Cis arms, respectively. Weekly infusional FU/FA plus biweekly Cis is effective and safe in patients with gastric cancer.

  13. The Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    Section 06 - 08*) of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A vacuum-tank, two bending magnets (BST06 and BST07 in blue) with a quadrupole (QDN07, in red) in between, another vacuum-tank, a wide quadrupole (QFW08) and a further tank . The tanks are covered with heating tape for bake-out. The tank left of BST06 contained the stack core pickup for stochastic cooling (see 7906193, 7906190, 8005051), the two other tanks served mainly as vacuum chambers in the region where the beam was large. Peter Zettwoch works on BST06. *) see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984)

  14. AA, bending magnet, BLG

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The very particular lattice of the AA required 2 types of dipole (bending magnets; BLG, long and narrow; BST, short and wide). The BLG had a steel length of 4.70 m, a good field width of 0.24 m, and a weight of about 70 t. Jean-Claude Brunet inspects the lower half of a BLG. For the BST magnets see 7811105 and 8006036.

  15. The Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    A section of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A large vacuum-tank, a quadrupole (QDN09*), a bending magnet (BST08), another vacuum-tank, a wide quadrupole (QFW08) and (in the background) a further bending magnet (BST08). The tanks are covered with heating tape for bake-out. The tank left of QDN09 contained the kickers for stochastic pre-cooling (see 790621, 8002234, 8002637X), the other one served mainly as vacuum chamber in the region where the beam was large. Peter Zettwoch works on QFW08. * see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984) See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  16. Thermodynamics of dinonylnaphthalene sulfonic acid (HD)

    International Nuclear Information System (INIS)

    Raieh, M.A.; Aly, H.F.

    1980-01-01

    The effect of temperature on the extraction of the trivalent actinides Am 3+ , Cm 3+ and Cf 3+ with the liquid cation exchanger dinonylnaphtalenesulphonic acid (HD) in toluene is studied. The different thermodynamic functions of this system are determined from the experimental results. It is found that the free energy variation for the extraction of these metal ions by HD is mainly determined by the entropic terms arising from the hydration-dehydration process of the exchanged ions. (author)

  17. Development of the HD-Teen Inventory.

    Science.gov (United States)

    Driessnack, Martha; Williams, Janet K; Barnette, J Jackson; Sparbel, Kathleen J; Paulsen, Jane S

    2012-05-01

    Adolescents, who have a parent with Huntington Disease (HD), not only are at genetic risk for HD but also are witness to its onset and devastating clinical progression as their parent declines. To date, no mechanism has been developed to direct health care providers to the atypical adolescent experiences of these teens. The purpose of this report is to describe the process of developing the HD-Teen Inventory clinical assessment tool. Forty-eight teens and young adults from 19 U.S. states participated in the evaluation of the HD-Teen Inventory tool. Following item analysis, the number of items was reduced and item frequency and reaction scales were combined, based on the strong correlation (r = .94). The resultant tool contains 15 inventory and 2 open-ended response items. The HD-Teen Inventory emerged as a more compact and efficient tool for identifying the most salient concerns of at-risk teens in HD families in research and/or clinical practice.

  18. Banana (Musa. spp.) strain HD-1 appraisal

    International Nuclear Information System (INIS)

    Longyan, G.; Xinguo, L.; Lingxia, W.; Xuefei, J.

    2016-01-01

    Being one of the important tropical and subtropical fruit trees, banana (Musa spp.) belongs to the family Musaceae and the order Scitaminae with two genera, Musa and Ensete. In a field survey, research team has discovered a potential banana mutant strain HD-1 with a sound economic value. The results of the finding are as follows: based on Simmonds classification, the pseudostem of banana strain HD-1 is relatively short and purplish red; its upright outward petiole groove has red edges and wraps its pseudostem loosely. Its ploidy is 3, AAA type. Karyotype analysis shows that the number of chromosomes is 33, the karyotype formula is 2n=3x=33=2L + 3 M2 + 4 M1 + 2 S, HD-1 is classified as 1B type. With the help of ISSR molecular markers, we find thatbanana HD-1 has the closest relationship with Pubei and Tianbao dwarf banana; the similarity coefficient is 0.81. In an artificial simulation tests of cold, drought and salt resistance environment changes of physiological and biochemical indexes indicate that HD-1 exhibits stronger defense capability than Brazil banana. By way of inoculation with injury of root dipping method, we respectively treat two kinds of banana seedlings inoculated Banana Fusarium wilt race 4 small species. The results show that their resistance evaluation scores are 3 and 4, disease levels are susceptible and high sensitivity respectively. We conclude that HD-1 has stronger resistance ability to Fusarium wilt than Brazil banana. (author)

  19. TWO SMALL PLANETS TRANSITING HD 3167

    International Nuclear Information System (INIS)

    Vanderburg, Andrew; Bieryla, Allyson; Latham, David W.; Mayo, Andrew W.; Berlind, Perry; Duev, Dmitry A.; Jensen-Clem, Rebecca; Kulkarni, Shrinivas; Riddle, Reed; Baranec, Christoph; Law, Nicholas M.; Nieberding, Megan N.; Salama, Maïssa

    2016-01-01

    We report the discovery of two super-Earth-sized planets transiting the bright (V = 8.94, K = 7.07) nearby late G-dwarf HD 3167, using data collected by the K2 mission. The inner planet, HD 3167 b, has a radius of 1.6 R ⊕ and an ultra-short orbital period of only 0.96 days. The outer planet, HD 3167 c, has a radius of 2.9 R ⊕ and orbits its host star every 29.85 days. At a distance of just 45.8 ± 2.2 pc, HD 3167 is one of the closest and brightest stars hosting multiple transiting planets, making HD 3167 b and c well suited for follow-up observations. The star is chromospherically inactive with low rotational line-broadening, ideal for radial velocity observations to measure the planets’ masses. The outer planet is large enough that it likely has a thick gaseous envelope that could be studied via transmission spectroscopy. Planets transiting bright, nearby stars like HD 3167 are valuable objects to study leading up to the launch of the James Webb Space Telescope .

  20. TWO SMALL PLANETS TRANSITING HD 3167

    Energy Technology Data Exchange (ETDEWEB)

    Vanderburg, Andrew; Bieryla, Allyson; Latham, David W.; Mayo, Andrew W.; Berlind, Perry [Harvard–Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Duev, Dmitry A.; Jensen-Clem, Rebecca; Kulkarni, Shrinivas; Riddle, Reed [California Institute of Technology, Pasadena, CA 91125 (United States); Baranec, Christoph [University of Hawai‘i at Mānoa, Hilo, HI 96720 (United States); Law, Nicholas M. [University of North Carolina at Chapel Hill, Chapel Hill, NC 27599 (United States); Nieberding, Megan N. [National Optical Astronomy Observatory, 950 N. Cherry Avenue, Tucson, AZ 85719 (United States); Salama, Maïssa, E-mail: avanderburg@cfa.harvard.edu [University of Hawai‘i at Mānoa, Honolulu, HI 96822 (United States)

    2016-09-20

    We report the discovery of two super-Earth-sized planets transiting the bright (V = 8.94, K = 7.07) nearby late G-dwarf HD 3167, using data collected by the K2 mission. The inner planet, HD 3167 b, has a radius of 1.6 R {sub ⊕} and an ultra-short orbital period of only 0.96 days. The outer planet, HD 3167 c, has a radius of 2.9 R {sub ⊕} and orbits its host star every 29.85 days. At a distance of just 45.8 ± 2.2 pc, HD 3167 is one of the closest and brightest stars hosting multiple transiting planets, making HD 3167 b and c well suited for follow-up observations. The star is chromospherically inactive with low rotational line-broadening, ideal for radial velocity observations to measure the planets’ masses. The outer planet is large enough that it likely has a thick gaseous envelope that could be studied via transmission spectroscopy. Planets transiting bright, nearby stars like HD 3167 are valuable objects to study leading up to the launch of the James Webb Space Telescope .

  1. Clinical and biomarker changes in premanifest Huntington disease show trial feasibility: a decade of the PREDICT-HD study

    Directory of Open Access Journals (Sweden)

    Jane S Paulsen

    2014-04-01

    Full Text Available There is growing consensus that intervention and treatment of Huntington disease (HD should occur at the earliest stage possible. Various early-intervention methods for this fatal neurodegenerative disease have been identified, but preventive clinical trials for HD are limited by a lack of knowledge of the natural history of the disease and a dearth of appropriate outcome measures. Objectives of the current study are to document the natural history of premanifest HD progression in the largest cohort ever studied and to develop a battery of imaging and clinical markers of premanifest HD progression that can be used as outcome measures in preventive clinical trials. PREDICT-HD is a 32-site, international, observational study of premanifest HD, with annual examination of 1013 participants with premanifest HD and 301 gene-expansion negative controls between 2001 and 2012. Findings document 39 variables representing imaging, motor, cognitive, functional, and psychiatric domains, showing different rates of decline between premanifest Huntington disease and controls. Required sample size and models of premanifest HD are presented to inform future design of clinical and preclinical research. Preventive clinical trials in premanifest HD with participants who have a medium or high probability of motor onset are calculated to be as resource-effective as those conducted in diagnosed HD and could interrupt disease seven to twelve years earlier. Methods and measures for preventive clinical trials in premanifest HD more than a dozen years from motor onset are also feasible. These findings represent the most thorough documentation of a clinical battery for experimental therapeutics in stages of premanifest HD, the time period for which effective intervention may provide the most positive possible outcome for patients and their families affected by this devastating disease.

  2. Introduction and feasibility study of the HD-270 MLC

    International Nuclear Information System (INIS)

    Kim, Dae Young; Kim Won Taek; Lee, Hwa Jung; Lee, Kang Hyeok

    2003-01-01

    The multileaf collimator(MLC) has many advantages, but use of the MLC increased effective penumbra and isodose undulation in dose distribution compared with that of an alloy block. In this work, we introduced the HD-270 MLC, which can improve the above disadvantages of MLC, and reported its feasibility study. The HD-270 MLC is a technique which combines the use of the existing Siemens multileaf collimator(3D MLC) with patient translation perpendicular to the leaf plane. The technique produces a smoothed isodose distribution with the reduced isodose undulation and effective penumbra. To assess the efficacy of the HD-270 technique and determine the appropriate resolution, a polygonal shaped MLC field was made to produce field edge angles from 0 degree to 75 degree with a step of 15 degree. Each HD-270 group was generated according to the allowed resolution, i. e., 5, 3, and 2 mm. The experiment was carried out on Primus, a Siemens linear accelerator configured with HD-270 MLC. The total 60 MU of 6 MV photon beam was delivered to X-Omat film (Kodak, USA) at a SAD of 100 cm and 1.5 cm depth in solid water phantom. Exposed films were scanned by Lumiscan75(LUMISYS) and analyzed using RIT113 software (Radiological Imaging Technology Inc., USA). To test the mechanical accuracy of table movement, the transverse, longitudinal, and vertical positions were controlled by a consol with ±5 mm, ±4 mm, ±3 mm, and ±2 mm steps, and then measured using a dial gauge with an accuracy of 0.001 inch. During the experiments, the table loaded with about 50 Kg human phantom to simulate the real treatment situation. The effective penumbra and isodose undulation became larger with increase the resolution and field edge angle. The accuracy of the table movement on each direction is good within the ±1 mm. Clinical use of the MLC can be increased by using of the HD-270 MLC which complements to the disadvantages of the MLC.

  3. Effect of Heat Exposure on the Fatigue Properties of AA7050 Friction Stir Welds

    Science.gov (United States)

    White, B. C.; Rodriguez, R. I.; Cisko, A.; Jordon, J. B.; Allison, P. G.; Rushing, T.; Garcia, L.

    2018-05-01

    This work examines the effect of heat exposure on the subsequent monotonic and fatigue properties of friction stir-welded AA7050. Mechanical characterization tests were conducted on friction stir-welded specimens as-welded (AW) and specimens heated to 315 °C in air for 20 min. Monotonic testing revealed high joint efficiencies of 98% (UTS) in the AW specimens and 60% in the heat-damaged (HD) specimens. Experimental results of strain-controlled fatigue testing revealed shorter fatigue lives for the HD coupons by nearly a factor of four, except for the highest strain amplitude tested. Postmortem fractography analysis found similar crack initiation or propagation behavior between the AW and HD specimens; however, the failure locations for the AW were predominantly in the heat-affected zone, while the HD specimens also failed in the stir zone. Microhardness measurements revealed a relatively uniform strength profile in the HD group, accounting for the variety of failure locations observed. The differences in both monotonic and cyclic properties observed between the AW and HD specimens support the conclusion that the heat damage (315 °C at 20 min) acts as an over-aging and a quasi-annealing treatment.

  4. Feasibility of using high-definition transcranial direct current stimulation (HD-tDCS) to enhance treatment outcomes in persons with aphasia.

    Science.gov (United States)

    Richardson, Jessica; Datta, Abhishek; Dmochowski, Jacek; Parra, Lucas C; Fridriksson, Julius

    2015-01-01

    Transcranial direct current stimulation (tDCS) enhances treatment outcomes post-stroke. Feasibility and tolerability of high-definition (HD) tDCS (a technique that increases current focality and intensity) for consecutive weekdays as an adjuvant to behavioral treatment in a clinical population has not been demonstrated. To determine HD-tDCS feasibility outcomes: 1) ability to implement study as designed, 2) acceptability of repeated HD-tDCS administration to patients, and 3) preliminary efficacy. Eight patients with chronic post-stroke aphasia participated in a randomized crossover trial with two arms: conventional sponge-based (CS) tDCS and HD-tDCS. Computerized anomia treatment was administered for five consecutive days during each treatment arm. Individualized modeling/targeting procedures and an 8-channel HD-tDCS device were developed. CS-tDCS and HD-tDCS were comparable in terms of implementation, acceptability, and outcomes. Naming accuracy and response time improved for both stimulation conditions. Change in accuracy of trained items was numerically higher (but not statistically significant) for HD-tDCS compared to CS-tDCS for most patients. Regarding feasibility, HD-tDCS treatment studies can be implemented when designed similarly to documented CS-tDCS studies. HD-tDCS is likely to be acceptable to patients and clinicians. Preliminary efficacy data suggest that HD-tDCS effects, using only 4 electrodes, are at least comparable to CS-tDCS.

  5. HD 97658 and its super-Earth

    Directory of Open Access Journals (Sweden)

    Van Grootel V.

    2015-01-01

    Full Text Available Super-Earths transiting nearby bright stars are key objects that simultaneously allow for accurate measurements of both their mass and radius, providing essential constraints on their internal composition. We present the confirmation, based on Spitzer observations, that the super-Earth HD 97658 b transits its host star. HD 97658 is a low-mass (M* = 0.77 ± 0.05 M⊙ K1 dwarf, as determined from the Hipparcos parallax and stellar evolution modeling. To constrain the planet parameters, we carry out Bayesian global analyses of Keck-HIRES radial velocities, and MOST and Spitzer photometry. HD 97658 b is a massive (MP = 7.55−0.79+0.83 M⊕ and large (RP = 2.247−0.095+0.098 R⊕ at 4.5 μm super-Earth. We investigate the possible internal compositions for HD 97658 b. Our results indicate a large rocky component, by at least 60% by mass, and very little H-He components, at most 2% by mass. We also discuss how future asteroseismic observations can improve the knowledge of the HD 97658 system, in particular by constraining its age.

  6. Role of the 2 adenine (g.11293_11294insAA) insertion polymorphism in the 3' untranslated region of the factor VII (FVII) gene: molecular characterization of a patient with severe FVII deficiency.

    Science.gov (United States)

    Peyvandi, F; Garagiola, I; Palla, R; Marziliano, N; Mannucci, P M

    2005-11-01

    Polymorphic variants in the gene encoding factor VII (F7) affect the plasma levels of this coagulation protein and modify the clinical phenotype of FVII deficiency in some patients. In this study we report the in vitro functional analysis of a novel polymorphic variant located in the 3' untranslated region of F7: g.11293_11294insAA. To determine whether this variant regulates FVII expression, we initially compared an expression vector containing FVII cDNA with g.11293_11294insAA with the FVII wild-type (WT) construct. The kinetics of mRNA production showed that the insertion decreases the steady-state FVII mRNA levels. To assess whether the insertion influences the phenotype of FVII-deficient patients, we evaluated its effect on the expression of FVII in a patient with severe FVII deficiency (undetectable FVII activity and antigen) carrying two additional homozygous missense variations (p.Arg277Cys and p.Arg353Gln). The two substitutions alone reduced the expression of FVII activity and antigen in vitro, but with the insertion polymorphism in our expression vector the patient's phenotype of undetectable plasma FVII was recapitulated. The insertion polymorphism in the 3' untranslated region of F7 is another modifier of FVII expression that might explain the poor genotype-phenotype correlation in some FVII-deficient patients. Copyright 2005 Wiley-Liss, Inc.

  7. HD 30187 B and HD 39927 B: Two suspected nearby hot subdwarfs in resolved binaries (based on observations made with the ESA Hipparcos satellite)

    DEFF Research Database (Denmark)

    Makarov, V.V.; Fabricius, C.

    1999-01-01

    Stars: Individual: HD 30187 B -- Stars: Individual: HD 39927 B - Stars: White dwarfs - Stars: Binaries: Visual......Stars: Individual: HD 30187 B -- Stars: Individual: HD 39927 B - Stars: White dwarfs - Stars: Binaries: Visual...

  8. Polarized proton and deuteron solid HD targets

    International Nuclear Information System (INIS)

    Honig, A.

    1977-01-01

    A decade has now elapsed since HD was proposed as a polarized proton and deuteron target with exceptionally desirable properties. These include a very high free proton proportion, independently polarizable proton and deuteron systems, and a ''frozen-spin'' mode of operation which allows separation of the functions of production and utilization of the highly polarized target. A discussion is given of what can be expected of the polarized HD system right now, without further research. The basic features of solid HD pertinent to its use as a ''frozen-spin'' target are outlined, then a summary is given of the particular experimental results which support the contention that the target will perform successfully, and finally, some feasible operating modes and the expected performances from them are presented

  9. AAS 227: Day 2

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new

  10. AAS 227: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto

  11. AN INTERFEROMETRIC AND SPECTROSCOPIC ANALYSIS OF THE MULTIPLE STAR SYSTEM HD 193322

    International Nuclear Information System (INIS)

    Ten Brummelaar, Theo A.; Farrington, Christopher D.; Schaefer, Gail H.

    2011-01-01

    The star HD 193322 is a remarkable multiple system of massive stars that lies at the heart of the cluster Collinder 419. Here we report on new spectroscopic observations and radial velocities of the narrow-lined component Ab1 which we use to determine its orbital motion around a close companion Ab2 (P = 312 days) and around a distant third star Aa (P = 35 years). We have also obtained long baseline interferometry of the target in the K' band with the CHARA Array which we use in two ways. First, we combine published speckle interferometric measurements with CHARA separated fringe packet measurements to improve the visual orbit for the wide Aa,Ab binary. Second, we use measurements of the fringe packet from Aa to calibrate the visibility of the fringes of the Ab1,Ab2 binary, and we analyze these fringe visibilities to determine the visual orbit of the close system. The two most massive stars, Aa and Ab1, have masses of approximately 21 and 23 M sun , respectively, and their spectral line broadening indicates that they represent extremes of fast and slow projected rotational velocity, respectively.

  12. Clinical Outcomes from Androgen Signaling-directed Therapy after Treatment with Abiraterone Acetate and Prednisone in Patients with Metastatic Castration-resistant Prostate Cancer: Post Hoc Analysis of COU-AA-302.

    Science.gov (United States)

    Smith, Matthew R; Saad, Fred; Rathkopf, Dana E; Mulders, Peter F A; de Bono, Johann S; Small, Eric J; Shore, Neal D; Fizazi, Karim; Kheoh, Thian; Li, Jinhui; De Porre, Peter; Todd, Mary B; Yu, Margaret K; Ryan, Charles J

    2017-07-01

    In the COU-AA-302 trial, abiraterone acetate plus prednisone significantly increased overall survival for patients with chemotherapy-naïve metastatic castration-resistant prostate cancer (mCRPC). Limited information exists regarding response to subsequent androgen signaling-directed therapies following abiraterone acetate plus prednisone in patients with mCRPC. We investigated clinical outcomes associated with subsequent abiraterone acetate plus prednisone (55 patients) and enzalutamide (33 patients) in a post hoc analysis of COU-AA-302. Prostate-specific antigen (PSA) response was assessed. Median time to PSA progression was estimated using the Kaplan-Meier method. The PSA response rate (≥50% PSA decline, unconfirmed) was 44% and 67%, respectively. The median time to PSA progression was 3.9 mo (range 2.6-not estimable) for subsequent abiraterone acetate plus prednisone and 2.8 mo (range 1.8-not estimable) for subsequent enzalutamide. The majority of patients (68%) received intervening chemotherapy before subsequent abiraterone acetate plus prednisone or enzalutamide. While acknowledging the limitations of post hoc analyses and high censoring (>75%) in both treatment groups, these results suggest that subsequent therapy with abiraterone acetate plus prednisone or enzalutamide for patients who progressed on abiraterone acetate is associated with limited clinical benefit. This analysis showed limited clinical benefit for subsequent abiraterone acetate plus prednisone or enzalutamide in patients with metastatic castration-resistant prostate cancer following initial treatment with abiraterone acetate plus prednisone. This analysis does not support prioritization of subsequent abiraterone acetate plus prednisone or enzalutamide following initial therapy with abiraterone acetate plus prednisone. Copyright © 2017 European Association of Urology. Published by Elsevier B.V. All rights reserved.

  13. AAS 228: Day 4

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note: Lastweek we were at the 228th AAS Meeting in San Diego, CA. Here is a final post aboutselectedevents on the last day of the meeting, written by authors fromastrobites.com, a grad-student collaborative project with which we recently announced a new partnership! Starting in July,keep an eye out for astrobites postsat AAS Nova in between Highlights(i.e., on Tuesdays and Thursdays).Were excited to be working together to bring you more recent astronomy research from AAS journals!Extrasolar Planets: Detection (by Leonardo dos Santos)Thursdays first session on exoplanets was about detecting these distant worlds, and the opening talk was given by Robert Siverd (Las Cumbres Observatory). He describes the NRES, a network of spectrographs that will look for exoplanets using the radial velocity method. One of the coolest aspects of this instrument is that it will feature an on the fly scheduling system that will perform observations as efficiently as possible. The spectrograph is still being tested, but a unit will be deployed at CTIO later this year.@lcogt contracted by @NASA_TESS for follow up of their candidates. #aas228 Jessie Christiansen (@aussiastronomer) June 16, 2016Measuring the depths of transits and eclipses in Spitzer has been problematic in the past, since the Spitzer instrument IRAC (InfraRed Array Camera) has a non-uniform response in its detectors pixels. But, as reported by James Ingalls (Spitzer Science Center, Caltech), observers are circumventing this issue by using what they call the staring mode (avoiding large pointing jumps) and an algorithm to pick sweet spot pixels. Moreover, the results from the IRAC Data Challenge are helping to better understand its behavior. Giuseppe Morello (University College London), on the other hand, explained how his research group gets rid of instrumental effects from IRAC using machine learning. This method removes systematics from exoplanet transit data no matter if the noise source is from an instrument or

  14. The Drentsche Aa valley system

    International Nuclear Information System (INIS)

    Gans, W. de.

    1981-01-01

    This thesis is composed of five papers concerned with Late Quaternary geology and geomorphology of the Aa valley system. The correlation and chronostratigraphic position of the layers have been established by radiocarbon dating. (Auth.)

  15. AAS 227: Day 4

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt

  16. Epstein-Barr virus (EBV antibody in childhood Hodgkin's disease (HD at Imam khomeini Medical Complex

    Directory of Open Access Journals (Sweden)

    Nahid M

    1998-08-01

    Full Text Available Association of EBV with the tumor cells of HD has been proven by a variety of the methods, using serologic and immunohistochemical techniques and in the recent years with molecular biologic techniques which can detect EBV genome in tumor biopsies. In this regard we prompted to perform a case control study on 25 childhood HD cases with respected to their antibodies gainst EBNA and EBV-IgM antibodies in Imam Khomeini Hospital in Tehran. In our study the ratio of positive titers was significantly higher among HD patients compared with age and sex-matched healthy controls.

  17. Supporting autonomous vehicles by creating HD maps

    Directory of Open Access Journals (Sweden)

    Arpad Barsi

    2017-10-01

    Full Text Available Maps are constantly developing, also, the newly defined High Definition (HD maps increase the map content remarkably. They are based on three-dimensional survey, like laser scanning, and then stored in a fully new structured way to be able to support modern-day vehicles. Beyond the traditional lane based map content, they contain information about the roads’ neighbourhood. The goal of these maps is twofold. Primarily, they store the connections where the vehicles can travel with the description of the road-environment. Secondly, they efficiently support the exact vehicle positioning. The paper demonstrates the first results of a pilot study in the creation of HD map of an urban and a rural environment. The applied data collection technology was the terrestrial laser scanning, where the obtained point cloud was evaluated. The data storage has been solved by an in-house developed information storage model with the ability to help in vehicle control processes.

  18. AD/HD: POSSIBLE DIAGNOSIS AND TREATMENT

    Directory of Open Access Journals (Sweden)

    Karl REICHELT

    2008-12-01

    Full Text Available The purpose of this paper is to show that a more exact diagnosis and dietary intervention in AD/HD (Attention Deficit/Hyperactivity Di­sor­der is possible and probable. The clinical symptom based diagnosis we suggest may be supplemented with physiological tests. A ge­netic and environmental inter-action is clearly involved and explainable using phenyl­ke­tonuria as a model.Method: Examining peer reviewed published papers on gut to blood, blood to brain inter­action and effect of interventions in AD/HD and our own studies in the field. The various treatment options are discussed.Results: It can be shown that a gut to brain activity is possible and probable, and dietary intervention is useful and probably safer than drugs. Preliminary data on a small five year follow up of dietary intervention is shown.

  19. Nanodiamonds around HD 97048 and Elias 1

    NARCIS (Netherlands)

    Van Kerckhoven, C; Tielens, AGGM; Waelkens, C

    We present an analysis of ISO-SWS observations of the Herbig Ae/Be stars HD 97048 and Elias 1. Besides the well-known family of IR emission bands at 3.3, 6.2, "7.7", 8.6 and 11.2 mum these objects show strong, peculiar emission features at 3.43 and 3.53 mum. The latter two features show pronounced

  20. [AA amyloidosis: a little-known complication of chronic leg ulcer].

    Science.gov (United States)

    Waton, J; Fays-Michel, S; Chandeclerc, M L; Corby, S; Cuny, J F; Barbaud, A; Schmutz, J-L

    2008-02-01

    AA amyloidosis, secondary to inflammatory chronic diseases like rheumatoid arthritis, is often complicated by renal failure. Chronic inflammatory dermatoses constitute rare causes of AA amyloidosis. We describe two cases of AA amyloidosis discovered after renal failure in patients presenting leg ulcers for several years. AL amyloidosis was suspected in both cases because of a history of monoclonal gammopathy in one patient and of plasmocytoma in the other. The diagnosis of AA amyloidosis was confirmed on renal histology through the detection of AA antibodies in amyloid deposits. No extrarenal amyloidosis was seen in either patient and there were no inflammatory diseases other than chronic leg ulcers. AA amyloidosis is caused by serum amyloid protein A (SAA), a reactive inflammatory protein. AA amyloidosis is thus caused by chronic inflammatory diseases, but only rarely by cutaneous inflammatory diseases. To our knowledge, the literature contains only seven other published cases of AA amyloidosis secondary to chronic leg ulcers. A review of the literature does not indicate whether cure of ulcers has any effect on the accompanying renal failure. We imagine that AA amyloidosis secondary to leg ulcer is in fact under-diagnosed. However, since the first specific treatment for AA amyloidosis is currently being evaluated by the Food and Drug Administration, it is essential that this serious complication of chronic leg ulcers be widely recognised.

  1. Score of Inattention Subscale of ADHD Rating Scale-IV is Significantly Higher for AD/HD than PDD.

    OpenAIRE

    Fujibayashi, Hiromi; Kitayama, Shinji; Matsuo, Masafumi

    2010-01-01

    Attention-deficit/hyperactivity disorder (AD/HD) and pervasive developmental disorder (PDD) must be differentiated because the respective treatments are different. However, they are difficult to distinguish because they often show similar symptoms. At our hospital, we have the rearer of a patient answer both the ADHD Rating Scale-IV (ADHD-RS) and the Autism Spectrum Screening Questionnaire (ASSQ), and use the results as an aid for the diagnosis of AD/HD or PDD. These results were compared wit...

  2. Elemental abundance studies of CP stars. II. The silicon stars HD 133029 and HD 192913

    CERN Document Server

    López-García, Z

    1999-01-01

    For pt.1 see ibid., vol.107, no.2, p.353-63 (1994). Fine analyses of the silicon stars HD 133029 and HD 192913 are presented using ATLAS9 model atmospheres whose predictions fit the optical region spectrophotometry and H gamma profiles and have the same bulk metallicity as the deduced abundances. Both are very He poor stars. The light elements are mostly solar except for silicon, and all the heavier elements, except nickel in HD 133029 which is solar, are greatly overabundant. The iron peak elements are typically 10 times overabundant. SrYZr are of order of 100 times solar. The rare earths are 1000 or more times overabundant. Table 4 is is only available in electronic form at the CDS via anonymous ftp to cdsarc.u-strasbg.fr (130.79.128.5) or via http://cdsweb.u-strasbg.fr/Abstract.html. (50 refs).

  3. The Danish HD Registrya nationwide family registry of HD families in Denmark

    DEFF Research Database (Denmark)

    Gilling, M.; Budtz-Jorgensen, E.; Boonen, S. E.

    2017-01-01

    -8:100 000. 1451 individuals in the DHR had the size of the HTT CAG repeat determined of which 975 had 36 CAG repeats or more (mean ± SD: 43,5 ± 4,8). Two unrelated individuals were compound heterozygous for alleles ≥36 CAGs, and 60 individuals from 34 independent families carried an intermediate allele.......The Danish Huntington's Disease Registry (DHR) is a nationwide family registry comprising 14 245 individuals from 445 Huntington's disease (HD) families of which the largest family includes 845 individuals in 8 generations. 1136 DNA and/or blood samples and 18 fibroblast cultures are stored...... in a local biobank. The birthplace of the oldest HD carrier in each of the 261 families of Danish origin was unevenly distributed across Denmark with a high number of families in the middle part of the peninsula Jutland and in Copenhagen, the capital. The prevalence of HD in Denmark was calculated to be 5...

  4. Spectroscopic studies of O-type binaries. IV. HD 165052 and Hd 167771

    International Nuclear Information System (INIS)

    Morrison, N.D.; Conti, P.S.

    1978-01-01

    HD 165052, O6.5 V, and HD 167771, 07.5 III ((f)), are double-lined binaries with periods of six and four days, respectively, and velocity semiamplitudes near 100 km s -1 . In our spectroscopic orbital analysis, we investigated the effect of correcting the measured radial velocities for pair blending. The derived velocity amplitudes are increased by roughly 7%, and hence the minimum masses increase by 20%--255. The raw data lead to minimum masses, m sin 3 i, between 2 and 3 mD/sub sun/. Since normal O stars are thought to have masses greater than 20 m/sub sun/, the orbits must be highly inclined to the line of sight. From the luminosities and effective temperatures we derived stellar radii. For HD 167771, the requirement that neither component over fill it Roche lobe implies that each has a mass in the neighborhood of 30m/sub sun/ or larger

  5. New investigations of polarized solid HD targets

    International Nuclear Information System (INIS)

    Honig, A.; Whisnant, C.S.

    1995-01-01

    Polarized solid HD targets in a frozen-spin mode, with superior nuclear physics characteristics and simple operational configurations, have previously been restricted in their deployment due to a disproportionate target production time with respect to utilization time. Recent investigations have yielded frozen-spin polarization lifetimes, at a convenient target temperature of 1.5 K, of nearly a year for both H and D at high holding fields, and of more than a week at sub-Tesla holding fields. These results, taken together with the advent of new interesting spin-physics using relatively weakly ionizing beams, such as polarized photon beams, remove the above impediment and open up the use of polarized solid HD to long duration nuclear spin-physics experiments. Large, multiple targets can be produced, retrieved from the polarization-production apparatus with a cold-transport (4 K) device, stored for very long times in inexpensive (1.5 K, 7 T) cryostats, and introduced 'off-the-shelf' into in-beam cryostats via the portable cold-transport apparatus. Various modes for achieving polarized H and/or D, as well as already achieved and expected polarization values, are reported. Experimental results are given on Kapitza resistance between the solid HD and the cooling wires necessary to obtain low temperatures during the heat-evolving polarization process. 15 mK is achievable using gold-plated aluminum wires, which constitute 15% extraneous nucleons over the number of polarizable H or D nucleons. Application to more highly ionizing beams is also given consideration. ((orig.))

  6. Inhibiting the Progression of Arterial Calcification with Vitamin K in HemoDialysis Patients (iPACK-HD Trial: Rationale and Study Design for a Randomized Trial of Vitamin K in Patients with End Stage Kidney Disease

    Directory of Open Access Journals (Sweden)

    Rachel M Holden

    2015-05-01

    Full Text Available Background: Cardiovascular disease, which is due in part to progressive vascular calcification, is the leading cause of death among patients with end stage kidney disease (ESKD on dialysis. A role for vitamin K in the prevention of vascular calcification is plausible based on the presence of vitamin K dependent proteins in vascular tissue, including matrix gla protein (MGP. Evidence from animal models and observational studies support a role for vitamin K in the prevention of vascular calcification. A large-scale study is needed to investigate the effect of vitamin K supplementation on the progression of vascular calcification in patients with ESKD, a group at risk for sub-clinical vitamin K deficiency. Methods/Design: We plan a prospective, randomized, double-blind, multicenter controlled trial of incident ESKD patients on hemodialysis in centers within North America. Eligible subjects with a baseline coronary artery calcium score of greater than or equal to 30 Agatston Units, will be randomly assigned to either the treatment group (10 mg of phylloquinone three times per week or to the control group (placebo administration three times per week. The primary endpoint is the progression of coronary artery calcification defined as a greater than 15% increase in CAC score over baseline after 12 months. Discussion: Vitamin K supplementation is a simple, safe and cost-effective nutritional strategy that can easily be integrated into patient care. If vitamin K reduces the progression of coronary artery calcification it may lead to decreased morbidity and mortality in men and women with ESKD. Trial registration: NCT 01528800.

  7. CHARACTERIZING THE RIGIDLY ROTATING MAGNETOSPHERE STARS HD 345439 AND HD 23478

    Energy Technology Data Exchange (ETDEWEB)

    Wisniewski, J. P.; Lomax, J. R. [Homer L. Dodge Department of Physics and Astronomy, The University of Oklahoma, 440 W. Brooks Street, Norman, OK 73019 (United States); Chojnowski, S. D. [Department of Astronomy, New Mexico State University, 1780 E University Avenue, Las Cruces, NM 88003 (United States); Davenport, J. R. A. [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Bartz, J.; Pepper, J. [Lehigh University, Department of Physics, 413 Deming Lewis Lab, 16 Memorial Drive, East Bethlehem, PA 18015 (United States); Whelan, D. G. [Department of Physics, Austin College, 900 N. Grand Avenue, Sherman, TX 75090 (United States); Eikenberry, S. S. [Department of Astronomy, University of Florida, 211 Bryant Space Science Center, Gainesville, FL 32611 (United States); Majewski, S. R.; Skrutskie, M. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Richardson, N. D., E-mail: wisniewski@ou.edu [Département de Physique and Centre de Recherche en Astrophysique du Québec (CRAQ), Université de Montréal, C.P. 6128, Succ. Centre-Ville, Montréal, QC H3C 3J7 (Canada)

    2015-10-01

    The SDSS III APOGEE survey recently identified two new σ Ori E type candidates, HD 345439 and HD 23478, which are a rare subset of rapidly rotating massive stars whose large (kGauss) magnetic fields confine circumstellar material around these systems. Our analysis of multi-epoch photometric observations of HD 345439 from the Kilodegree Extremely Little Telescope, Wide Angle Search for Planets, and ASAS surveys reveals the presence of a ∼0.7701 day period in each data set, suggesting the system is among the faster known σ Ori E analogs. We also see clear evidence that the strength of Hα, H i Brackett series lines, and He i lines also vary on a ∼0.7701 day period from our analysis of multi-epoch, multi-wavelength spectroscopic monitoring of the system from the APO 3.5 m telescope. We trace the evolution of select emission line profiles in the system, and observe coherent line profile variability in both optical and infrared H i lines, as expected for rigidly rotating magnetosphere stars. We also analyze the evolution of the H i Br-11 line strength and line profile in multi-epoch observations of HD 23478 from the SDSS-III APOGEE instrument. The observed periodic behavior is consistent with that recently reported by Sikora and collaborators in optical spectra.

  8. Search for Exoplanets around Northern Circumpolar Stars. II. The Detection of Radial Velocity Variations in M Giant Stars HD 36384, HD 52030, and HD 208742

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Byeong-Cheol; Jeong, Gwanghui; Han, Inwoo; Lee, Sang-Min; Kim, Kang-Min [Korea Astronomy and Space Science Institute 776, Daedeokdae-ro, Yuseong-gu, Daejeon 305-348 (Korea, Republic of); Park, Myeong-Gu; Oh, Hyeong-Il [Department of Astronomy and Atmospheric Sciences, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Mkrtichian, David E. [National Astronomical Research Institute of Thailand, Chiang Mai 50200 (Thailand); Hatzes, Artie P. [Thüringer Landessternwarte Tautenburg (TLS), Sternwarte 5, D-07778 Tautenburg (Germany); Gu, Shenghong; Bai, Jinming, E-mail: bclee@kasi.re.kr [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650011 (China)

    2017-07-20

    We present the detection of long-period RV variations in HD 36384, HD 52030, and HD 208742 by using the high-resolution, fiber-fed Bohyunsan Observatory Echelle Spectrograph (BOES) for the precise radial velocity (RV) survey of about 200 northern circumpolar stars. Analyses of RV data, chromospheric activity indicators, and bisector variations spanning about five years suggest that the RV variations are compatible with planet or brown dwarf companions in Keplerian motion. However, HD 36384 shows photometric variations with a period very close to that of RV variations as well as amplitude variations in the weighted wavelet Z-transform (WWZ) analysis, which argues that the RV variations in HD 36384 are from the stellar pulsations. Assuming that the companion hypothesis is correct, HD 52030 hosts a companion with minimum mass 13.3 M {sub Jup} orbiting in 484 days at a distance of 1.2 au. HD 208742 hosts a companion of 14.0 M {sub Jup} at 1.5 au with a period of 602 days. All stars are located at the asymptotic giant branch (AGB) stage on the H–R diagram after undergoing the helium flash and leaving the giant clump.With stellar radii of 53.0 R {sub ⊙} and 57.2 R {sub ⊙} for HD 52030 and HD 208742, respectively, these stars may be the largest yet, in terms of stellar radius, found to host substellar companions. However, given possible RV amplitude variations and the fact that these are highly evolved stars, the planet hypothesis is not yet certain.

  9. Effects of Hd2 in the presence of the photoperiod-insensitive functional allele of Hd1 in rice

    Directory of Open Access Journals (Sweden)

    Zhen-Hua Zhang

    2016-11-01

    Full Text Available The role of photoperiod sensitivity (PS of flowering genes have become well recognized in rice, whereas little attention has been drawn to the non-PS component of these genes, especially to their influence on gene-by-gene interactions. Rice populations in which the photoperiod-sensitive allele at Hd1 has become insensitive to photoperiod but continued to affect heading date (HD were used in this study to fine-map a quantitative trait locus (QTL for HD and analyze its genetic relationship to Hd1. The QTL was delimitated to a 96.3-kb region on the distal end of the long arm of chromosome 7. Sequence comparison revealed that this QTL is identical to Hd2. In the near-isogenic line (NIL populations analyzed, Hd1 and Hd2 were shown to be photoperiod insensitive and have pleiotropic effects for HD, plant height and yield traits. The two genes were found to largely act additively in regulating HD and yield traits. The results indicate that non-PS components of flowering genes involved in photoperiod response play an important role in controlling flowering time and grain yield in rice, which should allow breeders to better manipulate pleiotropic genes for balancing adaptability and high-yielding accumulation.

  10. Distillation of hydrogen isotopes for polarized HD targets

    Energy Technology Data Exchange (ETDEWEB)

    Ohta, T., E-mail: takeshi@rcnp.osaka-u.ac.jp [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan); Bouchigny, S. [IN2P3, Institut de Physique Nucleaire, F-91406 Orsay (France); CEA LIST, BP6-92265 Fontenay-aux-Roses, CEDEX (France); Didelez, J.-P. [IN2P3, Institut de Physique Nucleaire, F-91406 Orsay (France); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan); Fukuda, K. [Kansai University of Nursing and Health Sciences, Shizuki Awaji 656-2131 (Japan); Kohri, H.; Kunimatsu, T.; Morisaki, C.; Ono, S. [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan); Rouille, G. [IN2P3, Institut de Physique Nucleaire, F-91406 Orsay (France); Tanaka, M. [Kobe Tokiwa University, Ohtani-cho 2-6-2, Nagata, Kobe 653-0838 (Japan); Ueda, K.; Uraki, M.; Utsuro, M. [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan); Wang, S.Y. [Institute of Physics, Academia Sinica, Taipei 11529, Taiwan (China); Department of Physics, National Kaohsiung Normal University, Kaohsiung 824, Taiwan (China); Yosoi, M. [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan)

    2012-02-01

    We have developed a new cryogenic distillation system to purify Hydrogen-Deuteride (HD) gas for polarized HD targets in LEPS experiments at SPring-8. A small amount of ortho-H{sub 2} ({approx}0.01%) in the HD gas plays an important role in efficiently polarizing the HD target. Since there are 1-5% impurities of H{sub 2} and D{sub 2} in commercially available HD gases, it is necessary to purify the HD gas up to {approx}99.99%. The distillation system is equipped with a cryogenic distillation unit filled with many small stainless steel cells called 'Heli-pack'. The distillation unit consists of a condenser part, a rectification part, and a reboiler part. The unit is kept at the temperature of 17-21 K. The Heli-pack has a large surface area that makes a good contact between gases and liquids. An amount of 5.2 mol of commercial HD gas is fed into the distillation unit. Three trials were carried out to purify the HD gas by changing temperatures (17.5 K and 20.5 K) and gas extraction speeds (1.3 ml/min and 5.2 ml/min). The extracted gas was analyzed using a gas analyzer system combining a quadrupole mass spectrometer with a gas chromatograph. One mol of HD gas with a purity better than 99.99% has been successfully obtained for the first time. The effective NTP (Number of Theoretical Plates), which is an indication of the distillation performances, is obtained to be 37.2{+-}0.6. This value is in good agreement with a designed value of 37.9. The HD target is expected to be efficiently polarized under a well-controlled condition by adding an optimal amount of ortho-H{sub 2} to the purified HD gas.

  11. Serum Bicarbonate And Survival In Peritoneal Dialysis (Pd: Comparison With Hemodialysis (Hd

    Directory of Open Access Journals (Sweden)

    Tania Sharma

    2012-06-01

    Full Text Available Correction of metabolic acidosis is one of the goals of effective dialysis. The KDOQI guidelines recommend serum bicarbonate >22 meq/L irrespective of dialysis modality. Since the measured bicarbonate reflects the steady state in PD patients and the lowest inter-dialytic value in HD patients, we compared the survival predictability of serum bicarbonate 10,400 PD and 110,951 HD patients treated in DaVita facilities from 7/2001-6/2006 with follow-up through 6/2007. PD patients were substantially less likely to have lower serum bicarbonate (adjusted odds, 22 meq/L for all end-stage renal disease irrespective of dialysis modality.fx1

  12. Long-term safety and efficacy of autologous platelet lysate drops for treatment of ocular GvHD.

    Science.gov (United States)

    Pezzotta, S; Del Fante, C; Scudeller, L; Rossi, G C; Perotti, C; Bianchi, P E; Antoniazzi, E

    2017-01-01

    Current ocular GvHD (oGvHD) treatments are suboptimal. We investigated the safety and efficacy of long-term continuous treatment with autologous platelet lysate (PL) drops in patients with oGvHD Dry Eye Syndrome (DES) score 2-3 refractory to topical conventional therapy. Ophthalmic evaluation was performed at 6 month intervals. Symptoms were assessed using the Glaucoma Symptom Scale (GSS). Patients were defined 'responders' when showing a reduction at least one grade on National Institutes of Health Eye Score from baseline at the 6 month visit. Thirty-one patients were included, and 16 (51%) completed 36 months of follow-up (range 6.5-72.7). At 6 months all patients were classified as responders: median GSS symptom score decreased from 70 to 41 (33 at 36 months), median GSS function score reduced from 68 to 46 (33 at 36 months) (all P<0.001). Median Tear Break Up Time improved from 3 to 6 s after 6 months and was maintained over time. All signs improved at 6 and 36 months (clinical and statistical significance). No severe adverse events occurred. Long-term treatment with PL drops is secure and effective for oGvHD and can be an efficient therapy option from initial stages of oGvHD to prevent permanent ocular impairment and improving quality of life.

  13. Haemodiafiltration and mortality in end-stage kidney disease patients : a pooled individual participant data analysis from four randomized controlled trials

    NARCIS (Netherlands)

    Peters, Sanne A. E.; Bots, Michiel L.; Canaud, Bernard; Davenport, Andrew; Grooteman, Muriel P. C.; Kircelli, Fatih; Locatelli, Francesco; Maduell, Francisco; Morena, Marion; Nube, Menso J.; Ok, Ercan; Torres, Ferran; Woodward, Mark; Blankestijn, Peter J.

    BACKGROUND: Mortality rates remain high for haemodialysis (HD) patients and simply increasing the HD dose to remove more small solutes does not improve survival. Online haemodiafiltration (HDF) provides additional clearance of larger toxins compared with standard HD. Randomized controlled trials

  14. Phenomena of g-u symmetry-breakdown in HD

    NARCIS (Netherlands)

    de Lange, A.; Reinhold, E.M.; Ubachs, W.M.G.

    2002-01-01

    Phenomena associated with the breakdown of inversion symmetry in the HD molecule are reviewed and discussed. A distinction is made between three kinds of physical effects observed in HD spectra. The existence of a small electric dipole moment in the ground state gives rise to vibrational and pure

  15. H/D isotope effects in high temperature proton conductors

    DEFF Research Database (Denmark)

    Bonanos, Nikolaos; Huijser, A.; Poulsen, Finn Willy

    2015-01-01

    The atomic mass ratio of ca. 2 between deuterium and hydrogen is the highest for any pair of stable isotopes and results in significant and measurable H/D isotope effects in high temperature proton conductors containing these species. This paper discusses H/D isotope effects manifested in O-H/O-D...

  16. Phase 1 trial of ALT-801, an interleukin-2/T cell receptor fusion protein targeting p53 (aa264-272)/HLA-A*0201 complex, in patients with advanced malignancies

    Science.gov (United States)

    Fishman, Mayer N.; Thompson, John A.; Pennock, Gregory K.; Gonzalez, Rene; Diez, Luz M.; Daud, Adil I.; Weber, Jeffery S.; Huang, Bee Y.; Tang, Shamay; Rhode, Peter R.; Wong, Hing C.

    2014-01-01

    Purpose ALT-801 is a bifunctional fusion protein comprising interleukin-2 (IL-2) linked to a soluble, single-chain T cell receptor domain that recognizes a peptide epitope (aa264-272) of the human p53 antigen displayed on cancer cells in the context of HLA-A*0201 (p53+/HLA-A*0201). We evaluated the safety, pharmacokinetics and pharmacodynamics of ALT-801 in p53+/HLA-A*0201 patients with metastatic malignancies. Experimental Design p53+/HLA-A*0201 patients were treated with ALT-801 on a schedule of 4 daily 15-minute intravenous infusions, then 10 days rest and 4 more daily infusions. Cohorts of patients were treated at 0.015, 0.040, and 0.080 mg/kg/dose. Results Four, sixteen, and six patients were treated at the 0.015, 0.04 and 0.08 mg/kg cohorts, respectively. Two dose limiting toxicities (a grade 4 transient thrombocytopenia and a myocardial infarction) in the 0.08 mg/kg cohort established the maximum tolerated dose (MTD) at 0.04 mg/kg. Patients treated at the MTD experienced toxicities similar to those associated with high-dose IL-2 but of lesser severity. The serum half-life of ALT-801 was 4 hours and ALT-801 serum recovery was as expected based on the dose administered. ALT-801 treatment induced an increase of serum interferon-γ but not tumor necrosis factor-α. Response assessment showed 10 subjects with stable disease at at least 11 weeks, and in one who had melanoma metastasis, there is an ongoing complete absence of identifiable disease after resection of radiographically identified lesions. Conclusion This first-in-man study defines an ALT-801 regimen that can be administered safely and is associated with immunological changes of potential antitumor relevance. PMID:21994418

  17. Three Super-Earths Orbiting HD 7924

    Science.gov (United States)

    Fulton, Benjamin J.; Weiss, Lauren M.; Sinukoff, Evan; Isaacson, Howard; Howard, Andrew W.; Marcy, Geoffrey W.; Henry, Gregory W.; Holden, Bradford P.; Kibrick, Robert I.

    2015-06-01

    We report the discovery of two super-Earth-mass planets orbiting the nearby K0.5 dwarf HD 7924, which was previously known to host one small planet. The new companions have masses of 7.9 and 6.4 {{M}\\oplus }, and orbital periods of 15.3 and 24.5 days. We perform a joint analysis of high-precision radial velocity data from Keck/HIRES and the new Automated Planet Finder Telescope (APF) to robustly detect three total planets in the system. We refine the ephemeris of the previously known planet using 5 yr of new Keck data and high-cadence observations over the last 1.3 yr with the APF. With this new ephemeris, we show that a previous transit search for the inner-most planet would have covered 70% of the predicted ingress or egress times. Photometric data collected over the last eight years using the Automated Photometric Telescope shows no evidence for transits of any of the planets, which would be detectable if the planets transit and their compositions are hydrogen-dominated. We detect a long-period signal that we interpret as the stellar magnetic activity cycle since it is strongly correlated with the Ca ii H and K activity index. We also detect two additional short-period signals that we attribute to rotationally modulated starspots and a one-month alias. The high-cadence APF data help to distinguish between the true orbital periods and aliases caused by the window function of the Keck data. The planets orbiting HD 7924 are a local example of the compact, multi-planet systems that the Kepler Mission found in great abundance. Based on observations obtained at the W. M. Keck Observatory, which is operated jointly by the University of California and the California Institute of Technology. Keck time was granted for this project by the University of Hawai‘i, the University of California, and NASA.

  18. New ALMA Images of the HD 32297 and HD 61005 Debris Disks

    Science.gov (United States)

    MacGregor, Meredith Ann; Weinberger, Alycia; Wilner, David; Hughes, A. Meredith; debes, John Henry; Redfield, Seth; Donaldson, Jessica; Nesvold, Erika; Schneider, Glenn; Currie, Thayne; Roberge, Aki; Rodriguez, David

    2018-01-01

    HD 61005 (G-type star, “The Moth") and HD 32297 (A-type star) host two of the most iconic debris disks. Scattered light images show that both disks are nearly edge-on with dramatic swept-back wings of dust. Previous studies have proposed a range of mechanisms to explain this distinctive morphology including interactions with the interstellar medium, secular perturbations of grains by low-density, neutral interstellar gas, and gravitational interactions with an inclined, eccentric companion. We present new observations from the Atacama Large Millimeter/submillimeter Array (ALMA) at 1.3 mm that provide the highest resolution images at millimeter wavelengths to date of both systems. Observations at millimeter wavelengths are especially critical to our understanding of the physical mechanisms shaping the structure of these disks, since the large grains that dominate emission at these wavelengths are less affected by stellar radiation and winds and more reliably trace the underlying planetesimal distribution. We fit models directly to the observed visibilities within a Markov Chain Monte Carlo (MCMC) framework to characterize the continuum emission and place constraints on the structure of these unique debris disks. Our new ALMA images reveal that despite differences in spectral type, both systems are best described by a two-component structure with (1) a parent body belt, and (2) an outer halo aligned with the scattered light disk. Such halos have typically been assumed to be composed of small grains visible in scattered light, so these images are some of the first observational evidence that larger grains may also populate extended halos. In addition, we detect significant 12CO gas emission from HD 32297, and determine a robust upper limit for HD 61005.

  19. A.A., constructivism, and reflecting teams.

    Science.gov (United States)

    Nevels, B

    1997-12-01

    Numerous studies and clinical anecdotes reveal a relationship between attendance at A.A. meetings and/or degree of involvement in A.A. and maintenance of sobriety. Hypotheses as to how A.A. and/or the A.A. meeting is helpful to its members have ranged from a focus on factors common to all therapy groups, to aspects of A.A. "treatment" which are behavioral in nature. Presented here is another way of understanding A.A.'s effectiveness within the frame of more recent, constructivistic approaches to family therapy. In particular, the A.A. topic meeting is compared to the reflecting team concept of Tom Anderson.

  20. Constitutive behavior of as-cast AA1050, AA3104, and AA5182

    Science.gov (United States)

    van Haaften, W. M.; Magnin, B.; Kool, W. H.; Katgerman, L.

    2002-07-01

    Recent thermomechanical modeling to calculate the stress field in industrially direct-chill (DC) cast-aluminum slabs has been successful, but lack of material data limits the accuracy of these calculations. Therefore, the constitutive behavior of three aluminum alloys (AA1050, AA3104, and AA5182) was determined in the as-cast condition using tensile tests at low strain rates and from room temperature to solidus temperature. The parameters of two constitutive equations, the extended Ludwik equation and a combination of the Sellars-Tegart equation with a hardening law, were determined. In order to study the effect of recovery, the constitutive behavior after prestraining at higher temperatures was also investigated. To evaluate the quantified constitutive equations, tensile tests were performed simulating the deformation and cooling history experienced by the material during casting. It is concluded that both constitutive equations perform well, but the combined hardening-Sellars-Tegart (HST) equation has temperature-independent parameters, which makes it easier to implement in a DC casting model. Further, the deformation history of the ingot should be taken into account for accurate stress calculations.

  1. Perception, experience, and response to genetic discrimination in Huntington disease: the international RESPOND-HD study.

    Science.gov (United States)

    Erwin, Cheryl; Williams, Janet K; Juhl, Andrew R; Mengeling, Michelle; Mills, James A; Bombard, Yvonne; Hayden, Michael R; Quaid, Kimberly; Shoulson, Ira; Taylor, Sandra; Paulsen, Jane S

    2010-07-01

    Genetic discrimination-defined as the denial of rights, privileges, or opportunities or other adverse treatment based solely on genetic information (including family history)-is an important concern to patients, healthcare professionals, lawmakers, and family members at risk for carrying a deleterious gene. Data from the United States, Canada, and Australia were collected from 433 individuals at risk for Huntington disease (HD) who have tested either positive or negative for the gene that causes HD and family members of affected individuals who have a 50% risk for developing the disorder but remain untested. Across all three countries, a total of 46.2% of respondents report genetic discrimination or stigma based on either their family history of HD or genetic testing for the HD gene mutation. We report on the overall incidence of discrimination and stigma in the domains of insurance (25.9%), employment (6.5%), relationships (32.9%), and other transactions (4.6%) in the United States, Canada, and Australia combined. The incidence of self-reported discrimination is less than the overall worry about the risk of discrimination, which is more prevalent in each domain. Despite a relatively low rate of perceived genetic discrimination in the areas of health insurance and employment, compared to the perception of discrimination and stigma in personal relationships, the cumulative burden of genetic discrimination across all domains of experience represents a challenge to those at risk for HD. The effect of this cumulative burden on daily life decisions remains unknown. (c) 2010 Wiley-Liss, Inc.

  2. Changing epidemiology of AA amyloidosis: clinical observations over 25 years at a single national referral centre.

    Science.gov (United States)

    Lane, Thirusha; Pinney, Jennifer H; Gilbertson, Janet A; Hutt, David F; Rowczenio, Dorota M; Mahmood, Shameem; Sachchithanantham, Sajitha; Fontana, Marianna; Youngstein, Taryn; Quarta, Candida C; Wechalekar, Ashutosh D; Gillmore, Julian D; Hawkins, Philip N; Lachmann, Helen J

    2017-09-01

    Systemic AA amyloidosis is a serious complication of chronic inflammation; however, there are relatively few published data on its incidence. We investigated the changing epidemiology of AA amyloidosis over a 25-year period at a single national referral centre. We conducted a retrospective study of all patients diagnosed with AA amyloidosis who had attended the centre between 1990 and 2014 inclusive. Six hundred and twenty-five patients were studied in three cohorts: C1: 1990-1997; C2: 1998-2006; C3: 2007-2014. Mean age at presentation increased from 46 in C1 to 56 in C3 (p AA amyloidosis over a quarter of a century, reflecting advances in therapeutics and overall management of complex chronic disease in an ageing population. AA amyloidosis of uncertain aetiology presents an emerging major problem. Newer techniques such as next-generation sequencing may aid diagnosis and effective treatment, thereby improving overall survival.

  3. ROVIBRATIONAL QUENCHING RATE COEFFICIENTS OF HD IN COLLISIONS WITH He

    International Nuclear Information System (INIS)

    Nolte, J. L.; Stancil, P. C.; Lee, T.-G.; Balakrishnan, N.; Forrey, R. C.

    2012-01-01

    Along with H 2 , HD has been found to play an important role in the cooling of the primordial gas for the formation of the first stars and galaxies. It has also been observed in a variety of cool molecular astrophysical environments. The rate of cooling by HD molecules requires knowledge of collisional rate coefficients with the primary impactors, H, He, and H 2 . To improve knowledge of the collisional properties of HD, we present rate coefficients for the He-HD collision system over a range of collision energies from 10 –5 to 5 × 10 3 cm –1 . Fully quantum mechanical scattering calculations were performed for initial HD rovibrational states of j = 0 and 1 for v = 0-17 which utilized accurate diatom rovibrational wave functions. Rate coefficients of all Δv = 0, –1, and –2 transitions are reported. Significant discrepancies with previous calculations, which adopted a small basis and harmonic HD wave functions for excited vibrational levels, were found for the highest previously considered vibrational state of v = 3. Applications of the He-HD rate coefficients in various astrophysical environments are briefly discussed.

  4. AA amyloidosis complicating the hereditary periodic fever syndromes.

    Science.gov (United States)

    Lane, Thirusha; Loeffler, Jutta M; Rowczenio, Dorota M; Gilbertson, Janet A; Bybee, Alison; Russell, Tonia L; Gillmore, Julian D; Wechalekar, Ashutosh D; Hawkins, Philip N; Lachmann, Helen J

    2013-04-01

    AA amyloidosis is a life-threatening complication of the hereditary periodic fever syndromes (HPFS), which are otherwise often compatible with normal life expectancy. This study was undertaken to determine the characteristics, presentation, natural history, and response to treatment in 46 patients who had been referred for evaluation at the UK National Amyloidosis Centre. Disease activity was monitored by serial measurement of serum amyloid A. Renal function was assessed by measurement of serum creatinine and albumin levels, the estimated glomerular filtration rate, and proteinuria from 24-hour urine collections. The amyloid load was measured by serum amyloid P scintigraphy. Twenty-four patients had familial Mediterranean fever, 12 patients had tumor necrosis factor receptor-associated periodic syndrome, 6 patients had cryopyrin-associated periodic syndromes, and 4 patients had mevalonate kinase deficiency. The median age at onset of HPFS was 5 years; median age at presentation with AA amyloidosis was 38 years. Diagnosis of an HPFS had not been considered prior to presentation with AA amyloidosis in 23 patients (50%). Eleven patients (24%) had end-stage renal failure (ESRF) at presentation; of these, 3 had received transplants prior to referral. A further 13 patients developed ESRF over the followup period, with 10 undergoing renal transplantation. The median time to progression to ESRF from onset of AA amyloidosis was 3.3 years (interquartile range [IQR] 2-8), with a median time to transplant of 4 years (IQR 3-6). Eleven patients (24%) died. The median survival in the entire cohort was 19 years from diagnosis of AA amyloidosis. Of the 37 patients who were treated successfully, or in whom at least partial suppression of the underlying HPFS was achieved, 17 (46%) showed amyloid regression, 14 (38%) showed a stable amyloid load, and 2 (5%) showed increased amyloid deposition over the followup period. AA amyloidosis remains a challenging and serious late complication

  5. Laboratory Astrophysics Division of The AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-10-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  6. Laboratory Astrophysics Division of the AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-01-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  7. Concordance between (99m)Tc-ECD SPECT and 18F-FDG PET interpretations in patients with cognitive disorders diagnosed according to NIA-AA criteria.

    Science.gov (United States)

    Ito, Kimiteru; Shimano, Yasumasa; Imabayashi, Etsuko; Nakata, Yasuhiro; Omachi, Yoshie; Sato, Noriko; Arima, Kunimasa; Matsuda, Hiroshi

    2014-10-01

    The purpose of this study was to clarify the concordance of diagnostic abilities and interobserver agreement between 18F-fluorodeoxyglucose (FDG) positron emission tomography (PET) and brain perfusion single photon-emission computed tomography (SPECT) in patients with Alzheimer's disease (AD) who were diagnosed according to the research criteria of the National Institute of Aging-Alzheimer's Association Workshop. Fifty-five patients with "AD and mild cognitive impairment (MCI)" (n = 40) and "non-AD" (n = 15) were evaluated with 18F-FDG PET and (99m)Tc-ethyl cysteinate dimer (ECD) SPECT during an 8-week period. Three radiologists independently graded the regional uptake in the frontal, temporal, parietal, and occipital lobes as well as the precuneus/posterior cingulate cortex in both images. Kappa values were used to determine the interobserver reliability regarding regional uptake. The regions with better interobserver reliability between 18F-FDG PET and (99m)Tc-ECD SPECT were the frontal, parietal, and temporal lobes. The (99m)Tc-ECD SPECT agreement in the occipital lobes was not significant. The frontal, temporal, and parietal lobes showed good correlations between 18F-FDG PET and (99m)Tc-ECD SPECT in the degree of uptake, but the occipital lobe and precuneus/posterior cingulate cortex did not show good correlations. The diagnostic accuracy rates of "AD and MCI" ranged from 60% to 70% in both of the techniques. The degree of uptake on 18F-FDG PET and (99m)Tc-ECD SPECT showed significant correlations in the frontal, temporal, and parietal lobes. The diagnostic abilities of 18F-FDG PET and (99m)Tc-ECD SPECT for "AD and MCI," when diagnosed according to the National Institute of Aging-Alzheimer's Association Workshop criteria, were nearly identical. Copyright © 2014 John Wiley & Sons, Ltd.

  8. AA, closed orbit observation pickup

    CERN Multimedia

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. See also 8001372, 8010042, 8010045

  9. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles QFW, at maximum dispersion. See also 8001372, 8001383, 8010045

  10. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles, QFW, at maximum dispersion. See also 8001372,8001383, 8010042

  11. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. Werner Sax contemplates his achievement. See also 8001383, 8010042, 8010045.

  12. Reverse association of omega-3/omega-6 polyunsaturated fatty acids ratios with carotid atherosclerosis in patients on hemodialysis.

    Science.gov (United States)

    Umemoto, Norio; Ishii, Hideki; Kamoi, Daisuke; Aoyama, Toru; Sakakibara, Takashi; Takahashi, Hiroshi; Tanaka, Akihito; Yasuda, Yoshinari; Suzuki, Susumu; Matsubara, Tatsuaki; Murohara, Toyoaki

    2016-06-01

    Omega-3 (n-3) polyunsaturated fatty acids (PUFAs) are widely recognized to have beneficial effects against cardiovascular disease. We investigated the association of n-3 PUFAs levels with carotid atherosclerosis in patients on hemodialysis (HD), who are at high risk for cardiovascular events. Carotid ultra-sound was performed in a total of 461 patients on HD (male 67%, age 67 ± 12years, diabetes rate 46%). Intima-media thickness (IMT) and the plaque score (PS) in carotid arteries were measured. Carotid atherosclerosis was defined as IMT >1.2 mm and/or PS > 5.0. The levels of n-6 PUFAs [dihomo-gamma-linolenic acid (DHLA) and arachidonic acid (AA)] and n-3 PUFAs [eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA)] were also measured prior to carotid ultra-sound. Carotid atherosclerosis was observed in 94 patients (20.4%). Individual PUFAs levels were comparable between patients with and without carotid atherosclerosis. However, the ratio of EPA/AA and that of n-3/n-6 PUFAs were significantly lower in patients with carotid atherosclerosis compared to those without (median 0.36 vs. 0.41, p = 0.031 and 0.85 vs. 0.93, p = 0.041, respectively]. After adjustment for other confounders, the ratio of EPA/AA (OR 0.30, 95% CI 0.12-0.70, p = 0.0055) and the ratio of n-3/n-6 PUFAs (OR 0.45, 95% CI 0.25-0.80, p = 0.0066) showed an independent reverse association with carotid atherosclerosis. In addition, the area under receiver-operating characteristic curves for carotid atherosclerosis was significantly greater in an established risk model with EPA/AA and n-3/n-6 ratios than in the established risk model alone. These data suggest that low ratios of both EPA/AA ratio and n-3/n-6 PUFAs were closely associated with carotid atherosclerosis in patients on HD. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  13. Asymmetric H-D exchange reactions of fluorinated aromatic ketones

    KAUST Repository

    Zhao, Yujun; Lim, XiaoZhi; Pan, Yuanhang; Zong, Lili; Feng, Wei; Tan, Choonhong; Huang, Kuo-Wei

    2012-01-01

    Chiral bicyclic guanidine catalyzes the asymmetric H-D exchange reactions. Up to 30% ee was achieved. DFT calculations were employed to elucidate and explain the origin of the reaction's stereoselectivity. © 2012 The Royal Society of Chemistry.

  14. Asymmetric H-D exchange reactions of fluorinated aromatic ketones

    KAUST Repository

    Zhao, Yujun

    2012-01-01

    Chiral bicyclic guanidine catalyzes the asymmetric H-D exchange reactions. Up to 30% ee was achieved. DFT calculations were employed to elucidate and explain the origin of the reaction\\'s stereoselectivity. © 2012 The Royal Society of Chemistry.

  15. Automatic anterior chamber angle assessment for HD-OCT images.

    Science.gov (United States)

    Tian, Jing; Marziliano, Pina; Baskaran, Mani; Wong, Hong-Tym; Aung, Tin

    2011-11-01

    Angle-closure glaucoma is a major blinding eye disease and could be detected by measuring the anterior chamber angle in the human eyes. High-definition OCT (Cirrus HD-OCT) is an emerging noninvasive, high-speed, and high-resolution imaging modality for the anterior segment of the eye. Here, we propose a novel algorithm which automatically detects a new landmark, Schwalbe's line, and measures the anterior chamber angle in the HD-OCT images. The distortion caused by refraction is corrected by dewarping the HD-OCT images, and three biometric measurements are defined to quantitatively assess the anterior chamber angle. The proposed algorithm was tested on 40 HD-OCT images of the eye and provided accurate measurements in about 1 second.

  16. AAS 228: Day 3 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our

  17. DYNAMICAL MASS OF THE SUBSTELLAR BENCHMARK BINARY HD 130948BC , ,

    International Nuclear Information System (INIS)

    Dupuy, Trent J.; Liu, Michael C.; Ireland, Michael J.

    2009-01-01

    We present Keck adaptive optics imaging of the L4+L4 binary HD 130948BC along with archival Hubble Space Telescope and Gemini North observations, which together span ∼ 70% of the binary's orbital period. From the relative orbit, we determine a total dynamical mass of 0.109 ± 0.003 M sun (114 ± 3 M Jup ). The flux ratio of HD 130948BC is near unity, so both components are unambiguously substellar for any plausible mass ratio. An independent constraint on the age of the system is available from the primary HD 130948A (G2V, [M/H] = 0.0). The ensemble of available indicators suggests an age comparable to Hyades, with the most precise age being 0.79 +0.22 -0.15 Gyr based on gyrochronology. Therefore, HD 130948BC is now a unique benchmark among field L and T dwarfs, with a well-determined mass, luminosity, and age. We find that substellar theoretical models disagree with our observations. (1) Both components of HD 130948BC appear to be overluminous by a factor of ∼ 2-3 times compared to evolutionary models. The age of the system would have to be notably younger than the gyro age to ameliorate the luminosity disagreement. (2) Effective temperatures derived from evolutionary models for HD 130948B and C are inconsistent with temperatures determined from spectral synthesis for objects of similar spectral type. Overall, regardless of the adopted age, evolutionary and atmospheric models give inconsistent results, which indicate systematic errors in at least one class of models, possibly both. The masses of HD 130948BC happen to be very near the theoretical mass limit for lithium burning, and thus measuring the differential lithium depletion between B and C will provide a uniquely discriminating test of theoretical models. The potential underestimate of luminosities by evolutionary models would have wide-ranging implications; therefore, a more refined estimate age for HD 130948A is critically needed.

  18. Bidirectional uncompressed HD video distribution over fiber employing VCSELs

    DEFF Research Database (Denmark)

    Estaran Tolosa, Jose Manuel; Vegas Olmos, Juan José; Rodes, G. A.

    2012-01-01

    We report on a bidirectional system in which VCSELs are simultaneously modulated with two uncompressed HD video signals. The results show a large power budget and a negligible penalty over 10 km long transmission links.......We report on a bidirectional system in which VCSELs are simultaneously modulated with two uncompressed HD video signals. The results show a large power budget and a negligible penalty over 10 km long transmission links....

  19. Absolute parameters of southern detached eclipsing binary: HD 53570

    Science.gov (United States)

    Sürgit, D.

    2018-05-01

    In this study, we conducted the first analysis of spectroscopic and photometric observations of the eclipsing binary star HD 53570. Spectroscopic observations of HD 53570 were made at the Sutherland Station of the South African Astronomical Observatory in 2013 and 2014. The radial velocities of the components were determined using the cross-correlation technique. The spectroscopic mass ratio obtained for the system was 1.13 ( ± 0.07). The All Sky Automated Survey V light curve of HD 53570 was analyzed using the Wilson-Devinney code combined with the Monte Carlo search method. The final model showed that HD 53570 has a detached configuration. The mass and radii of the primary and secondary components of HD 53570 were derived as 1.06 ( ± 0.07) M⊙, 1.20 ( ± 0.16) M⊙, and 1.42 ( ± 0.14) R⊙, 2.07 ( ± 0.16) R⊙, respectively. The distance of HD 53570 was computed as 248 ( ± 38) pc considering interstellar extinction. The evolutionary status of the component stars was also investigated using Geneva evolutionary models.

  20. Automated choroid segmentation based on gradual intensity distance in HD-OCT images.

    Science.gov (United States)

    Chen, Qiang; Fan, Wen; Niu, Sijie; Shi, Jiajia; Shen, Honglie; Yuan, Songtao

    2015-04-06

    The choroid is an important structure of the eye and plays a vital role in the pathology of retinal diseases. This paper presents an automated choroid segmentation method for high-definition optical coherence tomography (HD-OCT) images, including Bruch's membrane (BM) segmentation and choroidal-scleral interface (CSI) segmentation. An improved retinal nerve fiber layer (RNFL) complex removal algorithm is presented to segment BM by considering the structure characteristics of retinal layers. By analyzing the characteristics of CSI boundaries, we present a novel algorithm to generate a gradual intensity distance image. Then an improved 2-D graph search method with curve smooth constraints is used to obtain the CSI segmentation. Experimental results with 212 HD-OCT images from 110 eyes in 66 patients demonstrate that the proposed method can achieve high segmentation accuracy. The mean choroid thickness difference and overlap ratio between our proposed method and outlines drawn by experts was 6.72µm and 85.04%, respectively.

  1. AAS 228: Day 1 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the

  2. Lamination sheet of AA BST magnet

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.

  3. The Determinants of Hemoglobin Variability in Hemodialysis Patients

    OpenAIRE

    Tomanoski Vasilije; Gjorgjievska Gordana; Zvezdakovska Jasminka; Krecova Vasiliki; Andonoski Aleksandar; Nakovska Margarita; Muharemi Serjat; Kliseski Tode; Janakievska Pavlina; Ristoska Katerina; Veliu Ramazan; Vasileva Liljana; Jovanov Toni; Mehmedi-Veseli Kaltrina; Ferati Beane

    2016-01-01

    Introduction. Factors that have been reported to affect erythropoietin (EPO) responsiveness in hemodialysis (HD) patients include iron deficiency, chronic inflammation, secondary hyperparathyroidism, malnutrition and inadequate HD dose. The aim of the study was to analyze the deteminants of hemoglobin variability in HD patients. Methods. The study encompassed 526 patients (197 F and 329 M). According to HD vintage at the beginning of the study the patients were divided into two groups: group-...

  4. We can predict when driving is no longer safe for people who have HD using standard neuropsychological measures.

    Science.gov (United States)

    Hennig, Bonnie L; Kaplan, Richard F; Nowicki, Ariel E; Barclay, Jessy E; Gertsberg, Anna G

    2014-01-01

    Early cognitive dysfunction in Huntington's Disease (HD) is typically of a subcortical frontal executive type, with bradyphrenia, poor spatial and working memory, poor planning and organization, a lack of judgment, and poor mental flexibility. Although there is literature suggesting a correlation between deficits in speed of processing, working memory and executive function on driving competency, there is little direct evidence comparing these declines on tests to actual driving skills. The current study examines the utility of specific neuropsychological measures in predicting actual driving competency in patients with HD. Fifty-two patients at the UConn Health HD Program underwent yearly neuropsychological evaluations and were included in this study. Four scales were chosen a priori to predict driving impairment because of their reported relationship to driving ability. Within each test category, subjects who scored below the threshold suggestive of neurological impairment were found to have results within the impaired range (1.5 standard deviations below corrective normative data). A referral to the Connecticut Department of Motor Vehicles (DMV) for a driving evaluation was subsequently made on patients who were found impaired on any two of these tests. The authors found a strong relationship between scores on a simple battery of four neuropsychological tests and driving competency. This short battery may prove of pragmatic value for clinicians working with people with HD and their families.

  5. Dosimetry during mango irradiation using Gafchromic HD-810 film

    International Nuclear Information System (INIS)

    Sharma, S. D.; Chilkulwar, R. H.; Kumar, R.

    2009-01-01

    The dosimetric characteristics of Gafchromic HD-810 film were evaluated for its possible use as a high-dose dosemeter for routine dosimetry during mango irradiation. The film dosemeter sample of size 2 x 2 cm 2 was used throughout the course of this work. The irradiation of the film dosemeter for characterisation and calibration purposes was carried out in a gamma irradiator. The dose-response of the Gafchromic HD-810 film dosemeter at 550 nm was found to be linear in the dose range 50-1000 Gy, which indicates the feasibility of using this film for dosimetry up to 1000 Gy. The mean inter-dosemeter variation was within 2%, which gives better dose-response consistency of the HD-810 film. The radiation absorbed dose measured by the Gafchromic HD-810 film dosemeter during mango irradiation was compared with that measured by a standard Ceric-cerous dosemeter. This study establishes the Gafchromic HD-810 film as a convenient and technically suitable dosemeter for high-dose dosimetry up to 1.0 kGy during mango irradiation. (authors)

  6. HD271791: dynamical versus binary-supernova ejection scenario

    Science.gov (United States)

    Gvaramadze, V. V.

    2009-05-01

    The atmosphere of the extremely high-velocity (530-920kms-1) early B-type star HD271791 is enriched in α-process elements, which suggests that this star is a former secondary component of a massive tight binary system and that its surface was polluted by the nucleosynthetic products after the primary star exploded in a supernova. It was proposed that the (asymmetric) supernova explosion unbind the system and that the secondary star (HD271791) was released at its orbital velocity in the direction of Galactic rotation. In this Letter, we show that to explain the Galactic rest-frame velocity of HD271791 within the framework of the binary-supernova scenario, the stellar remnant of the supernova explosion (a =750-1200kms-1. We therefore consider the binary-supernova scenario as highly unlikely and instead propose that HD271791 attained its peculiar velocity in the course of a strong dynamical three- or four-body encounter in the dense core of the parent star cluster. Our proposal implies that by the moment of encounter HD271791 was a member of a massive post-supernova binary.

  7. Side effects of AAS abuse: an overview.

    Science.gov (United States)

    Turillazzi, E; Perilli, G; Di Paolo, M; Neri, M; Riezzo, I; Fineschi, V

    2011-05-01

    Anabolic - androgenic steroids (AAS) were originally developed to promote growth of skeletal muscle. AAS abuse is commonly associated with bodybuilders, weightlifters, and other athletes. The issue of AAS toxicity is not yet completely understood since the adverse effects outline a varied scenario with side effects reported affecting many organs and systems in humans. The true incidence of AAS related medical problems is not known, due to several drawbacks in human studies. The entity of side effects depends on the sex, the dose, the duration of treatment, whether they are taken during exercise training or under sedentary conditions, and the susceptibility of the individuals themselves to androgen exposure partly depending on genetic factors. Both the acute and the chronic effects can lead to toxicity, but generally the serious and even fatal effects depend on the time and the duration of AAS administration. A limitation of human studies is represented by the fact that information about the intake of steroids are, generally, self reported and it is hardly possible to assess the exact dosage. AAS are often used in combination with other dugs or substances, so it is difficult to separate their toxic effects from those caused by the other drugs abused. Hence experimental studies conducted on animal models are mandatory to investigate the mechanisms underlying to AAS toxicity and the organ alterations due to these substances. Finally, clinicians should be aware of the complex and varied pattern of toxicity so as to be able to perform correct diagnoses and treatments.

  8. The HD+ dissociative recombination rate coefficient at low temperature

    Directory of Open Access Journals (Sweden)

    Wolf A.

    2015-01-01

    Full Text Available The effect of the rotational temperature of the ions is considered for low-energy dissociative recombination (DR of HD+. Merged beams measurements with HD+ ions of a rotational temperature near 300 K are compared to multichannel quantum defect theory calculations. The thermal DR rate coefficient for a Maxwellian electron velocity distribution is derived from the merged-beams data and compared to theoretical results for a range of rotational temperatures. Good agreement is found for the theory with 300 K rotational temperature. For a low-temperature plasma environment where also the rotational temperature assumes 10 K, theory predicts a considerably higher thermal DR rate coefficient. The origin of this is traced to predicted resonant structures of the collision-energy dependent DR cross section at few-meV collision energies for the particular case of HD+ ions in the rotational ground state.

  9. Quality of Life in Prodromal HD: Qualitative Analyses of Discourse from Participants and Companions

    Directory of Open Access Journals (Sweden)

    Rebecca E. Ready

    2011-01-01

    Full Text Available Persons who are at risk for Huntington's Disease (HD can be tested for the HD gene expansion before symptom onset. People with the gene expansion, but no clinical diagnosis, are in the prodromal phase of HD. This study explored quality of life (QOL in prodromal HD. Interviews about QOL, conducted with 9 prodromal HD participants and 6 companions, were transcribed. Discourse was coded for emotional valence, content (e.g., coping, spirituality, interpersonal relationships, HD in others, and employment, and time frame (e.g., current, past, and future. Respondents were more positive than negative about the present, which was their major focus. The most common statements were about positive attitudes. Positive statements were made about spirituality, and negative statements were made about HD in other people. Relationships, employment, and coping with HD reflected both positivity and negativity. Participants and companions spoke of the future with different concerns. Applicability of findings to the clinical management of HD are discussed.

  10. First circulating beam in the AA

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.56 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are too numerous to name them all, but the 3 most prominent ones are at the centre (left to right): Roy Billinge (Joint AA Project Leader, with his hand on the control box), Eifionydd Jones (white shirt), Simon van der Meer (spiritus rector and Joint AA Project Leader). The first antiprotons were injected, made to circulate and cooled soon after, on 14 July 1980.

  11. AAS 228: Day 3 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session 2015 Newton Lacy Pierce Prize Lecture: The Elephant in the Room: Effects of Distant, Massive Companions on Planetary System Architectures (by Leonardo dos Santos)The first session on Wednesday at 228th AAS Meeting was the Newton Lacy Pierce Prize Lecture by Heather Knutson (California Institute of Technology). This talk featured a broad range of research efforts on exoplanets, with the main focus on how we study the composition of their atmospheres, and how multi-body interactions carve the structure of the planetary systems we observe.One of her first points is the well-known idea that the Solar System is an oddball, compared to the exoplanet systems we have found so far: most of these systems contain hot Jupiters and mini-Neptunes at very close-in orbits around their host stars. Moreover, even when studying their transmission spectra, it is difficult to know the exact composition of their atmospheres.Knutson: it is difficult to constrain atmospheric composition of exoplanets (H-poor or H-rich+clouds?) #aas228pic.twitter.com/LdyN4o9RC7 astrobites (@astrobites) June 15, 2016The main proposal on how these systems formed is the migration scenario. In order to validate this idea, Dr. Knutson and her group The Friends of Hot Jupiters study systems with close-in gas giants and their frequency of binary companions, which are supposed to be the main culprits causing gas-giant migration. They found that approximately half of the observed systems have long-distance companions, providing strong validation of the migration scenario. Moreover, Dr. Knutson speculates that wide binaries have more

  12. NV-CMOS HD camera for day/night imaging

    Science.gov (United States)

    Vogelsong, T.; Tower, J.; Sudol, Thomas; Senko, T.; Chodelka, D.

    2014-06-01

    SRI International (SRI) has developed a new multi-purpose day/night video camera with low-light imaging performance comparable to an image intensifier, while offering the size, weight, ruggedness, and cost advantages enabled by the use of SRI's NV-CMOS HD digital image sensor chip. The digital video output is ideal for image enhancement, sharing with others through networking, video capture for data analysis, or fusion with thermal cameras. The camera provides Camera Link output with HD/WUXGA resolution of 1920 x 1200 pixels operating at 60 Hz. Windowing to smaller sizes enables operation at higher frame rates. High sensitivity is achieved through use of backside illumination, providing high Quantum Efficiency (QE) across the visible and near infrared (NIR) bands (peak QE camera, which operates from a single 5V supply. The NVCMOS HD camera provides a substantial reduction in size, weight, and power (SWaP) , ideal for SWaP-constrained day/night imaging platforms such as UAVs, ground vehicles, fixed mount surveillance, and may be reconfigured for mobile soldier operations such as night vision goggles and weapon sights. In addition the camera with the NV-CMOS HD imager is suitable for high performance digital cinematography/broadcast systems, biofluorescence/microscopy imaging, day/night security and surveillance, and other high-end applications which require HD video imaging with high sensitivity and wide dynamic range. The camera comes with an array of lens mounts including C-mount and F-mount. The latest test data from the NV-CMOS HD camera will be presented.

  13. Profile of renal AA amyloidosis in older and younger individuals: a single-centre experience.

    Science.gov (United States)

    Erdogmus, Siyar; Kendi Celebi, Zeynep; Akturk, Serkan; Kumru, Gizem; Duman, Neval; Ates, Kenan; Erturk, Sehsuvar; Nergizoglu, Gokhan; Kutlay, Sim; Sengul, Sule; Keven, Kenan

    2018-05-18

    In epidemiological studies of amyloid A (AA) amyloidosis from Turkey, the most frequently cause was familial Mediterranean fever (FMF) and it occurs generally in young age population. However, there are no sufficient data regarding aetiology, clinical presentation and prognosis of renal AA amyloidosis in advanced age patients. In this study, we aimed to investigate demographic, clinical presentation, aetiology and outcomes of adults aged 60 years or older patients with biopsy-proven renal AA amyloidosis. This is a retrospective study involving 53 patients who were diagnosed with AA amyloidosis by kidney biopsy from 2006 to 2016. In all patients, kidney biopsies were performed due to asymptomatic proteinuria, nephrotic syndrome and/or renal insufficiency. The patients were separated into two groups on the basis of age (group I: ≥60 years and group II: AA amyloidosis were as follows: FMF 16 (50%), bronchiectasis 7 (23%), chronic osteomyelitis 2 (6%), inflammatory bowel disease 2 (6%), rheumatoid arthritis 2 (6%), ankylosing spondylitis 1 (3%) and unknown aetiology 2 (6%). The underlying disorders of AA amyloidosis in group II patients were as follows: FMF 17 (81%), Behcet's disease 1 (5%) and unknown aetiology 3 (14%). No statistically significant differences were detected between two groups with regard to systolic and diastolic blood pressures, albumin, proteinuria and lipids. The combination of chronic kidney disease and nephrotic syndrome was the most common clinical presentation in group I (73%) and group II (43%) (p = .05). Compared to the group II, estimated glomerular filtration rate was significantly lower in group I at the time of kidney biopsy (p = .003). At 12-month follow-up, 61% of the group I and 33% of the group II developed end-stage kidney disease requiring dialysis, while 11% of the group I died. Our results indicated that renal AA amyloidosis is a rare disease in advanced age patients. At baseline and follow-up period, advanced age

  14. Radiofrequency/infrared double resonance spectroscopy of the HD+ ion

    International Nuclear Information System (INIS)

    Carrington, Alan; McNab, I.R.; Montgomerie, C.A.

    1989-01-01

    We describe a double resonance technique for obtaining radiofrequency spectra of the HD + ion in vibration-rotation levels close to the dissociation limit. Infrared transitions are driven by Doppler tuning an HD + ion beam into resonance with a carbon dioxide infrared laser, and are detected by measuring H + fragment ions produced by electric field dissociation of the upper vibration-rotation level. Radiofrequency transitions between nuclear hyperfine components of the lower vibration-rotation level are then detected through resonant increases in the H + fragment ion current. The high spectroscopic resolution obtained, and the ability to measure magnetic dipole hyperfine transitions, will enable the hyperfine constants to be determined accurately. (author)

  15. Quantum stereodynamics study for the reaction F + HD

    International Nuclear Information System (INIS)

    Yu-Fang, Liu; Wei, Zhang; De-Heng, Shi; Jin-Feng, Sun

    2009-01-01

    This paper studies the quantum stereodynamics of the F + HD(ν = 0,j = 0) → HD + F/HF + D reaction at the collision energies of 0.52 and 0.87 kcal/mol. The quantum scattering calculations, based on Stark–Werner potential energy surfaces, show that the differential cross sections for the HF(ν' = 2) + D and DF(ν' = 3) + H channels are consistent with the recent theoretical results. Furthermore, the product rotational angular momentum orientation and alignment have been determined for some selected rovibrational states of the HF + D and DF + H channels. (atomic and molecular physics)

  16. HD271791: dynamical versus binary-supernova ejection scenario

    OpenAIRE

    Gvaramadze, V. V.

    2009-01-01

    The atmosphere of the extremely high-velocity (530-920 km/s) early B-type star HD271791 is enriched in $\\alpha$-process elements, which suggests that this star is a former secondary component of a massive tight binary system and that its surface was polluted by the nucleosynthetic products after the primary star exploded in a supernova. It was proposed that the (asymmetric) supernova explosion unbind the system and that the secondary star (HD271791) was released at its orbital velocity in the...

  17. On the origin of the hypervelocity runaway star HD271791

    OpenAIRE

    Gvaramadze, V. V.

    2009-01-01

    We discuss the origin of the runaway early B-type star HD271791 and show that its extremely high velocity (\\simeq 530-920 km/s) cannot be explained within the framework of the binary-supernova ejection scenario. Instead, we suggest that HD271791 attained its peculiar velocity in the course of a strong dynamical encounter between two hard massive binaries or via an exchange encounter between a hard massive binary and a very massive star, formed through runaway mergers of ordinary massive stars...

  18. On the origin of the hypervelocity runaway star HD 271791

    Science.gov (United States)

    Gvaramadze, V. V.

    2010-01-01

    We discuss the origin of the early-B-type runaway star HD 271791 and show that its extremely high velocity (≃530 - 920km s-1) cannot be explained within the framework of the binary-supernova ejection scenario. Instead, we suggest that HD 271791 attained its peculiar velocity in the course of a strong dynamical encounter between two hard, massive binaries or through an exchange encounter between a hard, massive binary and a very massive star, formed through runaway mergers of ordinary massive stars in the dense core of a young massive star cluster.

  19. Catheter-related fungal endocarditis caused by Candida parapsilosis in a hemodialysis patient.

    Science.gov (United States)

    Shu, Ying; Yu, Shaobin; Zha, Ling; Fu, Ping; Cui, Tianlei

    2017-10-01

    Fungal endocarditis (FE) is commonly regarded as a rare but fatal disease. The incidence of infective endocarditis (IE) in hemodialysis (HD) patients is thought to be obviously higher than that in the general population. Moreover, IE occurs more likely in HD patients with catheters. With the increase of HD population and extensive use of catheters in HD patients, FE, as a special form of IE, may increase and bring new challenges to clinicians. We reported a case of FE associated with catheter infection in a 44-year-old woman on HD. The risk factors and treatment strategies of FE in HD patients were discussed. © 2017 International Society for Hemodialysis.

  20. AAS 228: Day 1 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session: From Space Archeology to Serving the World Today: A 20-year Journey from the Jungles of Guatemala to a Network of Satellite Remote Sensing Facilities Around the World(by Michael Zevin)In the conferences second plenary session, NASAs Daniel Irwin turned the eyes of the conference back to Earth by highlighting the huge impact that NASA missions play in protecting and developing our own planet.Daniel Irwin: using satellite imagery to detect differences in vegetation and find ancient Mayan cities. #aas228 pic.twitter.com/9LFPQdCHTM astrobites (@astrobites) June 13, 2016Irwin came to be involved in NASA through his work mapping Guatemalan jungles, where he would spend 22 days at a time exploring the treacherous jungles on foot armed with a 1st generation GPS, a compass, and a machete. A colleague introduced Irwin to the satellite imagery thathe was exploring, demonstratinghow these images are a strong complement to field work. The sharing of this satellite data with nearby villages helped to show the encroachment of agriculture and the necessity of connecting space to the village. Satellite imagery also played a role in archeological endeavors, uncovering dozens of Mayan cities that have been buried for over a millennia by vegetation, and it provided evidence that the fall of the Mayan civilization may have been due to massive deforestation that ledto drought.Glacial retreat in Chile imaged by ISERV.Irwin displayed the constellation of NASAs Earth-monitoring satellites that have played an integral role in conserving our planet and alerting the world of natural disasters. He also showed

  1. In vitro experiments for the development of a high density (HD) barium sulfate contrast medium

    International Nuclear Information System (INIS)

    Klein, J.

    1986-01-01

    In vitro experiments with the high-density (HD) barium meal Falibaryt HD are described. Several charges of BaSO 4 were tested together with certain additives influencing dispersion, stability of the suspension, flowability, surface tension etc. Particle size spectra were measured by the manufacturer, VEB Fahlberg-List. With a simple PVC test plate containing several grooves simulating small details (areae gastricae) the diagnostic capabilities of the HD contrast medium were evaluated in an in vitro test. The developed barium meal Falibaryt HD is in its physical and chemical parameters comparable with Prontobario-HD, one of the best HD barium meals. (author)

  2. Magnetic horn of the Antiproton Accumulator (AA)

    CERN Multimedia

    Photographic Service

    1988-01-01

    In the 1960s, the invention of this "current sheet lens" has helped to greatly improve the flux of neutrino beams. It was used again at the AA, collecting antiprotons from the production target at angles too large to fit into the acceptance of the AA. It was machined from aluminium to a thickness of 1.4 mm and pulsed at 400 kA for 15 microseconds (half-sine).

  3. Behavior of Abundances in Chemically Peculiar Dwarf and Subgiant A-Type Stars: HD 23193 and HD 170920

    Science.gov (United States)

    Kılıçoğlu, Tolgahan; Çalışkan, Şeyma; Ünal, Kübraözge

    2018-01-01

    To understand the origin of the abundance peculiarities of non-magnetic A-type stars, we present the first detailed chemical abundance analysis of a metallic line star HD 23193 (A2m) and an A-type subgiant HD 170920 (A5), which could have been a HgMn star on the main sequence. Our analysis is based on medium (R ∼ 14,000) and high (R ∼ 40,000) resolution spectroscopic data of the stars. The abundances of 18 elements are derived: C, O, Na, Mg, Al, Si, S, Ca, Sc, Ti, Cr, Mn, Fe, Ni, Zn, Sr, Y, and Ba. The masses of HD 23193 and HD 170920 are estimated from evolutionary tracks as 2.3 ± 0.1 M ⊙ and 2.9 ± 0.1 M ⊙. The ages are found to be 635 ± 33 Myr for HD 23193 and 480 ± 50 Myr for HD 170920 using isochrones. The abundance pattern of HD 23193 shows deviations from solar values in the iron-peak elements and indicates remarkable overabundances of Sr (1.16), Y (1.03), and Ba (1.24) with respect to the solar abundances. We compare the derived abundances of this moderately rotating (v\\sin i =37.5 km s‑1) Am star to the theoretical chemical evolution models including rotational mixing. The theoretically predicted abundances resemble our derived abundance pattern, except for a few elements (Si and Cr). For HD 170920, we find nearly solar abundances, except for C (‑0.43), S (0.16), Ti (0.15), Ni (0.16), Zn (0.41), Y (0.57), and Ba (0.97). Its low rotational velocity (v\\sin i=14.5 km s‑1), reduced carbon abundance, and enhanced heavy element abundances suggest that the star is most likely an evolved HgMn star. Based on observations made at the TÜBITAK National Observatory (Program ID 14BRTT150–671), and the Ankara University Observatory, Turkey.

  4. Mesenchymal stromal cells for treatment of steroid-refractory GvHD: a review of the literature and two pediatric cases

    Directory of Open Access Journals (Sweden)

    Wernicke Caroline M

    2011-08-01

    Full Text Available Abstract Severe acute graft versus host disease (GvHD is a life-threatening complication after allogeneic hematopoietic stem cell transplantation. Human mesenchymal stromal cells (MSCs play an important role in endogenous tissue repair and possess strong immune-modulatory properties making them a promising tool for the treatment of steroid-refractory GvHD. To date, a few reports exist on the use of MSCs in treatment of GvHD in children indicating that children tend to respond better than adults, albeit with heterogeneous results. We here present a review of the literature and the clinical course of two instructive pediatric patients with acute steroid-refractory GvHD after haploidentical stem cell transplantation, which exemplify the beneficial effects of third-party transplanted MSCs in treatment of acute steroid-refractory GvHD. Moreover, we provide a meta-analysis of clinical studies addressing the outcome of patients with steroid-refractory GvHD and treatment with MSCs in adults and in children (n = 183; 122 adults, 61 children. Our meta-analysis demonstrates that the overall response-rate is high (73.8% and confirms, for the first time, that children indeed respond better to treatment of GvHD with MSCs than adults (complete response 57.4% vs. 45.1%, respectively. These data emphasize the significance of this therapeutic approach especially in children and indicate that future prospective studies are needed to assess the reasons for the observed differential response-rates in pediatric and adult patients.

  5. Dosimetric validation of Monaco treatment planning system on an Elekta VersaHD linear accelerator.

    Science.gov (United States)

    Narayanasamy, Ganesh; Saenz, Daniel L; Defoor, Dewayne; Papanikolaou, Niko; Stathakis, Sotirios

    2017-11-01

    The purpose of this study is to perform dosimetric validation of Monaco treatment planning system version 5.1. The Elekta VersaHD linear accelerator with high dose rate flattening filter-free photon modes and electron energies was used in this study. The dosimetric output of the new Agility head combined with the FFF photon modes warranted this investigation into the dosimetric accuracy prior to clinical usage. A model of the VersaHD linac was created in Monaco TPS by Elekta using commissioned beam data including percent depth dose curves, beam profiles, and output factors. A variety of 3D conformal fields were created in Monaco TPS on a combined Plastic water/Styrofoam phantom and validated against measurements with a calibrated ion chamber. Some of the parameters varied including source to surface distance, field size, wedges, gantry angle, and depth for all photon and electron energies. In addition, a series of step and shoot IMRT, VMAT test plans, and patient plans on various anatomical sites were verified against measurements on a Delta 4 diode array. The agreement in point dose measurements was within 2% for all photon and electron energies in the homogeneous phantom and within 3% for photon energies in the heterogeneous phantom. The mean ± SD gamma passing rates of IMRT test fields yielded 93.8 ± 4.7% based on 2% dose difference and 2 mm distance-to-agreement criteria. Eight previously treated IMRT patient plans were replanned in Monaco TPS and five measurements on each yielded an average gamma passing rate of 95% with 6.7% confidence limit based on 3%, 3 mm gamma criteria. This investigation on dosimetric validation ensures accuracy of modeling VersaHD linac in Monaco TPS thereby improving patient safety. © 2017 The Authors. Journal of Applied Clinical Medical Physics published by Wiley Periodicals, Inc. on behalf of American Association of Physicists in Medicine.

  6. Gonadal function and fertility in survivors after Hodgkin lymphoma treatment within the German Hodgkin Study Group HD13 to HD15 trials.

    Science.gov (United States)

    Behringer, Karolin; Mueller, Horst; Goergen, Helen; Thielen, Indra; Eibl, Angelika Diana; Stumpf, Volker; Wessels, Carsten; Wiehlpütz, Martin; Rosenbrock, Johannes; Halbsguth, Teresa; Reiners, Katrin S; Schober, Thomas; Renno, Jorg H; von Wolff, Michael; van der Ven, Katrin; Kuehr, Marietta; Fuchs, Michael; Diehl, Volker; Engert, Andreas; Borchmann, Peter

    2013-01-10

    To optimize fertility advice in patients with Hodgkin lymphoma (HL) before therapy and during survivorship, information on the impact of chemotherapy is needed. Therefore, we analyzed gonadal functions in survivors of HL. Women younger than age 40 and men younger than 50 years at diagnosis in ongoing remission at least 1 year after therapy within the German Hodgkin Study Group HD13 to HD15 trials for early- and advanced-stage HL were included. Hormone parameters, menstrual cycle, symptoms of hypogonadism, and offspring were evaluated. A total of 1,323 (55%) of 2,412 contacted female and male survivors were evaluable for the current analysis (mean follow-up, 46 and 48 months, respectively). Follicle-stimulating hormone, anti-Müllerian hormone, and inhibin B levels correlated significantly with therapy intensity (P years: 82% v 45%, respectively; P years suffered severe menopausal symptoms (three- to four-fold more frequently than expected). In contrast, male survivors had mean levels of testosterone within the normal range and reported no increased symptoms of hypogonadism. The present analysis in a large group of survivors of HL provides well-grounded information on gonadal toxicity of currently used treatment regimens and allows risk-adapted fertility preservation and comprehensive support during therapy and follow-up.

  7. Treating AD/HD with Hypnosis and Neurotherapy.

    Science.gov (United States)

    Barabasz, Arreed; Barabasz, Marianne

    2000-01-01

    Presents details of Instant Alert Hypnosis procedure as an adjunct to neurotherapy in the treatment of attention deficit/hyperactivity disorder. Discusses AD/HD diagnostic issues, demographics, traditional treatments, neurological basis, EEG assessment, implications for the use of hypnosis, and the efficacy and promise of neurotherapy with and…

  8. Spectrum variability of the silicon Ap star HD 192913

    International Nuclear Information System (INIS)

    Riabchikova, T.A.; Davidova, E.S.; Adelman, S.J.

    1990-01-01

    The metal lines in the spectrum of the silicon Ap star HD 192913 are found to change with the photometric period. Many commonly found atomic species have lines which vary together in phase. The spectrum contains lines of most of the doubly ionized rare earth elements. 27 refs

  9. The period of the magnetic star HD 133 029

    International Nuclear Information System (INIS)

    Panov, K.; Schoeneich, W.

    1976-01-01

    The period of 0.741285 days for the light variability of the magnetic star HD 133 029 was obtained from UBV observations. The observations of the effective magnetic field by Babcock show variations with a period of 0.7447 days. A small change of the period and a slow change of the magnitude of this magnetic star seems to be present. (author)

  10. Dayside atmospheric structure of HD209458b from Spitzer eclipses

    Science.gov (United States)

    Reinhard, Matthew; Harrington, Joseph; Challener, Ryan; Cubillos, Patricio; Blecic, Jasmina

    2017-10-01

    HD209458b is a hot Jupiter with a radius of 1.26 ± 0.08 Jupiter radii (Richardson et al, 2006) and a mass of 0.64 ± 0.09 Jupiter masses (Snellen et al, 2010). The planet orbits a G0 type star with an orbital period of 3.52472 ± 2.81699e-05 days, and a relatively low eccentricity of 0.0082 +0.0078/-0.0082 (Wang and Ford 2013). We report the analysis of observations of HD209458b during eclipse, taken in the 3.6 and 4.5 micron channels by the Spitzer Space Telescope's Infrared Array Camera (Program 90186). We produce a photometric light curve of the eclipses in both channels, using our Photometry for Orbits Eclipses and Transits (POET) code, and calculate the brightness temperatures and eclipse depths. We also present best estimates of the atmospheric parameters of HD209458b using our Bayesian Atmospheric Radiative Transfer (BART) code. These are some preliminary results of what will be an analysis of all available Spitzer data for HD209458b. Spitzer is operated by the Jet Propulsion Laboratory, California Institute of Technology, under a contract with NASA. This work was supported by NASA Planetary Atmospheres grant NX12AI69G and NASA Astrophysics Data Analysis Program grant NNX13AF38G.

  11. THE ROTATION PERIOD OF HD-77581 (VELA X-1)

    NARCIS (Netherlands)

    ZUIDERWIJK, EJ

    The rotation period of HD 77581, supergiant primary in the X-ray binary Vela X-1, is determined from an analysis of selected absorption line profiles. The rotation rate determined from He I line profiles is 0.67 +/- 0.04 times that of the binary angular velocity, corresponding to a rotation velocity

  12. Spectroscopic Binaries near the North Galactic Pole Paper 15: HD ...

    Indian Academy of Sciences (India)

    tribpo

    Galactic Pole field he treated HD 106947 as if nothing were already known ... By good fortune a Palomar radial-velocity observing run in late 1986 fell near to a .... obvious to the naked eye as a grouping of fifth- and sixth-magnitude stars in an.

  13. Spectroscopic Binaries near the North Galactic Pole Paper 24: HD ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging Solutions)

    Paper 24: HD 106104, 109281, 109463 and 110743. R. F. Griffin, The ... with photoelectric radial-velocity spectrometers for many years. They have ..... G3 V against the principal star's F9 V, so the two objects would very well pass for a physical ...

  14. Calculation of the inter-nuclei separation of HD+

    International Nuclear Information System (INIS)

    Zhu Zhousen; Shi Miangong; Tang Ayou; Yang Baifang; Miao Jingwei

    1993-01-01

    With the Ritz variational principle, the authors calculate the inter nuclei separation of the HD + molecular ion, and introduces a method to calculate the inter nuclei separations of other simple non-symmetry two-atom molecular ions. One way to work out the trial wave function is provided

  15. Spectroscopic Variability of Supergiant Star HD14134, B3Ia

    Indian Academy of Sciences (India)

    Y. M. Maharramov

    2017-06-19

    Jun 19, 2017 ... the hot supergiant HD14134 studied in the present paper has a mass-loss rate of ...... tific program for the priority fields of research of the. National .... emission-line stars in the Large Magellanic Cloud, Astron. Astrophys., 158 ...

  16. IUE observations of an active region of HD206860

    Energy Technology Data Exchange (ETDEWEB)

    Blanco, C; Catalano, S; Marilli, E [Catania Univ. (Italy). Ist. di Astronomia

    1979-08-23

    The results of UV observations, with the IUE, of the Mg II H and k lines of HD206860, a GOV star, are reported. The aim of the observations was to search for short-term variability of the chromospheric emission connected with the rotation of the star.

  17. Fusion with highly spin polarized HD and D2

    International Nuclear Information System (INIS)

    Honig, A.

    1992-01-01

    This report discusses the following topics relating to inertial confinement with spin polarized hydrogen targets: low temperature implementation of mating a target to omega; dilution-refrigerator cold-entry and retrieval system; target shell tensile strength characterization at low temperatures; and proton and deuteron spin-lattice relaxation measurements in HD in the millikelvin temperature range

  18. Effect of supplementation of arachidonic acid (AA) or a combination of AA plus docosahexaenoic acid on breastmilk fatty acid composition

    NARCIS (Netherlands)

    Smit, EN; Koopmann, M; Boersma, ER; Muskiet, FAJ

    We investigated whether supplementation with arachidonic acid (20:4 omega 6; AA), ora combination of AA and docosahexaenoic acid (22:6 omega 3; DHA) would affect human milk polyunsaturated fatty acid (PUFA) composition. Ten women were daily supplemented with 300 mg AA, eight with 300 mg AA, 110 mg

  19. AAS 228: Day 2 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.The Limits of Scientific Cosmology: Setting the Stage: Accepted Facts, and Testing Limitations in Theory and Data (by Gourav Khullar)With a stellar lineup of speakers to talk about current and future prospects of cosmology and its limits (or lack thereof), the first session kicked off with talks by Risa Wechsler, Joseph Silk, and Sean Carroll (his talk on Multiverses is described below, by Nathan Sanders). Risa set the stage with an elaborate description of the current accepted facts in the era of precision cosmology including the standard model of concordance cosmology, described by seven parameters and an accepted Lambda-CDM paradigm (with a cosmological constant and cold dark matter). The talk stressed on the fact that all these parameters are understood to a percent order precision, which is a remarkable deviation from the time in 1990s when according to Risa, Alan Guth never thought that any of these numbers could be measured precisely!Risa Wechsler describing our current constraints on what Dark Matter could constitute.Joseph Silk discussing limits on cosmological parameters.The CMB measurements, Big Bang Nucleosynthesis estimates and galaxy clustering statistics all contribute to locking down the description of our universe. She emphasized on the tensions between different probes to measure expansion rate H0 of the universe, and small scale predictions of cold dark matter simulations, but she is hopeful that these shall be resolved eventually. Joe Silk followed this up with his interpretation of trying to understand our place in the universe and placing limits on different parameters and

  20. The Discovery of HD 37605c and a Dispositive Null Detection of Transits of HD 37605b

    DEFF Research Database (Denmark)

    Xuesong Wang, Sharon; Wright, Jason T.; Cochran, William

    2012-01-01

    the predicted ephemeris, we performed a transit search for HD 37605b with the photometric data taken by the T12 0.8-m Automatic Photoelectric Telescope (APT) and the Microvariability and Oscillations of Stars (MOST) satellite. Though the APT photometry did not capture the transit window, it characterized...

  1. THE DISCOVERY OF HD 37605c AND A DISPOSITIVE NULL DETECTION OF TRANSITS OF HD 37605b

    International Nuclear Information System (INIS)

    Wang, Sharon Xuesong; Wright, Jason T.; Mahadevan, Suvrath; Cochran, William; Endl, Michael; MacQueen, Phillip J.; Kane, Stephen R.; Von Braun, Kaspar; Henry, Gregory W.; Payne, Matthew J.; Ford, Eric B.; Valenti, Jeff A.; Antoci, Victoria; Dragomir, Diana; Matthews, Jaymie M.; Howard, Andrew W.; Marcy, Geoffrey W.; Isaacson, Howard

    2012-01-01

    We report the radial velocity discovery of a second planetary mass companion to the K0 V star HD 37605, which was already known to host an eccentric, P ∼ 55 days Jovian planet, HD 37605b. This second planet, HD 37605c, has a period of ∼7.5 years with a low eccentricity and an Msin i of ∼3.4 M Jup . Our discovery was made with the nearly 8 years of radial velocity follow-up at the Hobby-Eberly Telescope and Keck Observatory, including observations made as part of the Transit Ephemeris Refinement and Monitoring Survey effort to provide precise ephemerides to long-period planets for transit follow-up. With a total of 137 radial velocity observations covering almost 8 years, we provide a good orbital solution of the HD 37605 system, and a precise transit ephemeris for HD 37605b. Our dynamic analysis reveals very minimal planet-planet interaction and an insignificant transit time variation. Using the predicted ephemeris, we performed a transit search for HD 37605b with the photometric data taken by the T12 0.8 m Automatic Photoelectric Telescope (APT) and the MOST satellite. Though the APT photometry did not capture the transit window, it characterized the stellar activity of HD 37605, which is consistent of it being an old, inactive star, with a tentative rotation period of 57.67 days. The MOST photometry enabled us to report a dispositive null detection of a non-grazing transit for this planet. Within the predicted transit window, we exclude an edge-on predicted depth of 1.9% at the >>10σ level, and exclude any transit with an impact parameter b > 0.951 at greater than 5σ. We present the BOOTTRAN package for calculating Keplerian orbital parameter uncertainties via bootstrapping. We made a comparison and found consistency between our orbital fit parameters calculated by the RVLIN package and error bars by BOOTTRAN with those produced by a Bayesian analysis using MCMC.

  2. DISEQUILIBRIUM CARBON, OXYGEN, AND NITROGEN CHEMISTRY IN THE ATMOSPHERES OF HD 189733b AND HD 209458b

    International Nuclear Information System (INIS)

    Moses, Julianne I.; Visscher, C.; Fortney, J. J.; Showman, A. P.; Lewis, N. K.; Griffith, C. A.; Klippenstein, S. J.; Shabram, M.; Friedson, A. J.; Marley, M. S.; Freedman, R. S.

    2011-01-01

    We have developed a one-dimensional photochemical and thermochemical kinetics and diffusion model to study the effects of disequilibrium chemistry on the atmospheric composition of 'hot-Jupiter' exoplanets. Here we investigate the coupled chemistry of neutral carbon, hydrogen, oxygen, and nitrogen species on HD 189733b and HD 209458b and we compare the model results with existing transit and eclipse observations. We find that the vertical profiles of molecular constituents are significantly affected by transport-induced quenching and photochemistry, particularly on the cooler HD 189733b; however, the warmer stratospheric temperatures on HD 209458b help maintain thermochemical equilibrium and reduce the effects of disequilibrium chemistry. For both planets, the methane and ammonia mole fractions are found to be enhanced over their equilibrium values at pressures of a few bar to less than an mbar due to transport-induced quenching, but CH 4 and NH 3 are photochemically removed at higher altitudes. Disequilibrium chemistry also enhances atomic species, unsaturated hydrocarbons (particularly C 2 H 2 ), some nitriles (particularly HCN), and radicals like OH, CH 3 , and NH 2 . In contrast, CO, H 2 O, N 2 , and CO 2 more closely follow their equilibrium profiles, except at pressures ∼ 2 O, and N 2 are photochemically destroyed and CO 2 is produced before its eventual high-altitude destruction. The enhanced abundances of CH 4 , NH 3 , and HCN are expected to affect the spectral signatures and thermal profiles of HD 189733b and other relatively cool, transiting exoplanets. We examine the sensitivity of our results to the assumed temperature structure and eddy diffusion coefficients and discuss further observational consequences of these models.

  3. Elemental abundances of the field horizontal-branch stars HD 86986, 130095 and 202759

    International Nuclear Information System (INIS)

    Adelman, S.J.

    1990-01-01

    Fine analyses of limited spectral regions of the field horizontal-branch A Stars HD86986, 130095 and 202759 confirm that these stars have abundances typical of Population II stars. HD 86986 has a metallicity of about 1/200 solar while HD 130095 and 202759 are even more metal poor. (author)

  4. 76 FR 2243 - List of Approved Spent Fuel Storage Casks: NUHOMS ® HD System Revision 1

    Science.gov (United States)

    2011-01-13

    ... Storage Casks: NUHOMS [supreg] HD System Revision 1 AGENCY: Nuclear Regulatory Commission. ACTION: Direct... fuel storage regulations by revising the Transnuclear, Inc. (TN) NUHOMS [supreg] HD System listing... NUHOMS [supreg] HD System cask design listed in Sec. 72.214 (List of approved spent fuel storage casks...

  5. AAS 228: Day 2 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session (Day 1) The Galaxy Zoo(by Benny Tsang)Galaxy Zoo was so hot that the servers hosting the galaxy images got melted down soon after being launched.Kevin Schawinski from ETH Zurich took us on a tour ofhis wonderful Galaxy Zoo. It is a huge zoo with about a quarter million zookeepers, they are citizen astronomers who collaboratively classify galaxies by their looks as an attempt to understand galaxy evolution. The big question that is being answered is: how do blue, actively star-forming galaxies evolve into red, quiescent (non-star-forming) galaxies? The Zoo helped reveal that blue galaxies turn into red galaxies via two possible paths galaxies might run out of supply of gas and shut off star formation slowly; or they could merge with one another and turn off star formation by destroying the gas reservoir rapidly!The Galaxy Zoo project also led to the discoveries of:Green Peas: they are the living fossils of galaxy evolution; compact, bright, green galaxies that are actively forming starsOverlapping galaxies: they are pairs of galaxies that are separated physically but happen to lie on the same line of sight; they provide excellent laboratories for studying dust extinctionHannys Voorwerp: an unusual object named after Hanny the discoverer, which is believed to be the first detection of quasar light echoThe idea of Galaxy Zoo in getting help from citizen scientists was further extended into an award-winningproject known as the Zooniverse, which is an online platform for streamlined crowd-sourcing for scientific research that requires human input. The future of astronomy is going to be

  6. The AA disappearing under concrete shielding

    CERN Multimedia

    CERN PhotoLab

    1982-01-01

    When the AA started up in July 1980, the machine stood freely in its hall, providing visitors with a view through the large window in the AA Control Room. The target area, in which the high-intensity 26 GeV/c proton beam from the PS hit the production target, was heavily shielded, not only towards the outside but also towards the AA-Hall. However, electrons and pions emanating from the target with the same momentum as the antiprotons, but much more numerous, accompanied these through the injection line into the AA ring. The pions decayed with a half-time corresponding to approximately a revolution period (540 ns), whereas the electrons lost energy through synchrotron radiation and ended up on the vacuum chamber wall. Electrons and pions produced the dominant component of the radiation level in the hall and the control room. With operation times far exceeding original expectations, the AA had to be buried under concrete shielding in order to reduce the radiation level by an order of magnitude.

  7. The ABCB1, rs9282564, AG and TT Genotypes and the COMT, rs4680, AA Genotype are Less Frequent in Deceased Patients with Opioid Addiction than in Living Patients with Opioid Addiction

    DEFF Research Database (Denmark)

    Christoffersen, Dorte J; Damkier, Per; Feddersen, Søren

    2016-01-01

    Sudden death due to acute intoxication occurs frequently in patients with opioid addiction (OA). In order to examine if certain genotypes were associated with this, we examined the frequencies of 29 SNPs located in candidate genes related to opioid pharmacology: ABCB1, OPRM1, UGT2B7, CYP3A5, CYP2B6...... and fatal poisoning in OA is confirmed, then it may be possible at least in theory to personalize prevention of sudden death in this patient group. This article is protected by copyright. All rights reserved....

  8. Neural processing of emotions in traumatized children treated with eye movement desensitization and reprocessing therapy: a hdEEG study

    OpenAIRE

    Trentini, C; Pagani, M; Fania, P; Speranza, AM; Nicolais, G; Sibilia, A; Inguscio, L; Verardo, AR; Fernandez, I; Ammaniti, M

    2015-01-01

    Eye Movement Desensitization and Reprocessing (EMDR) therapy has been proven efficacious in restoring affective regulation in post-traumatic stress disorder (PTSD) patients. However, its effectiveness on emotion processing in children with complex trauma has yet to be explored. High density electroencephalography (hdEEG) was used to investigate the effects of EMDR on brain responses to adults’ emotions on children with histories of early maltreatment. Ten school-aged children were examined be...

  9. The association between Interleukin (IL)-4 gene intron 3 VNTR polymorphism and alopecia areata (AA) in Turkish population.

    Science.gov (United States)

    Kalkan, Göknur; Karakus, Nevin; Baş, Yalçın; Takçı, Zennure; Ozuğuz, Pınar; Ateş, Omer; Yigit, Serbulent

    2013-09-25

    Alopecia areata (AA) is hypothesized to be an organ-specific autoimmune disease of hair follicles mediated by T cells. As immunological and genetic factors have been implicated in the pathogenesis of AA, the purpose of the present study was to investigate possible associations between the functional Interleukin (IL)-4 gene intron 3 VNTR polymorphism and AA susceptibility and disease progression in Turkish population. The study group consisted of 116 unrelated patients with AA and 125 unrelated healthy controls. Genomic DNA was isolated and IL-4 gene 70 bp VNTR polymorphism determined by using polymerase chain reaction (PCR) with specific primers. No association was observed between AA patients and controls according to genotype distribution (p=0.051). The allele distribution of IL-4 gene intron 3 VNTR polymorphism was statistically different between AA patients and control group (p=0.026). The frequency of P1 allele in patients was significantly higher than that in the control group. When the P2P2 genotype was compared with P1P2+P1P1 genotypes, a statistically significant difference was observed between patients and controls (p=0.036). Intron 3 VNTR polymorphism in the IL-4 gene was found to be associated with AA susceptibility in Turkish population. The results suggest that IL-4 VNTR polymorphism in the intron 3 region may be a risk factor for the development of AA among Turkish population. This is the first to report that intron 3 VNTR polymorphism in the IL-4 gene is associated with AA susceptibility. © 2013.

  10. HD 38452 - J. R. Hind's star that changed colour

    Science.gov (United States)

    Warner, Brian; Sneden, Christopher

    1988-01-01

    In 1851, John Russell Hind announced that a star previously observed by him to be very red had become bluish white in color. It is shown that this star, HD 38451, is a ninth magnitude shell star which presumably was ejecting a shell when Hind first observed it. From high dispersion coude spectra, low dispersion IUE spectra, and ground-based photometry, HD 38451 is found to be a normal A21V shell star. Its current values of E(B-V) of about 0.14 is probably caused by interstellar rather than circumstellar reddening. There remains a problem to reconcile the large amount of reddening present when Hind first observed the star with its evidently small diminution in visual brightness at that time.

  11. Simulation of polarimetric effects in planetary system HD 189733

    Science.gov (United States)

    Frantseva, K.; Kostogryz, N. M.; Yakobchuk, T. M.

    2012-11-01

    In this paper we present results of linear polarization modelling for HD 189733 in the U filter using the Monte Carlo method. Our simulations are based on the well known effect that linear polarization of a centrosymmetric unresolved star becomes non-zero during the planet transit or in the presence of spots on its surface. HD 189733 is currently the brightest (m_{V}=7.67^{m}) known star to harbour a transiting exoplanet. This fact, along with the short orbital period (2.2 d), makes it very suitable for different types of observations including polarimetry. Since we are interested in occultation effects, a very important parameter is the ratio of the planet to star radii, which is also very large (0.15). As the host star is active and spots may cover up to 1% of the planetary surface, we perform our simulations for different spot parameters such as sizes, locations on the stellar disk, and temperatures.

  12. Hearily reddened Hg-Mn star HD 29647

    International Nuclear Information System (INIS)

    Strajzhis, V.; Glagolevskij, Yu.V.; Romanyuk, I.I.; Bychkov, V.D.; AN SSSR, Nizhnij Arkhyz. Spetsial'naya Astrofizicheskaya Observatoriya)

    1982-01-01

    A heavily reddened HD 29647 (V=8sup(m).4) star is investigated using the 6-meter telescope spectrograms with dispersions 9 and 28 A/mm and photometric observations in the Vilnius seven- color system. Parameters Tsub(e)=15600 K (corresponding spectral type B5) and log g=3.70 from hydrogen lines and Balmer jump were obtained. HD 29647 is a peculiar star of the Hg-Mn type. The radial velocity of the star is+14.1+-1.0 km/s, almost identical with that of the dark Taurus cloud and its T Tauri-type variables. If the star is near the front edge of the dark cloud at the distance of 165 pc and has Esub(B-V)=1.06, its visual absolute magnitude is - 0sup(m).9. Photometric observations permit to suspect a slight varia bility in the U, P, and X colors [ru

  13. Symmetry Breakdown in Ground State Dissociation of HD+

    International Nuclear Information System (INIS)

    Ben-Itzhak, I.; Wells, E.; Carnes, K. D.; Krishnamurthi, Vidhya; Weaver, O. L.; Esry, B. D.

    2000-01-01

    Experimental studies of the dissociation of the electronic ground state of HD + following ionization of HD by fast proton impact indicate that the H + +D 1s dissociation channel is more likely than the H1s+D + dissociation channel by about 7% . This isotopic symmetry breakdown is due to the finite nuclear mass correction to the Born-Oppenheimer approximation which makes the 1sσ state 3.7 meV lower than the 2pσ state at the dissociation limit. The measured fractions of the two dissociation channels are in agreement with coupled-channels calculations of 1sσ to 2pσ transitions. (c) 2000 The American Physical Society

  14. HD 38451: J.R. Hind's star that changed colour

    International Nuclear Information System (INIS)

    Warner, B.; Cape Town Univ.; Snedon, C.

    1988-01-01

    In 1851, John Russell Hind announced that a star previously observed by him to be very red had become bluish white in colour. We show that this star, HD 38451, is a ninth magnitude shell star which presumably was ejecting a shell when Hind first observed it. From high dispersion coude spectra, low dispersion IUE spectra and ground-based photometry we find HD 38451 to be a normal A2IV shell star. Its current value of E(B-V) approx. ident to 0.14 is probably caused by interstellar rather than circumstellar reddening. There remains a problem to reconcile the large amount of reddening present when Hind first observed the star with its evidently small diminution in visual brightness at that time. (author)

  15. Novel theory of the HD dipole moment. II. Computations

    International Nuclear Information System (INIS)

    Thorson, W.R.; Choi, J.H.; Knudson, S.K.

    1985-01-01

    In the preceding paper we derived a new theory of the dipole moments of homopolar but isotopically asymmetric molecules (such as HD, HT, and DT) in which the electrical asymmetry appears directly in the electronic Hamiltonian (in an appropriate Born-Oppenheimer separation) and the dipole moment may be computed as a purely electronic property. In the present paper we describe variation-perturbation calculations and convergence studies on the dipole moment for HD, which is found to have the value 8.51 x 10 -4 debye at 1.40 a.u. Using the two alternative formulations of the electronic problem, we can provide a test of basis-set adequacy and convergence of the results, and such convergence studies are reported here. We have also computed vibration-rotation transition matrix elements and these are compared with experimental and other theoretical results

  16. Dynamic behavior of PE-HD pipes grade

    Czech Academy of Sciences Publication Activity Database

    Trnka, Jan; Buchar, Jaroslav; Nezbedová, E.

    2017-01-01

    Roč. 373, č. 1 (2017), č. článku 1700038. ISSN 1022-1360 R&D Projects: GA MŠk(CZ) EF15_003/0000493 Institutional support: RVO:61388998 Keywords : dynamic behavior * PE-HD * split Hopkinson pressure bar test * strain rate Subject RIV: JI - Composite Materials OBOR OECD: Composites (including laminates, reinforced plastics, cermets, combined natural and synthetic fibre fabrics http://onlinelibrary.wiley.com/doi/10.1002/masy.201700038/full

  17. Searching for stable orbits in the HD 10180 planetary system

    Directory of Open Access Journals (Sweden)

    Laskar J.

    2011-02-01

    Full Text Available A planetary system with at least seven planets has been found around the star HD 10180. However, the traditional Keplerian and n-body fits to the data provide an orbital solution that becomes unstable very quickly, which may quest the reliability of the observations. Here we show that stable orbital configurations can be obtained if general relativity and long-term dissipation raised by tides on the innermost planet are taken into account.

  18. El medio interestelar alrededor de estrellas Of: HD 108

    Science.gov (United States)

    Cappa, C.; Testori, J. C.

    Hemos analizado la distribución del hidrógeno neutro interestelar en la vecindad de la estrella Of HD 108 en base a perfiles de la línea de 21 cm. Estos datos nos han permitido encontrar una probable burbuja interestelar asociada a la estrella. Comparamos estos resultados con la emisión en otros rangos espectrales y estimamos los principales parámetros físicos de la estructura.

  19. Delay Tolerance: A Therapeutic Possibility for AD/HD?

    Directory of Open Access Journals (Sweden)

    Edmund J. S. Sonuga-Barke

    2004-01-01

    on these two insights to explore the possibility that the motivational alterations underpinning delay aversion can be modified through specific training regimes in a way equivalent to that found with executive and attentional training. The requirements for such an approach are set out. Delay fading is proposed as a possible basis for reorganizing delay experience, altering the incentive value of delay (e.g., increasing tolerance for delay, thereby reducing AD/HD symptoms.

  20. HD-DVD: the next consumer electronics revolution?

    Science.gov (United States)

    Topiwala, Pankaj N.

    2003-11-01

    The DVD is emerging as one of the world's favorite consumer electronics product, rapidly replacing analog videotape in the US and many other markets at prodigious rates. It is capable of offering a full feature-length, standard-definition movie in crisp rendition on TV. TV technology is itself in the midst of switching from analog to digital TV, with high-definition being the main draw. In fact, the US government has been advocating that switch over to digital TC, with both carrot and stick approaches, for nearly two decades, with only modest results--about 2% penetration. Under FCC herding, broadcasters are falling in the digital line--slowly, and sans profit. Meanwhile, delivery of HD content on portable media would be a great solution. Indeed, a new disk technology based on blue lasers is coming; but its widespread adoption may yet be four to five yeras away. But a promising new video codec--H.264/MPEG-4 AVC, the latest coding standard jointly developed by the Video Coding Experts Group (VCEG) of ITU-T and Moving Picture Experts Group (MPEG) of ISO/IEC, just might be the missing link. It offers substantial coding gains over MPEG-2, used in today's DVDs. With H.264, it appears possible to put HD movies on today's red-laser DVDs. Since consumers love DVDs, and HD--when they can see it, can H.264 and HD-DVD ignite a new revolution, now? It may have a huge impact on (H)DTV adoption rates.

  1. HD Photo: a new image coding technology for digital photography

    Science.gov (United States)

    Srinivasan, Sridhar; Tu, Chengjie; Regunathan, Shankar L.; Sullivan, Gary J.

    2007-09-01

    This paper introduces the HD Photo coding technology developed by Microsoft Corporation. The storage format for this technology is now under consideration in the ITU-T/ISO/IEC JPEG committee as a candidate for standardization under the name JPEG XR. The technology was developed to address end-to-end digital imaging application requirements, particularly including the needs of digital photography. HD Photo includes features such as good compression capability, high dynamic range support, high image quality capability, lossless coding support, full-format 4:4:4 color sampling, simple thumbnail extraction, embedded bitstream scalability of resolution and fidelity, and degradation-free compressed domain support of key manipulations such as cropping, flipping and rotation. HD Photo has been designed to optimize image quality and compression efficiency while also enabling low-complexity encoding and decoding implementations. To ensure low complexity for implementations, the design features have been incorporated in a way that not only minimizes the computational requirements of the individual components (including consideration of such aspects as memory footprint, cache effects, and parallelization opportunities) but results in a self-consistent design that maximizes the commonality of functional processing components.

  2. Efforts towards a dynamically polarised HD-target

    International Nuclear Information System (INIS)

    Radtke, E.; Goertz, St.; Harmsen, J.; Heckmann, J.; Meier, A.; Meyer, W.; Reicherz, G.

    2004-01-01

    The molecular hydrogen isotopes contain no unpolarisable background. From this point of view they appear to be the material of choice for a polarised bulk target in scattering experiments. The fast nuclear relaxation of H 2 and D 2 is one reason that these substances are not highly polarisable. This fact brings hydrogendeuteride (HD) into focus. In Bochum a device to freeze out gases into the consisting 4 He-cryostat has been built up. The principle of the Dynamic Nuclear Polarisation requires a sufficient amount of paramagnetic electrons. These have been produced by cracking HD molecules at 1 K using a 90 Sr β-source with an activity of 3.7 GBq. Six days of effective irradiation resulted in a density of paramagnetic centres in the order of 10 18 spins/cm 3 . This could be estimated from bolometric electron paramagnetic resonance (EPR) measurements. Dynamic polarisation could not be achieved. This is accounted to isotopic impurities in the used HD, which accelerate the nuclear relaxation. The constant of ortho-para conversion in H 2 could be confirmed to be 1.9%/h

  3. Analysis of spectra of V471 Tau and HD 115404

    Science.gov (United States)

    Shimansky, V. V.; Bikmaev, I. F.; Shimanskaya, N. N.

    2011-10-01

    We analyze the chemical composition of the atmospheres of a single K-type star HD 115404 and the secondary component of the V471 Tau variable. We use the technique of modeling of synthetic spectra to analyze the high-resolution spectra of these stars, taken with the RTT 150 Russian-Turkish telescope and find the abundances of 23 and 17 elements in the atmospheres of HD 115404 and V471 Tau, respectively. We demonstrate the lack of composition anomalies in the HD 115404 and show it to be consistent with the published data, inferred from equivalent widths of spectral lines. We find the abundances of 15 elements from Na to Ba to be consistent with the metallicity of the atmosphere of V471 Tau ([Fe/H] = -0.22 ± 0.12dex), which differs significantly from the average metallicity of the Hyades cluster. We show the existence of strong carbon and oxygen overabundances (by more than 1dex) due to the enrichment of the secondary by the nucleosynthesis products during the common-envelope stage of the system. On the whole, we demonstrate that V471 Tau and the other precataclysmic variables share similar composition anomalies.

  4. Development of continuous cooling precipitation diagrams for aluminium alloys AA7150 and AA7020

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y., E-mail: yong.zhang@outlook.com [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia); Milkereit, B. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Kessler, O. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); Schick, C. [University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Rometsch, P.A. [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia)

    2014-01-25

    Highlights: • The DSC method was used for developing continuous cooling precipitation diagrams. • The quench-induced particles were observed by SEM for alloys AA7150 and AA7020. • There were more quench-induced particles in alloy AA7150. • Quench sensitivity of Al alloys can be evaluated by using the CCP diagrams. -- Abstract: Two commercial 7xxx series aluminium alloys with different solute contents and different quench-induced precipitation behaviour have been investigated by using a specialised differential scanning calorimetry (DSC) technique to record exothermal heat outputs during continuous cooling. Together with hardness testing and microstructural analysis, this DSC method was used to develop continuous cooling precipitation (CCP) diagrams for alloys AA7150 and AA7020. The results show that the total precipitation heat for each alloy decreases with increasing cooling rate. However, the excess specific heat at a given cooling rate in alloy AA7150 is much higher than that in alloy AA7020. It is evident that there are atleast three different quench-induced reactions in different temperature regimes for alloy AA7150 cooled at various linear cooling rates, but only equilibrium MgZn{sub 2} (η-phase) and Al{sub 2}CuMg (S-phase) particles were observed by scanning electron microscopy (SEM). There are at least two main precipitation peaks that can be found for alloy AA7020, which correspond to Mg{sub 2}Si and MgZn{sub 2} (η-phase). Furthermore, a method is developed to evaluate the quench sensitivity of an alloy based on a determination of the critical cooling rate. The maximum hardness values are reached at cooling rates that are faster than or similar to the critical cooling rate.

  5. Mitochondrial fragmentation in neuronal degeneration: Toward an understanding of HD striatal susceptibility

    International Nuclear Information System (INIS)

    Cherubini, Marta; Ginés, Silvia

    2017-01-01

    Huntington's disease (HD) is an autosomal-dominant progressive neurodegenerative disorder that primarily affects medium spiny neurons within the striatum. HD is caused by inheritance of an expanded CAG repeat in the HTT gene, resulting in a mutant huntingtin (mHtt) protein containing extra glutamine residues. Despite the advances in understanding the molecular mechanisms involved in HD the preferential vulnerability of the striatum remains an intriguing question. This review discusses current knowledge that links altered mitochondrial dynamics with striatal susceptibility in HD. We also highlight how the modulation of mitochondrial function may constitute an attractive therapeutic approach to reduce mHtt-induced toxicity and therefore prevent the selective striatal neurodegeneration. - Highlights: • Mitochondrial dynamics is unbalanced towards fission in HD. • Excessive mitochondrial fragmentation plays a critical role in the selective vulnerability of the striatum in HD. • Therapeutic approaches aimed to inhibit mitochondrial fission could contribute to prevent striatal neurodegeneration in HD.

  6. Development of a new high density (HD) barium meal (Falibaryt HD) for double contrast investigation of the stomach

    International Nuclear Information System (INIS)

    Dietze, R.

    1986-01-01

    During the development of a new double contrast barium meal barium sulfate preparations with various densities, additives and particle size distributions were tested. Phantoms made of leather, rubber and the opened stomachs of cows and pigs were used. A HD bariumsulfate suspension (200 - 250% W/V) of low viscosity and suitable grain size spectrum containing additives improving the adherence (e.g. natrium citrate) showed the best quality parameters for an optimal imaging of the fine mucosal relief. (author)

  7. AA, vacuum tank for stochastic precooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The vaccum tank in which the fast stochastic precooling kicker was installed. It is clad with heating jackets for bake-out to 200 deg C, indispensable for reaching the operational vacuum of 7E-11 Torr. Alain Poncet, responsible for AA vacuum, is looking on. See also 7910268, 8002234.

  8. Overview of the Antiproton Accumulator (AA)

    CERN Multimedia

    1982-01-01

    See photo 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  9. Overall view of AA (Bld 193)

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  10. Overall view of AA in Bld. 193

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  11. AA, sandwich line with magnetic horn

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Continuation from 8010293: Finally, the sandwich line with the horn is placed on the ground, for the horn to be inspected and, if needed, exchanged for a new one. The whole procedure was trained with several members of the AA team, for quick and safe handling, and to share the radiation dose amongst them.

  12. AA, mating of BST magnet halves

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

  13. Evidences of extragalactic origin and planet engulfment in the metal-poor twin pair HD 134439/HD 134440

    Science.gov (United States)

    Reggiani, Henrique; Meléndez, Jorge

    2018-04-01

    Recent studies of chemical abundances in metal-poor halo stars show the existence of different populations, which is important for studies of Galaxy formation and evolution. Here, we revisit the twin pair of chemically anomalous stars HD 134439 and HD 134440, using high resolution (R ˜ 72 000) and high S/N ratio (S/N ˜ 250) HDS/Subaru spectra. We compare them to the well-studied halo star HD 103095, using the line-by-line differential technique to estimate precise stellar parameters and LTE chemical abundances. We present the abundances of C, O, Na, Mg, Si, Ca, Sc, Ti, V, Cr, Mn, Co, Ni, Cu, Zn, Sr, Y, Ba, La, Ce, Nd, and Sm. We compare our results to the precise abundance patterns of Nissen & Schuster (2010) and data from dwarf Spheroidal galaxies (dSphs). We show that the abundance pattern of these stars appears to be closely linked to that of dSphs with [α/Fe] knee below [Fe/H] < -1.5. We also find a systematic difference of 0.06 ± 0.01 dex between the abundances of these twin binary stars, which could be explained by the engulfment of a planet, thus suggesting that planet formation is possible at low metallicities ([Fe/H] = -1.4).

  14. Dyssynergic defecation may play an important role in postoperative Hirschsprung's disease patients with severe persistent constipation Analysis of a case series

    NARCIS (Netherlands)

    Meinds, Rob J.; Eggink, Maura C.; Heineman, Erik; Broens, Paul M. A.

    2014-01-01

    Background: After surgery for Hirschsprung's disease (HD) the majority of patients have satisfactory clinical outcomes. Nevertheless, a substantial number of patients remain who suffer from severe persistent constipation. Current consensus attributes these complaints to the hallmarks of HD. In

  15. Metabolic and hormonal signatures in pre-manifest and manifest Huntington’s disease patients

    Directory of Open Access Journals (Sweden)

    Rui eWang

    2014-06-01

    Full Text Available Huntington's disease (HD is an inherited neurodegenerative disorder typified by involuntary body movements, and psychiatric and cognitive abnormalities. Many HD patients also exhibit metabolic changes including progressive weight loss and appetite dysfunction. Here we have investigated metabolic function in pre-manifest and manifest HD subjects to establish an HD subject metabolic hormonal plasma signature. Individuals at risk for HD who have had predictive genetic testing showing the cytosine-adenine-guanine (CAG expansion causative of HD, but who do not yet present signs and symptoms sufficient for the diagnosis of manifest HD are said to be pre-manifest. Pre-manifest and manifest HD patients, as well as both familial and non-familial controls, were evaluated for multiple peripheral metabolism signals including circulating levels of hormones, growth factors, lipids and cytokines. Both pre-manifest and manifest HD subjects exhibited significantly reduced levels of circulating growth factors, including growth hormone and prolactin. HD-related changes in the levels of metabolic hormones such as ghrelin, glucagon and amylin were also observed. Total cholesterol, HDL-C and LDL-C were significantly decreased in HD subjects. C-reactive protein was significantly elevated in pre-manifest HD subjects. The observation of metabolic alterations, even in subjects considered to be in the pre-manifest stage of HD, suggests that in addition, and prior, to overt neuronal damage, HD affects metabolic hormone secretion and energy regulation, which may shed light on pathogenesis, and provide opportunities for biomarker development.

  16. (PCL/AA) hydrogel for controlled drug delivery

    Indian Academy of Sciences (India)

    Administrator

    applications, (iii) dental applications, (iv) injectable polymers, (v) ... PCL with AA grafted PCL(PCL-g-AA) on the structure ... porosity. Structure, morphology and crystallinity of PCL/ .... X-ray diffraction patterns were recorded, in reflection,.

  17. [Risk control of traditional Chinese medicines containing aristolochis acids (AAs) based on influencing factors of content of AAs].

    Science.gov (United States)

    Tian, Jing-Zhuo; Liang, Ai-Hua; Liu, Jing; Zhang, Bo-Li

    2017-12-01

    Aristolochic acids (AAs) widely exist in such plants as Aristolochia and Asarum. The renal toxicity of AAs as well as its carcinogenicity to urinary system have been widely known. In 2003 and 2004, China prohibited the use of Aristolochiae Radix, Aristolochiae Manshuriensis Caulis and Aristolochiae Fangchi Radix, and required administering other AAs-containing medicines in accordance with the regulations for prescription drugs. In this paper, we retrieved literatures on the content determination of AAs in recent 10 years in China. It suggested that the AAs content is lower in Asarum herb, especially in its roots and rhizomes, and most of which do not show detectable amount of AA-I. Some of traditional Chinese medicines show fairly small amount of detectable AA-I. The AAs content in Aristolochia herb (including Fructus Aristolochiae, kaempfer dutchmanspipe root) is relatively high; however, there are fewer literatures for studying the content determination of AAs in Chinese patent medicines. There were many factors affecting AAs content, including the parts used, origins, processing methods, extraction process. It suggested that we should pay attention to the toxicity of Chinese medicines containing AAs and use these decoction pieces and traditional Chinese medicines cautiously. In addition, basic studies for the origins, processing methods and extraction process of Chinese patent medicines containing AAs, as well as supervision and detection of AAs content in traditional Chinese medicinal materials, decoction pieces and Chinese patent medicines shall be strengthened for reducing medication risk and guaranteeing clinical medication safety. Copyright© by the Chinese Pharmaceutical Association.

  18. Longitudinal study of experimental induction of AA amyloidosis in mice seeded with homologous and heterologous AA fibrils.

    Science.gov (United States)

    Muhammad, Naeem; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka

    2016-09-01

    To investigate pathogenesis and kinetics of experimentally induced murine AA amyloidosis seeded with homologous (murine) and heterologous (bovine) AA fibrils. Experimental AA amyloidosis was induced by administration of inflammatory stimulus and preformed AA fibrils to a total of 111 female C57/Black mice. In this longitudinal study, heterologous (bovine) as well as homologous (murine) AA fibrils were injected intraperitoneally to mice in various combinations. Re-stimulation was done at 120 or 300 days post first inoculation. To analyze the intensity of amyloid depositions in mice organs, immunohistochemical techniques and image J software were used. Assessment of cytokines level in sera was done using a Mouse Th1/Th2/Th17 Cytokine CBA Kit. Incidence and severity of AA amyloidosis were quite low in mice inoculated with heterologous bovine AA fibrils than homologous murine one. Homologous AA fibrils administration at first and second inoculation caused maximum amount of amyloid depositions and severe systemic form of amyloidosis. Increase in the level of pro-inflammatory cytokine IL-6 was observed after first inoculation, while second inoculation caused a further increase in the level of anti-inflammatory cytokine IL-10. AA amyloidosis can be induced by heterologous as well as homologous AA fibrils. Severity of AA amyloidosis induced with homologous AA fibrils is higher compared to heterologous AA fibrils.

  19. Nutritional status survey of aplastic anemia patients--a single center experience in China.

    Science.gov (United States)

    Li, Xinli; Feng, Yanyan; Wang, Hongyan; Song, Meijuan; Jin, Jingjing; Cui, Zhenzhu; Zheng, Yizhou

    2016-05-01

    To analyze the nutritional status of aplastic anemia (AA) patients. The nutrition-related anthropometric indicators and blood biochemical index of 622 newly-diagnosed AA patients were retrospectively analyzed. Of the cohort of AA patients, body mass index of non-severe AA (NSAA) patients were higher than those of severe AA (SAA) (phemoglobin was correlated with lower serum albumin protein concentration (peducation for patients. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. Refusal of hemodialysis by hospitalized chronic kidney disease patients in Pakistan.

    Science.gov (United States)

    Shafi, Salman Tahir; Saleem, Mohammad; Anjum, Roshina; Abdullah, Wajid; Shafi, Tahir

    2018-01-01

    In Pakistan, patients with chronic kidney disease (CKD) are commonly diagnosed at a late stage. There is little information about the refusal of hemodialysis by hospitalized CKD patients who need hemodialysis (HD) and reasons for acceptance and refusal among these patients. All patients with Stage V CKD who had medical indications to undergo HD and were hospitalized at a tertiary care facility over a six-month period were invited to participate in this study. Patients were surveyed regarding acceptance or refusing of HD and reasons for their decisions. Demographic, socioeconomic, and clinical characteristics of patients were compared between patients who accepted or refused HD. A total of 125 patients were included in the study. The mean age of the patients was 47.9 ±12.1 years. The mean duration of diagnosis of CKD was 2.5 ± 0.6 months. Of all patients, 72 (57.6%) agreed to do HD and 53 (42.4%) refused HD. Patients with arteriovenous fistula in place (27.1 vs. 9.1%, P 0.02) and those in the middle- or higher-income group (64.4% vs. 38.6%, p = 0.03) were more willing to undergo HD. Trust in doctor's advice (86.1%) was the most common reason for acceptance of HD. Frequency of HD per week (52.8%), lifelong and permanent nature of HD (50.9%), advice by family members or friends (37.7%), perception of poor quality of life on HD (35.8%), and fear of HD needles and complications during HD (33.9%) were the most common reasons for refusal. Refusal of HD is common among hospitalized CKD patients with medical indications to undergo HD, especially in lower income group.

  1. "Osiris"(HD209458b), an evaporating planet

    OpenAIRE

    Vidal-Madjar, Alfred; Etangs, Alain Lecavelier des

    2003-01-01

    Three transits of the planet orbiting the solar type star HD209458 were observed in the far UV at the wavelength of the HI Ly-alpha line. The planet size at this wavelength is equal to 4.3 R_Jup, i.e. larger than the planet Roche radius (3.6 R_Jup). Absorbing hydrogen atoms were found to be blueshifted by up to -130 km/s, exceeding the planet escape velocity. This implies that hydrogen atoms are escaping this ``hot Jupiter'' planet. An escape flux of >~ 10^10g/s is needed to explain the obser...

  2. HD 208905: um sistema múltiplo de estrelas quentes

    Science.gov (United States)

    Candeias, J. P.; Daflon, S.; Cunha, K.

    2003-08-01

    Durante o survey de associações OB do disco Galáctico, foi constatada a multiplicidade do sistema HD 208905, pertencentes à associação de Cep OB2. Este objeto está classificado como uma estrela pertencente a um sistema múltiplo, com magnitude mv = 7.0 e tipo espectral B1V. De fato, os espectros de HD 208905 apresentam perfis de absorção triplicados. Dois dos perfis são bastante similares entre si, e são estreitos e bem definidos, sugerindo que as velocidades rotacionais projetadas (v sin i) das duas estrelas são baixas. Os espectros obtidos também apresentam perfis mais alargados que poderiam ser atribuídos a uma terceira componente estelar com v sin i mais alto. A análise de HD 208905 é baseada no estudo da variação da posição relativa dos perfis espectrais de acordo com a fase do sistema. Nossos dados observacionais são um conjunto de espectros de alta resolução obtidos no McDonald Observatory (Universidade do Texas, Austin), Kitt Peak National Observatory e Palomar Observatory, cobrindo o período de 10/91 até 12/95. Inicialmente, calculamos a velocidade radial de cada componente do sistema, considerando o desvio Doppler sofrido por cada estrela. As velocidades radiais medidas foram, em seguida, corrigidas para velocidades radiais heliocêntricas. O passo seguinte constituiu na determinação da periodicidade da série temporal definida pelas medidas das velocidades radiais heliocêntricas através da análise de Fourier. A nossa base de dados não permitiu definir uma solução única para o sistema HD 208905. As possíveis soluções encontradas têm períodos entre 1 e 27 dias e serão apresentadas e discutidas.

  3. A SUBSTELLAR COMPANION TO THE DUSTY PLEIADES STAR HD 23514

    International Nuclear Information System (INIS)

    Rodriguez, David R.; Zuckerman, B.; Marois, Christian; Macintosh, Bruce; Melis, Carl

    2012-01-01

    With adaptive optics imaging at Keck observatory, we have discovered a substellar companion to the F6 Pleiades star HD 23514, one of the dustiest main-sequence stars known to date (L IR /L * ∼ 2%). This is one of the first brown dwarfs discovered as a companion to a star in the Pleiades. The 0.06 M ☉ late-M secondary has a projected separation of ∼360 AU. The scarcity of substellar companions to stellar primaries in the Pleiades combined with the extremely dusty environment make this a unique system to study.

  4. H-D exchange on natural aluminosilicates of orthosilicate group

    International Nuclear Information System (INIS)

    Markevich, S.V.; Kolesnikov, I.M.

    1982-01-01

    Experimental data are presented on the effect of aluminium ion coordination in the composition of polyhedrons on the capability of polyhedrons to change the reaction rate of H-D exchange (on the example of ethylene). It is shown that at temperature lower 400 deg C the rate of isotopic exchange reaction is low. Experimental results both for irradiated and non-irradiated minerals are presented. The conclusion is made that the increase of aluminosilicates activity under radiation is connected with the presence of (AlO 4 )-tetrahedrons in the system and change of their state. (AlO 5 ) and (AlO 6 )-polyhedrons are not activated with gamma rays

  5. Exocometary gas in the HD 181327 debris ring

    OpenAIRE

    Marino, S; Matrà, L; Stark, C; Wyatt, MC; Casassus, S; Kennedy, G; Rodriguez, D; Zuckerman, B; Perez, S; Dent, WRF; Kuchner, M; Hughes, AM; Schneider, G; Steele, A; Roberge, A

    2016-01-01

    An increasing number of observations have shown that gaseous debris discs are not an exception. However, until now, we only knew of cases around A stars. Here we present the first detection of 12CO (2-1) disc emission around an F star, HD 181327, obtained with the Atacama Large Millimeter/submillimeter Array (ALMA) observations at 1.3 mm. The continuum and CO emission are resolved into an axisymmetric disc with ring-like morphology. Using a Markov chain Monte Carlo method coupled with radiati...

  6. Profile of He I lambda5876 in the P-Cygni-type of star HD 152408

    International Nuclear Information System (INIS)

    Walborn, N.R.

    1975-01-01

    The blue-shifted absorption component of the P-Cygni profile at He I lambda 5876 in HD 152408 (O8: Iafpe) has been found to be extremely broad, extending -1000 km sec -1 from the emission maximum. This unusual profile is probably due to overpopulation of the lower level of lambda 5876, which permits it to form throughout a greater extent of the expanding atmosphere than most other lines. This observation confirms Hutchings' identification of very large velocities in the blue-violet spectrum of HD 152408, and in particular his interpretation of a similar feature at He I lambda 3889, which is metastable. The lambda 5876 profile in HD 152408 is compared to those in the similar but less extreme P-Cygni star HD 151804 (O8 Iaf), and in the Wolf-Rayet star HD 151932 (WN7-A). The similarity between the absorption components in HD 152408 and the WN star is striking

  7. Absorption spectra of AA-stacked graphite

    International Nuclear Information System (INIS)

    Chiu, C W; Lee, S H; Chen, S C; Lin, M F; Shyu, F L

    2010-01-01

    AA-stacked graphite shows strong anisotropy in geometric structures and velocity matrix elements. However, the absorption spectra are isotropic for the polarization vector on the graphene plane. The spectra exhibit one prominent plateau at middle energy and one shoulder structure at lower energy. These structures directly reflect the unique geometric and band structures and provide sufficient information for experimental fitting of the intralayer and interlayer atomic interactions. On the other hand, monolayer graphene shows a sharp absorption peak but no shoulder structure; AA-stacked bilayer graphene has two absorption peaks at middle energy and abruptly vanishes at lower energy. Furthermore, the isotropic features are expected to exist in other graphene-related systems. The calculated results and the predicted atomic interactions could be verified by optical measurements.

  8. Neural processing of emotions in traumatized children treated with Eye Movement Desensitization and Reprocessing therapy: A hdEEG study

    Directory of Open Access Journals (Sweden)

    Cristina eTrentini

    2015-11-01

    Full Text Available Eye Movement Desensitization and Reprocessing (EMDR therapy has been proven efficacious in restoring affective regulation in Post–Traumatic Stress Disorder (PTSD patients. However, its effectiveness on emotion processing in children with complex trauma has yet to be explored. High density Electroencephalography (hdEEG was used to investigate the effects of EMDR on brain responses to adults’ emotions on children with histories of early maltreatment. Ten school–aged children were examined before (T0 and within one month after the conclusion of EMDR (T1. hdEEGs were recorded while children passively viewed angry, afraid, happy, and neutral faces. Clinical scales were administered at the same time. Correlation analyses were performed to detect brain regions whose activity was linked to children’s traumatic symptom–related and emotional–adaptive problem scores. In all four conditions, hdEEG showed similar significantly higher activity on the right medial prefrontal and fronto–temporal limbic regions at T0, shifting towards the left medial and superior temporal regions at T1. Moreover, significant correlations were found between clinical scales and the same regions whose activity significantly differed between pre– and post–treatment. These preliminary results demonstrate that, after EMDR, children suffering from complex trauma show increased activity in areas implicated in high–order cognitive processing when passively viewing pictures of emotional expressions. These changes are associated with the decrease of depressive and traumatic symptoms, and with the improvement of emotional–adaptive functioning over time.

  9. Neural processing of emotions in traumatized children treated with Eye Movement Desensitization and Reprocessing therapy: a hdEEG study

    Science.gov (United States)

    Trentini, Cristina; Pagani, Marco; Fania, Piercarlo; Speranza, Anna Maria; Nicolais, Giampaolo; Sibilia, Alessandra; Inguscio, Lucio; Verardo, Anna Rita; Fernandez, Isabel; Ammaniti, Massimo

    2015-01-01

    Eye Movement Desensitization and Reprocessing (EMDR) therapy has been proven efficacious in restoring affective regulation in post-traumatic stress disorder (PTSD) patients. However, its effectiveness on emotion processing in children with complex trauma has yet to be explored. High density electroencephalography (hdEEG) was used to investigate the effects of EMDR on brain responses to adults’ emotions on children with histories of early maltreatment. Ten school-aged children were examined before (T0) and within one month after the conclusion of EMDR (T1). hdEEGs were recorded while children passively viewed angry, afraid, happy, and neutral faces. Clinical scales were administered at the same time. Correlation analyses were performed to detect brain regions whose activity was linked to children’s traumatic symptom-related and emotional-adaptive problem scores. In all four conditions, hdEEG showed similar significantly higher activity on the right medial prefrontal and fronto-temporal limbic regions at T0, shifting toward the left medial and superior temporal regions at T1. Moreover, significant correlations were found between clinical scales and the same regions whose activity significantly differed between pre- and post-treatment. These preliminary results demonstrate that, after EMDR, children suffering from complex trauma show increased activity in areas implicated in high-order cognitive processing when passively viewing pictures of emotional expressions. These changes are associated with the decrease of depressive and traumatic symptoms, and with the improvement of emotional-adaptive functioning over time. PMID:26594183

  10. AA, inner conductor of a magnetic horn

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    At the start-up of the AA and during its initial operation, magnetic horns focused the antiprotons emanating from the production target. These "current-sheet lenses" had a thin inner conductor (for minimum absorption of antiprotons), machined from aluminium to wall thicknesses of 0.7 or 1 mm. The half-sine pulses rose to 150 kA in 8 microsec. The angular acceptance was 50 mrad.

  11. First circulating beam in the AA

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.5 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are to numerous to name them all. Heribert Koziol, apparently asleep, is answering the call from an impatient director. See also 8007094.

  12. AA, assembly of wide bending magnet

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.

  13. AAS Publishing News: Astronomical Software Citation Workshop

    Science.gov (United States)

    Kohler, Susanna

    2015-07-01

    Do you write code for your research? Use astronomical software? Do you wish there were a better way of citing, sharing, archiving, or discovering software for astronomy research? You're not alone! In April 2015, AAS's publishing team joined other leaders in the astronomical software community in a meeting funded by the Sloan Foundation, with the purpose of discussing these issues and potential solutions. In attendance were representatives from academic astronomy, publishing, libraries, for-profit software sharing platforms, telescope facilities, and grantmaking institutions. The goal of the group was to establish “protocols, policies, and platforms for astronomical software citation, sharing, and archiving,” in the hopes of encouraging a set of normalized standards across the field. The AAS is now collaborating with leaders at GitHub to write grant proposals for a project to develop strategies for software discoverability and citation, in astronomy and beyond. If this topic interests you, you can find more details in this document released by the group after the meeting: http://astronomy-software-index.github.io/2015-workshop/ The group hopes to move this project forward with input and support from the broader community. Please share the above document, discuss it on social media using the hashtag #astroware (so that your conversations can be found!), or send private comments to julie.steffen@aas.org.

  14. Churg-Strauss syndrome associated with AA amyloidosis: a case report.

    Science.gov (United States)

    Maamar, Mouna; Tazi-Mezalek, Zoubida; Harmouche, Hicham; El Hamany, Zitouna; Adnaoui, Mohammed; Aouni, Mohammed

    2012-01-01

    Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/µL), positive p-ANCA, microscopic haematuria and proteinuria at 2g/day. A diagnosis of Churg-Strauss syndrome was established based on five criteria of the American College of Rheumatology (ACR). Renal biopsy showed an important type AA amyloid deposit. The patient was treated with steroids with a good response of the vasculitis and amyloidosis with disappearance of the proteinuria.

  15. Game-based combined cognitive and neurofeedback training using Focus Pocus reduces symptom severity in children with diagnosed AD/HD and subclinical AD/HD.

    Science.gov (United States)

    Johnstone, Stuart J; Roodenrys, Steven J; Johnson, Kirsten; Bonfield, Rebecca; Bennett, Susan J

    2017-06-01

    Previous studies report reductions in symptom severity after combined working memory (WM) and inhibitory control (IC) training in children with AD/HD. Based on theoretical accounts of the role of arousal/attention modulation problems in AD/HD, the current study examined the efficacy of combined WM, IC, and neurofeedback training in children with AD/HD and subclinical AD/HD. Using a randomized waitlist control design, 85 children were randomly allocated to a training or waitlist condition and completed pre- and post-training assessments of overt behavior, trained and untrained cognitive task performance, and resting and task-related EEG activity. The training group completed twenty-five sessions of training using Focus Pocus software at home over a 7 to 8-week period. Trainees improved at the trained tasks, while enjoyment and engagement declined across sessions. After training, AD/HD symptom severity was reduced in the AD/HD and subclinical groups according to parents, and in the former group only according to blinded teachers and significant-others. There were minor improvements in two of six near-transfer tasks, and evidence of far-transfer of training effects in four of five far-transfer tasks. Frontal region changes indicated normalization of atypical EEG features with reduced delta and increased alpha activity. It is concluded that technology developments provide an interesting a vehicle for delivering interventions and that, while further research is needed, combined WM, IC, and neurofeedback training can reduce AD/HD symptom severity in children with AD/HD and may also be beneficial to children with subclinical AD/HD. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. The Transiting Exocomets in the HD 172555 System

    Science.gov (United States)

    Grady, C. A.; Brown, A.; Kamp, I.; Roberge, A.; Riviere-Marichalar, P.; Welsh, B.

    2017-01-01

    The Earth is thought to have formed dry, in a part of the Solar Nebula deficient in organic material, and to have acquired its organics and water through bombardment by minor bodies. Observations of this process in well-dated systems can provide insight into the probable origin and composition of the bombarding parent bodies. Transiting cometary activity has previously been reported in Ca II for the late-A member of the 241 Myr old Pictoris Moving Group member, HD 172555(Kiefer et al. 2014). We present HST STIS and COS spectra of HD 172555 demonstrating that the star has chromospheric emission and variable in falling gas features in transitions of silicon and carbon ions at times when no Fe II absorption is seen in the UV data, and no Ca II absorption is seen in contemporary optical spectra. The lack of CO absorption and stable gas absorption at the system velocity is consistent with the absence of a cold Kuiper belt analog (Riviere-Marichalar et al. 2012) in this system. The presence of infall in some species at one epoch and others at different epochs suggests that, like Pictoris, there may be more than one family of exocomets. If perturbed into star-grazing orbits by the same mechanism as for Pic, these data suggest that the wide planet frequency among A-early F stars in the PMG is at least 37.5, well above the frequency estimated for young moving groups independent of host star spectral type.

  17. Cutaneous Uptake of 14C-HD Vapor by the Hairless Guinea Pig.

    Science.gov (United States)

    1996-10-01

    guinea pig (HGP) is used by our laboratory to model the human cutaneous response to sulfur mustard (HD) exposure. We have determined the HD content in the skin of HOP after 7-minute exposures to vapors saturated with a mixture of HD and 14C-HD. Concentration/time (C1) values in the range of 2 mg/sq cm/min were determined by counting skin 14C disintegrations per minute (dpm) in animals euthanized immediately after exposure. These values are similar to human penetration rates obtained by other investigators. A direct relationship between C1 and relative humidity was

  18. Structure and function of homodomain-leucine zipper (HD-Zip) proteins.

    Science.gov (United States)

    Elhiti, Mohamed; Stasolla, Claudio

    2009-02-01

    Homeodomain-leucine zipper (HD-Zip) proteins are transcription factors unique to plants and are encoded by more than 25 genes in Arabidopsis thaliana. Based on sequence analyses these proteins have been classified into four distinct groups: HD-Zip I-IV. HD-Zip proteins are characterized by the presence of two functional domains; a homeodomain (HD) responsible for DNA binding and a leucine zipper domain (Zip) located immediately C-terminal to the homeodomain and involved in protein-protein interaction. Despite sequence similarities HD-ZIP proteins participate in a variety of processes during plant growth and development. HD-Zip I proteins are generally involved in responses related to abiotic stress, abscisic acid (ABA), blue light, de-etiolation and embryogenesis. HD-Zip II proteins participate in light response, shade avoidance and auxin signalling. Members of the third group (HD-Zip III) control embryogenesis, leaf polarity, lateral organ initiation and meristem function. HD-Zip IV proteins play significant roles during anthocyanin accumulation, differentiation of epidermal cells, trichome formation and root development.

  19. Listeria monocytogenes infection of HD11, chicken macrophage-like cells.

    Science.gov (United States)

    Jarvis, N A; Donaldson, J R; O'Bryan, C A; Ricke, S C; Crandall, P G

    2017-04-01

    Listeria monocytogenes can be carried by and infect poultry, although the clinical disease in birds is rare. Escape from macrophage phagocytosis is a key step in pathogenesis for L. monocytogenes. Therefore, we investigated the infection of the chicken macrophage-like cell line HD11 with 2 strains of L. monocytogenes EGD-e and Scott A. After infection, L. monocytogenes was quantified by spread plating and HD11 was quantified with trypan blue exclusion stain before enumeration. The standard macrophage killing protocols require washing the cell monolayers 3 times with PBS, which was found to negatively influence HD11 monolayers. Maximum bacterial densities within macrophages were not different between the 2 Listeria strains. HD11 required more than 11 h to effectively reduce intracellular L. monocytogenes Scott A, and Scott A was more susceptible to HD11 killing than EGD-e. It appears that Listeria infection initially causes attenuation of HD11 growth, and infected HD11 cells do not begin to lyse until at least 11 h post infection. These results suggest that there are subtle strain to strain differences in response to HD11 macrophage phagocytosis. The long lead-time required for HD11 to kill L. monocytogenes cells means that there is sufficient time available for chicken macrophages to circulate in the blood and transfer the intracellular Listeria to multiple tissues. © 2016 Poultry Science Association Inc.

  20. 40 CFR Appendix A to Subpart Aa of... - Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA

    Science.gov (United States)

    2010-07-01

    ... (40 CFR Part 63, Subpart A) to Subpart AA A Appendix A to Subpart AA of Part 63 Protection of... Hazardous Air Pollutants From Phosphoric Acid Manufacturing Plants Pt. 63, Subpt. AA, App. A Appendix A to Subpart AA of Part 63—Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA 40 CFR...

  1. SU-E-I-22: A Comprehensive Investigation of Noise Variations Between the GE Discovery CT750 HD and GE LightSpeed VCT

    International Nuclear Information System (INIS)

    Bache, S; Loyer, E; Stauduhar, P; Liu, X; Rong, J

    2015-01-01

    Purpose: To quantify and compare the noise properties between two GE CT models-the Discovery CT750 HD (aka HD750) and LightSpeed VCT, with the overall goal of assessing the impact in clinical diagnostic practice. Methods: Daily QC data from a fleet of 9 CT scanners currently in clinical use were investigated – 5 HD750 and 4 VCT (over 600 total acquisitions for each scanner). A standard GE QC phantom was scanned daily using two sets of scan parameters with each scanner over 1 year. Water CT number and standard deviation were recorded from the image of water section of the QC phantom. The standard GE QC scan parameters (Pitch = 0.516, 120kVp, 0.4s, 335mA, Small Body SFOV, 5mm thickness) and an in-house developed protocol (Axial, 120kVp, 1.0s, 240mA, Head SFOV, 5mm thickness) were used, with Standard reconstruction algorithm. Noise was measured as the standard deviation in the center of the water phantom image. Inter-model noise distributions and tube output in mR/mAs were compared to assess any relative differences in noise properties. Results: With the in-house protocols, average noise for the five HD750 scanners was ∼9% higher than the VCT scanners (5.8 vs 5.3). For the GE QC protocol, average noise with the HD750 scanners was ∼11% higher than with the VCT scanners (4.8 vs 4.3). This discrepancy in noise between the two models was found despite the tube output in mR/mAs being comparable with the HD750 scanners only having ∼4% lower output (8.0 vs 8.3 mR/mAs). Conclusion: Using identical scan protocols, average noise in images from the HD750 group was higher than that from the VCT group. This confirms feedback from an institutional radiologist’s feedback regarding grainier patient images from HD750 scanners. Further investigation is warranted to assess the noise texture and distribution, as well as clinical impact

  2. SUBSTELLAR-MASS COMPANIONS TO THE K-GIANTS HD 240237, BD +48 738, AND HD 96127

    International Nuclear Information System (INIS)

    Gettel, S.; Wolszczan, A.; Niedzielski, A.; Nowak, G.; Adamów, M.; Zieliński, P.; Maciejewski, G.

    2012-01-01

    We present the discovery of substellar-mass companions to three giant stars by the ongoing Penn State-Toruń Planet Search conducted with the 9.2 m Hobby-Eberly Telescope. The most massive of the three stars, K2-giant HD 240237, has a 5.3 M J minimum mass companion orbiting the star at a 746 day period. The K0-giant BD +48 738 is orbited by a ≥0.91 M J planet which has a period of 393 days and shows a nonlinear, long-term radial velocity (RV) trend that indicates a presence of another, more distant companion, which may have a substellar mass or be a low-mass star. The K2-giant HD 96127 has a ≥4.0 M J mass companion in a 647 day orbit around the star. The two K2-giants exhibit a significant RV noise that complicates the detection of low-amplitude, periodic variations in the data. If the noise component of the observed RV variations is due to solar-type oscillations, we show, using all the published data for the substellar companions to giants, that its amplitude is anti-correlated with stellar metallicity.

  3. Comorbid externalising behaviour in AD/HD: evidence for a distinct pathological entity in adolescence.

    Directory of Open Access Journals (Sweden)

    Sharnel Perera

    Full Text Available While the profiling of subtypes of Attention Deficit Hyperactivity Disorder (AD/HD have been the subject of considerable scrutiny, both psychometrically and psychophysiologically, little attention has been paid to the effect of diagnoses comorbid with AD/HD on such profiles. This is despite the greater than 80% prevalence of comorbidity under the DSM-IV-TR diagnostic definitions. Here we investigate the event related potential (ERP and psychometric profiles of Controls, AD/HD, and comorbid AD/HD (particularly AD/HD+ODD/CD groups on six neurocognitive tasks thought to probe the constructs of selective and sustained attention, response inhibition and executive function. Data from 29 parameters extracted from a child group (age range 6 to 12; 52 Controls and 64 AD/HD and from an adolescent group (age range 13 to 17; 79 Controls and 88 AD/HD were reduced via a Principal Components Analysis, the 6 significant eigenvectors then used as determinants of cluster membership via a Two-Step Cluster Analysis. Two clusters were found in the analysis of the adolescent age group--a cluster dominated by Control and AD/HD participants without comorbidity, while the second cluster was dominated by AD/HD participants with externalising comorbidity (largely oppositional defiant/conduct disorder ODD/CD. A similar segregation within the child age group was not found. Further analysis of these objectively determined clusters in terms of their clinical diagnoses indicates a significant effect of ODD/CD comorbidity on a concurrent AD/HD diagnosis. We conclude that comorbid externalising behaviour in AD/HD constitutes a distinct pathological entity in adolescence.

  4. Feasibility of Incremental 2-Times Weekly Hemodialysis in Incident Patients With Residual Kidney Function

    Directory of Open Access Journals (Sweden)

    Andrew I. Chin

    2017-09-01

    Discussion: More than 50% of incident HD patients with RKF have adequate kidney urea clearance to be considered for 2-times weekly HD. When additionally ultrafiltration volume and blood pressure stability are taken into account, more than one-fourth of the total cohort could optimally start HD in an incremental fashion.

  5. A modern study of HD 166734: a massive supergiant system

    Science.gov (United States)

    Mahy, L.; Damerdji, Y.; Gosset, E.; Nitschelm, C.; Eenens, P.; Sana, H.; Klotz, A.

    2017-11-01

    Aims: HD 166734 is an eccentric eclipsing binary system composed of two supergiant O-type stars, orbiting with a 34.5-day period. In this rare configuration for such stars, the two objects mainly evolve independently, following single-star evolution so far. This system provides a chance to study the individual parameters of two supergiant massive stars and to derive their real masses. Methods: An intensive monitoring was dedicated to HD 166734. We analyzed mid- and high-resolution optical spectra to constrain the orbital parameters of this system. We also studied its light curve for the first time, obtained in the VRI filters. Finally, we disentangled the spectra of the two stars and modeled them with the CMFGEN atmosphere code in order to determine the individual physical parameters. Results: HD 166734 is a O7.5If+O9I(f) binary. We confirm its orbital period but we revise the other orbital parameters. In comparison to what we found in the literature, the system is more eccentric and, now, the hottest and the most luminous component is also the most massive one. The light curve exhibits only one eclipse and its analysis indicates an inclination of 63.0° ± 2.7°. The photometric analysis provides us with a good estimation of the luminosities of the stars, and therefore their exact positions in the Hertzsprung-Russell diagram. The evolutionary and the spectroscopic masses show good agreement with the dynamical masses of 39.5 M⊙ for the primary and 33.5 M⊙ for the secondary, within the uncertainties. The two components are both enriched in helium and in nitrogen and depleted in carbon. In addition, the primary also shows a depletion in oxygen. Their surface abundances are however not different from those derived from single supergiant stars, yielding, for both components, an evolution similar to that of single stars. Based on observations collected at the European Southern Observatory (La Silla, Chile) with FEROS and TAROT and on data collected at the San Pedro

  6. Ascorbic acid (AA) metabolism in protection against radiation damage

    International Nuclear Information System (INIS)

    Rose, R.C.; Koch, M.J.

    1986-01-01

    The possibility is considered that AA protects tissues against radiation damage by scavenging free radicals that result from radiolysis of water. A physiologic buffer (pH 6.7) was incubated with 14 C-AA and 1 mM thiourea (to slow spontaneous oxidation of AA). Aliquots were assayed by HPLC and scintillation spectrometry to identify the 14 C-label. Samples exposed to Cobalt-60 radiation had a half time of AA decay of 30 minutes) indicating that AA scavenges radiation-induced free radicals and forms the ascorbate free radical (AFR). Pairs of 14 C-AFR disproportionate, with the net effect of 14 C-dehydroascorbic acid formation from 14 C-AA. Having established that AFR result from ionizing radiation in an aqueous solution, the possibility was evaluated that a tissue factor reduces AFR. Cortical tissue from the kidneys of male rats was minced, homogenized in buffer and centrifuged at 8000 xg. The supernatant was found to slow the rate of radiation-induced AA degradation by > 90% when incubated at 23 0 C in the presence of 15 μM 14 C-AA. Samples of supernatant maintained at 100 0 C for 10 minutes or precipitated with 5% PCA did not prevent radiation-induced AA degradation. AA may have a specific role in scavenging free radicals generated by ionizing radiation and thereby protect body tissues

  7. Perceived Quality of Full HD Video - Subjective Quality Assessment

    Directory of Open Access Journals (Sweden)

    Juraj Bienik

    2016-01-01

    Full Text Available In recent years, an interest in multimedia services has become a global trend and this trend is still rising. The video quality is a very significant part from the bundle of multimedia services, which leads to a requirement for quality assessment in the video domain. Video quality of a streamed video across IP networks is generally influenced by two factors “transmission link imperfection and efficiency of compression standards. This paper deals with subjective video quality assessment and the impact of the compression standards H.264, H.265 and VP9 on perceived video quality of these compression standards. The evaluation is done for four full HD sequences, the difference of scenes is in the content“ distinction is based on Spatial (SI and Temporal (TI Index of test sequences. Finally, experimental results follow up to 30% bitrate reducing of H.265 and VP9 compared with the reference H.264.

  8. Magnetic field evidence for the supergiant ν Cep (HD 207260)

    International Nuclear Information System (INIS)

    Scholz, G.; Gerth, E.

    1981-01-01

    On the basis of 55 Zeeman spectrograms the effective magnetic fields and the radial velocities of the supergiant ν Cep (HD 207260) were determined. For the effective magnetic field a slow variation occurring on a time-scale of years was found. The spectrograms taken at the first epoch show only moderate effective magnetic field strengths of a few hundred Gauss but in 1978 values of + 2000 G were detected. The measured radial velocities show a long-term variability similar to that of the magnetic field as well as more rapid changes of approximately equal to 39.9 day. Not only the Balmer absorption lines Hβ, Hγ, and Hdelta but also the various elements and ions have different radial velocities. (author)

  9. On the inclination and habitability of the HD 10180 system

    Energy Technology Data Exchange (ETDEWEB)

    Kane, Stephen R. [Department of Physics and Astronomy, San Francisco State University, 1600 Holloway Avenue, San Francisco, CA 94132 (United States); Gelino, Dawn M., E-mail: skane@sfsu.edu [NASA Exoplanet Science Institute, Caltech, MS 100-22, 770 South Wilson Avenue, Pasadena, CA 91125 (United States)

    2014-09-10

    There are numerous multi-planet systems that have now been detected via a variety of techniques. These systems exhibit a range of both planetary properties and orbital configurations. For those systems without detected planetary transits, a significant unknown factor is the orbital inclination. This produces an uncertainty in the mass of the planets and their related properties, such as atmospheric scale height. Here we investigate the HD 10180 system, which was discovered using the radial velocity technique. We provide a new orbital solution for the system which allows for eccentric orbits for all planets. We show how the inclination of the system affects the mass/radius properties of the planets and how the detection of phase signatures may resolve the inclination ambiguity. We finally evaluate the Habitable Zone properties of the system and show that the g planet spends 100% of an eccentric orbit within the Habitable Zone.

  10. Estudio multifrecuencia del medio interestelar cercano a HD 192281

    Science.gov (United States)

    Arnal, E. M.; Cappa, C.; Cichowolski, S.; Pineault, S.; St-Louis, N.

    Una de las causas que modifica la estructura y dinámica del medio interestelar es la acción que los vientos de las estrellas de gran masa ejercen sobre el mismo. En este trabajo, mediante el uso de datos interferométricos obtenidos en la banda de radio en la transición de 21-cm del Hidrógeno neutro y de imágenes de la emisión de continuo en las bandas de 408 y 1420 MHz, de imágenes HIRES del satélite IRAS en 60 y 100 micrones, y de observaciones de continuo obtenidas con radiotelescopios de disco simple en 2695, 4850 y 8350 MHz se ha realizado un estudio multifrecuencia de los efectos que los vientos estelares de HD 192281, una estrella de tipo espectral O5 Vn((f))p, han tenido sobre el medio interestelar que rodea a la misma.

  11. Polarizability tensor invariants of H2, HD, and D2

    Science.gov (United States)

    Raj, Ankit; Hamaguchi, Hiro-o.; Witek, Henryk A.

    2018-03-01

    We report an exhaustive compilation of wavelength-dependent matrix elements over the mean polarizability (α ¯ ) and polarizability anisotropy (γ) operators for the rovibrational states of the H2, HD, and D2 molecules together with an accompanying computer program for their evaluation. The matrix elements can be readily evaluated using the provided codes for rovibrational states with J = 0-15 and v = 0-4 and for any laser wavelengths in the interval 182.25-1320.6 nm corresponding to popular, commercially available lasers. The presented results substantially extend the scope of the data available in the literature, both in respect of the rovibrational transitions analyzed and the range of covered laser frequencies. The presented detailed tabulation of accurate polarizability tensor invariants is essential for successful realization of our main long-term goal: developing a universal standard for determining absolute Raman cross sections and absolute Raman intensities in experimental Rayleigh and Raman scattering studies of molecules.

  12. OBSERVATIONS OF ENHANCED RADIATIVE GRAIN ALIGNMENT NEAR HD 97300

    International Nuclear Information System (INIS)

    Andersson, B-G; Potter, S. B.

    2010-01-01

    We have obtained optical multi-band polarimetry toward sightlines through the Chamaeleon I cloud, particularly in the vicinity of the young B9/A0 star HD 97300. We show, in agreement with earlier studies, that the radiation field impinging on the cloud in the projected vicinity of the star is dominated by the flux from the star, as evidenced by a local enhancement in the grain heating. By comparing the differential grain heating with the differential change in the location of the peak of the polarization curve, we show that the grain alignment is enhanced by the increase in the radiation field. We also find a weak, but measurable, variation in the grain alignment with the relative angle between the radiation field anisotropy and the magnetic field direction. Such an anisotropy in the grain alignment is consistent with a unique prediction of modern radiative alignment torque theory and provides direct support for radiatively driven grain alignment.

  13. AA, Inner Conductor of Magnetic Horn

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    Antiprotons emerging at large angles from the production target (hit by an intense 26 GeV proton beam from the PS), were focused into the acceptance of the injection line of the AA by means of a "magnetic horn" (current-sheet lens). Here we see an early protype of the horn's inner conductor, machined from solid aluminium to a thickness of less than 1 mm. The 1st version had to withstand pulses of 150 kA, 15 us long, every 2.4 s. See 8801040 for a later version.

  14. Testing stellar evolution models with the retired A star HD 185351

    DEFF Research Database (Denmark)

    Hjørringgaard, J. G.; Silva Aguirre, V.; White, T. R.

    2017-01-01

    The physical parameters of the retired A star HD 185351 were analysed in great detail by Johnson et al. using interferometry, spectroscopy, and asteroseismology. Results from all independent methods are consistent with HD 185351 having a mass in excess of 1.5 M⊙. However, the study also showed th...

  15. The Stroop Revisited: A Meta-Analysis of Interference Control in AD/HD

    Science.gov (United States)

    Van Mourik, Rosa; Oosterlaan, Jaap; Sergeant, Joseph A.

    2005-01-01

    Background: An inhibition deficit, including poor interference control, has been implicated as one of the core deficits in AD/HD. Interference control is clinically measured by the Stroop Colour-Word Task. The aim of this meta-analysis was to investigate the strength of an interference deficit in AD/HD as measured by the Stroop Colour-Word Task…

  16. 75 FR 24786 - List of Approved Spent Fuel Storage Casks: NUHOMS® HD System Revision 1

    Science.gov (United States)

    2010-05-06

    ... Fuel Storage Casks: NUHOMS[supreg] HD System Revision 1 AGENCY: Nuclear Regulatory Commission. ACTION... storage regulations by revising the Transnuclear, Inc. (TN) NUHOMS[supreg] HD System listing within the... System cask design within the list of approved spent fuel storage casks that power reactor licensees can...

  17. 75 FR 25120 - List of Approved Spent Fuel Storage Casks: NUHOMS® HD System Revision 1

    Science.gov (United States)

    2010-05-07

    ...] RIN 3150-AI75 List of Approved Spent Fuel Storage Casks: NUHOMS[supreg] HD System Revision 1 AGENCY...), NUHOMS[supreg] HD System listing within the ``List of Approved Spent Fuel Storage Casks'' to include... Modular Storage System for Irradiated Nuclear Fuel. Docket Number: 72-1030. Certificate Expiration Date...

  18. 75 FR 27463 - List of Approved Spent Fuel Storage Casks: NUHOMS® HD System Revision 1; Correction

    Science.gov (United States)

    2010-05-17

    ... Fuel Storage Casks: NUHOMS[supreg] HD System Revision 1; Correction AGENCY: Nuclear Regulatory... fuel storage casks to add revision 1 to the NUHOMS HD spent fuel storage cask system. This action is... Federal Register on May 7, 2010 (75 FR 25120), that proposes to amend the regulations that govern storage...

  19. 75 FR 27401 - List of Approved Spent Fuel Storage Casks: NUHOMS® HD System Revision 1; Correction

    Science.gov (United States)

    2010-05-17

    ... Storage Casks: NUHOMS[reg] HD System Revision 1; Correction AGENCY: Nuclear Regulatory Commission. ACTION... HD spent fuel storage cask system. This action is necessary to correctly specify the effective date... on May 6, 2010 (75 FR 24786), that amends the regulations that govern storage of spent nuclear fuel...

  20. 76 FR 2277 - List of Approved Spent Fuel Storage Casks: NUHOMS® HD System Revision 1

    Science.gov (United States)

    2011-01-13

    ... Fuel Storage Casks: NUHOMS[supreg] HD System Revision 1 AGENCY: Nuclear Regulatory Commission. ACTION... System listing within the ``List of Approved Spent Fuel Storage Casks'' to include Amendment No. 1 to... the NUHOMS[supreg] HD Horizontal Modular Storage System for Irradiated Nuclear Fuel. [[Page 2279...

  1. AD/HD Symptoms and Conduct Problems: Similarities and Differences in Maternal Perceptions

    Science.gov (United States)

    Maniadaki, Katerina; Sonuga-Barke, Edmund; Kakouros, Efthymios; Karaba, Rania

    2006-01-01

    Several theories attempt to explain the high co-occurrence of Attention Deficit/ Hyperactivity Disorder (AD/HD) and Conduct Problems (CP). A strong possibility is that AD/HD behaviours lead to the development of CP, due to family coercive interaction patterns, maintained through parental false beliefs regarding child problem behaviour. We compared…

  2. The Schooling Experience of Adolescent Boys with AD/HD: An Australian Case Study

    Science.gov (United States)

    Gibbs, Kathryn; Mercer, K. Louise; Carrington, Suzanne

    2016-01-01

    This study explored the experience of schooling of six adolescent boys diagnosed with AD/HD from the perspectives of the boys, their mothers and their teachers. The study utilised social constructionism as the theoretical orientation and the Dynamic Developmental Theory (DDT) of AD/HD as the explanatory framework. Utilising a multiple,…

  3. Observation of the v′=8←v=0 vibrational overtone in cold trapped HD +

    NARCIS (Netherlands)

    J.C.J. Koelemeij; D.W.E. Noom; D. de Jong; M.A. Haddad; W. Ubachs

    2011-01-01

    textabstractWe report the observation of the hitherto undetected v′=8←v=0 vibrational overtone in trapped HD+molecular ions, sympathetically cooled by laser-cooled Be+ions. The overtone is excited using 782 nm laser radiation, after which HD+ions in v=8 are photodissociated by the 313 nm laser used

  4. HD 12098 and Other Results from Nainital–Cape Survey V. Girish

    Indian Academy of Sciences (India)

    Strömgren colours (δm1) of HD 12098, the first roAp star discovered under the ... 2, we can see an unresolved frequency very close to the alias peak (marked ... Figure 3. Lightcurve of HD 25499 observed on the night of 10th November 2003.

  5. HD 101065, the Most Peculiar Star: First Results from Precise Radial ...

    Indian Academy of Sciences (India)

    Abstract. In this paper we discuss the prospects for asteroseismology with spatial resolution and motivate studies of the most chemically peculiar. roAp star HD 101065. We present the first results from a high-precision radial velocity (RV) study of HD 101065 based on data spanning four nights that were acquired using the ...

  6. HDAC4-Myogenin Axis As an Important Marker of HD-Related Skeletal Muscle Atrophy

    Science.gov (United States)

    Smeets, Cleo J. L. M.; Franklin, Sophie A.; Bondulich, Marie K.; Jolinon, Nelly; Muller, Thomas; Ahmed, Mhoriam; Dick, James R. T.; Piotrowska, Izabela; Greensmith, Linda; Smolenski, Ryszard T.; Bates, Gillian P.

    2015-01-01

    Skeletal muscle remodelling and contractile dysfunction occur through both acute and chronic disease processes. These include the accumulation of insoluble aggregates of misfolded amyloid proteins that is a pathological feature of Huntington’s disease (HD). While HD has been described primarily as a neurological disease, HD patients’ exhibit pronounced skeletal muscle atrophy. Given that huntingtin is a ubiquitously expressed protein, skeletal muscle fibres may be at risk of a cell autonomous HD-related dysfunction. However the mechanism leading to skeletal muscle abnormalities in the clinical and pre-clinical HD settings remains unknown. To unravel this mechanism, we employed the R6/2 transgenic and HdhQ150 knock-in mouse models of HD. We found that symptomatic animals developed a progressive impairment of the contractile characteristics of the hind limb muscles tibialis anterior (TA) and extensor digitorum longus (EDL), accompanied by a significant loss of motor units in the EDL. In symptomatic animals, these pronounced functional changes were accompanied by an aberrant deregulation of contractile protein transcripts and their up-stream transcriptional regulators. In addition, HD mouse models develop a significant reduction in muscle force, possibly as a result of a deterioration in energy metabolism and decreased oxidation that is accompanied by the re-expression of the HDAC4-DACH2-myogenin axis. These results show that muscle dysfunction is a key pathological feature of HD. PMID:25748626

  7. The Reality of Living with AD/HD: Children's Concern about Educational and Medical Support

    Science.gov (United States)

    Hughes, Lesley

    2007-01-01

    A diagnosis of AD/HD may tell us that the child has the core characteristics of inattentiveness, impulsivity and or hyperactivity, but it fails to convey the extent to which the social context of the child's environment manipulates these characteristics. This article reports on how children with a diagnosis of AD/HD view the impact their social…

  8. Fusion with highly spin polarized HD and D2

    International Nuclear Information System (INIS)

    Honig, A.; Letzring, S.; Skupsky, S.

    1993-01-01

    Our experimental efforts over the past 5 years have been aimed at cazrying out ICF shots with spin-polarized 0 fuel. We successfully prepared polarized 0 in HD, and solved the problems of loading target shells with our carefully prepared isotopic -rnixt.l.l?-es, polarizing them so that the 0 polarization remains metastably frozen-in for about half a day, and carrying out the various cold transfer requirements at Syracuse, where the target is prepared, and at Rochester, where the cold target is inserted fusion chamber. Upon shooting the accurately positioned unpolarized high density cold target, no neutron yield was observed. Inspection inside the OMEGA tank after the shot indicated the absence of neutron yield was dus to mal-timing or insufficient retraction rate of OMEGA'S fast shroud mechanism, resulting in interception of at least 20 of the 24 laser beams by the faulty shroud. In spits of this, all alements of the complex experiment we originally undertook have been successfully demonstrated, and the cold retrieval concepts and methods we developed are being utilized on the ICF upgrades at Rochester and at Livermore. In addition to the solution of the interface problems, we obtained novel results on polymer shell characteristics at low temperatures, and continuation of these experiments is c = ently supported by KLUP. Extensive additional mappings were ca=ied out of nuclear spin relaxation rates of H and D in solid HD in the temperature-magnetic field rangs of 0.01 to 4.2K and 0 - 13 Tesla. New phenomena were discovered, such as association of impurity clustering with very low temperature motion, and inequality of the growth-rate and decay-rate of the magnetization

  9. Gas Modelling in the Disc of HD 163296

    Science.gov (United States)

    Tilling, I.; Woitke, P.; Meeus, G.; Mora, A.; Montesinos, B.; Riviere-Marichalar, P.; Eiroa, C.; Thi, W. -F.; Isella, A.; Roberge, A.; hide

    2011-01-01

    We present detailed model fits to observations of the disc around the Herbig Ae star HD 163296. This well-studied object has an age of approx. 4Myr, with evidence of a circumstellar disc extending out to approx. 540AU. We use the radiation thermo-chemical disc code ProDiMo to model the gas and dust in the circumstellar disc of HD 163296, and attempt to determine the disc properties by fitting to observational line and continuum data. These include new Herschel/PACS observations obtained as part of the open-time key program GASPS (Gas in Protoplanetary Systems), consisting of a detection of the [Oi] 63 m line and upper limits for several other far infrared lines. We complement this with continuum data and ground-based observations of the CO-12 3-2, 2-1 and CO-13 J=1-0 line transitions, as well as the H2 S(1) transition. We explore the effects of stellar ultraviolet variability and dust settling on the line emission, and on the derived disc properties. Our fitting efforts lead to derived gas/dust ratios in the range 9-100, depending on the assumptions made. We note that the line fluxes are sensitive in general to the degree of dust settling in the disc, with an increase in line flux for settled models. This is most pronounced in lines which are formed in the warm gas in the inner disc, but the low excitation molecular lines are also affected. This has serious implications for attempts to derive the disc gas mass from line observations. We derive fractional PAH abundances between 0.007 and 0.04 relative to ISM levels. Using a stellar and UV excess input spectrum based on a detailed analysis of observations, we find that the all observations are consistent with the previously assumed disc geometry

  10. H/D Isotope Effects in Hydrogen Bonded Systems

    Directory of Open Access Journals (Sweden)

    Aleksander Filarowski

    2013-04-01

    Full Text Available An extremely strong H/D isotope effect observed in hydrogen bonded A-H…B systems is connected with a reach diversity of the potential shape for the proton/deuteron motion. It is connected with the anharmonicity of the proton/deuteron vibrations and of the tunneling effect, particularly in cases of short bridges with low barrier for protonic and deuteronic jumping. Six extreme shapes of the proton motion are presented starting from the state without possibility of the proton transfer up to the state with a full ionization. The manifestations of the H/D isotope effect are best reflected in the infra-red absorption spectra. A most characteristic is the run of the relationship between the isotopic ratio nH/nD and position of the absorption band shown by using the example of NHN hydrogen bonds. One can distinguish a critical range of correlation when the isotopic ratio reaches the value of ca. 1 and then increases up to unusual values higher than . The critical range of the isotope effect is also visible in NQR and NMR spectra. In the critical region one observes a stepwise change of the NQR frequency reaching 1.1 MHz. In the case of NMR, the maximal isotope effect is reflected on the curve presenting the dependence of Δd (1H,2H on d (1H. This effect corresponds to the range of maximum on the correlation curve between dH and ΔpKa that is observed in various systems. There is a lack in the literature of quantitative information about the influence of isotopic substitution on the dielectric properties of hydrogen bond except the isotope effect on the ferroelectric phase transition in some hydrogen bonded crystals.

  11. ALMA OBSERVATIONS OF HD 141569’s CIRCUMSTELLAR DISK

    Energy Technology Data Exchange (ETDEWEB)

    White, J. A.; Boley, A. C. [Department of Physics and Astronomy, 6224 Agricultural Road, Vancouver, BC V6T 1Z1 (Canada); Hughes, A. M.; Flaherty, K. M. [Department of Astronomy, Van Vleck Observatory, Wesleyan University, 96 Foss Hill Drive, Middletown, CT 06459 (United States); Ford, E. [Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University, University Park, PA 16802-2111 (United States); Wilner, D.; Payne, M. [Harvard Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Corder, S., E-mail: jawhite@astro.ubc.ca [North American ALMA Science Center, National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA, 22903 (United States)

    2016-09-20

    We present ALMA band 7 (345 GHz) continuum and {sup 12}CO( J = 3-2) observations of the circumstellar disk surrounding HD 141569. At an age of about 5 Myr, the disk has a complex morphology that may be best interpreted as a nascent debris system with gas. Our 870 μ m ALMA continuum observations resolve a dust disk out to approximately 56 au from the star (assuming a distance of 116 pc) with 0.″38 resolution and 0.07 mJy beam{sup −1} sensitivity. We measure a continuum flux density for this inner material of 3.8 ± 0.4 mJy (including calibration uncertainties). The {sup 12}CO(3-2) gas is resolved kinematically and spatially from about 30 to 210 au. The integrated {sup 12}CO(3-2) line flux density is 15.7 ± 1.6 Jy km s{sup −1}. We estimate the mass of the millimeter debris and {sup 12}CO(3-2) gas to be ≳0.04 M {sub ⊕} and ∼2 × 10{sup −3} M {sub ⊕}, respectively. If the millimeter grains are part of a collisional cascade, then we infer that the inner disk (<50 au) has ∼160 M {sub ⊕} contained within objects less than 50 km in radius, depending on the planetesimal size distribution and density assumptions. Markov Chain Monte Carlo modeling of the system reveals a disk morphology with an inclination of 53.°4 centered around an M = 2.39 M {sub ⊙} host star ( M sin( i ) = 1.92 M {sub ⊙}). We discuss whether the gas in HD 141569's disk may be second generation. If it is, the system can be used to study the clearing stages of planet formation.

  12. Microstructural features of friction stir welded dissimilar Aluminium alloys AA2219-AA7475

    Science.gov (United States)

    Zaman Khan, Noor; Ubaid, Mohammed; Siddiquee, Arshad Noor; Khan, Zahid A.; Al-Ahmari, Abdulrahman; Chen, Xizhang; Haider Abidi, Mustufa

    2018-05-01

    High strength, good corrosion resistance, light weight make aluminium alloys a material of choice in many industrial sectors like aerospace, marine etc. Problems associated with welding of these alloys by fusion welding processes restricted their use in various industries. Friction stir welding (FSW), a clean solid-state joining process, easily overcomes various difficulties encountered during conventional fusion welding processes. In the present work, the effect of rotational speed (710 rpm, 900 rpm and 1120 rpm) on micro-hardness distribution and microstructure of FSWed dissimilar aluminium alloy joints were analyzed. Plates of AA7475-T761 and AA2219-O having thickness of 2.5 mm were welded by fixing AA7475 on retreating side (RS) and AA2219 on advancing side (AS). Welded joints were characterized by Vickers micro-hardness testing, scanning electron microscopy (SEM) and optical microscopy (OM). Results revealed that rotational speed significantly affects the micro-hardness due to increase in grain size, coarsening and dissolution of strengthening precipitates and re-precipitation. Higher micro-hardness values were observed in stir zone due to grain refinement and re-precipitation. Minimum micro-hardness value was observed at the TMAZ/HAZ of advancing side due to thermal softening.

  13. Experimental immunologically mediated aplastic anemia (AA) in mice: cyclosporin A fails to protect against AA

    International Nuclear Information System (INIS)

    Knospe, W.H.; Steinberg, D.; Gratwohl, A.; Speck, B.

    1984-01-01

    Immunologically mediated aplastic anemia (AA) in mice was induced by the i.v. injection of 10(7) lymph node cells (LNC) from H-2k identical but Mls mismatched CBA/J donor mice into previously irradiated (600 rad total body gamma) C3H/HeJ mice. Cyclosporin A (CsA), 25 mg/kg, was administered subcutaneously from day -1 to day 30. Control mice included C3H/HeJ mice which received 600 rad alone, C3H/HeJ mice which received 600 rad plus CsA as above, and C3H/HeJ mice which received 600 rad total body irradiation followed by 10(7) LNC from CBA/J donors. CsA failed to prevent lethal AA. These results suggest that the pathogenetic mechanisms operating in immunologically mediated AA differ from the mechanisms operating in rodents transplanted with allogeneically mismatched marrow or spleen cells which develop graft-versus-host disease. The results are consistent with a non-T cell-dependent mechanism causing the AA

  14. Simon van der Meer in the AA Control Room

    CERN Multimedia

    CERN PhotoLab

    1984-01-01

    Simon van der Meer, spiritus rector of the Antiproton Accumulator, in the AA Control Room. Inventor of stochastic cooling, on which the AA was based, and of the magnetic horn, with which the antiprotons were focused, he also wrote most of the software with which the AA was controlled, and spent uncountable numbers of hours in this chair to tickle the AA to top performance. 8 months after this picture was taken, he received, in October 1984, the Nobel prize, together with Carlo Rubbia, the moving force behind the whole Proton-Antiproton Collider project that led to the discovery, in 1983, of the W and Z intermediate bosons.

  15. Mechanical and corrosion properties of AA8011 sheets and foils:

    OpenAIRE

    Asanović, Vanja; Dalijić, Kemal; Radonjić, Dragan

    2006-01-01

    The mechanical and corrosion properties of a twin-roll cast Al-Fe-Si aluminum alloy with 0.74 % Fe and 0.52 % Si (AA8011) were investigated. The influence of the thermo-mehanical processing route on the mechanical behavior of AA8011 sheets was determined. Comparisons were made with AA3003 and A199.5 sheets. The restoration of the mechanical properties was used in the analysis of the recrystallization behavior of the twin-roll cast AA8011 alloy deformed under cold-working conditions and subseq...

  16. Which Executive Functioning Deficits Are Associated with AD/HD, ODD/CD and Comorbid AD/HD+ODD/CD? (Attention Deficit/hyperactivity Disorder)(Oppositional Defiant Disorder)

    Science.gov (United States)

    Oosterlaan, Jaap; Scheres, Anouk; Sergeant, Joseph A.

    2005-01-01

    This study investigated (1) whether attention deficit/hyperactivity disorder (AD/HD) is associated with executive functioning (EF) deficits while controlling for oppositional defiant disorder/conduct disorder (ODD/CD), (2) whether ODD/CD is associated with EF deficits while controlling for AD/HD, and (3) whether a combination of AD/HD and ODD/CD…

  17. Activity of vegetative insecticidal proteins Vip3Aa58 and Vip3Aa59 of Bacillus thuringiensis against lepidopteran pests.

    Science.gov (United States)

    Baranek, Jakub; Kaznowski, Adam; Konecka, Edyta; Naimov, Samir

    2015-09-01

    Vegetative insecticidal proteins (Vips) secreted by some isolates of Bacillus thuringiensis show activity against insects and are regarded as insecticides against pests. A number of B. thuringiensis strains harbouring vip3A genes were isolated from different sources and identified by using a PCR based approach. The isolates with the highest insecticidal activity were indicated in screening tests, and their vip genes were cloned and sequenced. The analysis revealed two polymorphic Vip protein forms, which were classified as Vip3Aa58 and Vip3Aa59. After expression of the vip genes, the proteins were isolated and characterized. The activity of both toxins was estimated against economically important lepidopteran pests of woodlands (Dendrolimus pini), orchards (Cydia pomonella) and field crops (Spodoptera exigua). Vip3Aa58 and Vip3Aa59 were highly toxic and their potency surpassed those of many Cry proteins used in commercial bioinsecticides. Vip3Aa59 revealed similar larvicidal activity as Vip3Aa58 against S. exigua and C. pomonella. Despite 98% similarity of amino acid sequences of both proteins, Vip3Aa59 was significantly more active against D. pini. Additionally the effect of proteolytic activation of Vip58Aa and Vip3Aa59 on toxicity of D. pini and S. exigua was studied. Both Vip3Aa proteins did not show any activity against Tenebrio molitor (Coleoptera) larvae. The results suggest that the Vip3Aa58 and Vip3Aa59 toxins might be useful for controlling populations of insect pests of crops and forests. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Maternal Emotions and Self-Efficacy Beliefs in Relation to Boys and Girls with AD/HD

    Science.gov (United States)

    Maniadaki, Katerina; Sonuga-Barke, Edmund; Kakouros, Efthymios; Karaba, Rania

    2005-01-01

    This study examined the impact of child gender on mothers' emotional responses to AD/HD, self-efficacy beliefs and perceived severity of AD/HD. Mothers (N = 118) of pre-schoolers were presented with a vignette describing a typical boy or girl with AD/HD and then completed three scales relating to their emotional response to AD/HD behaviour, their…

  19. Valsartan reduces AT1-AA-induced apoptosis through suppression oxidative stress mediated ER stress in endothelial progenitor cells.

    Science.gov (United States)

    Wang, Z-C; Qi, J; Liu, L-M; Li, J; Xu, H-Y; Liang, B; Li, B

    2017-03-01

    Valsartan has been reported to have the function of treating hypertension and improving the prognosis of patients. Many studies indicated that valsartan can also increase angiotensin II, andosterone and plasma renin activity (PRA). Autoantibodies against the angiotensin II type 1 receptor (AT1-AA) have been showed to increase reactive oxygen species (ROS) and calcium (Ca2+) and result in apoptosis in vascular smooth muscle cells. In this study, we attempted to explore the effect of valsartan on AT1-AA-induced apoptosis in endothelial progenitor cells. Endothelial progenitor cells (EPCs) were cultured. The cytotoxicity was determined by MTT assay. EPCs apoptosis was determined by DAPI staining and flow cytometry. Reactive oxygen species, intracellular calcium concentration and calpain activity were measured using Fluostar Omega Spectrofluorimeter. The expression of p-ERK, p-eIF-2a, CHOP, Bcl-2 and caspase-3 were detected by Western blot. MTT assays showed valsartan significantly inhibited AT1-AA- induced decline of the viability of EPCs. DAPI staining and flow cytometry results indicated valsartan inhibited AT1-AA-induced decline of the viability of EPCs via inhibiting AT1-AA-induced apoptosis. Furthermore, the increasing of reactive oxygen species, intracellular calcium and calpain activity induced by AT1-AA in EPCs were also recovered after pre-treated with valsartan. Meanwhile, the upregulation of p-ERK, p-eIF-2a and CHOP, downregulation of Bcl-2, and activation of Caspase-3 caused by AT1-AA were reversed after pre-incubated with valsartan. Valsartan could inhibit AT1-AA-induced apoptosis through inhibiting oxidative stress mediated ER stress in EPCs.

  20. THREE-DIMENSIONAL ATMOSPHERIC CIRCULATION MODELS OF HD 189733b AND HD 209458b WITH CONSISTENT MAGNETIC DRAG AND OHMIC DISSIPATION

    International Nuclear Information System (INIS)

    Rauscher, Emily; Menou, Kristen

    2013-01-01

    We present the first three-dimensional circulation models for extrasolar gas giant atmospheres with geometrically and energetically consistent treatments of magnetic drag and ohmic dissipation. Atmospheric resistivities are continuously updated and calculated directly from the flow structure, strongly coupling the magnetic effects with the circulation pattern. We model the hot Jupiters HD 189733b (T eq ≈ 1200 K) and HD 209458b (T eq ≈ 1500 K) and test planetary magnetic field strengths from 0 to 30 G. We find that even at B = 3 G the atmospheric structure and circulation of HD 209458b are strongly influenced by magnetic effects, while the cooler HD 189733b remains largely unaffected, even in the case of B = 30 G and super-solar metallicities. Our models of HD 209458b indicate that magnetic effects can substantially slow down atmospheric winds, change circulation and temperature patterns, and alter observable properties. These models establish that longitudinal and latitudinal hot spot offsets, day-night flux contrasts, and planetary radius inflation are interrelated diagnostics of the magnetic induction process occurring in the atmospheres of hot Jupiters and other similarly forced exoplanets. Most of the ohmic heating occurs high in the atmosphere and on the dayside of the planet, while the heating at depth is strongly dependent on the internal heat flux assumed for the planet, with more heating when the deep atmosphere is hot. We compare the ohmic power at depth in our models, and estimates of the ohmic dissipation in the bulk interior (from general scaling laws), to evolutionary models that constrain the amount of heating necessary to explain the inflated radius of HD 209458b. Our results suggest that deep ohmic heating can successfully inflate the radius of HD 209458b for planetary magnetic field strengths of B ≥ 3-10 G.

  1. The Mass of the Candidate Exoplanet Companion to HD 33636 from Hubble Space Telescope Astrometry and High-Precision Radial Velocities

    Science.gov (United States)

    Bean, Jacob L.; McArthur, Barbara E.; Benedict, G. Fritz; Harrison, Thomas E.; Bizyaev, Dmitry; Nelan, Edmund; Smith, Verne V.

    2007-08-01

    We have determined a dynamical mass for the companion to HD 33636 that indicates it is a low-mass star instead of an exoplanet. Our result is based on an analysis of Hubble Space Telescope (HST) astrometry and ground-based radial velocity data. We have obtained high-cadence radial velocity measurements spanning 1.3 yr of HD 33636 with the Hobby-Eberly Telescope at McDonald Observatory. We combined these data with previously published velocities to create a data set that spans 9 yr. We used this data set to search for, and place mass limits on, the existence of additional companions in the HD 33636 system. Our high-precision astrometric observations of the system with the HST Fine Guidance Sensor 1r span 1.2 yr. We simultaneously modeled the radial velocity and astrometry data to determine the parallax, proper motion, and perturbation orbit parameters of HD 33636. Our derived parallax, πabs=35.6+/-0.2 mas, agrees within the uncertainties with the Hipparcos value. We find a perturbation period P=2117.3+/-0.8 days, semimajor axis aA=14.2+/-0.2 mas, and system inclination i=4.1deg+/-0.1deg. Assuming the mass of the primary star to be MA=1.02+/-0.03 Msolar, we obtain a companion mass MB=142+/-11 MJup=0.14+/-0.01 Msolar. The much larger true mass of the companion relative to its minimum mass estimated from the spectroscopic orbit parameters (Msini=9.3 MJup) is due to the nearly face-on orbit orientation. This result demonstrates the value of follow-up astrometric observations to determine the true masses of exoplanet candidates detected with the radial velocity method. Based on data obtained with the NASA/ESA Hubble Space Telescope (HST) and the Hobby-Eberly Telescope (HET). The HST observations were obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555. The HET is a joint project of the University of Texas at Austin, Pennsylvania State University, Stanford

  2. Recent Insights into the Pathogenesis of Type AA Amyloidosis

    Directory of Open Access Journals (Sweden)

    J. C. H. van der Hilst

    2011-01-01

    Full Text Available The amyloidoses are a group of life-threatening diseases in which fibrils made of misfolded proteins are deposited in organs and tissues. The fibrils are stable, insoluble aggregates of precursor proteins that have adopted an antiparallel β-sheet structure. In type AA, or reactive, amyloidosis, the precursor protein of the fibrils is serum amyloid A (SAA. SAA is a 104-amino-acid protein that is produced in the liver in response to proinflammatory cytokines. Although the protein that is produced by the liver contains 104 amino acids, only the N-terminal 66–76 amino acids are found in amyloid fibrils. Furthermore, SAA has been shown to have an α-helical structure primarily. Thus, for SAA to be incorporated into an amyloid fibril, two processes have to occur: C-terminal cleavage and conversion into a β-sheet. Only a minority of patients with elevated SAA levels develop amyloidosis. Factors that contribute to the risk of amyloidosis include the duration and degree of SAA elevation, polymorphisms in SAA, and the type of autoinflammatory syndrome. In the Hyper-IgD syndrome, amyloidosis is less prevalent than in the other autoinflammatory diseases. In vitro work has shown that the isoprenoid pathway influences amyloidogenesis by farnesylated proteins. Although many proteins contain domains that have a potential for self-aggregation, amyloidosis is only a very rare event. Heat shock proteins (HSPs are chaperones that assist other proteins to attain, maintain, and regain a functional conformation. In this review, recent insights into the pathogenesis of amyloidosis are discussed, in addition to a new hypothesis for a role of HSPs in the pathogenesis of type AA.

  3. [Relationship between characteristic behaviors of children with AD/HD and mothers' parenting styles].

    Science.gov (United States)

    Mano, Shoko; Uno, Hiroyuki

    2007-01-01

    Previous studies have revealed that mothers of children with attention-deficit/hyperactivity disorder (AD/HD) have an authoritarian parenting style. However, the psychological process of developing an authoritarian parenting style has yet to be clearly defined. To clarify this psychological process, the present study examined the hypothesis that the characteristic behaviors of children with AD/HD initially increase the mothers' parenting stress, which influences their parenting style. Thirty-six mothers of children with AD/HD (children's mean age: 8.1 years) and the same number of controls (children's mean age: 8.4 years) participated in the present study. The mothers' parenting stress was assessed using the Japanese Parenting Stress Index. Parenting styles were assessed using the TK-style scale for evaluating the relationships between parents and children. The results indicated that the mothers of children with AD/HD had significantly higher scores than controls for all parenting stress items and negative parenting style variables (dissatisfaction, reproach, strictness, interference, inconsistency and disagreement of 10 attitudes). Stepwise multiple regression analysis revealed that the characteristic behaviors of children with AD/HD were associated with the degree of attachment in mothers, which was related to the strict and reproachful parenting style in the AD/HD group. These results suggest that mothers of children with AD/HD are likely to have a strict and reproachful parenting style as a result of a lack of attachment with the child.

  4. The impact of reinforcement contingencies on AD/HD: a review and theoretical appraisal.

    Science.gov (United States)

    Luman, Marjolein; Oosterlaan, Jaap; Sergeant, Joseph A

    2005-02-01

    One of the core deficits in attention deficit/hyperactivity disorder (AD/HD) is thought to be an aberrant sensitivity to reinforcement, such as reward and response cost. Twenty-two studies (N=1181 children) employing AD/HD and reinforcement contingencies are reviewed from vantage points: task performance, motivation, and psychophysiology. Results indicate that reinforcement contingencies have a positive impact on task performance and levels of motivation for both children with AD/HD and normal controls. There is evidence that the effect related to task performance is somewhat more prominent in AD/HD. There is some evidence that a high intensity of reinforcement is highly effective in AD/HD. Children with AD/HD prefer immediate over delayed reward. From a psychophysiological point of view, children with AD/HD seem less sensitive to reinforcement compared to controls. While comorbid disorders are suggested to be confounders of the dependent variables, many studies do not examine the effect of oppositional defiant disorder (ODD) and conduct disorder (CD). We discuss the implications of the findings for five theoretical frameworks, including the model by, the cognitive-energetic model (CEM), the dual-pathway model and the BIS/BAS model. Results show a discrepancy between the theoretical models and the behavioural findings.

  5. Hot tearing studies in AA5182

    Science.gov (United States)

    van Haaften, W. M.; Kool, W. H.; Katgerman, L.

    2002-10-01

    One of the major problems during direct chill (DC) casting is hot tearing. These tears initiate during solidification of the alloy and may run through the entire ingot. To study the hot tearing mechanism, tensile tests were carried out in semisolid state and at low strain rates, and crack propagation was studied in situ by scanning electron microscopy (SEM). These experimentally induced cracks were compared with hot tears developed in an AA5182 ingot during a casting trial in an industrial research facility. Similarities in the microstructure of the tensile test specimens and the hot tears indicate that hot tearing can be simulated by performing tensile tests at semisolid temperatures. The experimental data were compared with existing hot tearing models and it was concluded that the latter are restricted to relatively high liquid fractions because they do not take into account the existence of solid bridges in the crack.

  6. Predicting Hot Deformation of AA5182 Sheet

    Science.gov (United States)

    Lee, John T.; Carpenter, Alexander J.; Jodlowski, Jakub P.; Taleff, Eric M.

    Aluminum 5000-series alloy sheet materials exhibit substantial ductilities at hot and warm temperatures, even when grain size is not particularly fine. The relatively high strain-rate sensitivity exhibited by these non-superplastic materials, when deforming under solute-drag creep, is a primary contributor to large tensile ductilities. This active deformation mechanism influences both plastic flow and microstructure evolution across conditions of interest for hot- and warm-forming. Data are presented from uniaxial tensile and biaxial bulge tests of AA5182 sheet material at elevated temperatures. These data are used to construct a material constitutive model for plastic flow, which is applied in finite-element-method (FEM) simulations of plastic deformation under multiaxial stress states. Simulation results are directly compared against experimental data to explore the usefulness of this constitutive model. The effects of temperature and stress state on plastic response and microstructure evolution are discussed.

  7. AA, shims and washers on quadrupole ends

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    Due to the fact that much of the field of the quadrupoles was outside the iron (in particular with the wide quadrupoles) and that thus the fields of quadrupoles and bending magnets interacted, the lattice properties of the AA could not be predicted with the required accuracy. After a first running period in 1980, during which detailed measurements were made with proton test beams, corrections to the quadrupoles were made in 1981, in the form of laminated shims at the ends of the poles, and with steel washers. With the latter ones, further refinements were made in an iterative procedure with measurements on the circulating beam. This eventually resulted, amongst other things, in a very low chromaticity, with the Q-values being constant to within +- 0.001 over the total momentum range of 6 %. Here we see the shims and washers on a narrow qudrupole (QFN, QDN). See also 8103203, 8103204, 8103205, 8103206.

  8. Positive evolutionary selection of an HD motif on Alzheimer precursor protein orthologues suggests a functional role.

    Science.gov (United States)

    Miklós, István; Zádori, Zoltán

    2012-02-01

    HD amino acid duplex has been found in the active center of many different enzymes. The dyad plays remarkably different roles in their catalytic processes that usually involve metal coordination. An HD motif is positioned directly on the amyloid beta fragment (Aβ) and on the carboxy-terminal region of the extracellular domain (CAED) of the human amyloid precursor protein (APP) and a taxonomically well defined group of APP orthologues (APPOs). In human Aβ HD is part of a presumed, RGD-like integrin-binding motif RHD; however, neither RHD nor RXD demonstrates reasonable conservation in APPOs. The sequences of CAEDs and the position of the HD are not particularly conserved either, yet we show with a novel statistical method using evolutionary modeling that the presence of HD on CAEDs cannot be the result of neutral evolutionary forces (pHD motif is underrepresented in the proteomes of all species of the animal kingdom. Position migration can be explained by high probability occurrence of multiple copies of HD on intermediate sequences, from which only one is kept by selective evolutionary forces, in a similar way as in the case of the "transcription binding site turnover." CAED of all APP orthologues and homologues are predicted to bind metal ions including Amyloid-like protein 1 (APLP1) and Amyloid-like protein 2 (APLP2). Our results suggest that HDs on the CAEDs are most probably key components of metal-binding domains, which facilitate and/or regulate inter- or intra-molecular interactions in a metal ion-dependent or metal ion concentration-dependent manner. The involvement of naturally occurring mutations of HD (Tottori (D7N) and English (H6R) mutations) in early onset Alzheimer's disease gives additional support to our finding that HD has an evolutionary preserved function on APPOs.

  9. Partially melted zone cracking in AA6061 welds

    International Nuclear Information System (INIS)

    Prasad Rao, K.; Ramanaiah, N.; Viswanathan, N.

    2008-01-01

    Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043

  10. Partially melted zone cracking in AA6061 welds

    Energy Technology Data Exchange (ETDEWEB)

    Prasad Rao, K. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai (India)], E-mail: kpr@iitm.ac.in; Ramanaiah, N. [Sri Kalahasteeswara Institute of Technology, Srikalahasti (India); Viswanathan, N. [Defence Research and Development Laboratory, Hyderabad (India)

    2008-07-01

    Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043.

  11. INAA and flame AAS of various vegetable reference materials

    International Nuclear Information System (INIS)

    Djingova, R.; Arpadjan, S.; Kuleff, I.

    1991-01-01

    INAA and flame AAS have been used for the analysis of a large number of vegetable reference materials. Out of all determined elements (28 by INAA and 11 by AAS) nine are common for both methods (Ca, Cd, Co, Cu, Fe, Mg, Mn, Na, Zn) and for these the possibilities of the two methods have been compared. (orig.)

  12. Intensive Nutritional Counselling And Support And Clinical Outcomes In Hemodialysis Patients

    OpenAIRE

    Alessio Molfino; Alessandro Laviano; Maria Grazia Chiappini; Thomas Amman; Filippo Rossi Fanelli; Maurizio Muscaritoli

    2012-01-01

    Protein-energy wasting is frequently found in haemodialysis (HD) patients. Anorexia and hypophagia contribute to malnutrition, increased morbidity and mortality, but the clinical impact of correcting hypophagia remains uncertain. We evaluated whether correction of hypophagia influences morbidity and mortality in anorexic HD patients. Thirty-four HD patients were enrolled in a 2-year follow-up programme including regular nutritional assessment. Patients not meeting nutritional requirements dur...

  13. Failure analysis of fusion clad alloy system AA3003/AA6xxx sheet under bending

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Y., E-mail: shiyh@mcmaster.ca [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Jin, H. [Novelis Global Technology Center, P.O. Box 8400, Kingston, Ontario, Canada K7L 5L9 (Canada); Wu, P.D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Lloyd, D.J. [Aluminum Materials Consultants, 106 Nicholsons Point Road, Bath, Ontario, Canada K0H 1G0 (Canada); Embury, D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada)

    2014-07-29

    An ingot of AA6xxx Al–Si–Mg–Cu alloy clad with AA3003 Al–Mn alloy was co-cast by Fusion technology. Bending tests and numerical modeling were performed to investigate the potential for sub-surface cracking for this laminate system. To simulate particle-induced crack initiation and growth, both random and stringer particles have been selected to mimic the particle distribution in the tested samples. The morphology of cracking in the model was similar to that observed in clad sheet tested in the Cantilever bend test. The crack initiated in the core close to the clad-core interface where the strain in the core is highest, between particles or near particles and propagates along local shear bands in the core, while the clad layer experiences extreme thinning before failure.

  14. Light variations of the population II F-type supergiant HD 46703

    Science.gov (United States)

    Bond, H. E.; Carney, B. W.; Grauer, A. D.

    1984-01-01

    Photometric monitoring has revealed brightness variations of 0.1 m on a time scale of weeks for HD 46703, a metal-deficient F-type field analog of the stars lying above the horizontal branch in globular clusters. It is suggested that HD 46703 belongs to the '89 Her' class of luminous F-type variables. Since HD 46703 is unquestionably a halo object, it is almost certainly a low-mass star. It is suggested that it, and probably the other 89 Her variables, are masquerading as supergiants during their final evolution off the asymptotic giant branch.

  15. Permeation of a H2 + HD + D2 gas mixture through a polymer membrane

    International Nuclear Information System (INIS)

    Mercea, P.; Cuna, S.; Kreibik, S.; Ursu, I.

    1990-01-01

    The selective permeation of a H 2 + HD + D 2 gas mixture through a polyethylene terephthalate membrane was studied at T 20 0 C. It was found that the permeation of the HD through the membrane leads to a smaller overall hydrogen-deuterium separation factor than that determined in the permeation experiments with pure H 2 and D 2 . On the other hand, a process of isotopic exchange between deuterium atoms from the penetrant gas stream and hydrogen atoms from the polymer membrane is assumed and discussed in order to explain temporal variations of the H 2 , HD and D 2 concentrations of the permanent gas stream. (author)

  16. Interstellar gas and large grains toward HD 38087

    International Nuclear Information System (INIS)

    Snow, T.P.; Witt, A.

    1989-01-01

    High-dispersion IUE spectra have been obtained of HD 38087, a star associated with reflection nebulosity where 2175 A scattering has previously been observed. The presence of 2175 A in emission implies unusually large grains, an attempt was made to see how these unusual grains may have affected the depletions of gas-phase elements onto dust in the line of sight. Even though the observed scattering region constitutes only a fraction of the total column density of dust, it is expected that the present line-of-sight analysis provides useful information on the gas and dust in the scattering nebulosity. Somewhat larger overall depletions than normal are found, and it is found that the depletions of certain elements (manganese and zinc) are enhanced relative to the normal pattern of element-to-element depletions, suggesting that grain growth has occurred with some elements sticking to grains preferentially. The molecular fraction in the line of sight is low, in accord with similar lines of sight having low far-ultraviolet extinction and large depletions. 37 refs

  17. HD 169142 in the eyes of ZIMPOL/SPHERE

    Science.gov (United States)

    Bertrang, G. H.-M.; Avenhaus, H.; Casassus, S.; Montesinos, M.; Kirchschlager, F.; Perez, S.; Cieza, L.; Wolf, S.

    2018-03-01

    We present new data of the protoplanetary disc surrounding the Herbig Ae/Be star HD 169142 obtained in the very broad-band (VBB) with the Zurich imaging polarimeter (ZIMPOL), a subsystem of the Spectro-Polarimetric High-contrast Exoplanet REsearch instrument (SPHERE) at the Very Large Telescope (VLT). Our Polarimetric Differential Imaging (PDI) observations probe the disc as close as 0.03 arcsec (3.5 au) to the star and are able to trace the disc out to ˜1.08 arcsec (˜126 au). We find an inner hole, a bright ring bearing substructures around 0.18 arcsec (21 au), and an elliptically shaped gap stretching from 0.25 to 0.47 arcsec (29-55 au). Outside of 0.47 arcsec, the surface brightness drops off, discontinued only by a narrow annular brightness minimum at ˜0.63 to 0.74 arcsec (74-87 au). These observations confirm features found in less-well-resolved data as well as reveal yet undetected indications for planet-disc interactions, such as small-scale structures, star-disc offsets, and potentially moving shadows.

  18. Slow Motion and Zoom in HD Digital Videos Using Fractals

    Directory of Open Access Journals (Sweden)

    Maurizio Murroni

    2009-01-01

    Full Text Available Slow motion replay and spatial zooming are special effects used in digital video rendering. At present, most techniques to perform digital spatial zoom and slow motion are based on interpolation for both enlarging the size of the original pictures and generating additional intermediate frames. Mainly, interpolation is done either by linear or cubic spline functions or by motion estimation/compensation which both can be applied pixel by pixel, or by partitioning frames into blocks. Purpose of this paper is to present an alternative technique combining fractals theory and wavelet decomposition to achieve spatial zoom and slow motion replay of HD digital color video sequences. Fast scene change detection, active scene detection, wavelet subband analysis, and color fractal coding based on Earth Mover's Distance (EMD measure are used to reduce computational load and to improve visual quality. Experiments show that the proposed scheme achieves better results in terms of overall visual quality compared to the state-of-the-art techniques.

  19. HD-RNAS: An automated hierarchical database of RNA structures

    Directory of Open Access Journals (Sweden)

    Shubhra Sankar eRay

    2012-04-01

    Full Text Available One of the important goals of most biological investigations is to classify and organize the experimental findings so that they are readily useful for deriving generalized rules. Although there is a huge amount of information on RNA structures in PDB, there are redundant files, ambiguous synthetic sequences etc. Moreover, a systematic hierarchical organization, reflecting RNA classification, is missing in PDB. In this investigation, we have classified all the available RNA crystal structures from PDB through a programmatic approach. Hence, it would be now a simple assignment to regularly update the classification as and when new structures are released. The classification can further determine (i a non-redundant set of RNA structures and (ii if available, a set of structures of identical sequence and function, which can highlight structural polymorphism, ligand-induced conformational alterations etc. Presently, we have classified the available structures (2095 PDB entries having RNA chain longer than 9 nucleotides solved by X-ray crystallography or NMR spectroscopy into nine functional classes. The structures of same function and same source are mostly seen to be similar with subtle differences depending on their functional complexation. The web-server is available online at http://www.saha.ac.in/biop/www/HD-RNAS.html and is updated regularly.

  20. TRIGGERED STAR FORMATION SURROUNDING WOLF-RAYET STAR HD 211853

    Energy Technology Data Exchange (ETDEWEB)

    Liu Tie; Wu Yuefang; Zhang Huawei [Department of Astronomy, Peking University, 100871 Beijing (China); Qin Shengli, E-mail: liutiepku@gmail.com [I. Physikalisches Institut, Universitaet zu Koeln, Zuelpicher Str. 77, 50937 Koeln (Germany)

    2012-05-20

    The environment surrounding Wolf-Rayet (W-R) star HD 211853 is studied in molecular, infrared, as well as radio, and H I emission. The molecular ring consists of well-separated cores, which have a volume density of 10{sup 3} cm{sup -3} and kinematic temperature {approx}20 K. Most of the cores are under gravitational collapse due to external pressure from the surrounding ionized gas. From the spectral energy distribution modeling toward the young stellar objects, the sequential star formation is revealed on a large scale in space spreading from the W-R star to the molecular ring. A small-scale sequential star formation is revealed toward core 'A', which harbors a very young star cluster. Triggered star formations are thus suggested. The presence of the photodissociation region, the fragmentation of the molecular ring, the collapse of the cores, and the large-scale sequential star formation indicate that the 'collect and collapse' process functions in this region. The star-forming activities in core 'A' seem to be affected by the 'radiation-driven implosion' process.

  1. TRIGGERED STAR FORMATION SURROUNDING WOLF-RAYET STAR HD 211853

    International Nuclear Information System (INIS)

    Liu Tie; Wu Yuefang; Zhang Huawei; Qin Shengli

    2012-01-01

    The environment surrounding Wolf-Rayet (W-R) star HD 211853 is studied in molecular, infrared, as well as radio, and H I emission. The molecular ring consists of well-separated cores, which have a volume density of 10 3 cm –3 and kinematic temperature ∼20 K. Most of the cores are under gravitational collapse due to external pressure from the surrounding ionized gas. From the spectral energy distribution modeling toward the young stellar objects, the sequential star formation is revealed on a large scale in space spreading from the W-R star to the molecular ring. A small-scale sequential star formation is revealed toward core 'A', which harbors a very young star cluster. Triggered star formations are thus suggested. The presence of the photodissociation region, the fragmentation of the molecular ring, the collapse of the cores, and the large-scale sequential star formation indicate that the 'collect and collapse' process functions in this region. The star-forming activities in core 'A' seem to be affected by the 'radiation-driven implosion' process.

  2. The Star-grazing Bodies in the HD 172555 System

    Science.gov (United States)

    Grady, C. A.; Brown, Alexander; Welsh, Barry; Roberge, Aki; Kamp, Inga; Rivière Marichalar, P.

    2018-06-01

    Kiefer et al. reported the detection of infalling Ca II absorption in HD 172555, a member of the β Pictoris Moving Group (βPMG). We obtained HST Space Telescope Imaging Spectrograph and Cosmic Origins Spectrograph spectroscopy of this star at 2 epochs separated by a week, and we report the discovery of infalling gas in resonant transitions of Si III and IV, C II and IV, and neutral atomic oxygen. Variable absorption is seen in the C II transitions and is optically thick, with covering factors which range between 58% and 68%, similar to features seen in β Pictoris. The O I spectral profile resembles that of C II, showing a strong low-velocity absorption to +50 km s‑1 in the single spectral segment obtained during orbital night, as well as what may be higher-velocity absorption. Studies of the mid-IR spectrum of this system have suggested the presence of silica. The O I absorption differs from that seen in Si III, suggesting that the neutral atomic oxygen does not originate in SiO dissociation products but in a more volatile parent molecule such as CO.

  3. Effect of hemodialysis and peritoneal dialysis on redox status in chronic renal failure patients: a comparative study

    Directory of Open Access Journals (Sweden)

    Mekki Khedidja

    2010-09-01

    Full Text Available Abstract Objective To investigate the effects of hemodialysis (HD and periotoneal dialysis (PD on oxidative stress in chronic renal failure patients (CRF. Methods 20 HD patients (M/F: 8/12, 36 ± 12 years and 20 PD patients (M/F: 10/10, 40 ± 8 years were compared with 20 end stage renal failure patients (CRF (M/F: 4/16, 61 ± 13 years. Results Thiobarbituric acid reactive substances (TBARS values were elevated in HD and decreased in PD compared to CRF (P 2 were decreased in HD and PD, compared to CRF (p 3 values between the three groups. Carbonyls were increased in HD (p Conclusion HD and PD aggravate oxidative stress generated by uremia. HD accentuates lipid and protein peroxidation, while PD aggravates protein oxidation. However, the activity of antioxidant enzymes was altered by both dialysis treatments.

  4. Inhibitory effect of propolis on the development of AA amyloidosis.

    Science.gov (United States)

    Harata, Daichi; Tsuchiya, Yuya; Miyoshi, Tomoyuki; Yanai, Tokuma; Suzuki, Kazuhiko; Murakami, Tomoaki

    2018-04-01

    In the several types of amyloidoses, participation of oxidative stresses in the pathogenesis and the effect of antioxidants on amyloidosis have been reported. Meanwhile, the relationship between oxidative stresses and pathogenesis of amyloid A (AA) amyloidosis is still unclear. In this study, we used an antioxidant, Brazilian propolis, to investigate the inhibitory effects on AA amyloidosis. The results showed that AA deposition was inhibited by administration of propolis. Increased expression of antioxidant markers was detected in molecular biological examinations of mice treated with propolis. Although serum amyloid A (SAA) levels were strongly correlated with the immunoreactive area of AA deposits in the control group, the correlation was weaker in the propolis-treated groups. In addition, there were no changes in SAA levels between the control group and the propolis-treated groups. The results indicate that propolis, an antioxidant, may induce inhibitory effects against AA amyloidosis.

  5. Relative survival of peritoneal dialysis and haemodialysis patients

    DEFF Research Database (Denmark)

    Heaf, James G; Wehberg, Sonja

    2014-01-01

    INTRODUCTION: Epidemiological studies consistently show an initial survival advantage for PD patients compared to HD. It has recently been suggested that this is due to the fact that many HD patients are referred late, and start dialysis on an acute, in-patient basis. The present study was perfor...

  6. Patterns of False Memory in Patients with Huntington's Disease.

    Science.gov (United States)

    Chen, I-Wen; Chen, Chiung-Mei; Wu, Yih-Ru; Hua, Mau-Sun

    2017-06-01

    Increased false memory recognition in patients with Huntington's disease (HD) has been widely reported; however, the underlying memory constructive processes remain unclear. The present study explored gist memory, item-specific memory, and monitoring ability in patients with HD. Twenty-five patients (including 13 patients with mild HD and 12 patients with moderate-to-severe HD) and 30 healthy comparison participants (HC) were recruited. We used the Deese-Roediger-McDermott (DRM) paradigm to investigate participants' false recognition patterns, along with neuropsychological tests to assess general cognitive function. Both mild and moderate-to-severe patients with HD showed significant executive functioning and episodic memory impairment. On the DRM tasks, both HD patient groups showed significantly impaired performance in tasks assessing unrelated false recognition and item-specific memory as compared to the HC group; moderate-to-severe patients performed more poorly than mild patients did. Only moderate-severe patients exhibited significantly poorer related false recognition index scores than HCs in the verbal DRM task; performance of HD patient groups was comparable to the HC group on the pictorial DRM task. It appears that diminished verbatim memory and monitoring ability are early signs of cognitive decline during the HD course. Conversely, gist memory is relatively robust, with only partial decline during advanced-stage HD. Our findings suggest that medial temporal lobe function is relatively preserved compared to that of frontal-related structures in early HD. Thus, gist-based memory rehabilitation programs might be beneficial for patients with HD. © The Author 2017. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  7. Daily dialysis reduces pulse wave velocity in chronic hemodialysis patients.

    Science.gov (United States)

    Di Micco, Lucia; Torraca, Serena; Sirico, Maria Luisa; Tartaglia, Domenico; Di Iorio, Biagio

    2012-05-01

    Pulse wave velocity (PWV) is a predictor of morbidity and mortality in patients with end-stage renal disease (ESRD). Dialysis patients show cyclic changes in PWV related to their hydration status and blood pressure. Our aim is to assess the impact of daily dialysis on PWV. We performed a randomized crossover study of 60 patients who underwent standard hemodialysis (HD) three times per week for at least 6 months. Patients were classified into three groups according to their PWV values before (pre-) and after (post-) HD, with a cutoff value of 12 m s(-1), as follows: the low-low (LL) group had normal pre-HD and post-HD PWV; the high-low (HL) group had high pre-HD PWV and normal post-HD PWV; and the high-high (HH) group had high pre- and post-HD PWV. All patients continued standard HD for 2 weeks. A total of 10 patients from each group were randomly assigned to continue standard HD for 1 week and then underwent daily dialysis for 1 week. The remaining 10 patients underwent daily dialysis for 1 week and then underwent standard HD for 1 week. PWV values were measured before and 1 h after each dialysis session. With daily dialysis treatment, 2 of 20 patients (10%) moved from the PWV-HH group to the PWV-HL group, whereas 18 of 20 patients (90%) moved from the PWV-HL group to the PWV-LL group (P = 0.030). Daily dialysis reduces PWV in the ESRD patients. As PWV is a strong predictor of mortality in ESRD and has cyclic variations in patients who are on standard HD, we believe that daily dialysis may be used in patients with high PWV levels to reduce their mortality risk.

  8. States' Flexibility Waiver Plans for Alternate Assessments Based on Alternate Achievement Standards (AA-AAS). Synthesis Report 96

    Science.gov (United States)

    Lazarus, Sheryl S.; Edwards, Lynn M.; Thurlow, Martha L.; Hodgson, Jennifer R.

    2014-01-01

    All states have alternate assessments based on alternate achievement standards (AA-AAS) for students with the most significant cognitive disabilities. For accountability purposes, the Elementary and Secondary Education Act (ESEA) allows up to 1% of students to be counted as proficient with this assessment option. In 2011 the U.S. Department of…

  9. [Vitreomacular adhesion in HD-OCT images in the age-related macular degeneration].

    Science.gov (United States)

    Latalska, Małgorzata; Swiech-Zubilewicz, Anna; Mackiewicz, Jerzy

    2013-01-01

    The aim of this study was to evaluate an incidence of the vitreomacular adhesion in patients with age-related macular degeneration. We examined 472 eyes in 241 patients (136 W/ 105 M) in age of 54-92 years (mean 62.6 years +/- 8.5) with dry or wet age-related macular degeneration using Cirrus HD-OCT (Zeiss) macular cube 512x128 program or 5-line pro-gram. Vitreomacular adhesion was observed in 139 eyes with dry age-related macular degeneration (29.4%, p=0.000*), in 101 eyes with drusen (21.4%, p=0.000*), in 38 eyes with retinal pigment epithelium alterations (8%, p=0.202), in 278 eyes with wet age-related macular degeneration (58.9%, p=0.001*), in 21 eyes with pigment epithelial detachment (4.4%, p=0.303), in 161 eyes with choroidal neovascularzation (34. 1%, p=0.031*/ and in 96 eyes with scar (20.4%, p=0.040*). Probably, vitreomacular adhesion alone is not able to induce age-related macular degeneration, but it may be associated with choroidal neovascularization development, it can contribute to exudate formation and choroidal neovascularization, it may induces or sustains a chronic low-grade inflammation in the macula region.

  10. Experimental investigation of hardness of FSW and TIG joints of Aluminium alloys of AA7075 and AA6061

    Directory of Open Access Journals (Sweden)

    Chetan Patil

    2016-07-01

    Full Text Available This paper reports hardness testing conducted on welded butt joints by FSW and TIG welding process on similar and dissimilar aluminium alloys. FSW joints were produced for similar alloys of AA7075T651 and dissimilar alloys of AA7075T651- AA6061T6. The Friction stir welds of AA7075 & AA6061 aluminium alloy were produced at different tool rotational speeds of 650,700, 800, 900, 1000 and transverse speed of 30, 35, 40 mm/min. TIG welding was conducted along the rolling direction of similar and dissimilar aluminium plates. The Brinell hardness testing techniques were employed to conduct the tests; these tests were conducted on the welds to ascertain the joint integrity before characterization to have an idea of the quality of the welds

  11. Relations between diabetes, blood pressure and aortic pulse wave velocity in haemodialysis patients

    DEFF Research Database (Denmark)

    Peters, Christian Daugaard; Kjærgaard, Krista Dybtved; Dzeko, Mirela

    (HD) and 32 HD patients with DM (HD+DM). The SphygmoCor system was used for estimation of PWV. HD-duration, age, gender and BP medication were similar in the two groups. Mean DM-duration was 23±11 years and 25(78%) had type 2 DM. HD+DM had higher BMI (26±5 vs. 29±5 kg/m2, p=0.02), systolic BP (142......Diabetes (DM) is common in haemodialysis (HD) patients and affects both blood pressure (BP) and arterial stiffness. Carotid femoral pulse wave velocity (PWV) reflects the stiffness of the aorta and is regarded as a strong risk factor for cardiovascular (CV) mortality in HD patients. However, PWV......±20 vs. 152±21 mmHg, p=0.02) and pulse pressure (65±17 vs. 80±18 mmHg, p2.5 in HD and 12.3±3.1 m/s in HD+DM. The mean PWV difference HD vs. HD+DM was 3.1(1.9-4.3)m/s, p

  12. Compensation in Preclinical Huntington's Disease: Evidence From the Track-On HD Study

    Directory of Open Access Journals (Sweden)

    Stefan Klöppel

    2015-10-01

    Interpretation: Our findings provide evidence for active compensatory processes in premanifest-HD for cognitive demands and suggest a higher vulnerability of the left hemisphere to the effects of regional atrophy.

  13. THz/Infrared Double Resonance Two-Photon Spectroscopy of HD+ for Determination of Fundamental Constants

    Directory of Open Access Journals (Sweden)

    Florin Lucian Constantin

    2017-10-01

    Full Text Available A double resonance two-photon spectroscopy scheme is discussed to probe jointly rotational and rovibrational transitions of ensembles of trapped HD+ ions. The two-photon transition rates and lightshifts are calculated with the two-photon tensor operator formalism. The rotational lines may be observed with sub-Doppler linewidth at the hertz level and good signal-to-noise ratio, improving the resolution in HD+ spectroscopy beyond the 10−12 level. The experimental accuracy, estimated at the 10−12 level, is comparable with the accuracy of theoretical calculations of HD+ energy levels. An adjustment of selected rotational and rovibrational HD+ lines may add clues to the proton radius puzzle, may provide an independent determination of the Rydberg constant, and may improve the values of proton-to-electron and deuteron-to-proton mass ratios beyond the 10−11 level.

  14. Clarifying the Status of HD 100546 as Observed by the Gemini Planet Imager

    Science.gov (United States)

    Currie, Thayne; Brittain, Sean; Grady, Carol A.; Kenyon, Scott J.; Muto, Takayuki

    2017-12-01

    HD 100546 is a young, early-type star and key laboratory for studying gas giant planet formation. GPI data taken in 2015 and reported by Currie et al. (2015) recover the previously-identified protoplanet candidate HD 100546 b and identify a second emission source at ~13--14 au: either a disk hot spot or a second protoplanetary candidate (HD 100546 "c"). In this short research note, we update the status of HD 100546 as observed by the Gemini Planet Imager by rereducing our original data using a different PSF subtraction method (KLIP instead of A-LOCI), rereducing recently public GPI Campaign Team (GPIES) data, and comparing the quality of the two data sets. Our results support the original findings in Currie et al. (2015).

  15. Onyx HD-500 embolization of intracranial aneurysms: modified technique using continuous balloon inflation under conscious sedation.

    Science.gov (United States)

    Rahme, Ralph; Grande, Andrew; Jimenez, Lincoln; Abruzzo, Todd A; Ringer, Andrew J

    2014-08-01

    The conventional technique of intracranial aneurysm embolization using Onyx HD-500 (ev3 Neurovascular, Irvine, CA, USA) involves repetitive balloon inflation-deflation cycles under general anesthesia. By limiting parent artery occlusion to 5 minutes, this cyclic technique is thought to minimize cerebral ischemia. However, intermittent balloon deflation may lengthen procedure time and allow balloon migration, resulting in intimal injury or Onyx leakage. We report our experience using a modified technique of uninterrupted Onyx injection with continuous balloon occlusion under conscious sedation. All Onyx embolization procedures for unruptured aneurysms performed by the senior author (A.J.R.) between September 2008 and April 2010 were retrospectively reviewed. Demographic, clinical, angiographic, and procedural data were recorded. Twenty-four embolization procedures were performed in 21 patients with 23 aneurysms, including four recurrences. Twenty aneurysms (87%) involved the paraclinoid or proximal supraclinoid internal carotid artery. Size ranged from 2.5 to 24mm and neck diameter from 2 to 8mm. The modified technique was employed in 19 cases. All but one patient (94.4%) tolerated continuous balloon inflation. Complete occlusion was achieved in 20 aneurysms (83.3%) and subtotal occlusion in three (12.5%). Stable angiographic results were seen in 85%, 94%, 94%, and 100% of patients at 6, 12, 24, and 36months, respectively. There were no deaths. Permanent non-disabling neurological morbidity occurred in one patient (4.2%). Minor, transient, and/or angiographic complications were seen in three patients (12.5%), none related to the technique itself. Onyx embolization of unruptured intracranial aneurysms can be safely and effectively performed using continuous balloon inflation under conscious sedation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  16. Warfarin use in hemodialysis patients: what is the risk?

    LENUS (Irish Health Repository)

    Phelan, P J

    2011-03-01

    Background: There is a paucity of data concerning the risks associated with warfarin in hemodialysis (HD) patients. We compared major bleeding episodes in this group with HD patients not receiving warfarin and with a cohort of non-HD patients receiving warfarin. Methods: A retrospective review of 141 HD patients on warfarin (HDW), 704 HD patients not on warfarin (HDNW) and 3,266 non-dialysis warfarin patients (NDW) was performed. Hospital admissions for hemorrhagic events and ischemic strokes were examined as was hospital length of stay and blood product use. INR variability was also assessed. Results: The incidence rates for major hemorrhage per 100 patient years was 10.8 in the HDW group as compared to 8.0 in the HDNW (p = 0.593) and 2.1 in the NDW (p < 0.001) groups. Mean units of red blood cell transfusions required was higher in patients on dialysis with no significant difference between HDW and HDNW groups. The risk of ischemic stroke per 100 patient years was 1.7 in the HDW group as compared to 0.7 in the HDNW groups (p = 0.636) and 0.4 in the NDW (p = 0.003). The HDW group had higher inter-measurement INR variability compared to the NDW group (p = 0.034). In patients with atrial fibrillation, HDW group had a higher incidence of ischemic stroke than the NDW group (2.2 versus 0.4 events per 100 patient years; p = 0.024). Conclusions: This study confirms the higher bleeding risk associated with HD\\/ESRD but suggests that warfarin use in these patients may not add significantly to this risk. We also demonstrated high rates of ischemic stroke in HD patients despite warfarin use. Summary: Our study compares the frequency of major hemorrhage and secondarily, ischemic stroke in HD patients receiving or not receiving warfarin, with non-HD patients receiving warfarin. The major finding was that frequency of hemorrhage was higher in HD patients receiving warfarin than in non-HD patients receiving warfarin, but not different in HD patients with or without warfarin. A

  17. Warfarin use in hemodialysis patients: what is the risk?

    LENUS (Irish Health Repository)

    Phelan, P J

    2012-02-01

    BACKGROUND: There is a paucity of data concerning the risks associated with warfarin in hemodialysis (HD) patients. We compared major bleeding episodes in this group with HD patients not receiving warfarin and with a cohort of non-HD patients receiving warfarin. METHODS: A retrospective review of 141 HD patients on warfarin (HDW), 704 HD patients not on warfarin (HDNW) and 3,266 non-dialysis warfarin patients (NDW) was performed. Hospital admissions for hemorrhagic events and ischemic strokes were examined as was hospital length of stay and blood product use. INR variability was also assessed. RESULTS: The incidence rates for major hemorrhage per 100 patient years was 10.8 in the HDW group as compared to 8.0 in the HDNW (p = 0.593) and 2.1 in the NDW (p < 0.001) groups. Mean units of red blood cell transfusions required was higher in patients on dialysis with no significant difference between HDW and HDNW groups. The risk of ischemic stroke per 100 patient years was 1.7 in the HDW group as compared to 0.7 in the HDNW groups (p = 0.636) and 0.4 in the NDW (p = 0.003). The HDW group had higher inter-measurement INR variability compared to the NDW group (p = 0.034). In patients with atrial fibrillation, HDW group had a higher incidence of ischemic stroke than the NDW group (2.2 versus 0.4 events per 100 patient years; p = 0.024). CONCLUSIONS: This study confirms the higher bleeding risk associated with HD\\/ESRD but suggests that warfarin use in these patients may not add significantly to this risk. We also demonstrated high rates of ischemic stroke in HD patients despite warfarin use. SUMMARY: Our study compares the frequency of major hemorrhage and secondarily, ischemic stroke in HD patients receiving or not receiving warfarin, with non-HD patients receiving warfarin. The major finding was that frequency of hemorrhage was higher in HD patients receiving warfarin than in non-HD patients receiving warfarin, but not different in HD patients with or without warfarin. A

  18. Prognostic factors of infective endocarditis in patients on hemodialysis: A case series from a National Multicenter Registry.

    Science.gov (United States)

    Ramos-Martínez, Antonio; Roque, Fernado; Fariñas, Maria Carmen; Muñoz, Patricia; Verde, Eduardo; Cuerpo, Gregorio Pablo; de Alarcón, Arístides; Lepe, José Antonio; Miró, José María; Plata, Antonio; Goenaga, Miguel Ángel; García-Rosado, Dácil; Martínez-Monzonis, Amparo; de la Torre, Javier; García-Pavía, Pablo

    2017-08-15

    Infective endocarditis (IE) is a severe complication associated with high mortality. To examine the clinical characteristics of IE in hemodialysis (HD) patients and to determine prognostic factors related to HD. From January 2008 to April 2015, 2488 consecutive patients with definite IE were included. Clinical characteristics of IE patients on HD were compared with those of IE patients who were not on HD. A total of 126 patients (63% male, median age: 66years; IQR: 54-74years) with IE (5.1%) were on HD. Fifty-two patients died during hospitalization (41%) and 17 additional patients (14%) died during the first year. The rate of patients who underwent surgery during hospitalization was lower in HD patients (38 patients, 30%) than in non-HD patients (1177 patients, 50%; p70years (OR: 4.1, 95% CI: 1.7-10), heart failure (OR: 3.3, 95% CI: 1.4-7-6), central nervous system (CNS) vascular events (OR: 6.7, 95% CI: 2.1-22) and septic shock (OR: 4.1, 95% CI: 1.4-12.1) were independently associated with fatal outcome in HD patients. Of the 38 patients who underwent surgery, 15 (39.5%) died during hospitalization. HD patients with IE present a high mortality. Advanced age and complications, such as heart failure, CNS stroke or septic shock, are associated with mortality. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. NCBI nr-aa BLAST: CBRC-DMEL-02-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0054 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 0.0 100% ...

  20. NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0048 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 1e-163 91% ...

  1. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74196.1| 5-HT1A [Drosophila melanogaster] gb|AAS74220.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74309.1| 5-HT1A [Drosophila melanogaster] gb|AAS74310.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74335.1| 5-HT1A [Drosophila melanogaster] AAS74196.1 1e-176 97% ...

  2. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-177 97% ...

  3. Bone Morphogenic Protein 4-Smad-Induced Upregulation of Platelet-Derived Growth Factor AA Impairs Endothelial Function.

    Science.gov (United States)

    Hu, Weining; Zhang, Yang; Wang, Li; Lau, Chi Wai; Xu, Jian; Luo, Jiang-Yun; Gou, Lingshan; Yao, Xiaoqiang; Chen, Zhen-Yu; Ma, Ronald Ching Wan; Tian, Xiao Yu; Huang, Yu

    2016-03-01

    Bone morphogenic protein 4 (BMP4) is an important mediator of endothelial dysfunction in cardio-metabolic diseases, whereas platelet-derived growth factors (PDGFs) are major angiogenic and proinflammatory mediator, although the functional link between these 2 factors is unknown. The present study investigated whether PDGF mediates BMP4-induced endothelial dysfunction in diabetes mellitus. We generated Ad-Bmp4 to overexpress Bmp4 and Ad-Pdgfa-shRNA to knockdown Pdgfa in mice through tail intravenous injection. SMAD4-shRNA lentivirus, SMAD1-shRNA, and SMAD5 shRNA adenovirus were used for knockdown in human and mouse endothelial cells. We found that PDGF-AA impaired endothelium-dependent vasodilation in aortas and mesenteric resistance arteries. BMP4 upregulated PDGF-AA in human and mouse endothelial cells, which was abolished by BMP4 antagonist noggin or knockdown of SMAD1/5 or SMAD4. BMP4-impared relaxation in mouse aorta was also ameliorated by PDGF-AA neutralizing antibody. Tail injection of Ad-Pdgfa-shRNA ameliorates endothelial dysfunction induced by Bmp4 overexpression (Ad-Bmp4) in vivo. Serum PDGF-AA was elevated in both diabetic patients and diabetic db/db mice compared with nondiabetic controls. Pdgfa-shRNA or Bmp4-shRNA adenovirus reduced serum PDGF-AA concentration in db/db mice. PDGF-AA neutralizing antibody or tail injection with Pdgfa-shRNA adenovirus improved endothelial function in aortas and mesenteric resistance arteries from db/db mice. The effect of PDGF-AA on endothelial function in mouse aorta was also inhibited by Ad-Pdgfra-shRNA to inhibit PDGFRα. The present study provides novel evidences to show that PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms. Inhibition of PGDF-AA ameliorates vascular dysfunction in diabetic mice. © 2016 American Heart Association, Inc.

  4. The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

    Energy Technology Data Exchange (ETDEWEB)

    Kubota, Akira [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Bainy, Afonso C.D. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Departamento de Bioquímica, CCB, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Woodin, Bruce R.; Goldstone, Jared V. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States)

    2013-10-01

    The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

  5. The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

    International Nuclear Information System (INIS)

    Kubota, Akira; Bainy, Afonso C.D.; Woodin, Bruce R.; Goldstone, Jared V.; Stegeman, John J.

    2013-01-01

    The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

  6. NBM-HD-1: A Novel Histone Deacetylase Inhibitor with Anticancer Activity

    Directory of Open Access Journals (Sweden)

    Wei-Jan Huang

    2012-01-01

    Full Text Available HDAC inhibitors (HDACis have been developed as promising anticancer agents in recent years. In this study, we synthesized and characterized a novel HDACi, termed NBM-HD-1. This agent was derived from the semisynthesis of propolin G, isolated from Taiwanese green propolis (TGP, and was shown to be a potent suppressor of tumor cell growth in human breast cancer cells (MCF-7 and MDA-MB-231 and rat glioma cells (C6, with an IC50 ranging from 8.5 to 10.3 μM. Western blot demonstrated that levels of p21(Waf1/Cip1, gelsolin, Ac-histone 4, and Ac-tubulin markedly increased after treatment of cancer cells with NBM-HD-1. After NBM-HD-1 treatment for 1–4 h, p-PTEN and p-AKT levels were markedly decreased. Furthermore, we also found the anticancer activities of NBM-HD-1 in regulating cell cycle regulators. Treatment with NBM-HD-1, p21(Waf1/Cip1 gene expression had markedly increased while cyclin B1 and D1 gene expressions had markedly decreased. On the other hand, we found that NBM-HD-1 increased the expressions of tumor-suppressor gene p53 in a dose-dependent manner. Finally, we showed that NBM-HD-1 exhibited potent antitumor activity in a xenograft model. In conclusion, this study demonstrated that this compound, NBM-HD-1, is a novel and potent HDACi with anticancer activity in vitro and in vivo.

  7. Secondary electron emission from solid HD and a solid H2-D2 mixture

    DEFF Research Database (Denmark)

    Sørensen, H.; Børgesen, P.; Hao-Ming, Chen

    1983-01-01

    Secondary electron emission from solid HD and a solid 0.6 H2 + 0.4 D2 mixture has been studied for electron and hydrogen ion bombardment at primary energies from 0.5 to 3 keV and 2 to 10 keV/amu, respectively. The yield for solid HD is well explained by a simple stoichiometric model of the low...

  8. Asteroseismic Investigations of the Binary System HD 176465

    Science.gov (United States)

    Gai, Ning; Basu, Sarbani; Tang, Yanke

    2018-04-01

    HD 176465 is a binary system for which both components are solar-like pulsators and oscillation frequencies were observed by the Kepler mission. In this paper, we have modeled the asteroseismic and spectroscopic data of the stars, and have determined their convection-zone helium abundances using the signatures left by the He II ionization zone on the mode frequencies. As expected, we find that the components of the binary are of the same age within uncertainties (3.087 ± 0.580 Gyr and 3.569 ± 0.912 Gyr); they also have the same initial helium abundance (Y init = 0.253 ± 0.006 and 0.254 ± 0.008). Their current metallicity ([Fe/H] = ‑0.275 ± 0.04 and ‑0.285 ± 0.04) is also the same within errors. Fits to the signature of the He II acoustic glitch yield current helium abundances of Y A = 0.224 ± 0.006 and Y B = 0.233 ± 0.008 for the two components. Analyzing the complete ensemble of models generated for this investigation, we find that both the amplitude and acoustic depth of the glitch signature arising from the second helium ionization zone and the base of the convection zone (CZ) are functions of mass. We show that the acoustic depths of these glitches are positively correlated with each other. The analysis can help us to detect the internal structure and constrain the chemical compositions.

  9. SUBMILLIMETER POLARIZATION OBSERVATION OF THE PROTOPLANETARY DISK AROUND HD 142527

    Energy Technology Data Exchange (ETDEWEB)

    Kataoka, Akimasa; Dullemond, Cornelis P.; Pohl, Adriana [Zentrum für Astronomie der Universität Heidelberg, Institut für Theoretische Astrophysik, Albert-Ueberle-Str. 2, D-69120 Heidelberg (Germany); Tsukagoshi, Takashi; Momose, Munetake [College of Science, Ibaraki University, 2-1-1 Bunkyo, Mito, Ibaraki 310-8512 (Japan); Nagai, Hiroshi [National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Muto, Takayuki [Division of Liberal Arts, Kogakuin University, 1-24-2 Nishi-Shinjuku, Shinjuku-ku, Tokyo 163-8677 (Japan); Fukagawa, Misato [Division of Particle and Astrophysical Science, Graduate School of Science, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi 464-8602 (Japan); Shibai, Hiroshi [Graduate School of Science, Osaka University, 1-1 Machikaneyama, Toyonaka, Osaka 560-0043 (Japan); Hanawa, Tomoyuki [Center for Frontier Science, Chiba University, 1-33 Yayoi-cho, Inage, Chiba 263-8522 (Japan); Murakawa, Koji, E-mail: kataoka@uni-heidelberg.de [College of General Education, Osaka Sangyo University, 3-1-1, Nakagaito, Daito, Osaka 574-8530 (Japan)

    2016-11-10

    We present the polarization observations toward the circumstellar disk around HD 142527 by using Atacama Large Millimeter/submillimeter Array at the frequency of 343 GHz. The beam size is 0.″51 × 0.″44, which corresponds to the spatial resolution of ∼71 × 62 au. The polarized intensity displays a ring-like structure with a peak located on the east side with a polarization fraction of P = 3.26 ± 0.02%, which is different from the peak of the continuum emission from the northeast region. The polarized intensity is significantly weaker at the peak of the continuum where P = 0.220 ± 0.010%. The polarization vectors are in the radial direction in the main ring of the polarized intensity, while there are two regions outside at the northwest and northeast areas where the vectors are in the azimuthal direction. If the polarization vectors represent the magnetic field morphology, the polarization vectors indicate the toroidal magnetic field configuration on the main ring and the poloidal fields outside. On the other hand, the flip of the polarization vectors is predicted by the self-scattering of thermal dust emission due to the change of the direction of thermal radiation flux. Therefore, we conclude that self-scattering of thermal dust emission plays a major role in producing polarization at millimeter wavelengths in this protoplanetary disk. Also, this puts a constraint on the maximum grain size to be approximately 150 μ m if we assume compact spherical dust grains.

  10. Multiple spiral patterns in the transitional disk of HD 100546

    Science.gov (United States)

    Boccaletti, A.; Pantin, E.; Lagrange, A.-M.; Augereau, J.-C.; Meheut, H.; Quanz, S. P.

    2013-12-01

    Context. Protoplanetary disks around young stars harbor many structures related to planetary formation. Of particular interest, spiral patterns were discovered among several of these disks and are expected to be the sign of gravitational instabilities leading to giant planet formation or gravitational perturbations caused by already existing planets. In this context, the star HD 100546 presents some specific characteristics with a complex gaseous and dusty disk that includes spirals, as well as a possible planet in formation. Aims: The objective of this study is to analyze high-contrast and high angular resolution images of this emblematic system to shed light on critical steps in planet formation. Methods: We retrieved archival images obtained at Gemini in the near IR (Ks band) with the instrument NICI and processed the data using an advanced high contrast imaging technique that takes advantage of the angular differential imaging. Results: These new images reveal the spiral pattern previously identified with Hubble Space Telescope (HST) with an unprecedented resolution, while the large-scale structure of the disk is mostly cancelled by the data processing. The single pattern to the southeast in HST images is now resolved into a multi-armed spiral pattern. Using two models of a gravitational perturber orbiting in a gaseous disk, we attempted to constrain the characteristics of this perturber, assuming that each spiral is independent, and drew qualitative conclusions. The non-detection of the northeast spiral pattern observed in HST allows putting a lower limit on the intensity ratio between the two sides of the disk, which if interpreted as forward scattering, yields a larger anisotropic scattering than is derived in the visible. Also, we find that the spirals are likely to be spatially resolved with a thickness of about 5-10 AU. Finally, we did not detect the candidate planet in formation recently discovered in the Lp band, with a mass upper limit of 16-18 MJ

  11. Does the debris disk around HD 32297 contain cometary grains?

    Energy Technology Data Exchange (ETDEWEB)

    Rodigas, Timothy J.; Hinz, Philip M.; Bailey, Vanessa; Defrere, Denis; Leisenring, Jarron; Schneider, Glenn; Skemer, Andrew J.; Vaitheeswaran, Vidhya [Steward Observatory, The University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Debes, John H. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Mamajek, Eric E.; Pecaut, Mark J. [Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627-0171 (United States); Currie, Thayne [University of Toronto, 50 St. George Street, Toronto, ON M5S 1A1 (Canada); De Rosa, Robert J.; Ward-Duong, Kimberly [School of Earth and Space Exploration, Arizona State University, P.O. Box 871404, Tempe, AZ 85287-1404 (United States); Hill, John M. [Large Binocular Telescope Observatory, University of Arizona, Tucson, AZ 85721 (United States); Skrutskie, Michael, E-mail: rodigas@as.arizona.edu [Department of Astronomy, University of Virginia, 530 McCormick Road, Charlottesville, VA 22903 (United States)

    2014-03-01

    We present an adaptive optics imaging detection of the HD 32297 debris disk at L' (3.8 μm) obtained with the LBTI/LMIRcam infrared instrument at the Large Binocular Telescope. The disk is detected at signal-to-noise ratio per resolution element ∼3-7.5 from ∼0.''3 to 1.''1 (30-120 AU). The disk at L' is bowed, as was seen at shorter wavelengths. This likely indicates that the disk is not perfectly edge-on and contains highly forward-scattering grains. Interior to ∼50 AU, the surface brightness at L' rises sharply on both sides of the disk, which was also previously seen at Ks band. This evidence together points to the disk containing a second inner component located at ≲50 AU. Comparing the color of the outer (50

  12. Spectroscopic Peculiarity of the Herbig Be Star HD 259431

    Science.gov (United States)

    Pogodin, M. A.; Pavlovskij, S. E.; Drake, N. A.; Beskrovnaya, N. G.; Kozlova, O. V.; Alekseev, I. Yu.; Borges Fernandes, M.; Pereira, C. B.; Valyavin, G.

    2017-06-01

    High-resolution spectra of the Herbig Be star HD 259431 obtained in 2010-2016 at three observatories (Crimean AO, ESO in Chile, and OAN SPN in Mexico) are analysed. The object demonstrates a very rich emission line profile spectrum. The bulk of the lines exhibit double-peaked emission profiles and originate in the gaseous disk. The atmospheric lines are unusually shallow, and majority of them are distorted by the circumstellar (CS) contribution. Moreover, we have revealed that they are overlapped with an additional continuum emission. Using the observed ratio of the equivalent widths of two He I λ 4009 and 4026 lines, we estimated the spectral type of the object as B5 V. We also constructed the spectral energy distribution of the additional continuum using wide wings of the atmospheric Hβ-Hɛ lines free of the CS contribution. The continuum corresponds to the blue part of the black body spectrum. The Hβ - Hɛ Balmer emission lines show very variable profiles looking as either of P Cyg-type or a double-peaked emission line with a depression of the red wing. We found the period of this variability P = 2.630d and interpreted it as a sign of a rotating magnetosphere of the star with the magnetic axis inclined to the rotation axis. At different phases of rotation, the observer can see either an accretion flow at high magnetic latitudes or a wind zone at lower latitudes. We also estimated the inclination of the rotation axis i = 52°±1°.

  13. Fusion with highly spin polarized HD and D2

    International Nuclear Information System (INIS)

    Honig, A.; Letzring, S.; Skupsky, S.

    1993-01-01

    The experimental efforts over the past 5 years have been aimed at carrying out ICF shots with spin-polarized D fuel. The authors successfully prepared polarized D in HD, and solved the problems of loading target shells with their carefully prepared isotopic mixtures, polarizing them so that the D polarization remains metastably frozen-in for about half a day, and carrying out the various cold transfer requirements at Syracuse, where the target is prepared, and at Rochester, where the cold target is inserted into the OMEGA fusion chamber. A principal concern during this past year was overcoming difficulties encountered in maintaining the integrity of the fragile cold target during the multitude of cold-transfers required for the experiment. These difficulties arose from insufficient rigidity of the cold transfer systems, which were constrained to be of small diameter by the narrow central access bore of the dilution refrigerator, and were exacerbated by the multitude of required target shell manipulations between different environments, each with different coupling geometry, including target shell permeation, polarization, storage, transport, retrieval and insertion into OMEGA. The authors did solve all of these problems, and were able to position a cold, high density but unpolarized target with required precision in OMEGA. Upon shooting the accurately positioned unpolarized high density cold target, no neutron yield was observed. Inspection inside the OMEGA tank after the shot indicated the absence of neutron yield was due to mal-timing or insufficient retraction rate of OMEGA's fast shroud mechanism, resulting in interception of at least 20 of the 24 laser beams by the faulty shroud. In spite of this, all elements of the complex experiment the authors originally undertook have been successfully demonstrated, and the cold retrieval concepts and methods they developed are being utilized on the ICF upgrades at Rochester and at Livermore

  14. Exocometary gas in the HD 181327 debris ring

    Science.gov (United States)

    Marino, S.; Matrà, L.; Stark, C.; Wyatt, M. C.; Casassus, S.; Kennedy, G.; Rodriguez, D.; Zuckerman, B.; Perez, S.; Dent, W. R. F.; Kuchner, M.; Hughes, A. M.; Schneider, G.; Steele, A.; Roberge, A.; Donaldson, J.; Nesvold, E.

    2016-08-01

    An increasing number of observations have shown that gaseous debris discs are not an exception. However, until now, we only knew of cases around A stars. Here we present the first detection of 12CO (2-1) disc emission around an F star, HD 181327, obtained with the Atacama Large Millimeter/submillimeter Array (ALMA) observations at 1.3 mm. The continuum and CO emission are resolved into an axisymmetric disc with ring-like morphology. Using a Markov chain Monte Carlo method coupled with radiative transfer calculations, we study the dust and CO mass distribution. We find the dust is distributed in a ring with a radius of 86.0 ± 0.4 au and a radial width of 23.2 ± 1.0 au. At this frequency, the ring radius is smaller than in the optical, revealing grain size segregation expected due to radiation pressure. We also report on the detection of low-level continuum emission beyond the main ring out to ˜200 au. We model the CO emission in the non-local thermodynamic equilibrium regime and we find that the CO is co-located with the dust, with a total CO gas mass ranging between 1.2 × 10-6 M⊕ and 2.9 × 10-6 M⊕, depending on the gas kinetic temperature and collisional partners densities. The CO densities and location suggest a secondary origin, I.e. released from icy planetesimals in the ring. We derive a CO+CO2 cometary composition that is consistent with Solar system comets. Due to the low gas densities, it is unlikely that the gas is shaping the dust distribution.

  15. Air assisted dispersive liquid-liquid microextraction with solidification of the floating organic droplets (AA-DLLME-SFO) and UHPLC-PDA method: Application to antibiotics analysis in human plasma of hospital acquired pneumonia patients.

    Science.gov (United States)

    Ferrone, Vincenzo; Cotellese, Roberto; Carlucci, Maura; Di Marco, Lorenzo; Carlucci, Giuseppe

    2018-03-20

    An ultra high-performance liquid chromatographic (UHPLC) method with PDA detection was developed and validated for the simultaneous quantification of metronidazole, meropenem, ciprofloxacin, linezolid and piperacillin in human plasma and applied to patients suffering from hospital acquired pneumonia (HAP). The method uses an air assisted dispersive liquid-liquid microextraction for sample preparation. All parameters in the extraction step, including selection of extractant, amount of extractant, ionic strength, pH, and extraction cycles, were investigated and optimized. Chromatography was carried out using a Poroshell 120 SB C 18 (50 × 2.1 mm I.D. 2.6 μm particle size) column and a gradient mobile phase consisting of ammonium acetate buffer (10 mM, pH 4.0) (eluent A); and a mixture of acetonitrile-methanol in a ratio (80/20)(eluent B). Ulifloxacin was used as internal standard. The method demonstrated good linearity with correlation coefficients, r 2  > 0.9995 for the drugs, as well as high precision (RSD% ≤ 9.87%), accuracy ranged from -8.14% to +8.98. The enrichment factor (EF) obtained ranged within 87 and 121. During the validation, the concentrations of the analytes were found to be stable after 3 freeze-thaw cycles and for at least 24 h after extraction. Subsequently, this method was used to quantify the drugs in patients with HAP in order to establish if the dosage regimen given was sufficient to eradicate the infection at the target site. Copyright © 2017. Published by Elsevier B.V.

  16. FIVE PLANETS AND AN INDEPENDENT CONFIRMATION OF HD 196885Ab FROM LICK OBSERVATORY

    International Nuclear Information System (INIS)

    Fischer, Debra; Isaacson, Howard; Giguere, Matt; McCarthy, Chris; Driscoll, Peter; Marcy, Geoffrey W.; Howard, Andrew; Peek, Katherine; Valenti, Jeff; Wright, Jason T.; Henry, Gregory W.; Johnson, John Asher

    2009-01-01

    We present time series Doppler data from Lick Observatory that reveal the presence of long-period planetary companions orbiting nearby stars. The typical eccentricity of these massive planets are greater than the mean eccentricity of known exoplanets. HD 30562b has Msin i = 1.29 M Jup , with semimajor axis of 2.3 AU and eccentricity 0.76. The host star has a spectral type F8V and is metal rich. HD 86264b has Msin i = 7.0 M Jup , a rel = 2.86 AU, an eccentricity e = 0.7 and orbits a metal-rich, F7V star. HD 87883b has Msin i = 1.78 M Jup , a rel = 3.6 AU, e = 0.53 and orbits a metal-rich K0V star. HD 89307b has Msin i = 1.78 M Jup , a rel = 3.3 AU, e = 0.24 and orbits a G0V star with slightly subsolar metallicity. HD 148427b has Msin i = 0.96 M Jup , a rel = 0.93 AU, eccentricity of 0.16 and orbits a metal rich K0 subgiant. We also present velocities for a planet orbiting the F8V metal-rich binary star, HD 196885A. The planet has Msin i = 2.58 M Jup , a rel = 2.37 AU, and orbital eccentricity of 0.48, in agreement with the independent discovery by Correia et al.

  17. A SEARCH FOR THE TRANSIT OF HD 168443b: IMPROVED ORBITAL PARAMETERS AND PHOTOMETRY

    Energy Technology Data Exchange (ETDEWEB)

    Pilyavsky, Genady; Mahadevan, Suvrath; Wright, Jason T.; Wang, Xuesong X. [Department of Astronomy and Astrophysics, Pennsylvania State University, 525 Davey Laboratory, University Park, PA 16802 (United States); Kane, Stephen R.; Ciardi, David R.; Dragomir, Diana; Von Braun, Kaspar [NASA Exoplanet Science Institute, Caltech, MS 100-22, 770 South Wilson Avenue, Pasadena, CA 91125 (United States); Howard, Andrew W. [Department of Astronomy, University of California, Berkeley, CA 94720 (United States); De Pree, Chris; Marlowe, Hannah [Department of Physics and Astronomy, Agnes Scott College, 141 East College Avenue, Decatur, GA 30030 (United States); Fischer, Debra [Department of Astronomy, Yale University, New Haven, CT 06511 (United States); Henry, Gregory W. [Center of Excellence in Information Systems, Tennessee State University, 3500 John A. Merritt Blvd., Box 9501, Nashville, TN 37209 (United States); Jensen, Eric L. N. [Department of Physics and Astronomy, Swarthmore College, Swarthmore, PA 19081 (United States); Laughlin, Gregory [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States); Rabus, Markus, E-mail: gcp5017@psu.edu, E-mail: suvrath@astro.psu.edu [Departamento de Astonomia y Astrofisica, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile)

    2011-12-20

    The discovery of transiting planets around bright stars holds the potential to greatly enhance our understanding of planetary atmospheres. In this work we present the search for transits of HD 168443b, a massive planet orbiting the bright star HD 168443 (V = 6.92) with a period of 58.11 days. The high eccentricity of the planetary orbit (e = 0.53) significantly enhances the a priori transit probability beyond that expected for a circular orbit, making HD 168443 a candidate for our ongoing Transit Ephemeris Refinement and Monitoring Survey. Using additional radial velocities from Keck High Resolution Echelle Spectrometer, we refined the orbital parameters of this multi-planet system and derived a new transit ephemeris for HD 168443b. The reduced uncertainties in the transit window make a photometric transit search practicable. Photometric observations acquired during predicted transit windows were obtained on three nights. Cerro Tololo Inter-American Observatory 1.0 m photometry acquired on 2010 September 7 had the required precision to detect a transit but fell just outside of our final transit window. Nightly photometry from the T8 0.8 m automated photometric telescope at Fairborn Observatory, acquired over a span of 109 nights, demonstrates that HD 168443 is constant on a timescale of weeks. Higher-cadence photometry on 2011 April 28 and June 25 shows no evidence of a transit. We are able to rule out a non-grazing transit of HD 168443b.

  18. A Search for the Transit of HD 168443b: Improved Orbital Parameters and Photometry

    Science.gov (United States)

    Pilyavsky, Genady; Mahadevan, Suvrath; Kane, Stephen R.; Howard, Andrew W.; Ciardi, David R.; de Pree, Chris; Dragomir, Diana; Fischer, Debra; Henry, Gregory W.; Jensen, Eric L. N.; Laughlin, Gregory; Marlowe, Hannah; Rabus, Markus; von Braun, Kaspar; Wright, Jason T.; Wang, Xuesong X.

    2011-12-01

    The discovery of transiting planets around bright stars holds the potential to greatly enhance our understanding of planetary atmospheres. In this work we present the search for transits of HD 168443b, a massive planet orbiting the bright star HD 168443 (V = 6.92) with a period of 58.11 days. The high eccentricity of the planetary orbit (e = 0.53) significantly enhances the a priori transit probability beyond that expected for a circular orbit, making HD 168443 a candidate for our ongoing Transit Ephemeris Refinement and Monitoring Survey. Using additional radial velocities from Keck High Resolution Echelle Spectrometer, we refined the orbital parameters of this multi-planet system and derived a new transit ephemeris for HD 168443b. The reduced uncertainties in the transit window make a photometric transit search practicable. Photometric observations acquired during predicted transit windows were obtained on three nights. Cerro Tololo Inter-American Observatory 1.0 m photometry acquired on 2010 September 7 had the required precision to detect a transit but fell just outside of our final transit window. Nightly photometry from the T8 0.8 m automated photometric telescope at Fairborn Observatory, acquired over a span of 109 nights, demonstrates that HD 168443 is constant on a timescale of weeks. Higher-cadence photometry on 2011 April 28 and June 25 shows no evidence of a transit. We are able to rule out a non-grazing transit of HD 168443b.

  19. Benefits of a low intensity exercise programme during haemodialysis sessions in elderly patients

    Directory of Open Access Journals (Sweden)

    Vicent Esteve Simo

    2015-07-01

    Conclusions: (1 An adapted low intensity exercise programme improved muscle strength, functional capacity and health-related quality of life in our elderly patients on HD. (2 Our results highlight the benefits from exercise in HD patients even in this elderly population. (3 In elderly patients on HD, it is worth considering an adapted low intensity intradialytic exercise programme as a part of a comprehensive care.

  20. Effect of pressurized steam on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Ambat, Rajan

    2012-01-01

    Purpose - The purpose of this paper is to understand the effect of pressurized steam on surface changes, structures of intermetallic particles and corrosion behavior of AA1050 aluminium. Design/methodology/approach - Industrially pure aluminium (AA1050, 99.5 per cent) surfaces were exposed...... reactivities was observed due to the formation of the compact oxide layer. Originality/value - This paper reveals a detailed investigation of how pressurized steam can affect the corrosion behaviour of AA1050 aluminium and the structure of Fe-containing intermetallic particles....

  1. Corrosion issues of powder coated AA6060 aluminium profiles

    DEFF Research Database (Denmark)

    Din, Rameez Ud; Valgarðsson, Smári; Jellesen, Morten Stendahl

    2015-01-01

    In this study detailed microstructural investigation of the reason for unexpected corrosion of powder coated aluminium alloy AA6060 windows profiles has been performed. The results from this study reveals that the failure of the window profiles was originated from the surface defects present...... on the extruded AA6060 aluminium profile after metallurgical process prior to powder coating. Surface defects are produced due to intermetallic particles in the alloy, which disturb the flow during the extrusion process. The corrosion mechanism leading to the failure of the powder coated AA6060 aluminium profiles...

  2. Wound healing of critical limb ischemia with tissue loss in patients on hemodialysis.

    Science.gov (United States)

    Honda, Yohsuke; Hirano, Keisuke; Yamawaki, Masahiro; Mori, Shinsuke; Shirai, Shigemitsu; Makino, Kenji; Tokuda, Takahiro; Takama, Takuro; Tsutumi, Masakazu; Sakamoto, Yasunari; Takimura, Hideyuki; Kobayashi, Norihiro; Araki, Motoharu; Ito, Yoshiaki

    2017-06-01

    We assessed wound healing in patients on hemodialysis (HD) with critical limb ischemia (CLI). This study enrolled 267 patients (including 120 patients on HD and 147 patients not on HD) who underwent endovascular therapy (EVT) for CLI. The primary endpoint was wound-healing rate at two years. Secondary endpoints were time to wound healing, wound recurrence rate, and limb salvage at two years. The percentage of male and young patients was higher in the HD patients ( p healing rate was significantly lower in HD patients (79.5% vs. 92.4%, p healing was significantly longer in HD patients (median 132 days vs. 82 days, p = 0.005). Wound recurrence was observed more frequently in HD patients (25.0% vs. 10.2%, p = 0.007). Limb salvage (72.8% vs. 86.4%, p = 0.002) was significantly lower in HD patients. In a cox proportional hazard model, HD was an independent predictor of wound healing (risk ratio (RR), 0.46; 95% confidence interval (CI), 0.33-0.62; p healing, and wound recurrence.

  3. Detection of AA-type amyloid protein in labial salivary glands.

    Science.gov (United States)

    Sacsaquispe, Sonia-Julia; Antúnez-de Mayolo, Eleazar-Antonio; Vicetti, Rodolfo; Delgado, Wilson-Alejandro

    2011-03-01

    Among the diverse forms of amyloidosis, secondary type is the most frequent one. Diagnosis of amyloid deposition is based on the identification of the fibrillary protein amyloid by means of Congo Red (CR) or crystal violet (CV) stains, but these techniques do not differentiate between the different types of amyloid fibrils. The aim of this study was to identify by immunofluorescence (IF) AA amyloid a pathological fibrillar low-molecular-weight protein formed by cleavage of serum amyloid A (SAA) protein in labial salivary gland (LSG) biopsies from patients with secondary amyloidosis. 98 LSG were studied, 65 were from patients with secondary amyloidosis and 33 from subjects with chronic inflammatory diseases without evidence of this anomaly. All sections were stained with hematoxylin and eosin (H &E), CV, CR and IF using anti-AA antibodies. Positive and negative controls were used for all techniques. CV and CR demonstrated that the amyloid substance was found mainly distributed periductally (93.8%), followed by periacinar and perivascular locations (p <0.001); however, the IF demonstrated that amyloid AA substance predominates in the periacinar area (73.8%), followed by periductal and perivascular locations (p <0.001). IF has a sensitivity of 83%, 100% of specificity, 100% of predictive positive value and 75% of predictive negative value. The results of this study confirm the efficacy of the LSG biopsy as a highly reliable method for diagnosis of secondary amyloidosis.

  4. Inclusive cross sections in AA collisions at high energies

    International Nuclear Information System (INIS)

    Braun, M.A.

    1988-01-01

    Inclusive cross sections in AA collisions at high energies are considered in the Glauber multiple scattering theory taking into account many-nucleon collisions. Correspondence is found between the AA amplitude and the effective action of the two-dimensional quantum field theory with exponential interaction. The tree and one-loop contributions are calculated in this formalism. The rules are derived, which relate the absorption part of the AA-collision amplitudes associated with various inclusive cross sections to the absorption parts of NN amplitudes. These rules generalize the well-known Agranowsky-Gribov-Kanchelli rules for hh and hA collisions. Formulas are written for single and double inclusive cross sections in AA collisions

  5. AtHD2D gene plays a role in plant growth, development and response to abiotic stresses in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Zhaofen eHan

    2016-03-01

    Full Text Available Abstracts: The histone deacetylases play important roles in the regulation of gene expression and the subsequent control of a number of important biological processes, including those involved in the response to environmental stress. A specific group of histone deacetylase genes, HD2, is present in plants. In Arabidopsis, HD2s include HD2A, HD2B, HD2C and HD2D. Previous research showed that HD2A, HD2B and HD2C are more related in terms of expression and function, but not HD2D. In this report, we studied different aspects of AtHD2D in Arabidopsis with respect to plant response to drought and other abiotic stresses. Bioinformatics analysis indicates that HD2D is distantly related to other HD2 genes. Transient expression in Nicotiana benthamiana and stable expression in Arabidopsis of AtHD2D fused with gfp showed that AtHD2D was expressed in the nucleus. Overexpression of AtHD2D resulted in developmental changes including fewer main roots, more lateral roots, and a higher root:shoot ratio. Seed germination and plant flowering time were delayed in transgenic plants expressing AtHD2D, but these plants exhibited higher degrees of tolerance to abiotic stresses, including drought, salt and cold stresses. Physiological studies indicated that the malondialdehyde (MDA content was high in wild-type plants but in plants overexpressing HD2D the MDA level increased slowly in response to stress conditions of drought, cold, and salt stress. Furthermore, electrolyte leakage in leaf cells of wild type plants increased but remained stable in transgenic plants. Our results indicate that AtHD2D is unique among HD2 genes and it plays a role in plant growth and development regulation and these changes can modulate plant stress responses.

  6. Bake hardening of nanograin AA7075 aluminum alloy

    International Nuclear Information System (INIS)

    Dehghani, Kamran

    2011-01-01

    Highlights: ► The bake hardening behavior of AA7075 was studied and compared with its coarse-grain counterpart. ► Nanograin AA7075 exhibited 88–100% increase in bake hardenability. ► Nanograin AA7075 exhibited 36–38% increase in final yield strength after baking. ► Maximum bake hardenability and final yield stress were about 185 MPa and 719 MPa. - Abstract: In the present work, the bake hardening of nanostructured AA7075 aluminum alloy was compared with that of its coarse-grain counterpart. Surface severe plastic deformation (SSPD) was used to produce nanograin layers on both surfaces of workpieces. The nanostructured layers were characterized using scanning electron microscopy (SEM) and atomic force microscopy (AFM) techniques. The thickness of nanostructured layer, having the grains of 50–110 nm, was about 75 μm on each side of workpiece. The bake hardenability of nanograin and coarse-grain AA7075 was then compared by pre-straining to 2, 4 and 6% followed by baking at 100 °C and 200 °C for 20 min. Comparing to coarse-grain case, there was about 88–100% increase in bake hardenability and about 36–38% increase in yield strength after the bake hardening of present nanograin AA7075. Such an increase in bake hardenability and strength was achieved when the thickness of two nanograin layers was about only one-tenth of the whole thickness.

  7. Quantitative Gait Analysis in Patients with Huntington’s Disease

    Directory of Open Access Journals (Sweden)

    Seon Jong Pyo

    2017-09-01

    Full Text Available Objective Gait disturbance is the main factor contributing to a negative impact on quality of life in patients with Huntington’s disease (HD. Understanding gait features in patients with HD is essential for planning a successful gait strategy. The aim of this study was to investigate temporospatial gait parameters in patients with HD compared with healthy controls. Methods We investigated 7 patients with HD. Diagnosis was confirmed by genetic analysis, and patients were evaluated with the Unified Huntington’s Disease Rating Scale (UHDRS. Gait features were assessed with a gait analyzer. We compared the results of patients with HD to those of 7 age- and sex-matched normal controls. Results Step length and stride length were decreased and base of support was increased in the HD group compared to the control group. In addition, coefficients of variability for step and stride length were increased in the HD group. The HD group showed slower walking velocity, an increased stance/swing phase in the gait cycle and a decreased proportion of single support time compared to the control group. Cadence did not differ significantly between groups. Among the UHDRS subscores, total motor score and total behavior score were positively correlated with step length, and total behavior score was positively correlated with walking velocity in patients with HD. Conclusion Increased variability in step and stride length, slower walking velocity, increased stance phase, and decreased swing phase and single support time with preserved cadence suggest that HD gait patterns are slow, ataxic and ineffective. This study suggests that quantitative gait analysis is needed to assess gait problems in HD.

  8. A Petunia Homeodomain-Leucine Zipper Protein, PhHD-Zip, Plays an Important Role in Flower Senescence

    Science.gov (United States)

    Chang, Xiaoxiao; Donnelly, Linda; Sun, Daoyang; Rao, Jingping; Reid, Michael S.; Jiang, Cai-Zhong

    2014-01-01

    Flower senescence is initiated by developmental and environmental signals, and regulated by gene transcription. A homeodomain-leucine zipper transcription factor, PhHD-Zip, is up-regulated during petunia flower senescence. Virus-induced gene silencing of PhHD-Zip extended flower life by 20% both in unpollinated and pollinated flowers. Silencing PhHD-Zip also dramatically reduced ethylene production and the abundance of transcripts of genes involved in ethylene (ACS, ACO), and ABA (NCED) biosynthesis. Abundance of transcripts of senescence-related genes (SAG12, SAG29) was also dramatically reduced in the silenced flowers. Over-expression of PhHD-Zip accelerated petunia flower senescence. Furthermore, PhHD-Zip transcript abundance in petunia flowers was increased by application of hormones (ethylene, ABA) and abiotic stresses (dehydration, NaCl and cold). Our results suggest that PhHD-Zip plays an important role in regulating petunia flower senescence. PMID:24551088

  9. A Petunia homeodomain-leucine zipper protein, PhHD-Zip, plays an important role in flower senescence.

    Science.gov (United States)

    Chang, Xiaoxiao; Donnelly, Linda; Sun, Daoyang; Rao, Jingping; Reid, Michael S; Jiang, Cai-Zhong

    2014-01-01

    Flower senescence is initiated by developmental and environmental signals, and regulated by gene transcription. A homeodomain-leucine zipper transcription factor, PhHD-Zip, is up-regulated during petunia flower senescence. Virus-induced gene silencing of PhHD-Zip extended flower life by 20% both in unpollinated and pollinated flowers. Silencing PhHD-Zip also dramatically reduced ethylene production and the abundance of transcripts of genes involved in ethylene (ACS, ACO), and ABA (NCED) biosynthesis. Abundance of transcripts of senescence-related genes (SAG12, SAG29) was also dramatically reduced in the silenced flowers. Over-expression of PhHD-Zip accelerated petunia flower senescence. Furthermore, PhHD-Zip transcript abundance in petunia flowers was increased by application of hormones (ethylene, ABA) and abiotic stresses (dehydration, NaCl and cold). Our results suggest that PhHD-Zip plays an important role in regulating petunia flower senescence.

  10. A Petunia homeodomain-leucine zipper protein, PhHD-Zip, plays an important role in flower senescence.

    Directory of Open Access Journals (Sweden)

    Xiaoxiao Chang

    Full Text Available Flower senescence is initiated by developmental and environmental signals, and regulated by gene transcription. A homeodomain-leucine zipper transcription factor, PhHD-Zip, is up-regulated during petunia flower senescence. Virus-induced gene silencing of PhHD-Zip extended flower life by 20% both in unpollinated and pollinated flowers. Silencing PhHD-Zip also dramatically reduced ethylene production and the abundance of transcripts of genes involved in ethylene (ACS, ACO, and ABA (NCED biosynthesis. Abundance of transcripts of senescence-related genes (SAG12, SAG29 was also dramatically reduced in the silenced flowers. Over-expression of PhHD-Zip accelerated petunia flower senescence. Furthermore, PhHD-Zip transcript abundance in petunia flowers was increased by application of hormones (ethylene, ABA and abiotic stresses (dehydration, NaCl and cold. Our results suggest that PhHD-Zip plays an important role in regulating petunia flower senescence.

  11. Search for Black-Holes: the nature of the Unseen Companions of the Systems HD 152667 and 72754

    International Nuclear Information System (INIS)

    Freitas Pacheco, J.A. de

    1978-01-01

    The nature of the unseen companions in the single spectroscopic binary systems HD 152667 and HD 72754 is analysed. In the first system, the secondary is likely to be a normal B4 main sequence star while in HD 72754, the secondary, in spite of being the more massive star, is not detected. We cannot at the present, disregard the possibility that this massive object be associated with a collapsed star - a black-hole [pt

  12. Extraction and Analysis of Sulfur Mustard (HD) from Various Food Matrices by Gas ChromatographyMass Spectrometry

    Science.gov (United States)

    2016-01-01

    9 8. (a) GC chromatogram and (b) mass spectrum for HD extracted from hot dog; (c) mass spectrum at Rt = 5.08 min (benzoic acid ...shows the mass spectrum for benzoic acid . Percent recoveries were calculated based on an external calibration curve for HD (Figure 14). The recoveries...EXTRACTION AND ANALYSIS OF SULFUR MUSTARD ( HD ) FROM VARIOUS FOOD MATRICES BY GAS CHROMATOGRAPHY–MASS

  13. Design of a polarized target made of pure HD: analysis and distillation of HD, resonant virtual Compton scattering on the nucleon at TJNAF; Developpement d'une cible polarisee de pur HD: analyse et distillation du HD, diffusion compton virtuelle resonante sur le nucleon a TJNAF

    Energy Technology Data Exchange (ETDEWEB)

    Bouchigny, S

    2004-04-01

    The first part describe my work on the frozen spin target project HYDILE. This target has to be made of very pure HD (Hydrogen Deuterium), better than 99.95%. However, commercial HD is never found with a concentration better than 98%. The goal was, then, to build an HD distillation facility which could produce pure HD. We describe, in this thesis, the design of the distillator and the implementation of a quadrupole mass spectrometer to monitor the HD purity during the distillation process. The second part of the thesis concerns the analysis taken at the electron accelerator facility TJNAF (Virginia, USA). We look at the electroproduction of Delta resonances involving Deep Virtual Compton Scattering (DeltaVCS). The interpretation of this reaction in terms of GPDs (Generalized Parton Distribution) can provide new insights to the nucleon structure. We focus on the measurement of the beam spin asymmetry which comes from the interference of the Bethe Heitler process with the DeltaVCS. (author)

  14. BD+15 2940 AND HD 233604: TWO GIANTS WITH PLANETS CLOSE TO THE ENGULFMENT ZONE

    International Nuclear Information System (INIS)

    Nowak, G.; Niedzielski, A.; Adamów, M.; Maciejewski, G.; Wolszczan, A.

    2013-01-01

    We report the discovery of planetary-mass companions to two red giants by the ongoing Penn State-Toruń Planet Search (PTPS) conducted with the 9.2 m Hobby-Eberly Telescope. The 1.1 M ☉ K0-giant, BD+15 2940, has a 1.1 M J minimum mass companion orbiting the star at a 137.5 day period in a 0.54 AU orbit what makes it the closest—in planet around a giant and possible subject of engulfment as the consequence of stellar evolution. HD 233604, a 1.5 M ☉ K5-giant, is orbited by a 6.6 M J minimum mass planet which has a period of 192 days and a semi-major axis of only 0.75 AU making it one of the least distant planets to a giant star. The chemical composition analysis of HD 233604 reveals a relatively high 7 Li abundance which may be a sign of its early evolutionary stage or recent engulfment of another planet in the system. We also present independent detections of planetary-mass companions to HD 209458 and HD 88133, and stellar activity-induced radial velocity variations in HD 166435, as part of the discussion of the observing and data analysis methods used in the PTPS project.

  15. Treatment adherence and perception in patients on maintenance hemodialysis: a cross ? sectional study from Palestine

    OpenAIRE

    Naalweh, Karam Sh.; Barakat, Mohammad A.; Sweileh, Moutaz W.; Al-Jabi, Samah W.; Sweileh, Waleed M.; Zyoud, Sa?ed H.

    2017-01-01

    Background Adherence to diet recommendations, fluid restriction, prescribed medications, and attendance at hemodialysis (HD) sessions are essential for optimal and effective treatment of patients with end-stage renal disease. No data regarding this issue are available from Palestine. Therefore, this study was carried out to assess adherence to diet, fluid restriction, medications, and HD sessions. Methods A cross-sectional study of HD patients at An-Najah National University Hospital was carr...

  16. NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0049 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

  17. NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0053 gb|AAS74380.1| 5-HT1B [Drosophila melanogaster] gb|AAS74382.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74389.1| 5-HT1B [Drosophila melanogaster] gb|AAS74402.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74403.1| 5-HT1B [Drosophila melanogaster] gb|AAS74405.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74406.1| 5-HT1B [Drosophila melanogaster] gb|AAS74411.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74412.1| 5-HT1B [Drosophila melanogaster] gb|AAS74413.1| 5-HT1B [Drosophila mela

  18. NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0049 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  19. NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0053 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  20. NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0001 gb|AAS74960.1| 5-HT2 [Drosophila melanogaster] gb|AAS74962.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74964.1| 5-HT2 [Drosophila melanogaster] gb|AAS74966.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74970.1| 5-HT2 [Drosophila melanogaster] gb|AAS74972.1| 5-HT2 [Drosophila melanogaster]... gb|AAS74976.1| 5-HT2 [Drosophila melanogaster] gb|AAS74978.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74979.1| 5-HT2 [Drosophila melanogaster] gb|AAS74980.1| 5-HT2 [Drosophila melanogaster

  1. NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-156 96% ...

  2. NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0056 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  3. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74185.1| 5-HT1A [Drosophila melanogaster] gb|AAS74209.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74210.1| 5-HT1A [Drosophila melanogaster] gb|AAS74211.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74224.1| 5-HT1A [Drosophila melanogaster] gb|AAS74234.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74254.1| 5-HT1A [Drosophila melanogaster] gb|AAS74258.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74262.1| 5-HT1A [Drosophila melanogaster] gb|AAS74278.1| 5-HT1A [Drosophila mela

  4. NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0056 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

  5. NCBI nr-aa BLAST: CBRC-DMEL-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-165 100% ...

  6. Multi-modal neuroimaging in premanifest and early Huntington's disease: 18 month longitudinal data from the IMAGE-HD study.

    Science.gov (United States)

    Domínguez D, Juan F; Egan, Gary F; Gray, Marcus A; Poudel, Govinda R; Churchyard, Andrew; Chua, Phyllis; Stout, Julie C; Georgiou-Karistianis, Nellie

    2013-01-01

    IMAGE-HD is an Australian based multi-modal longitudinal magnetic resonance imaging (MRI) study in premanifest and early symptomatic Huntington's disease (pre-HD and symp-HD, respectively). In this investigation we sought to determine the sensitivity of imaging methods to detect macrostructural (volume) and microstructural (diffusivity) longitudinal change in HD. We used a 3T MRI scanner to acquire T1 and diffusion weighted images at baseline and 18 months in 31 pre-HD, 31 symp-HD and 29 controls. Volume was measured across the whole brain, and volume and diffusion measures were ascertained for caudate and putamen. We observed a range of significant volumetric and, for the first time, diffusion changes over 18 months in both pre-HD and symp-HD, relative to controls, detectable at the brain-wide level (volume change in grey and white matter) and in caudate and putamen (volume and diffusivity change). Importantly, longitudinal volume change in the caudate was the only measure that discriminated between groups across all stages of disease: far from diagnosis (>15 years), close to diagnosis (fractional anisotropy, FA), only longitudinal FA change was sensitive to group differences, but only after diagnosis. These findings further confirm caudate atrophy as one of the most sensitive and early biomarkers of neurodegeneration in HD. They also highlight that different tissue properties have varying schedules in their ability to discriminate between groups along disease progression and may therefore inform biomarker selection for future therapeutic interventions.

  7. Outcomes From AAS Hack Day at the 227th AAS Meeting

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts

  8. Skylab ultraviolet stellar spectra - A new white dwarf, HD 149499 B

    Science.gov (United States)

    Parsons, S. B.; Wray, J. D.; Benedict, G. F.; Henize, K. G.; Laget, M.

    1976-01-01

    The letter reports the discovery of a cool star with excess brightness in the vacuum ultraviolet on an objective-prism photograph obtained during the second Skylab mission. This star, HD 149499, is of type K0 V and has a companion with an apparent magnitude of about 11.8; the relatively flat UV spectrum observed at the position of HD 149499 is characteristic of a 10th or 11th magnitude unreddened O- or early B-type star. It is shown that the excess VUV brightness is due to the companion, HD 149499B, which probably lies in the region of the H-R diagram occupied by the hot white dwarfs. Inspection of white dwarf lists indicates that this star is the sixth or seventh brightest white dwarf known. A maximum orbital motion of 0.025 arcsec/yr is estimated along with a period of just under 500 yr.

  9. Mechanical Analysis of the Nb3Sn Dipole Magnet HD1

    International Nuclear Information System (INIS)

    Ferracin, Paolo; Bartlett, Scott E.; Caspi, Shlomo; Dietderich, Daniel R.; Gourlay, Steve A.; Hannaford, Charles R.; Hafalia, Aurelio R.; Lietzke, Alan F.; Mattafirri, Sara; Sabbi, Gianluca

    2005-01-01

    The Superconducting Magnet Group at Lawrence Berkeley National Laboratory (LBNL) has recently fabricated and tested HD1, a Nb3Sn dipole magnet. The magnet reached a 16 T field, and exhibited training quenches in the end regions and in the straight section. After the test, HD1 was disassembled and inspected, and a detailed 3D finite element mechanical analysis was done to investigate for possible quench triggers. The study led to minor modifications to mechanical structure and assembly procedure, which were verified in a second test (HD1b). This paper presents the results of the mechanical analysis, including strain gauge measurements and coil visual inspection. The adjustments implemented in the magnet structure are reported and their effect on magnet training discussed

  10. Mechanical analysis of the Nb3Sn dipole magnet HD1

    International Nuclear Information System (INIS)

    Ferracin, Paolo; Bartlett, Scott E.; Caspi, Shlomo; Dietderich, Daniel R.; Gourlay, Steve A.; Hannaford, Carles R.; Hafalia, Aurelio R.; Lietzke, Alan F.; Mattafirri, Sara; Sabbi, Gianluca

    2005-01-01

    The Superconducting Magnet Group at Lawrence Berkeley National Laboratory (LBNL) has recently fabricated and tested HD1, a Nb 3 Sn dipole magnet. The magnet reached a 16 T field, and exhibited training quenches in the end regions and in the straight section. After the test, HD1 was disassembled and inspected, and a detailed 3D finite element mechanical analysis was done to investigate for possible quench triggers. The study led to minor modifications to mechanical structure and assembly procedure, which were verified in a second test (HD1b). This paper presents the results of the mechanical analysis, including strain gauge measurements and coil visual inspection. The adjustments implemented in the magnet structure are reported and their effect on magnet training discussed

  11. Effects of flaxseed consumption on systemic inflammation and serum lipid profile in hemodialysis patients with lipid abnormalities.

    Science.gov (United States)

    Khalatbari Soltani, Saman; Jamaluddin, Rosita; Tabibi, Hadi; Mohd Yusof, Barakatun Nisak; Atabak, Shahnaz; Loh, Su-Peng; Rahmani, Leila

    2013-04-01

    Inflammation and lipid abnormalities are two important risk factors for cardiovascular disease in hemodialysis (HD) patients. The present study was designed to investigate the effects of flaxseed consumption on systemic inflammation and serum lipid profile in HD patients with lipid abnormalities. This was an unblinded, randomized clinical trial. Thirty HD patients with dyslipidemia (triglyceride >200 mg/dL and/or high-density lipoprotein-cholesterol (HDL-C) consumption improves lipid abnormalities and reduces systemic inflammation in HD patients with lipid abnormalities. © 2012 The Authors. Hemodialysis International © 2012 International Society for Hemodialysis.

  12. Hot granules medium pressure forming process of AA7075 conical parts

    Science.gov (United States)

    Dong, Guojiang; Zhao, Changcai; Peng, Yaxin; Li, Ying

    2015-05-01

    High strength aluminum alloy plate has a low elongation at room temperature, which leads to the forming of its components need a high temperature. Liquid or gas is used as the pressure-transfer medium in the existing flexible mould forming process, the heat resistance of the medium and pressurizing device makes the application of aluminum alloy plate thermoforming restricted. To solve this problem, the existing medium is replaced by the heat-resisting solid granules and the general pressure equipments are applied. Based on the pressure-transfer performance test of the solid granules medium, the feasibility that the assumption of the extended Drucker-Prager linear model can be used in the finite element analysis is proved. The constitutive equation, the yield function and the theoretical forming limit diagram(FLD) of AA7075 sheet are established. Through the finite element numerical simulation of hot granules medium pressure forming(HGMF) process, not only the influence laws of the process parameters, such as forming temperature, the blank-holder gap and the diameter of the slab, on sheet metal forming performance are discussed, but also the broken area of the forming process is analyzed and predicted, which are coincided with the technological test. The conical part whose half cone angle is 15° and relative height H/d 0 is 0.57, is formed in one process at 250°C. The HGMF process solves the problems of loading and seal in the existing flexible mould forming process and provides a novel technology for thermoforming of light alloy plate, such as magnesium alloy, aluminium alloy and titanium alloy.

  13. Purification and characterization of antifungal compounds from Lactobacillus plantarum HD1 isolated from kimchi.

    Science.gov (United States)

    Ryu, Eun Hye; Yang, Eun Ju; Woo, Eun Rhan; Chang, Hae Choon

    2014-08-01

    Strain HD1 with antifungal activity was isolated from kimchi and identified as Lactobacillus plantarum. Antifungal compounds from Lb. plantarum HD1 were active against food- and feed-borne filamentous fungi and yeasts in a spot-on-the-lawn assay. Antifungal activity of Lb. plantarum HD1 was stronger against filamentous fungi than yeast. Antifungal compounds were purified using solid phase extraction (SPE) and recycling preparative-HPLC. Structures of the antifungal compounds were elucidated by electrospray ionization-mass spectrometry and nuclear magnetic resonance. Active compounds from Lb. plantarum HD1 were identified as 5-oxododecanoic acid (MW 214), 3-hydroxy decanoic acid (MW 188), and 3-hydroxy-5-dodecenoic acid (MW 214). To investigate the potential application of these antifungal compounds for reduction of fungal spoilage in foods, Korean draft rice wine was used as a food model. White film-forming yeasts were observed in control draft rice wine after 11 days of incubation. However, film-forming yeasts were not observed in draft rice wine treated with SPE-prepared culture supernatant of Lb. plantarum HD1 (equivalent to 2.5% addition of culture supernatant) until 27 days of incubation. The addition of antifungal compounds to Korean draft rice wine extended shelf-life up to 27 days at 10 °C without any sterilization process. Therefore, the antifungal activity of Lb. plantarum HD1 may lead to the development of powerful biopreservative systems capable of preventing food- and feed-borne fungal spoilage. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. No hydrogen exosphere detected around the super-Earth HD 97658 b

    Science.gov (United States)

    Bourrier, V.; Ehrenreich, D.; King, G.; Lecavelier des Etangs, A.; Wheatley, P. J.; Vidal-Madjar, A.; Pepe, F.; Udry, S.

    2017-01-01

    The exoplanet HD 97658 b provides a rare opportunity to probe the atmospheric composition and evolution of moderately irradiated super-Earths. It transits a bright K star at a moderate orbital distance of 0.08 au. Its low density is compatible with a massive steam envelope that could photodissociate at high altitudes and become observable as escaping neutral hydrogen. Our analysis of three transits with HST/STIS at Lyman-α reveals no such signature, suggesting that the thermosphere of HD 97658 b is not hydrodynamically expanding and is subjected to a low escape of neutral hydrogen (soft X-ray source with signs of chromospheric variability in the Lyman-α line core. We determine an average reference for the intrinsic Lyman-α line and X-EUV (XUV) spectrum of the star, and show that HD 97658 b is in mild conditions of irradiation compared to other known evaporating exoplanets with an XUV irradiation about three times lower than the evaporating warm Neptune GJ436 b. This could be the reason why the thermosphere of HD 97658 b is not expanding: the low XUV irradiation prevents an efficient photodissociation of any putative steam envelope. Alternatively, it could be linked to a low hydrogen content or inefficient conversion of the stellar energy input. The HD 97658 system provides clues for understanding the stability of low-mass planet atmospheres in terms of composition, planetary density, and irradiation. Our study of HD 97658 b can be seen as a control experiment of our methodology, confirming that it does not bias detections of atmospheric escape and underlining its strength and reliability. Our results show that stellar activity can be efficiently discriminated from absorption signatures by a transiting exospheric cloud. They also highlight the potential of observing the upper atmosphere of small transiting planets to probe their physical and chemical properties.

  15. Genetic screening of Greek patients with Huntington’s disease phenocopies identifies an SCA8 expansion.

    Science.gov (United States)

    Koutsis, G; Karadima, G; Pandraud, A; Sweeney, M G; Paudel, R; Houlden, H; Wood, N W; Panas, M

    2012-09-01

    Huntington’s disease (HD) is an autosomal dominant disorder characterized by a triad of chorea, psychiatric disturbance and cognitive decline. Around 1% of patients with HD-like symptoms lack the causative HD expansion and are considered HD phenocopies. Genetic diseases that can present as HD phenocopies include HD-like syndromes such as HDL1, HDL2 and HDL4 (SCA17), some spinocerebellar ataxias (SCAs) and dentatorubral-pallidoluysian atrophy (DRPLA). In this study we screened a cohort of 21 Greek patients with HD phenocopy syndromes formutations causing HDL2, SCA17, SCA1, SCA2, SCA3,SCA8, SCA12 and DRPLA. Fifteen patients (71%) had a positive family history. We identified one patient (4.8% of the total cohort) with an expansion of 81 combined CTA/CTG repeats at the SCA8 locus. This falls within what is believed to be the high-penetrance allele range. In addition to the classic HD triad, the patient had features of dystonia and oculomotor apraxia. There were no cases of HDL2, SCA17, SCA1, SCA2, SCA3, SCA12 or DRPLA. Given the controversy surrounding the SCA8 expansion, the present finding may be incidental. However, if pathogenic, it broadens the phenotype that may be associated with SCA8 expansions. The absence of any other mutations in our cohort is not surprising, given the low probability of reaching a genetic diagnosis in HD phenocopy patients.

  16. Hemodialysis in the Poisoned Patient

    Directory of Open Access Journals (Sweden)

    Megan Boysen-Osborn

    2017-09-01

    Full Text Available Audience: This classic team based learning (cTBL didactic is aimed for emergency medicine residents and fourth year medical students entering emergency medicine. Introduction: Over one million visits per year to United States (US emergency departments (ED are related to poisonings.1 Extracorporeal treatment (ECTR, specifically hemodialysis (HD, is one potential method to enhance elimination of certain drugs and their toxic metabolites.2-12 While HD may be life-saving in certain poisonings, it may have no effect on others and it carries associated risks and costs. It is essential that emergency physicians know the indications for HD in the poisoned patient. This cTBL reviews many poisonings which may be managed by HD. Objectives: By the end of this cTBL, the learner will: 1 recognize laboratory abnormalities related to toxic alcohol ingestion; 2 calculate an anion gap and osmolal gap; 3 know the characteristics of drugs that are good candidates for HD; 4 discuss the management of patients with toxic alcohol ingestions; 5 discuss the management of patients with salicylate overdose; 6 know the indications for HD in patients with overdoses of antiepileptic drugs; 7 discuss the management of patients with lithium toxicity. Method: This didactic session is a cTBL (classic team based learning.

  17. Thoracic radiation therapy (RT) before autologous bone marrow transplantation (ABMT) in relapsed or refractory Hodgkin's disease (HD)

    International Nuclear Information System (INIS)

    Tsang, Richard W.; Gospodarowicz, Mary K.; Sutcliffe, Simon B.; Crump, Michael; Keating, Armand

    1997-01-01

    Purpose: To assess the relationship between peri-ABMT RT and treatment-related mortality in patients receiving high-dose chemotherapy (HDCT) and ABMT for recurrent/refractory HD. Materials and Methods: Between 12/1986 and 12/1992, 90 patients (pts) with HD were treated with HDCT (etoposide 60 mg/kg, melphalan 160 mg/m 2 ) +ABMT in Toronto. Fifty-nine of these had all or part of their treatment (RT and/or CT) at the PMH, and they form the basis of this report. HDCT + ABMT was performed for refractory (11 pts) or relapsed (48 pts) HD. The median age at ABMT was 29 (range 16-47), F:M ratio was 1:1.2. Salvage chemotherapy consisted of DHAP (36), mini-BEAM (7), both (8), other chemotherapy (5), and no chemotherapy (3). RT have been incorporated in the salvage treatment with the intent to achieve complete disease control of active disease at relapse or disease progression. RT was given pre-ABMT in 33 pts (3 mantle, 8 mantle with lung, 7 modified mantle excluding axillae, 4 involved field, 1 mantle with TBI, 1 TBI, and 9 non-thoracic), and post-ABMT in 4 pts (2 mantle, 2 modified mantle). Planned RT tumor dose was 35 Gy over 4 weeks (median 35 Gy, range 25-40 Gy), lower doses were used for lung RT (15-17.5 Gy). Treatment-related (TR) mortality was defined as any death occurring within 100 days of ABMT. Autopsies were performed for all patients with TR deaths. Results: We observed 36 deaths, and 10 of these were treatment-related (TR) deaths. With an average follow-up of 4.9 years (range 1.2-7.4 years), the actuarial overall survival was 52% ± 13% at 3 years, and 41% ± 14% at 5 years. Among the 24 patients who received thoracic RT before ABMT, there were 8 TR deaths, with 3 solely attributable to radiation pneumonitis. The remaining 5 TR deaths all had respiratory failure as a major medical problem with complicating sepsis and pancytopenia. The interval from RT to ABMT was shorter for 8 patients dying of TR death (mean 37 days; range 0-103 days), than for the 16 pts with

  18. HD 91669B: A NEW BROWN DWARF CANDIDATE FROM THE MCDONALD OBSERVATORY PLANET SEARCH

    International Nuclear Information System (INIS)

    Wittenmyer, Robert A.; Endl, Michael; Cochran, William D.; Ramirez, Ivan; MacQueen, Phillip J.; Shetrone, Matthew; Reffert, Sabine

    2009-01-01

    We report the detection of a brown dwarf candidate orbiting the metal-rich K dwarf HD 91669, based on radial-velocity data from the McDonald Observatory Planet Search. HD 91669b is a substellar object in an eccentric orbit (e = 0.45) at a separation of 1.2 AU. The minimum mass of 30.6M Jup places this object firmly within the brown dwarf desert for inclinations i ∼> 23 0 . This is the second rare close-in brown dwarf candidate discovered by the McDonald planet search program.

  19. Three-dimensional (3D) structure prediction and function analysis of the chitin-binding domain 3 protein HD73_3189 from Bacillus thuringiensis HD73.

    Science.gov (United States)

    Zhan, Yiling; Guo, Shuyuan

    2015-01-01

    Bacillus thuringiensis (Bt) is capable of producing a chitin-binding protein believed to be functionally important to bacteria during the stationary phase of its growth cycle. In this paper, the chitin-binding domain 3 protein HD73_3189 from B. thuringiensis has been analyzed by computer technology. Primary and secondary structural analyses demonstrated that HD73_3189 is negatively charged and contains several α-helices, aperiodical coils and β-strands. Domain and motif analyses revealed that HD73_3189 contains a signal peptide, an N-terminal chitin binding 3 domains, two copies of a fibronectin-like domain 3 and a C-terminal carbohydrate binding domain classified as CBM_5_12. Moreover, analysis predicted the protein's associated localization site to be the cell wall. Ligand site prediction determined that amino acid residues GLU-312, TRP-334, ILE-341 and VAL-382 exposed on the surface of the target protein exhibit polar interactions with the substrate.

  20. Prognosis of bedridden patients with end-stage renal failure after starting hemodialysis.

    Science.gov (United States)

    Sugaya, Kimio; Hokama, Asanori; Hayashi, Eiri; Naka, Hidekatsu; Oda, Masami; Nishijima, Saori; Miyazato, Minoru; Hokama, Sanehiro; Ogawa, Yoshihide

    2007-06-01

    The mean age of starting hemodialysis (HD) in patients with end-stage renal failure is gradually increasing in Japan. It is not uncommon for HD to be commenced in bedridden elderly patients who cannot give informed consent, because of brain damage. However, we have not been able to provide useful advice to their families because there was no relevant information available about the prognosis of bedridden patients on HD. Therefore, we examined the prognosis of bedridden HD patients. Two hundred and nineteen patients who received HD were enrolled. These subjects were divided into five groups; (aged or=80 years at the commencement of HD), and we compared the overall prognosis between bedridden and nonbedridden patients, as well as that for each age group. There were 76 bedridden patients among the 219 HD patients, and the main cause of their bedridden state before starting HD was cerebrovascular disease. The 50% survival time after the start of HD was 120 months for the nonbedridden patients versus 56 months for bedridden patients. However, the mean (+/-SD) age of the bedridden patients was higher than that of nonbedridden patients (70 +/- 13 versus 64 +/- 14 years). In patients under age 50 years at the start of dialysis, the survival rate was lower in the bedridden than in the nonbedridden patients, but there were no differences between survival rates for bedridden and nonbedridden patients in the other four age groups. The prognosis of HD patients is poor compared with the general life expectancy of the Japanese population, but whether these patients are bedridden or not has little influence on their survival.

  1. Early Chemotherapy Intensification With Escalated BEACOPP in Patients With Advanced-Stage Hodgkin Lymphoma With a Positive Interim Positron Emission Tomography/Computed Tomography Scan After Two ABVD Cycles: Long-Term Results of the GITIL/FIL HD 0607 Trial.

    Science.gov (United States)

    Gallamini, Andrea; Tarella, Corrado; Viviani, Simonetta; Rossi, Andrea; Patti, Caterina; Mulé, Antonino; Picardi, Marco; Romano, Alessandra; Cantonetti, Maria; La Nasa, Giorgio; Trentin, Livio; Bolis, Silvia; Rapezzi, Davide; Battistini, Roberta; Gottardi, Daniela; Gavarotti, Paolo; Corradini, Paolo; Cimminiello, Michele; Schiavotto, Corrado; Parvis, Guido; Zanotti, Roberta; Gini, Guido; Ferreri, Andrés J M; Viero, Piera; Miglino, Maurizio; Billio, Atto; Avigdor, Abraham; Biggi, Alberto; Fallanca, Federico; Ficola, Umberto; Gregianin, Michele; Chiaravalloti, Agostino; Prosperini, Giuseppe; Bergesio, Fabrizio; Chauvie, Stephane; Pavoni, Chiara; Gianni, Alessandro Massimo; Rambaldi, Alessandro

    2018-02-10

    Purpose To investigate the progression-free survival (PFS) of patients with advanced Hodgkin lymphoma (HL) after a risk-adapted treatment strategy that was based on a positive positron emission tomography scan performed after two doxorubicin, vinblastine, vincristine, and dacarbazine (ABVD) cycles (PET2). Patients and Methods Patients with advanced-stage (IIB to IVB) HL were consecutively enrolled. After two ABVD cycles, PET2 was performed and centrally reviewed according to the Deauville five-point scale. Patients with a positive PET2 were randomly assigned to four cycles of escalated bleomycin, etoposide, doxorubicin, cyclophosphamide, vincristine, procarbazine, and prednisone (BEACOPP) followed by four cycles of standard BEACOPP with or without rituximab. Patients with a negative PET2 continued ABVD, and those with a large nodal mass at diagnosis (≥ 5 cm) in complete remission with a negative PET at the end of chemotherapy were randomly assigned to radiotherapy or no further treatment. The primary end point was 3-year PFS. Results Of 782 enrolled patients, 150 (19%) had a positive and 630 (81%) a negative PET2. The 3-year PFS of all patients was 82%. The 3-year PFS of those with a positive and negative PET2 was 60% and 87%, respectively ( P < .001). The 3-year PFS of patients with a positive PET2 assigned to BEACOPP with or without rituximab was 63% versus 57% ( P = .53). In 296 patients with both interim and post-ABVD-negative PET who had a large nodal mass at diagnosis, radiotherapy was randomly added after chemotherapy without a significant PFS improvement (97% v 93%, respectively; P = .29). The 3-year overall survival of all 782 patients was 97% (99% and 89% for PET2 negative and positive, respectively). Conclusion The PET-driven switch from ABVD to escalated BEACOPP is feasible and effective in high-risk patients with advanced-stage HL.

  2. Effects of HD-tDCS on memory and metamemory for general knowledge questions that vary by difficulty

    Science.gov (United States)

    Chua, Elizabeth F.; Ahmed, Rifat; Garcia, Sandry

    2016-01-01

    Background The ability to monitor one’s own memory is an important feature of normal memory and is an aspect of ‘metamemory’. Lesion studies have shown dissociations between memory and metamemory, but only single dissociations have been shown using transcranial direct current stimulation (tDCS). One potential reason that only single dissociations have been shown is that tDCS effects may be moderated by task difficulty. Objective/Hypothesis We used high definition (HD) tDCS to test for dissociable roles of the dorsolateral prefrontal cortex (DLPFC) and anterior temporal lobe (ATL) in semantic long-term memory and metamemory tasks. We also tested whether general knowledge question difficulty moderated the effects of HD-tDCS. Methods Across 3 sessions, participants received active HD-tDCS over the left DLPFC or left ATL, or sham HD-tDCS during general knowledge recall and recognition tests, and a ‘feeling-of-knowing’ metamemory task. General knowledge questions were blocked by difficulty. Repeated measures ANOVAs were used to examine the effects of HD-tDCS on memory and metamemory tasks by memory question difficulty. Results HD-tDCS over the ATL led to improved recall compared to DLPFC and sham HD-tDCS, and this occurred only for medium difficulty questions. In contrast, for non-recalled questions, HD-tDCS over the DLPFC led to improved recognition accuracy and improved feeling-of-knowing accuracy compared to ATL and sham HD-tDCS, and this was not moderated by memory question difficulty. Conclusion(s) HD-tDCS can be used to dissociate the roles of the ATL and DLPFC in different memory and ‘metamemory’ tasks. The effects of HD-tDCS on task may be moderated by task difficulty, depending on the nature of the task and site of stimulation. PMID:27876306

  3. Impact of Sequencing Targeted Therapies With High-dose Interleukin-2 Immunotherapy: An Analysis of Outcome and Survival of Patients With Metastatic Renal Cell Carcinoma From an On-going Observational IL-2 Clinical Trial: PROCLAIMSM.

    Science.gov (United States)

    Clark, Joseph I; Wong, Michael K K; Kaufman, Howard L; Daniels, Gregory A; Morse, Michael A; McDermott, David F; Agarwala, Sanjiv S; Lewis, Lionel D; Stewart, John H; Vaishampayan, Ulka; Curti, Brendan; Gonzalez, René; Lutzky, Jose; Rudraptna, Venkatesh; Cranmer, Lee D; Jeter, Joanne M; Hauke, Ralph J; Miletello, Gerald; Milhem, Mohammed M; Amin, Asim; Richart, John M; Fishman, Mayer; Hallmeyer, Sigrun; Patel, Sapna P; Van Veldhuizen, Peter; Agarwal, Neeraj; Taback, Bret; Treisman, Jonathan S; Ernstoff, Marc S; Perritt, Jessica C; Hua, Hong; Rao, Tharak B; Dutcher, Janice P; Aung, Sandra

    2017-02-01

    This analysis describes the outcome for patients who received targeted therapy (TT) prior to or following high-dose interleukin-2 (HD IL-2). Patients with renal cell carcinoma (n = 352) receiving HD IL-2 were enrolled in Proleukin R Observational Study to Evaluate the Treatment Patterns and Clinical Response in Malignancy (PROCLAIM SM ) beginning in 2011. Statistical analyses were performed using datasets as of September 24, 2015. Overall, there were 4% complete response (CR), 13% partial response (PR), 39% stable disease (SD), and 43% progressive disease (PD) with HD IL-2. The median overall survival (mOS) was not reached in patients with CR, PR, or SD, and was 15.5 months in patients with PD (median follow-up, 21 months). Sixty-one patients had prior TT before HD IL-2 with an overall response rate (ORR) to HD IL-2 of 19% (1 CR, 9 PR) and an mOS of 22.1 months. One hundred forty-nine patients received TT only after HD IL-2 with an mOS of 35.5 months. One hundred forty-two patients had no TT before or after HD IL-2, and mOS was not reached. The mOS was 8.5 months in PD patients who received HD IL-2 without follow-on TT and 29.7 months in PD patients who received follow-on TT after HD IL-2. HD IL-2 as sole front-line therapy, in the absence of added TT, shows extended clinical benefit (CR, PR, and SD). Patients with PD after HD IL-2 appear to benefit from follow-on TT. Patients who progressed on TT and received follow-on HD IL-2 experienced major clinical benefit. HD IL-2 therapy should be considered in eligible patients. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  4. Yield and flow properties of aluminum alloy AA 8001

    International Nuclear Information System (INIS)

    Lyons, J.S.; Johnson, H.W.; Han, E.G.

    1995-01-01

    Aluminum alloy AA 8001 is being used at the Westinghouse Savannah River Company (WSRC) for nuclear reactor fuel and target components. The objective of this research was to determine parameters for predictive models of the compressive flow properties of AA 8001. Seventy-five true strain-rate, hot compression tests were performed. New, quantitative information about the yield and flow behavior of aluminum alloy AA 8001 was determined. Parameters were determined to use in a hyperbolic sine constitutive law so that the yield stress, the peak stress, and the peak strain can be predicted from the temperature-compensated strain-rate, Z. It was found that the onset of strain softening was more strongly dependent on Z than the onset of yielding was

  5. Establishing Core Outcome Domains in Hemodialysis: Report of the Standardized Outcomes in Nephrology-Hemodialysis (SONG-HD) Consensus Workshop.

    Science.gov (United States)

    Tong, Allison; Manns, Braden; Hemmelgarn, Brenda; Wheeler, David C; Evangelidis, Nicole; Tugwell, Peter; Crowe, Sally; Van Biesen, Wim; Winkelmayer, Wolfgang C; O'Donoghue, Donal; Tam-Tham, Helen; Shen, Jenny I; Pinter, Jule; Larkins, Nicholas; Youssouf, Sajeda; Mandayam, Sreedhar; Ju, Angela; Craig, Jonathan C

    2017-01-01

    Evidence-informed decision making in clinical care and policy in nephrology is undermined by trials that selectively report a large number of heterogeneous outcomes, many of which are not patient centered. The Standardized Outcomes in Nephrology-Hemodialysis (SONG-HD) Initiative convened an international consensus workshop on November 7, 2015, to discuss the identification and implementation of a potential core outcome set for all trials in hemodialysis. The purpose of this article is to report qualitative analyses of the workshop discussions, describing the key aspects to consider when establishing core outcomes in trials involving patients on hemodialysis therapy. Key stakeholders including 8 patients/caregivers and 47 health professionals (nephrologists, policymakers, industry, and researchers) attended the workshop. Attendees suggested that identifying core outcomes required equitable stakeholder engagement to ensure relevance across patient populations, flexibility to consider evolving priorities over time, deconstruction of language and meaning for conceptual consistency and clarity, understanding of potential overlap and associations between outcomes, and an assessment of applicability to the range of interventions in hemodialysis. For implementation, they proposed that core outcomes must have simple, inexpensive, and validated outcome measures that could be used in clinical care (quality indicators) and trials (including pragmatic trials) and endorsement by regulatory agencies. Integrating these recommendations may foster acceptance and optimize the uptake and translation of core outcomes in hemodialysis, leading to more informative research, for better treatment and improved patient outcomes. Copyright © 2016 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  6. Establishing Core Outcome Domains in Hemodialysis: Report of the Standardized Outcomes in Nephrology−Hemodialysis (SONG-HD) Consensus Workshop

    Science.gov (United States)

    Tong, Allison; Manns, Braden; Hemmelgarn, Brenda; Wheeler, David C.; Evangelidis, Nicole; Tugwell, Peter; Crowe, Sally; Van Biesen, Wim; Winkelmayer, Wolfgang C.; O’Donoghue, Donal; Tam-Tham, Helen; Shen, Jenny; Pinter, Jule; Larkins, Nicholas; Youssouf, Sajeda; Mandayam, Sreedhar; Ju, Angela; Craig, Jonathan C.

    2017-01-01

    Evidence-informed decision-making in clinical care and policy in nephrology is undermined by trials that selectively report a large number of heterogeneous outcomes, many of which are not patient-centered. The Standardized Outcomes in Nephrology−Hemodialysis (SONG-HD) Initiative convened an international consensus workshop on November 7, 2015, to discuss the identification and implementation of a potential core outcome set for all trials in hemodialysis. The purpose of this article is to report qualitative analyses of the workshop discussions, describing the key aspects to consider when establishing core outcomes in trials involving patients on hemodialysis. Key stakeholders including eight patients/caregivers and 47 health professionals (nephrologists, policy makers, industry, researchers) attended the workshop. Attendees suggested that identifying core outcomes required equitable stakeholder engagement to ensure relevance across patient populations; flexibility to consider evolving priorities over time; deconstruction of language and meaning for conceptual consistency and clarity; understanding of potential overlap and associations between outcomes; and an assessment of applicability to the range of interventions in hemodialysis. For implementation, they proposed that core outcomes must have simple, inexpensive and validated outcome measures that could be used in clinical care (quality ndicators) and trials (including pragmatic trials), and endorsement by regulatory agencies. Integrating these recommendations may foster acceptance and optimize the uptake and translation of core outcomes in hemodialysis, leading to more informative research, for better treatment, and improved patient outcomes. PMID:27497527

  7. Dissimilar friction stir welds in AA5083-AA6082: The effect of process parameters on residual stress

    International Nuclear Information System (INIS)

    Steuwer, A.; Peel, M.J.; Withers, P.J.

    2006-01-01

    The effect of tool traverse and rotation speeds on the residual stresses are quantified for welds between non-age-hardening AA5083 and age-hardening AA6082 and compared to single alloy joints made from each of the two constituents. The residual stresses have been characterised non-destructively by neutron diffraction and synchrotron X-ray diffraction. The region around the weld line was characterised by significant tensile residual stress fields which are balanced by compressive stresses in the parent material. The rotation speed of the tool has been found to have a substantially greater influence than the transverse speed on the properties and residual stresses in the welds, particularly on the AA5083 side where the location of the peak stress moves from the stir zone to beyond the edge of the tool shoulder. The changes in residual stress are related to microstructural and hardness changes as determined in a previous study . In particular the larger stresses under the weld tool on the AA5083 side compared to the AA6082 side are related to a transient reduction in yield stress due to dissolution of the hardening precipitates during welding prior to natural aging after welding

  8. Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease

    Science.gov (United States)

    Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi

    2008-01-01

    AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were different from those of the liver with regard to molecular weight and shape and had greater transmissibility. The infectious activity of fecal AA amyloid fibrils was reduced or abolished by the protein denaturants 6 M guanidine·HCl and formic acid or by AA immunodepletion. Thus, we propose that feces are a vehicle of transmission that may accelerate AA amyloidosis in captive cheetah populations. These results provide a pathogenesis for AA amyloidosis and suggest possible measures for rescuing cheetahs from extinction. PMID:18474855

  9. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74195.1| 5-HT1A [Drosophila melanogaster] gb|AAS74276.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74292.1| 5-HT1A [Drosophila melanogaster] gb|AAS74298.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74303.1| 5-HT1A [Drosophila melanogaster] gb|AAS74304.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74321.1| 5-HT1A [Drosophila melanogaster] gb|AAS74359.1| 5-HT1A [Drosophila melanogaster] AAS74195.1 1e-176 97% ...

  10. Association of vascular access flow with short-term and long-term mortality in chronic haemodialysis patients: a retrospective cohort study

    OpenAIRE

    Wu, Chung-Kuan; Wu, Chia-Lin; Lin, Chia-Hsun; Leu, Jyh-Gang; Kor, Chew-Teng; Tarng, Der-Cherng

    2017-01-01

    Objectives To investigate the impact of vascular access flow (Qa) on vascular and all-cause mortality in chronic haemodialysis (HD) patients. Design Observational cohort study. Setting Single centre. Participants Adult chronic HD patients at the HD unit of Shin Kong Wu Ho-Su Memorial Hospital between 1 January 2003 and 31 December 2003 were recruited. Patients were excluded if they had arteriovenous fistula or arteriovenous graft failure within 3 months before the date of Qa measurement, were...

  11. 76 FR 12825 - List of Approved Spent Fuel Storage Casks: NUHOMS® HD System Revision 1; Confirmation of...

    Science.gov (United States)

    2011-03-09

    ... Storage Casks: NUHOMS[supreg] HD System Revision 1; Confirmation of Effective Date AGENCY: Nuclear... direct final rule amended the NRC's spent fuel storage regulations at Title 10 of the Code of Federal Regulations (10 CFR 72.214) to revise the NUHOMS[supreg] HD System listing to include Amendment Number 1 to...

  12. Genome-wide analysis of the homeodomain-leucine zipper (HD-ZIP) gene family in peach (Prunus persica).

    Science.gov (United States)

    Zhang, C H; Ma, R J; Shen, Z J; Sun, X; Korir, N K; Yu, M L

    2014-04-08

    In this study, 33 homeodomain-leucine zipper (HD-ZIP) genes were identified in peach using the HD-ZIP amino acid sequences of Arabidopsis thaliana as a probe. Based on the phylogenetic analysis and the individual gene or protein characteristics, the HD-ZIP gene family in peach can be classified into 4 subfamilies, HD-ZIP I, II, III, and IV, containing 14, 7, 4, and 8 members, respectively. The most closely related peach HD-ZIP members within the same subfamilies shared very similar gene structure in terms of either intron/exon numbers or lengths. Almost all members of the same subfamily shared common motif compositions, thereby implying that the HD-ZIP proteins within the same subfamily may have functional similarity. The 33 peach HD-ZIP genes were distributed across scaffolds 1 to 7. Although the primary structure varied among HD-ZIP family proteins, their tertiary structures were similar. The results from this study will be useful in selecting candidate genes from specific subfamilies for functional analysis.

  13. HD-PTP is a catalytically inactive tyrosine phosphatase due to a conserved divergence in its phosphatase domain.

    Directory of Open Access Journals (Sweden)

    Marie-Claude Gingras

    Full Text Available The HD-PTP protein has been described as a tumor suppressor candidate and based on its amino acid sequence, categorized as a classical non-transmembrane protein tyrosine phosphatase (PTP. To date, no HD-PTP phosphorylated substrate has been identified and controversial results concerning its catalytic activity have been recently reported.Here we report a rigorous enzymatic analysis demonstrating that the HD-PTP protein does not harbor tyrosine phosphatase or lipid phosphatase activity using the highly sensitive DiFMUP substrate and a panel of different phosphatidylinositol phosphates. We found that HD-PTP tyrosine phosphatase inactivity is caused by an evolutionary conserved amino acid divergence of a key residue located in the HD-PTP phosphatase domain since its back mutation is sufficient to restore the HD-PTP tyrosine phosphatase activity. Moreover, in agreement with a tumor suppressor activity, HD-PTP expression leads to colony growth reduction in human cancer cell lines, independently of its catalytic PTP activity status.In summary, we demonstrate that HD-PTP is a catalytically inactive protein tyrosine phosphatase. As such, we identify one residue involved in its inactivation and show that its colony growth reduction activity is independent of its PTP activity status in human cancer cell lines.

  14. Prevalence of HCV Infections Among Hemodialysis Patients in Al ...

    African Journals Online (AJOL)

    1527 patients (11%) who were HCV free at the start of the study. By the end of the study, a total of 42.2% were found to be anti-HCV reactive. Conclusion: The study demonstrated high prevalence of anti-HCV in HD units in Al Gharbiyah Governorate. Similar studies must be conducted in all Egyptian governorates' HD units ...

  15. Huntington\\'s disease: Genetic heterogeneity in black African patients

    African Journals Online (AJOL)

    Objective. Huntington's disease (HD) has been reported to occur rarely in black patients. A new genetic variant– Huntington's disease-like 2 (HDL2) – occurring more frequently in blacks, has recently been described. The absence of an expanded trinucleotide repeat at the chromosome 4 HD locus was previously regarded ...

  16. Huntington's disease and its therapeutic target genes: a global functional profile based on the HD Research Crossroads database.

    Science.gov (United States)

    Kalathur, Ravi Kiran Reddy; Hernández-Prieto, Miguel A; Futschik, Matthias E

    2012-06-28

    Huntington's disease (HD) is a fatal progressive neurodegenerative disorder caused by the expansion of the polyglutamine repeat region in the huntingtin gene. Although the disease is triggered by the mutation of a single gene, intensive research has linked numerous other genes to its pathogenesis. To obtain a systematic overview of these genes, which may serve as therapeutic targets, CHDI Foundation has recently established the HD Research Crossroads database. With currently over 800 cataloged genes, this web-based resource constitutes the most extensive curation of genes relevant to HD. It provides us with an unprecedented opportunity to survey molecular mechanisms involved in HD in a holistic manner. To gain a synoptic view of therapeutic targets for HD, we have carried out a variety of bioinformatical and statistical analyses to scrutinize the functional association of genes curated in the HD Research Crossroads database. In particular, enrichment analyses were performed with respect to Gene Ontology categories, KEGG signaling pathways, and Pfam protein families. For selected processes, we also analyzed differential expression, using published microarray data. Additionally, we generated a candidate set of novel genetic modifiers of HD by combining information from the HD Research Crossroads database with previous genome-wide linkage studies. Our analyses led to a comprehensive identification of molecular mechanisms associated with HD. Remarkably, we not only recovered processes and pathways, which have frequently been linked to HD (such as cytotoxicity, apoptosis, and calcium signaling), but also found strong indications for other potentially disease-relevant mechanisms that have been less intensively studied in the context of HD (such as the cell cycle and RNA splicing, as well as Wnt and ErbB signaling). For follow-up studies, we provide a regularly updated compendium of molecular mechanism, that are associated with HD, at http://hdtt.sysbiolab.eu Additionally

  17. Huntington's Disease and its therapeutic target genes: a global functional profile based on the HD Research Crossroads database

    Directory of Open Access Journals (Sweden)

    Kalathur Ravi Kiran

    2012-06-01

    Full Text Available Abstract Background Huntington’s disease (HD is a fatal progressive neurodegenerative disorder caused by the expansion of the polyglutamine repeat region in the huntingtin gene. Although the disease is triggered by the mutation of a single gene, intensive research has linked numerous other genes to its pathogenesis. To obtain a systematic overview of these genes, which may serve as therapeutic targets, CHDI Foundation has recently established the HD Research Crossroads database. With currently over 800 cataloged genes, this web-based resource constitutes the most extensive curation of genes relevant to HD. It provides us with an unprecedented opportunity to survey molecular mechanisms involved in HD in a holistic manner. Methods To gain a synoptic view of therapeutic targets for HD, we have carried out a variety of bioinformatical and statistical analyses to scrutinize the functional association of genes curated in the HD Research Crossroads database. In particular, enrichment analyses were performed with respect to Gene Ontology categories, KEGG signaling pathways, and Pfam protein families. For selected processes, we also analyzed differential expression, using published microarray data. Additionally, we generated a candidate set of novel genetic modifiers of HD by combining information from the HD Research Crossroads database with previous genome-wide linkage studies. Results Our analyses led to a comprehensive identification of molecular mechanisms associated with HD. Remarkably, we not only recovered processes and pathways, which have frequently been linked to HD (such as cytotoxicity, apoptosis, and calcium signaling, but also found strong indications for other potentially disease-relevant mechanisms that have been less intensively studied in the context of HD (such as the cell cycle and RNA splicing, as well as Wnt and ErbB signaling. For follow-up studies, we provide a regularly updated compendium of molecular mechanism, that are

  18. A Preliminary Multiple Case Report of Neurocognitive Training for Children With AD/HD in China

    Directory of Open Access Journals (Sweden)

    Han Jiang

    2015-06-01

    Full Text Available This preliminary multiple case study examined the behavioral outcomes of neurocognitive training on children with attention-deficit/hyperactivity disorder (AD/HD in China, as well as parent acceptance of the treatment. The training approach targeted working memory, impulse control, and attention/relaxation (via brain electrical activity. Outcome measures included overt behavior as rated by parents and teachers, AD/HD symptom frequency, and parent opinion/feedback. Training was completed by five individuals and delivered via a themed computer game with electroencephalogram (EEG input via a wireless, single-channel, dry-sensor, portable measurement device. The objective (i.e., training outcomes and EEG and subjective (i.e., parent ratings/feedback and teacher ratings data suggested that use of the neurocognitive training resulted in reduced AD/HD behaviors and improvement in socially meaningful outcomes. The parents expressed satisfaction with the training procedure and outcomes. It is concluded that the innovative neurocognitive training approach is effective for improving behavior and reducing symptoms of AD/HD for children in China.

  19. Elemental abundances of mercury-manganese stars and the population 2-type star HD 109995

    International Nuclear Information System (INIS)

    Adelman, S.J.

    1985-02-01

    Ultraviolet and optical data for the Hg-Mn stars Coronae Borealis and Cancri is being combined with data for the field-horizontal-branch population II star HD 109995 in order to derive the element abundances in their photospheres. Data collected by IUE is being utilized

  20. HD 185330 — chemically peculiar 3He star in the Kepler field

    Science.gov (United States)

    Niemczura, E.; Vennes, S.; Różański, T.; Pigulski, A.; Hełminiak, K.; Lehmann, H.

    2018-01-01

    We analyzed high-resolution spectra of the chemically peculiar 3He star HD 185330. We determined its atmospheric parameters (Teff, log g, ξ) and constrained its rotation velocity and abundance pattern. In particular, we found a large (×100) phosphorus abundance excess and evidence of 3He and 4He abundance stratification in the atmosphere.

  1. The Stroop revisited: a meta-analysis of interference control in AD/HD

    NARCIS (Netherlands)

    van Mourik, R.; Oosterlaan, J.; Sergeant, J.A.

    2005-01-01

    Background: An inhibition deficit, including poor interference control, has been implicated as one of the core deficits in AD/HD. Interference control is clinically measured by the Stroop Colour-Word Task. The aim of this meta-analysis was to investigate the strength of an interference deficit in

  2. Molecular marker analysis of heading date Hd1 locus in Egyptian ...

    African Journals Online (AJOL)

    Nine molecular markers derived from the heading date QTL Hd1 DNA sequence for cultivated rice were used to study the heading date allelic diversity of the cultivated Egyptian rice varieties. The results showed that among the nine simple sequence repeats (SSR) and sequence tagged-sites (STS) markers used, one SSR ...

  3. HD 140283: A STAR IN THE SOLAR NEIGHBORHOOD THAT FORMED SHORTLY AFTER THE BIG BANG

    Energy Technology Data Exchange (ETDEWEB)

    Bond, Howard E.; Nelan, Edmund P. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); VandenBerg, Don A. [Department of Physics and Astronomy, University of Victoria, P.O. Box 3055, Victoria, BC V8W 3P6 (Canada); Schaefer, Gail H. [The CHARA Array of Georgia State University, Mount Wilson Observatory, Mount Wilson, CA 91023 (United States); Harmer, Dianne, E-mail: bond@stsci.edu, E-mail: nelan@stsci.edu, E-mail: vandenbe@uvic.ca, E-mail: schaefer@chara-array.org, E-mail: diharmer@noao.edu [National Optical Astronomy Observatories, 950 North Cherry Avenue, Tucson, AZ 85726 (United States)

    2013-03-01

    HD 140283 is an extremely metal-deficient and high-velocity subgiant in the solar neighborhood, having a location in the Hertzsprung-Russell diagram where absolute magnitude is most sensitive to stellar age. Because it is bright, nearby, unreddened, and has a well-determined chemical composition, this star avoids most of the issues involved in age determinations for globular clusters. Using the Fine Guidance Sensors on the Hubble Space Telescope, we have measured a trigonometric parallax of 17.15 {+-} 0.14 mas for HD 140283, with an error one-fifth of that determined by the Hipparcos mission. Employing modern theoretical isochrones, which include effects of helium diffusion, revised nuclear reaction rates, and enhanced oxygen abundance, we use the precise distance to infer an age of 14.46 {+-} 0.31 Gyr. The quoted error includes only the uncertainty in the parallax, and is for adopted surface oxygen and iron abundances of [O/H] = -1.67 and [Fe/H] = -2.40. Uncertainties in the stellar parameters and chemical composition, especially the oxygen content, now contribute more to the error budget for the age of HD 140283 than does its distance, increasing the total uncertainty to about {+-}0.8 Gyr. Within the errors, the age of HD 140283 does not conflict with the age of the Universe, 13.77 {+-} 0.06 Gyr, based on the microwave background and Hubble constant, but it must have formed soon after the big bang.

  4. Unravelling the Nature of HD 81032 – A New RS CVn Binary

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... ... component solar-abundance coronal plasma model, but implies either the presence of two or more plasma components, non-solar abundances, or a combination of both of these properties. All of the above properties of HD 81032 suggest that it is a newly identified, evolved RS CVn binary.

  5. Non-detection of Previously Reported Transits of HD 97658b with MOST Photometry

    DEFF Research Database (Denmark)

    Dragomir, Diana; Matthews, Jaymie M.; Howard, Andrew W.

    2012-01-01

    The radial velocity-discovered exoplanet HD 97658b was recently announced to transit, with a derived planetary radius of 2.93 ± 0.28 R ⊕. As a transiting super-Earth orbiting a bright star, this planet would make an attractive candidate for additional observations, including studies of its atmosp...

  6. VizieR Online Data Catalog: HD20794 HARPS radial velocities (Feng+, 2017)

    Science.gov (United States)

    Feng, F.; Tuomi, M.; Jones, H. R. A.

    2017-05-01

    HARPS radial velocities, activity indices and differential radial velocities for HD 20794. The HARPS spectra are available in the European Southern Observatory archive, and are processed using the TERRA algorithm (Anglada-Escude and Butler, 2012, Cat. J/ApJS/200/15). (1 data file).

  7. Computer-aided detection of early cancer in the esophagus using HD endoscopy images

    NARCIS (Netherlands)

    Sommen, van der F.; Zinger, S.; Schoon, E.J.; With, de P.H.N.

    2013-01-01

    Esophageal cancer is the fastest rising type of cancer in the Western world. The recent development of High-Definition (HD) endoscopy has enabled the specialist physician to identify cancer at an early stage. Nevertheless, it still requires considerable effort and training to be able to recognize

  8. The effect of methylphenidate on three forms of response inhibition in boys with AD/HD

    NARCIS (Netherlands)

    Scheres, A.; Oosterlaan, J.; Swanson, J.; Morein-Zamir, S.; Meiran, N.; Schut, H.; Vlasveld, L.; Sergeant, J.A.

    2003-01-01

    The current study was aimed at (a) investigating the effect of three doses methylphenidate (MPH) and placebo on inhibition of a prepotent response, inhibition of an ongoing response, and interference control in Attention Deficit/Hyperactivity Disorder (AD/HD), and (b) studying dose-response

  9. Bound energy levels at the n=2 dissociation threshold in HD

    NARCIS (Netherlands)

    Pielage, T.G.P.; de Lange, A.; Brandi, F.; Ubachs, W.M.G.

    2002-01-01

    Level energies of g symmetry states lying just below the n = 2 dissociation threshold have been determined in a XUV + IR multi-step laser excitation experiment in HD, with an absolute accuracy of the excitation energy of 0.015 cm

  10. XUV-laser spectroscopy of HD at 92-98 nm.

    NARCIS (Netherlands)

    Hinnen, P.C.; Werners, S.E.; Stolte, S.; Hogervorst, W.; Ubachs, W.M.G.

    1995-01-01

    Sub-Doppler excitation spectra of HD have been recorded in the range 9298 nm with the use of a narrow-band and tunable extreme ultraviolet laser in combination with a molecular beam. Frequencies of 147 transitions to the B 1u+, C 1 u, and EF 1g+ states have been calibrated with an average absolute

  11. Electrochemical H-D isotope effect at metal-perovskite proton conductor interfaces

    DEFF Research Database (Denmark)

    Kek, D.; Bonanos, N.

    1999-01-01

    The H-D isotope effect on the electrode kinetics of a metal-proton conductor interface has been investigated. The current-voltage behaviour depends on the nature of the electrode (Ni, Ag), the atmosphere (H(2), D(2)), the partial pressures of the gases, and the temperature. The isotope effect was...

  12. Home video monitoring system for neurodegenerative diseases based on commercial HD cameras

    NARCIS (Netherlands)

    Abramiuc, B.; Zinger, S.; De With, P.H.N.; De Vries-Farrouh, N.; Van Gilst, M.M.; Bloem, B.; Overeem, S.

    2016-01-01

    Neurodegenerative disease (ND) is an umbrella term for chronic disorders that are characterized by severe joint cognitive-motor impairments, which are difficult to evaluate on a frequent basis. HD cameras in the home environment could extend and enhance the diagnosis process and could lead to better

  13. Modeling the HD 32297 Debris Disk With Far-Infrared Herschel Data

    Science.gov (United States)

    Donaldson, J.K.; Lebreton, J.; Roberge, A.; Augereau, J.-C.; Krivov, A. V.

    2013-01-01

    HD 32297 is a young A-star (approx. 30 Myr) 112 pc away with a bright edge-on debris disk that has been resolved in scattered light. We observed the HD 32297 debris disk in the far-infrared and sub-millimeter with the Herschel Space Observatory PACS and SPIRE instruments, populating the spectral energy distribution (SED) from 63 to 500 micron..We aimed to determine the composition of dust grains in the HD 32297 disk through SED modeling, using geometrical constraints from the resolved imaging to break the degeneracies inherent in SED modeling. We found the best fitting SED model has two components: an outer ring centered around 110 AU, seen in the scattered light images, and an inner disk near the habitable zone of the star. The outer disk appears to be composed of grains>2 micron consisting of silicates, carbonaceous material, and water ice with an abundance ratio of 1:2:3 respectively and 90% porosity. These grains appear consistent with cometary grains, implying the underlying planetesimal population is dominated by comet-like bodies. We also discuss the 3.7 sigma detection of [C ii] emission at 158 micron with the Herschel PACS instrument, making HD 32297 one of only a handful of debris disks with circumstellar gas detected

  14. Critique: Can Children with AD/HD Learn Relaxation and Breathing Techniques through Biofeedback Video Games?

    Science.gov (United States)

    Wright, Craig; Conlon, Elizabeth

    2009-01-01

    This article presents a critique on K. Amon and A. Campbell's "Can children with AD/HD learn relaxation and breathing techniques through biofeedback video games?". Amon and Campbell reported a successful trial of a commercially available biofeedback program, "The Wild Divine", in reducing symptoms of Attention-Deficit/Hyperactivity Disorder (ADHD)…

  15. THE PECULIAR DEBRIS DISK OF HD 111520 AS RESOLVED BY THE GEMINI PLANET IMAGER

    Energy Technology Data Exchange (ETDEWEB)

    Draper, Zachary H.; Matthews, Brenda C.; Gerard, Benjamin [Department of Physics and Astronomy, University of Victoria, 3800 Finnerty Rd., Victoria, BC V8P 5C2 (Canada); Duchêne, Gaspard; Wang, Jason J.; Kalas, Paul; Graham, James R. [Department of Astronomy, UC Berkeley, Berkeley, CA 94720 (United States); Millar-Blanchaer, Maxwell A. [Department of Astronomy and Astrophysics, University of Toronto, Toronto, ON M5S 3H4 (Canada); Padgett, Deborah [NASA Goddard Space Flight Center, 8800 Greenbelt Rd., Greenbelt, MD 20771 (United States); Ammons, S. Mark [Lawrence Livermore National Lab, 7000 East Ave., Livermore, CA 94551 (United States); Bulger, Joanna [Subaru Telescope, NAOJ, 650 North Aohoku Pl., Hilo, HI 96720 (United States); Chen, Christine; Greenbaum, Alexandra Z. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Chilcote, Jeffrey K. [Dunlap Institute for Astronomy and Astrophysics, University of Toronto, 50 St. George St., Toronto, ON M5S 3H4 (Canada); Doyon, René [Institut de Recherche sur les Exoplanètes, Départment de Physique, Université de Montréal, Montréal, QC H3C 3J7 (Canada); Fitzgerald, Michael P. [Department of Physics and Astronomy, UCLA, Los Angeles, CA 90095 (United States); Follette, Kate B.; Macintosh, Bruce [Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, CA 94305 (United States); Hibon, Pascale [European Southern Observatory, Casilla 19001, Santiago 19 (Chile); Hinkley, Sasha [University of Exeter, Astrophysics Group, Physics Building, Stocker Rd., Exeter, EX4 4QL (United Kingdom); and others

    2016-08-01

    Using the Gemini Planet Imager, we have resolved the circumstellar debris disk around HD 111520 at a projected range of ∼30–100 AU in both total and polarized H -band intensity. The disk is seen edge-on at a position angle of 165° along the spine of emission. A slight inclination and asymmetric warp are covariant and alter the interpretation of the observed disk emission. We employ three point-spread function subtraction methods to reduce the stellar glare and instrumental artifacts to confirm that there is a roughly 2:1 brightness asymmetry between the NW and SE extension. This specific feature makes HD 111520 the most extreme example of asymmetric debris disks observed in scattered light among similar highly inclined systems, such as HD 15115 and HD 106906. We further identify a tentative localized brightness enhancement and scale height enhancement associated with the disk at ∼40 AU away from the star on the SE extension. We also find that the fractional polarization rises from 10% to 40% from 0.″5 to 0.″8 from the star. The combination of large brightness asymmetry and symmetric polarization fraction leads us to believe that an azimuthal dust density variation is causing the observed asymmetry.

  16. Simulation and control of a HD diesel engine equipped with new EGR technology

    NARCIS (Netherlands)

    Dekker, H.J.; Sturm, W.L.

    1996-01-01

    A dynamic model of a Heavy Duty (HD) turbocharged and aftercooled diesel engine was developed. The engine was equipped with high pressure diesel injection, a Variable Geometry Turbine (VGT) and an Exhaust Gas Recirculation (EGR) system. This engine was targeted at meeting EURO4 emission

  17. AAS Nov 07 Cover.indd

    African Journals Online (AJOL)

    The rate of advanced colorectal disease (Duke. C and D) was 73.5%. Mean follow-up time was. 5.8 months with median survival of only 6.9 months. The Duke staging, histology, symptom duration, locations of tumours, follow-up and the complication rates were similar for young and older patients. CONCLUSION: Younger ...

  18. Evidence for a modifier of onset age in Huntington disease linked to the HD gene in 4p16

    Science.gov (United States)

    Djoussé, Luc; Knowlton, Beth; Hayden, Michael R.; Almqvist, Elisabeth W.; Brinkman, Ryan R.; Ross, Christopher A.; Margolis, Russel L.; Rosenblatt, Adam; Durr, Alexandra; Dode, Catherine; Morrison, Patrick J.; Novelletto, Andrea; Frontali, Marina; Trent, Ronald J. A.; McCusker, Elizabeth; Gómez-Tortosa, Estrella; Mayo Cabrero, David; Jones, Randi; Zanko, Andrea; Nance, Martha; Abramson, Ruth K.; Suchowersky, Oksana; Paulsen, Jane S.; Harrison, Madaline B.; Yang, Qiong; Cupples, L. Adrienne; Mysore, Jayalakshmi; Gusella, James F.; MacDonald, Marcy E.

    2007-01-01

    Huntington disease (HD) is a neurodegenerative disorder caused by the abnormal expansion of CAG repeats in the HD gene on chromosome 4p16.3. A recent genome scan for genetic modifiers of age at onset of motor symptoms (AO) in HD suggests that one modifier may reside in the region close to the HD gene itself. We used data from 535 HD participants of the New England Huntington cohort and the HD MAPS cohort to assess whether AO was influenced by any of the three markers in the 4p16 region: MSX1 (Drosophila homeo box homologue 1, formerly known as homeo box 7, HOX7), Δ2642 (within the HD coding sequence), and BJ56 (D4S127). Suggestive evidence for an association was seen between MSX1 alleles and AO, after adjustment for normal CAG repeat, expanded repeat, and their product term (model P value 0.079). Of the variance of AO that was not accounted for by HD and normal CAG repeats, 0.8% could be attributed to the MSX1 genotype. Individuals with MSX1 genotype 3/3 tended to have younger AO. No association was found between Δ2642 (P=0.44) and BJ56 (P=0.73) and AO. This study supports previous studies suggesting that there may be a significant genetic modifier for AO in HD in the 4p16 region. Furthermore, the modifier may be present on both HD and normal chromosomes bearing the 3 allele of the MSX1 marker. PMID:15029481

  19. Experimental transmission of AA amyloidosis by injecting the AA amyloid protein into interleukin-1 receptor antagonist knockout (IL-1raKO) mice.

    Science.gov (United States)

    Watanabe, K; Uchida, K; Chambers, J K; Tei, M; Shoji, A; Ushio, N; Nakayama, H

    2015-05-01

    The incidence of AA amyloidosis is high in humans with rheumatoid arthritis and several animal species, including cats and cattle with prolonged inflammation. AA amyloidosis can be experimentally induced in mice using severe inflammatory stimuli and a coinjection of AA amyloid; however, difficulties have been associated with transmitting AA amyloidosis to a different animal species, and this has been attributed to the "species barrier." The interleukin-1 receptor antagonist knockout (IL-1raKO) mouse, a rodent model of human rheumatoid arthritis, has been used in the transmission of AA amyloid. When IL-1raKO and BALB/c mice were intraperitoneally injected with mouse AA amyloid together with a subcutaneous pretreatment of 2% AgNO3, all mice from both strains that were injected with crude or purified murine AA amyloid developed AA amyloidosis. However, the amyloid index, which was determined by the intensity of AA amyloid deposition, was significantly higher in IL-1raKO mice than in BALB/c mice. When IL-1raKO and BALB/c mice were injected with crude or purified bovine AA amyloid together with the pretreatment, 83% (5/6 cases) and 38% (3/8 cases) of IL-1raKO mice and 17% (1/6 cases) and 0% (0/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. Similarly, when IL-1raKO and BALB/c mice were injected with crude or purified feline AA amyloid, 33% (2/6 cases) and 88% (7/8 cases) of IL-1raKO mice and 0% (0/6 cases) and 29% (2/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. These results indicated that IL-1raKO mice are a useful animal model for investigating AA amyloidogenesis. © The Author(s) 2014.

  20. Relationship between mental health and spiritual wellbeing among hemodialysis patients: a correlation study.

    Science.gov (United States)

    Martínez, Beatriz Bertolaccini; Custódio, Rodrigo Pereira

    2014-01-01

    The stress of living with a terminal disease has a negative impact on the mental health of hemodialysis (HD) patients. Spirituality is a potential coping mechanism for stressful experiences. Studies on the relationship between spirituality and mental health among HD patients are scarce. The purpose of this study was to evaluate the relationship between mental health and spiritual well-being among HD patients. Cross-sectional observational study on hemodialysis patients at a single center in Brazil, between January and December 2011. Mental health was assessed using the General Health Questionnaire and spiritual wellbeing was assessed using the Spiritual Wellbeing Scale; 150 HD patients participated in the study. A significant correlation was found between mental health and spiritual wellbeing (P = 0.001). Spiritual wellbeing was the strongest predictor of mental health, psychological distress, sleep disturbance and psychosomatic complaints. Poor mental health was associated with lower spiritual wellbeing. This has important implications for delivery of palliative care to HD patients.

  1. THE TRENDS HIGH-CONTRAST IMAGING SURVEY. III. A FAINT WHITE DWARF COMPANION ORBITING HD 114174

    International Nuclear Information System (INIS)

    Crepp, Justin R.; Johnson, John Asher; Howard, Andrew W.; Marcy, Geoffrey W.; Gianninas, Alexandros; Kilic, Mukremin; Wright, Jason T.

    2013-01-01

    The nearby Sun-like star HD 114174 exhibits a strong and persistent Doppler acceleration indicating the presence of an unseen distant companion. We have acquired high-contrast imaging observations of this star using NIRC2 at Keck and report the direct detection of the body responsible for causing the ''trend''. HD 114174 B has a projected separation of 692 ± 9 mas (18.1 AU) and is 10.75 ± 0.12 mag (contrast of 5 × 10 –5 ) fainter than its host in the K-band, requiring aggressive point-spread function subtraction to identify. Our astrometric time baseline of 1.4 yr demonstrates physical association through common proper motion. We find that the companion has absolute magnitude, M J = 13.97 ± 0.11, and colors, J – K = 0.12 ± 0.16 mag. These characteristics are consistent with an ≈T3 dwarf, initially leading us to believe that HD 114174 B was a substellar object. However, a dynamical analysis that combines radial velocity measurements with available imaging data indicates a minimum mass of 0.260 ± 0.010 M ☉ . We conclude that HD 114174 B must be a white dwarf. Assuming a hydrogen-rich composition, atmospheric and evolutionary model fits yield an effective temperature T eff = 8200 ± 4000 K, surface gravity log g = 8.90 ± 0.02, and cooling age of t c ≈ 3.4 Gyr, which is consistent with the 4.7 +2.3 -2.6 Gyr host star isochronal age estimate. HD 114174 B is a benchmark object located only 26.14 ± 0.37 pc from the Sun. It may be studied at a level of detail comparable to Sirius and Procyon, and used to understand the link between the mass of white dwarf remnants with that of their progenitors

  2. Identification of Heading Date Six (Hd6 Gene Derived from Rice Mutant Varieties

    Directory of Open Access Journals (Sweden)

    Aryanti Aryanti

    2017-04-01

    Full Text Available Genes which were associated with flowering time to indicate the early maturity is known as heading date (Hd. Heading date six (Hd6 gene was identified from rice mutant varieties were Atomita 2, Atomita 3, Atomita 4, Bestari, Cilosari, Diah Suci, Sidenuk, Kahayan, Mayang, Meraoke, Mira-1, Pandan Putri, Superwin, Suluttan Unsrat 1, Suluttan Unsrat 2, Winongo, Woyla, Yuwono, while the rice var. Nipponbare was used as a positive control. All of rice mutant varieties derived from mutation induction by the dose of 0.2 kGy. The aim of this experiment was to find out the data base of mutant varieties which could be used as parent material with earlier maturity trait genetically. To obtain the DNA of plants, young leaves of each variety were extracted by liquid nitrogen, and then lysis and extracted by Kit Plant Genomic DNA. The amplification of DNA with 7 primers of Hd6 conducted of 40 cycles by PCR and were continues to separated by 1 % agarose. The results were shown that the rice Mira-1 and Bestari varieties obtained from mutation of Cisantana highly different from one to another on 7 primers of Hd6 used. Mayang variety from mutation of cross breeding between Cilosari and IR64, Pandan putri from Pandan wangi and Woyla from mutation of cross breeding from Atomita 2 and IR64 were highly different with those of their parents. Identification of Hd6 gene on Sidenuk variety was shown the same bands pattern with Nipponbare as control positive toward all primers used, this variety would be better for earlier maturity parent material compared to others. The information could be useful for breeding programs aiming to develop early maturing widely adaptive and high yielding rice cultivars.

  3. Enhanced neuronal glucose transporter expression reveals metabolic choice in a HD Drosophila model.

    Science.gov (United States)

    Besson, Marie Thérèse; Alegría, Karin; Garrido-Gerter, Pamela; Barros, Luis Felipe; Liévens, Jean-Charles

    2015-01-01

    Huntington's disease is a neurodegenerative disorder caused by toxic insertions of polyglutamine residues in the Huntingtin protein and characterized by progressive deterioration of cognitive and motor functions. Altered brain glucose metabolism has long been suggested and a possible link has been proposed in HD. However, the precise function of glucose transporters was not yet determined. Here, we report the effects of the specifically-neuronal human glucose transporter expression in neurons of a Drosophila model carrying the exon 1 of the human huntingtin gene with 93 glutamine repeats (HQ93). We demonstrated that overexpression of the human glucose transporter in neurons ameliorated significantly the status of HD flies by increasing their lifespan, reducing their locomotor deficits and rescuing eye neurodegeneration. Then, we investigated whether increasing the major pathways of glucose catabolism, glycolysis and pentose-phosphate pathway (PPP) impacts HD. To mimic increased glycolytic flux, we overexpressed phosphofructokinase (PFK) which catalyzes an irreversible step in glycolysis. Overexpression of PFK did not affect HQ93 fly survival, but protected from photoreceptor loss. Overexpression of glucose-6-phosphate dehydrogenase (G6PD), the key enzyme of the PPP, extended significantly the lifespan of HD flies and rescued eye neurodegeneration. Since G6PD is able to synthesize NADPH involved in cell survival by maintenance of the redox state, we showed that tolerance to experimental oxidative stress was enhanced in flies co-expressing HQ93 and G6PD. Additionally overexpressions of hGluT3, G6PD or PFK were able to circumvent mitochondrial deficits induced by specific silencing of genes necessary for mitochondrial homeostasis. Our study confirms the involvement of bioenergetic deficits in HD course; they can be rescued by specific expression of a glucose transporter in neurons. Finally, the PPP and, to a lesser extent, the glycolysis seem to mediate the hGluT3

  4. Enhanced neuronal glucose transporter expression reveals metabolic choice in a HD Drosophila model.

    Directory of Open Access Journals (Sweden)

    Marie Thérèse Besson

    Full Text Available Huntington's disease is a neurodegenerative disorder caused by toxic insertions of polyglutamine residues in the Huntingtin protein and characterized by progressive deterioration of cognitive and motor functions. Altered brain glucose metabolism has long been suggested and a possible link has been proposed in HD. However, the precise function of glucose transporters was not yet determined. Here, we report the effects of the specifically-neuronal human glucose transporter expression in neurons of a Drosophila model carrying the exon 1 of the human huntingtin gene with 93 glutamine repeats (HQ93. We demonstrated that overexpression of the human glucose transporter in neurons ameliorated significantly the status of HD flies by increasing their lifespan, reducing their locomotor deficits and rescuing eye neurodegeneration. Then, we investigated whether increasing the major pathways of glucose catabolism, glycolysis and pentose-phosphate pathway (PPP impacts HD. To mimic increased glycolytic flux, we overexpressed phosphofructokinase (PFK which catalyzes an irreversible step in glycolysis. Overexpression of PFK did not affect HQ93 fly survival, but protected from photoreceptor loss. Overexpression of glucose-6-phosphate dehydrogenase (G6PD, the key enzyme of the PPP, extended significantly the lifespan of HD flies and rescued eye neurodegeneration. Since G6PD is able to synthesize NADPH involved in cell survival by maintenance of the redox state, we showed that tolerance to experimental oxidative stress was enhanced in flies co-expressing HQ93 and G6PD. Additionally overexpressions of hGluT3, G6PD or PFK were able to circumvent mitochondrial deficits induced by specific silencing of genes necessary for mitochondrial homeostasis. Our study confirms the involvement of bioenergetic deficits in HD course; they can be rescued by specific expression of a glucose transporter in neurons. Finally, the PPP and, to a lesser extent, the glycolysis seem to

  5. Fatal dialysis disequilibrium syndrome: A tale of two patients

    Directory of Open Access Journals (Sweden)

    Shaikh Nissar

    2010-01-01

    Full Text Available Dialysis disequilibrium syndrome (DDS is a central nervous system disorder, which occurs during hemodialysis (HD or within 24 h following the first HD. DDS commonly occurs in patients suffering from end-stage renal failure undergoing HD for the first time. In a critically ill patient suffering from severe sepsis or septic shock, the combined effects of post-HD brain edema and changes in the brain due to septic encephalopathy, may become amplified leading to DDS. Here we report 2 cases with acute renal failure (ARF, undergoing HD for more than a week and being ventilated and who developed DDS. DDS might have contributed to the sudden deterioration and death in these septic patients. The first case was a 31-year-old male, involved in a motor vehicle accident and had a severe abdominal injury. Underwent laparotomy and hemostasis was achieved. On day 4, the patient developed hemorrhagic shock associated with ARF, which prompted daily HD. On day 8, he went into septic shock. On day 16, 1 h after his daily HD, he became unresponsive and his pupils became dilated and fixed and he expired 2 days later. The second case was a young male who suffered severe abdominal and chest injury after a fall from a height. He developed ARF on day 3 and required HD. On day 9, he had septic shock. Three days later, during his daily HD, he became unconscious and his pupils were not reacting to light and the patient died on day 12. Conclusion: In patients with severe sepsis/septic shock, DDS may occur even after repeated sessions of HD. The acute care physicians, intensivists, and nephrologists should be aware of the risks of DDS.

  6. Daily intake and serum concentration of menaquinone-4 (MK-4) in haemodialysis patients with chronic kidney disease.

    Science.gov (United States)

    Wyskida, Katarzyna; Żak-Gołąb, Agnieszka; Łabuzek, Krzysztof; Suchy, Dariusz; Ficek, Rafał; Pośpiech, Kornel; Olszanecka-Glinianowicz, Magdalena; Okopień, Bogusław; Więcek, Andrzej; Chudek, Jerzy

    2015-12-01

    Decreased concentration of menaquinone-4 (MK-4) seems to be an important risk factor of vascular calcification in haemodialysis (HD) patients. Optimal dietary intake, as well as serum MK-4 reference range, in HD has not been determined, yet. The aim of the present study was to assess daily vitamin K1 and MK-4 intakes and their relation to serum MK-4 concentration in HD patients. Daily vitamin K1 and MK-4, micro- and macronutrients and energy intakes were assessed using 3-day food diary completed by patients and serum MK-4 concentration was measured by HPLC [limit of quantification (LOQ): 0.055 ng/mL] in 85 HD patients (51 males) and 22 apparently healthy subjects. Daily MK-4 intake was significantly lower (by 29%) among HD, while K1 consumption was similar in both groups. Daily MK-4 intake was associated with fat and protein consumption in HD (r=0.43, pintakes were weaker in HD (r=0.38 and r=0.30 respectively) than in the control group (r=0.47 and r=0.45, respectively). In multiple regression analysis the variability of serum MK-4 concentrations in HD patients was explained by its daily intake. Decreased serum MK-4 concentration in HD patients is caused by lower dietary MK-4 intake, mainly due to diminished meat consumption, and in addition, probably reduced K1 conversion. Copyright © 2015 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  7. Dialysis access, infections, and hospitalisations in unplanned dialysis start patients

    DEFF Research Database (Denmark)

    Machowska, Anna; Alscher, Mark Dominik; Vanga, Satyanarayana Reddy

    2017-01-01

    Introduction: Unplanned dialysis start (UPS) associates with worse clinical outcomes, higher utilisation of healthcare resources, lower chances to select dialysis modality and UPS patients typically commenced in-centre haemodialysis (HD) with central venous catheter (CVC). We evaluated patient ou...

  8. Programmed initiation of hemodialysis for systemic amyloidosis patients associated with rheumatoid arthritis.

    Science.gov (United States)

    Kuroda, Takeshi; Tanabe, Naohito; Kobayashi, Daisuke; Sato, Hiroe; Wada, Yoko; Murakami, Shuichi; Sakatsume, Minoru; Nakano, Masaaki; Narita, Ichiei

    2011-09-01

    Reactive amyloidosis is a serious systemic disease in rheumatoid arthritis (RA). Amyloid protein can be deposited in kidneys, heart or gastrointestinal tract leading to organ failure. Renal involvement is a well-known complication in amyloidosis as this may culminate in end-stage renal disease (ESRD). Hemodialysis (HD) is always considered the treatment of choice for such patients; however, the prognosis is usually poor due to a large number of sudden deaths immediately following HD therapy. To circumvent the problem of HD initiation while instituting HD safety, we devised a plan to start HD and compare patient's survival with our previous data. Sixty-three patients were treated with HD. They were categorized according to the initiation of first dialysis. All patients were divided into planned, unplanned and programmed initiation groups. First dialysis that had been initiated as not urgent was considered 'planned' (20 patients). First dialysis that had been performed urgently for life-threatening renal insufficiency was considered 'unplanned' (31 patients). First dialysis that had been initiated as not urgent and according to our dialysis program was considered 'programmed' (12 patients). Survival of these 63 patients from the initiation of HD at 38 days was 75%, at 321 days was 50% and at 1,784 days was 25%. Patients with unplanned initiation of HD showed a significant poor survival compared with those of both planned and programmed initiation. Additionally, patients with planned and programmed initiation of HD showed no significant difference for the patients' survival. Our study demonstrates that patients with amyloidosis have a higher mortality rate. Nevertheless, programmed initiation of HD will improve the prognosis of patients with ESRD. Such possibility needs to be considered in more detail in the future.

  9. Calcium, Parathyroid Hormone, and Vitamin D: Major Determinants of Chronic Pain in Hemodialysis Patients

    OpenAIRE

    Golan, Eliezer; Haggiag, Isabelle; Os, Pnina; Bernheim, Jacques

    2009-01-01

    Background and objectives: Pain is a frequent complaint of hemodialysis (HD) patients, yet information regarding its causes and frequency is relatively scarce. The aim of this study was to evaluate the frequency and possible causes of chronic pain in patients who are on long-term HD.

  10. Hypocretin and melanin-concentrating hormone in patients with Huntington disease.

    NARCIS (Netherlands)

    Aziz, A.; Fronczek, R.; Maat-Schieman, M.L.; Unmehopa, U.A.; Roelandse, F.W.; Overeem, S.; Duinen, S.G. van; Lammers, G.J.; Swaab, D.F.; Roos, R.A.C.

    2008-01-01

    To evaluate whether hypocretin-1 (orexin-A) and melanin-concentrating hormone (MCH) neurotransmission are affected in patients with Huntington disease (HD), we immunohistochemically stained hypocretin and MCH neurons and estimated their total numbers in the lateral hypothalamus of both HD patients

  11. Superoxide dismutase type 1 in monocytes of chronic kidney disease patients

    DEFF Research Database (Denmark)

    Scholze, Alexandra; Krueger, Katharina; Diedrich, Madeleine

    2011-01-01

    chronic hemodialysis (HD) and 211 CKD patients, and 34 control subjects. Furthermore, we showed that different SOD1 protein species exist in human monocytes. SOD1 protein amount was significantly lower in HD (normalized SOD1 protein, 27.2 ± 2.8) compared to CKD patients (34.3 ± 2.8), or control subjects...

  12. Significant association between renal function and area of amyloid deposition in kidney biopsy specimens in both AA amyloidosis associated with rheumatoid arthritis and AL amyloidosis.

    Science.gov (United States)

    Kuroda, Takeshi; Tanabe, Naohito; Hasegawa, Eriko; Wakamatsu, Ayako; Nozawa, Yukiko; Sato, Hiroe; Nakatsue, Takeshi; Wada, Yoko; Ito, Yumi; Imai, Naofumi; Ueno, Mitsuhiro; Nakano, Masaaki; Narita, Ichiei

    2017-06-01

    The kidney is a major target organ for systemic amyloidosis, which results in proteinuria and an elevated serum creatinine level. The clinical manifestations and precursor proteins of amyloid A (AA) and light-chain (AL) amyloidosis are different, and the renal damage due to amyloid deposition also seems to differ. The purpose of this study was to clarify haw the difference in clinical features between AA and AL amyloidosis are explained by the difference in the amount and distribution of amyloid deposition in the renal tissues. A total of 119 patients participated: 58 patients with an established diagnosis of AA amyloidosis (AA group) and 61 with AL amyloidosis (AL group). We retrospectively investigated the correlation between clinical data, pathological manifestations, and the area occupied by amyloid in renal biopsy specimens. In most of the renal specimens the percentage area occupied by amyloid was less than 10%. For statistical analyses, the percentage area of amyloid deposition was transformed to a common logarithmic value (Log 10 %amyloid). The results of sex-, age-, and Log 10 %amyloid-adjusted analyses showed that systolic blood pressure (SBP) was higher in the AA group. In terms of renal function parameters, serum creatinine, creatinine clearance (Ccr) and estimated glomerular filtration rate (eGFR) indicated significant renal impairment in the AA group, whereas urinary protein indicated significant renal impairment in the AL group. Pathological examinations revealed amyloid was predominantly deposited at glomerular basement membrane (GBM) and easily transferred to the mesangial area in the AA group, and it was predominantly deposited at in the AL group. The degree of amyloid deposition in the glomerular capillary was significantly more severe in AL group. The frequency of amyloid deposits in extraglomerular mesangium was not significantly different between the two groups, but in AA group, the degree amyloid deposition was significantly more severe, and

  13. Churg-Strauss syndrome associated with AA amyloidosis: a case ...

    African Journals Online (AJOL)

    Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/μL), positive ...

  14. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. See also 7906190, 7906193.

  15. Systemic AA amyloidosis in the red fox (Vulpes vulpes).

    Science.gov (United States)

    Rising, Anna; Cederlund, Ella; Palmberg, Carina; Uhlhorn, Henrik; Gaunitz, Stefan; Nordling, Kerstin; Ågren, Erik; Ihse, Elisabet; Westermark, Gunilla T; Tjernberg, Lars; Jörnvall, Hans; Johansson, Jan; Westermark, Per

    2017-11-01

    Amyloid A (AA) amyloidosis occurs spontaneously in many mammals and birds, but the prevalence varies considerably among different species, and even among subgroups of the same species. The Blue fox and the Gray fox seem to be resistant to the development of AA amyloidosis, while Island foxes have a high prevalence of the disease. Herein, we report on the identification of AA amyloidosis in the Red fox (Vulpes vulpes). Edman degradation and tandem MS analysis of proteolyzed amyloid protein revealed that the amyloid partly was composed of full-length SAA. Its amino acid sequence was determined and found to consist of 111 amino acid residues. Based on inter-species sequence comparisons we found four residue exchanges (Ser31, Lys63, Leu71, Lys72) between the Red and Blue fox SAAs. Lys63 seems unique to the Red fox SAA. We found no obvious explanation to how these exchanges might correlate with the reported differences in SAA amyloidogenicity. Furthermore, in contrast to fibrils from many other mammalian species, the isolated amyloid fibrils from Red fox did not seed AA amyloidosis in a mouse model. © 2017 The Protein Society.

  16. Making ET AAS Determination Less Dependent on Vapourization ...

    African Journals Online (AJOL)

    NICO

    The quantification of the analytes in ET AAS is normally attained by the measurement and integration of transient absorbance. High degree of atomization and constant vapour transportation rate for the analyte atoms in the absorption volume are considered to be crucial to grant correctness of the measurements. However ...

  17. Three body abrasion of laser surface alloyed aluminium AA1200

    CSIR Research Space (South Africa)

    Mabhali, Luyolo AB

    2012-06-01

    Full Text Available Laser surface alloying of aluminium AA1200 was performed with a 4 kW Nd:YAG laser to improve the abrasion wear resistance. Aluminium surfaces reinforced with metal matrix composites and intermetallic phases were achieved. The phases present depended...

  18. Contribution to comprehensive study of aluminium alloy Aa 5083 ...

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... Corrosion induced by elemental mercury in aqueous media of industrial Aluminium alloys AA5083 used in heat exchanger industries of natural gas liquefaction has been studied by linear sweep voltammétry on ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  19. The effect of atmospheric corona treatment on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.

    2010-01-01

    The effect of atmospheric corona discharge on AM 050 aluminium surface was investigated using electrochemical polarization, SEM-EDX, FIB-SEM. and XPS. The corona treatment was performed with varying time (1, 5, and 15 min) in atmospheric air. A 200 nm oxide layer was generated on AA1050 after...

  20. Backend solutions for AA in the MUSE network supporting FMC

    NARCIS (Netherlands)

    Neerbos, A.N.R. van; Prins, M.; Melander, B.; Pimilla Larrucea, I.; Thakur, M.J.; Fredricx, F.

    2007-01-01

    The European MUSE project investigated fixed-mobile convergence from the perspective of an unbundled fixed network. A major part of the work consisted of finding solutions for the authentication and authorisation of users who roam from their home network to a visited network. This paper shows how AA

  1. Amino acid repletion does not decrease muscle protein catabolism during hemodialysis.

    Science.gov (United States)

    Raj, Dominic S C; Adeniyi, Oladipo; Dominic, Elizabeth A; Boivin, Michel A; McClelland, Sandra; Tzamaloukas, Antonios H; Morgan, Nancy; Gonzales, Lawrence; Wolfe, Robert; Ferrando, Arny

    2007-06-01

    Intradialytic protein catabolism is attributed to loss of amino acids in the dialysate. We investigated the effect of amino acid infusion during hemodialysis (HD) on muscle protein turnover and amino acid transport kinetics by using stable isotopes of phenylalanine, leucine, and lysine in eight patients with end-stage renal disease (ESRD). Subjects were studied at baseline (pre-HD), 2 h of HD without amino acid infusion (HD-O), and 2 h of HD with amino acid infusion (HD+AA). Amino acid depletion during HD-O augmented the outward transport of amino acids from muscle into the vein. Increased delivery of amino acids to the leg during HD+AA facilitated the transport of amino acids from the artery into the intracellular compartment. Increase in muscle protein breakdown was more than the increase in synthesis during HD-O (46.7 vs. 22.3%, P HD-O compared with pre-HD (-33.7 +/- 1.5 vs. -6.0 +/- 2.3, P acids, the net balance (-16.9 +/- 1.8) did not switch from net release to net uptake. HD+AA induced a proportional increase in muscle protein synthesis and catabolism. Branched chain amino acid catabolism increased significantly from baseline during HD-O and did not decrease during HD+AA. Protein synthesis efficiency, the fraction of amino acid in the intracellular pool that is utilized for muscle protein synthesis decreased from 42.1% pre-HD to 33.7 and 32.6% during HD-O and HD+AA, respectively (P acid repletion during HD increased muscle protein synthesis but did not decrease muscle protein breakdown.

  2. A Status Report on the AAS Astronomy Ambassadors Program

    Science.gov (United States)

    Fienberg, Richard Tresch; Fraknoi, Andrew; Gurton, Suzanne; Hurst, Anna; Schatz, Dennis L.

    2014-06-01

    The American Astronomical Society, in partnership with the Astronomical Society of the Pacific (ASP), has launched a series of professional-development workshops and a community of practice designed to improve early-career astronomers’ ability to communicate effectively with students and the public. Called AAS Astronomy Ambassadors, the program provides training and mentoring for young astronomers, from advanced undergraduates to beginning faculty; it also provides them access to resources and a network of contacts within the astronomy education and public outreach (EPO) community. Ambassadors are provided with a library of outreach activities and resource materials suitable for a range of venues and audiences. For much of this library we are using resources developed by organizations such as the ASP, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. After a period of evaluation and revision, the program’s “Menu of Outreach Opportunities for Science Education” (MOOSE) is now posted on the AAS website at http://aas.org/outreach/moose-menu-outreach-opportunities-science-education.The first two Astronomy Ambassadors workshops were held at AAS meetings in January 2013 and January 2014; each served 30 young astronomers chosen from about twice that many applicants. Web-based follow-up activities are being provided through a website at the ASP designed to keep cohorts of educators trained in their programs in touch with one another. The AAS is exploring ways to fund additional workshops at future winter meetings; suggestions are most welcome. Meanwhile, the Astronomy Ambassadors trained to date have logged more than 150 outreach events, reaching many thousands of children and adults across the U.S. and Canada.

  3. Delayed gastric emptying and Helicobacter pylori infection in patients with chronic renal failure

    International Nuclear Information System (INIS)

    Kao Chiahung; Hsu Yuehhan; Wang Shyhjen

    1995-01-01

    Forty patients with chronic renal failure (CRF) were enrolled in this study. Twelve of the 40 patients had upper gastrointestinal symptoms or signs (GI Sx). Twenty of the 40 patients had been receiving regular haemodialysis (HD) for at least 1 year prior to the study. Radionuclide-labelled solid metals were used to calculate gastric emptying times (GETs). The carbon-14 urea breath test ( 14 C4-UBT) was used to diagnose Helicobacter pylori (HP) infection. Among the 40 patients, 35 (88%) had an abnormal HP infection. There were no statistically significant differences in the incidence of abnormal GET among patients with HP infection and patients without HP infection. There were also no significant differences in the incidence of HP infection among patients with abnormal and normal GETs. In addition, the incidences of abnormal GET in patients with and without upper GI Sx were 83% and 89% respectively. The incidences of HP infection in patients with and without upper GI Sx were 58% and 54%, respectively. The incidences of abnormal GET in HD and non-HD patients were 95% and 80%, respectively. The incidences of HP infection in HD and non-HD patients were 45% and 65%, respectively. The differences in the incidences of abnormal GET and HP infection among HD and non-HD patients, as well as among patients with and without upper GI Sx, were not statistically significant. (orig.)

  4. Long-term use of mizoribine in rheumatoid arthritis patients on hemodialysis.

    Science.gov (United States)

    Saisho, K; Kurosawa, O; Fukanoki, T; Hanafusa, A; Tajima, N

    2001-06-01

    Abstract Small doses of mizoribine (MZR) were administered to five rheumatoid arthritis (RA) patients on hemodialysis (HD). A maintenance dose of 25 mg or less was administered either once per day or once following HD. The Lansbury activity index improved in all patients. The blood concentrations of MZR before and after HD were 0.33-1.79 μg/ml and 0-0.93 μg/ml, respectively. Hence, the rate of elimination by HD ranged from 50.3% to 83.4%. As far as side effects were concerned, alopecia was seen in two patients, and one patient developed shingles. However, the severity of these symptoms was mild and, after discontinuing or reducing the dose of MZR for a certain period of time, we were able to continue its administration. These findings suggest that the long-term administration of MZR is a useful treatment for RA patients on HD.

  5. Dynamic Response and Microstructure Evolution of AA2219-T4 and AA2219-T6 Aluminum Alloys

    Science.gov (United States)

    Olasumboye, A.; Owolabi, G.; Odeshi, A.; Zeytinci, A.; Yilmaz, N.

    2018-02-01

    In this study, the dynamic deformation behavior of AA2219 aluminum alloy was investigated in two different temper conditions: T4 and T6, with a view to determining the effect of heat treatment on the microstructure and flow behavior of the material under high strain rates. Split Hopkinson pressure bar experiment was used in determining the dynamic response of the alloy while a digital image correlation system was employed in visualizing and tracking the surface deformation of the specimens. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. The results obtained showed heterogeneous deformation of the alloy in the two temper conditions. It was observed that the dynamic mechanical behavior of each sample preparation was dependent on its strength properties due to aging type, which in turn controls the metamorphosis of the strengthening precipitates and the initial microstructure. At the maximum strain rate of 3500 s-1, transformed bands leading to crack nucleation was observed in the AA2219-T4 aluminum alloy while AA2219-T6 had fractured at the same strain rate. The modes of crack formation and growth in the two alloys were found to be similar: nucleation, growth and coalescence of voids. However, shear band bifurcation phenomenon was observed only in the AA2219-T6 alloy.

  6. Intensive Nutritional Counselling And Support And Clinical Outcomes In Hemodialysis Patients

    Directory of Open Access Journals (Sweden)

    Alessio Molfino

    2012-06-01

    In conclusion, in HD patients, nutritional counselling and nutritional support positively affect nutritional status in hypophagic patients and make the risk of morbidity and mortality in anorexic patients comparable to non-anorexic.

  7. Understanding evaporation characteristics of a drop of distilled sulfur mustard (HD) chemical agent from stainless steel and aluminum substrates

    Energy Technology Data Exchange (ETDEWEB)

    Jung, H., E-mail: junghs@add.re.kr; Lee, H.W.

    2014-05-01

    Highlights: • Evaporation rates of HD are obtained from stainless steel and aluminum substrates. • The rates increase with temperature and are linearly proportional to drop size. • HD evaporation from stainless steel follows only constant contact area mechanism. • HD evaporation from aluminum proceeds by a combined mechanism. - Abstract: We report herein the evaporation rates and mechanism of a drop of distilled sulfur mustard (HD) agent from stainless steel and aluminum substrates. For systematic analysis, we used a laboratory-sized wind tunnel, thermal desorption (TD) connected to gas chromatograph/mass spectrometry (GC/MS) and drop shape analysis (DSA). We found that the evaporation rates of HD from stainless steel and aluminum increased with temperature. The rates were also linearly proportional to drop size. The time-dependent contact angle measurement showed that the evaporation of the drop of HD proceeded only by constant contact area mechanism from stainless steel surface. On the other hand, the evaporation of HD from aluminum proceeded by a combined mechanism of constant contact area mode and constant contact angle mode. Our experimental data sets and analysis could be used to predict vapor and contact hazard persistence of chemical warfare agents (CWAs) in the air and on exterior surfaces with chemical releases, which assists the military decision influencing personnel safety and decontamination of the site upon a chemical attack event.

  8. Understanding evaporation characteristics of a drop of distilled sulfur mustard (HD) chemical agent from stainless steel and aluminum substrates

    International Nuclear Information System (INIS)

    Jung, H.; Lee, H.W.

    2014-01-01

    Highlights: • Evaporation rates of HD are obtained from stainless steel and aluminum substrates. • The rates increase with temperature and are linearly proportional to drop size. • HD evaporation from stainless steel follows only constant contact area mechanism. • HD evaporation from aluminum proceeds by a combined mechanism. - Abstract: We report herein the evaporation rates and mechanism of a drop of distilled sulfur mustard (HD) agent from stainless steel and aluminum substrates. For systematic analysis, we used a laboratory-sized wind tunnel, thermal desorption (TD) connected to gas chromatograph/mass spectrometry (GC/MS) and drop shape analysis (DSA). We found that the evaporation rates of HD from stainless steel and aluminum increased with temperature. The rates were also linearly proportional to drop size. The time-dependent contact angle measurement showed that the evaporation of the drop of HD proceeded only by constant contact area mechanism from stainless steel surface. On the other hand, the evaporation of HD from aluminum proceeded by a combined mechanism of constant contact area mode and constant contact angle mode. Our experimental data sets and analysis could be used to predict vapor and contact hazard persistence of chemical warfare agents (CWAs) in the air and on exterior surfaces with chemical releases, which assists the military decision influencing personnel safety and decontamination of the site upon a chemical attack event

  9. ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GTGMKSFLEKLDEATKEFETQYKKWINDRREAIKKQRENEKLQKWNEISNIFKSDGVELNRDAQTPCIPEHLVEGFEESNESEDLSEIDQIEQVMLNPKGRLNFV* ... ch_oct10_gene_aa_db Chro.50191 >Chro.50191 hypothetical protein MSNSFLRDLKFVGVSSFL

  10. Multi-modal neuroimaging in premanifest and early Huntington's disease: 18 month longitudinal data from the IMAGE-HD study.

    Directory of Open Access Journals (Sweden)

    Juan F Domínguez D

    Full Text Available IMAGE-HD is an Australian based multi-modal longitudinal magnetic resonance imaging (MRI study in premanifest and early symptomatic Huntington's disease (pre-HD and symp-HD, respectively. In this investigation we sought to determine the sensitivity of imaging methods to detect macrostructural (volume and microstructural (diffusivity longitudinal change in HD. We used a 3T MRI scanner to acquire T1 and diffusion weighted images at baseline and 18 months in 31 pre-HD, 31 symp-HD and 29 controls. Volume was measured across the whole brain, and volume and diffusion measures were ascertained for caudate and putamen. We observed a range of significant volumetric and, for the first time, diffusion changes over 18 months in both pre-HD and symp-HD, relative to controls, detectable at the brain-wide level (volume change in grey and white matter and in caudate and putamen (volume and diffusivity change. Importantly, longitudinal volume change in the caudate was the only measure that discriminated between groups across all stages of disease: far from diagnosis (>15 years, close to diagnosis (<15 years and after diagnosis. Of the two diffusion metrics (mean diffusivity, MD; fractional anisotropy, FA, only longitudinal FA change was sensitive to group differences, but only after diagnosis. These findings further confirm caudate atrophy as one of the most sensitive and early biomarkers of neurodegeneration in HD. They also highlight that different tissue properties have varying schedules in their ability to discriminate between groups along disease progression and may therefore inform biomarker selection for future therapeutic interventions.

  11. Nutritional profile of hemodialysis patients concerning treatment time

    Directory of Open Access Journals (Sweden)

    Livia de Almeida Alvarenga

    Full Text Available Abstract Introduction: The mortality of the population with chronic kidney disease (CKD on hemodialysis (HD is very high and the protein-energy malnutrition stands out as one of the most common consequences in relation to this condition. Objective: To evaluate the association between time of hemodialysis and nutritional parameters of patients. Methods: It is a cross-sectional study with secondary data, developed of the University Hospital of the Federal University of Juiz de Fora (HU/UFJF. This study was approved by the Research Ethics Committee (Nº 1.233.142, a total of 36 patients. The medical records and collected data were analyzed for anthropometric markers, biochemical and diet, considering two groups: HD time less than three and greater than or equal to three years. Results: There was reduction of mass of somatic protein with increased duration of HD. In relation to food intake was observed that in patients with increased duration of dialysis, an increase in average consumption of protein / kg of weight, calories, phosphorus and potassium, with a significant difference from the mean protein intake / kg (p = 0.04 and phosphorus (p = 0.045. Increasing HD time has altered body composition of patients, indicating a decline in the nutritional status of these individuals. Conclusion: HD patients are a risk group for protein-energy malnutrition, where HD time interferes with the nutritional status and food profile of the patient. The group HD time greater than or equal to 3 years presented worsening nutritional status.

  12. Longitudinal ophthalmic findings in a child with Helsmoortel-Van der Aa Syndrome

    Directory of Open Access Journals (Sweden)

    Michael J. Gale

    2018-06-01

    Full Text Available Purpose: We present the first detailed ophthalmic description of a child with Helsmoortel-Van der Aa Syndrome (HVDAS, including longitudinal follow-up and analysis. Observations: After extensive workup, a young child with poor visual behavior, hypotonic cerebral palsy, intellectual disability, and global developmental delay was found to have a heterozygous de novo mutation in the ADNP gene and diagnosed with HVDAS. Ophthalmic findings were remarkable for progressive nystagmus, macular pigment mottling, mild foveal hypoplasia with abnormal macular laminations, persistent rod dysfunction with electronegative waveform, and progressive cone degeneration. Conclusions and importance: Patients with HVDAS are known to have abnormal visual behavior due to refractive or cortical impairment. However, we present the first description, to our knowledge, of an association with retinal mal-development and degeneration. Thus, patients with HVDAS should be referred for ophthalmic genetics evaluation, and HVDAS should be on the differential diagnosis for young children with global developmental delay who present with nystagmus, rod and cone dysfunction with electronegative waveform, and relative lack of severe structural degeneration on optical coherence tomography. Keywords: Helsmoortel-Van der Aa Syndrome, HVDAS, Activity-dependent neuroprotective protein, ADNP, Nystagmus, Retinal degeneration, Electronegative waveform, Optical coherence tomography

  13. Home hemodialysis: a comprehensive review of patient-centered and economic considerations

    Directory of Open Access Journals (Sweden)

    Walker RC

    2017-02-01

    Full Text Available Rachael C Walker,1,2 Kirsten Howard,1 Rachael L Morton3 1School of Public Health, Sydney Medical School, University of Sydney, Sydney, Australia; 2Hawke’s Bay District Health Board, Hastings, New Zealand; 3NHMRC Clinical Trials Centre, Sydney Medical School, University of Sydney, Sydney, Australia Abstract: Internationally, the number of patients requiring treatment for end-stage kidney disease (ESKD continues to increase, placing substantial burden on health systems and patients. Home hemodialysis (HD has fluctuated in its popularity, and the rates of home HD vary considerably between and within countries although there is evidence suggesting a number of clinical, survival, economic, and quality of life (QoL advantages associated with this treatment. International guidelines encourage shared decision making between patients and clinicians for the type of dialysis, with an emphasis on a treatment that aligned to the patients’ lifestyle. This is a comprehensive literature review of patient-centered and economic impacts of home HD with the studies published between January 2000 and July 2016. Data from the primary studies representing both efficiency and equity of home HD were presented as a narrative synthesis under the following topics: advantages to patients, barriers to patients, economic factors influencing patients, cost-effectiveness of home HD, and inequities in home HD delivery. There were a number of advantages for patients on home HD including improved survival and QoL and flexibility and potential for employment, compared to hospital HD. Similarly, there were several barriers to patients preferring or maintaining home HD, and the strategies to overcome these barriers were frequently reported. Good evidence reported that indigenous, low-income, and other socially disadvantaged individuals had reduced access to home HD compared to other forms of dialysis and that this situation compounds already-poor health outcomes on renal

  14. Displaying Now-Understanding: The Finnish Change-of-State Token "aa"

    Science.gov (United States)

    Koivisto, Aino

    2015-01-01

    This article discusses the use of the Finnish change-of-state token "aa" that has previously not been identified. The central claim is that even though "aa" indicates a cognitive shift experienced by the speaker, it does not function as a receipt of new information. Instead, the token "aa" indicates that the speaker…

  15. An Analysis of the Rise and Fall of the AA-MAS Policy

    Science.gov (United States)

    Lazarus, Sheryl S.; Thurlow, Martha L.; Ysseldyke, James E.; Edwards, Lynn M.

    2015-01-01

    In 2005, to address concerns about students who might fall in the "gap" between the regular assessment and the alternate assessment based on alternate achievement standards (AA-AAS), the U.S. Department of Education announced that states could develop alternate assessments based on modified achievement standards (AA-MAS). This article…

  16. Chromospherically active stars. IV - HD 178450 = V478 Lyr: An early-type BY Draconis type binary

    Science.gov (United States)

    Fekel, Francis C.

    1988-01-01

    It is shown that the variable star HD 178450 = V478 Lyr is a chromospherically active G8 V single-lined spectroscopic binary with a period of 2.130514 days. This star is characterized by strong UV emission features and a filled-in H-alpha absorption line which is variable in strength. Classified as an early-type BY Draconis system, it is similar to the BY Dra star HD 175742 = V775 Her. The unseen secondary of HD 178450 has a mass of about 0.3 solar masses and is believed to be an M2-M3 dwarf.

  17. Resolving the HD 100546 Protoplanetary System with the Gemini Planet Imager: Evidence for Multiple Forming, Accreting Planets

    OpenAIRE

    Currie, Thayne; Cloutier, Ryan; Brittain, Sean; Grady, Carol; Burrows, Adam; Muto, Takayuki; Kenyon, Scott J.; Kuchner, Marc J.

    2015-01-01

    We report Gemini Planet Imager H band high-contrast imaging/integral field spectroscopy and polarimetry of the HD 100546, a 10 $Myr$-old early-type star recently confirmed to host a thermal infrared bright (super)jovian protoplanet at wide separation, HD 100546 b. We resolve the inner disk cavity in polarized light, recover the thermal-infrared (IR) bright arm, and identify one additional spiral arm. We easily recover HD 100546 b and show that much of its emission originates an unresolved, po...

  18. Anomalous H/D isotope effect on 35Cl NQR frequencies and H/D isotope effect on 1H MAS NMR spectra in pyrrolidinium p-chlorobenzoate

    International Nuclear Information System (INIS)

    Nakano, Ryo; Honda, Hisashi; Nakata, Eiichi; Takamizawa, Satoshi; Noro, Sumiko; Kimura, Taiki; Kyo, Shin-shin; Ishimaru, Shin'ichi; Miyake, Ryosuke

    2010-01-01

    An anomalous isotope effect was observed in the 35 Cl NQR frequency of pyrrolidinium p-chlorobenzoate (C 4 H 8 NH 2 + ·ClC 6 H 4 COO - ) by deuterium substitution of hydrogen atoms which form two kinds of N-H...O type hydrogen bonds. Large negative frequency shifts of the 35 Cl resonance lines, reaching 309 kHz at 77 K and 267 kHz at 293 K, were obtained upon deuteration, although the Cl atom in the molecule formed no hydrogen bonds in the crystal. 1 H MAS NMR lines showed significant changes by the deuterium substitution, while in contrast, small shifts of 13 C CP/MAS NMR signals were obtained. Our measurements of 1 H NMR spin-lattice relaxation times (T 1 ) suggested that the H/D isotope shifts detected from the 35 Cl NQR frequencies and 1 H NMR spectra are due to structural changes rather than molecular dynamics. Single-crystal X-ray diffraction measurements showed two remarkable H/D isotope differences in the molecular arrangements, (1) the N-H length along the crystallographic a axis became 1 pm shorter, and (2) the dihedral angle between benzene and the pyrrolidine ring changed by 1.1(2)deg upon deuteration. Using density functional theory estimations, the anomalous 35 Cl NQR frequency shifts and 1 H MAS NMR line-shape changes could be explained by the dihedral angle change rather than the N-H length difference. (author)

  19. The Determinants of Hemoglobin Variability in Hemodialysis Patients

    Directory of Open Access Journals (Sweden)

    Tomanoski Vasilije

    2016-12-01

    Full Text Available Introduction. Factors that have been reported to affect erythropoietin (EPO responsiveness in hemodialysis (HD patients include iron deficiency, chronic inflammation, secondary hyperparathyroidism, malnutrition and inadequate HD dose. The aim of the study was to analyze the deteminants of hemoglobin variability in HD patients. Methods. The study encompassed 526 patients (197 F and 329 M. According to HD vintage at the beginning of the study the patients were divided into two groups: group-1 encompassed 153 patients with HD vintage bellow 24 months, and group-2 encompassed 329 patients with HD vintage over 24 months. Over a period of 21 months after admission the following parameters were analyzed: hemoglobin (Hb, EPO dose, iron dose, HD dose (eKT/V, transferrin saturation (TSAT, C-reactive protein (CRP, ferritin and serum albumin at 3 months and parathyroid hormone (PTH at 6 months. Results. The percentage of patients with Hb>=105g/L significantly improved, and the average Hb level significantly increased in both groups over a period of 21 months. The average EPO and iron dose significantly decreased, but TSAT and ferritin levels significantly increased over a period of 21 months. The average eKT/V and s-albumin values significantly increased, but the average CRP and PTH levels significantly decresead over a period of 21 months. In group-1 EPO dose and CRP, but in group-2 EPO dose, ferritin, HD vintage, and iron dose were statistically significant predictors of the Hb level 9 months after admission. Conclusions. Insufficient EPO therapy, iron deficiency and chronic inflammation were the main factors of inadequate correction of anemia in HD patients before admission.

  20. Implementation of respiratory-gated VMAT on a Versa HD linear accelerator.

    Science.gov (United States)

    Snyder, Jeffrey E; Flynn, Ryan T; Hyer, Daniel E

    2017-09-01

    The accurate delivery of respiratory-gated volumetric modulated arc therapy (VMAT) treatment plans presents a challenge since the gantry rotation and collimator leaves must be repeatedly stopped and set into motion during each breathing cycle. In this study, we present the commissioning process for an Anzai gating system (AZ-733VI) on an Elekta Versa HD linear accelerator and make recommendations for successful clinical implementation. The commissioning tests include central axis dose consistency, profile consistency, gating beam-on/off delay, and comparison of gated versus nongated gamma pass rates for patient-specific quality assurance using four clinically commissioned photon energies: 6 MV, 6 FFF, 10 MV, and 10 FFF. The central axis dose constancy between gated and nongated deliveries was within 0.6% for all energies and the analysis of open field profiles for gated and nongated deliveries showed an agreement of 97.8% or greater when evaluated with a percent difference criteria of 1%. The measurement of the beam-on/off delay was done by evaluating images of a moving ball-bearing phantom triggered by the gating system and average beam-on delays of 0.22-0.29 s were observed. No measurable beam-off delay was present. Measurements of gated VMAT dose distributions resulted in decrements as high as 9% in the gamma passing rate as compared to nongated deliveries when evaluated against the planned dose distribution at 3%/3 mm. By decreasing the dose rate, which decreases the gantry speed during gated delivery, the gamma passing rates of gated and nongated treatments can be made equivalent. We present an empirically derived formula to limit the maximum dose rate during VMAT deliveries and show that by implementing a reduced dose rate, a gamma passing rate of greater than 95% (3%/3 mm) was obtained for all plan measurements. © 2017 The Authors. Journal of Applied Clinical Medical Physics published by Wiley Periodicals, Inc. on behalf of American Association of

  1. The discovery of 13.72-min oscillations in the cool magnetic Ap star HD 217522

    International Nuclear Information System (INIS)

    Kurtz, D.W.

    1983-01-01

    The discovery is announced of oscillations with a period near 13.72 min in the cool magnetic Ap star HD 217522. 97 hr of high-speed photometric observations are presented, obtained on 18 nights spread over a time span of 74 days in 1982. The amplitude of the oscillations in HD 217522 is variable from night to night and also on a longer time-scale. A frequency analysis of the data identifies the principal frequency of oscillation to be 4.37435+-0.00014 hr -1 . Because of the complexities of the amplitude modulation of the light curve and the very low amplitude of the light variations, the data are insufficient for a complete frequency solution. This star is the seventh member of the class of rapidly oscillating Ap stars. (author)

  2. Some measurements of H/D polarizability isotope effects using differential refractometry

    Energy Technology Data Exchange (ETDEWEB)

    Foster Smith, M; Van Hook, W A [Tennessee Univ., Knoxville (USA). Dept. of Chemistry

    1989-05-01

    Refractive index differences between the H and D isomers of some common molecules in the liquid phase were measured between 404.7 and 690.0 nm. The data are combined with information on molar volume isotope effects to yield values for H/D isotope effects on the static polarizability, the vibrational contribution to the static and frequency dependent parts of the polarizability, and the H/D isotope effect on the second moment of the electronic charge distribution. The present results suffice to demonstrate the practicability of this technique to measure the components of the polarizability listed above. However for accurate resolution of the vibrational and second moment contributions, refractive index data of still greater precision will be required. (orig.).

  3. Some measurements of H/D polarizability isotope effects using differential refractometry

    International Nuclear Information System (INIS)

    Foster Smith, M.; Van Hook, W.A.

    1989-01-01

    Refractive index differences between the H and D isomers of some common molecules in the liquid phase were measured between 404.7 and 690.0 nm. The data are combined with information on molar volume isotope effects to yield values for H/D isotope effects on the static polarizability, the vibrational contribution to the static and frequency dependent parts of the polarizability, and the H/D isotope effect on the second moment of the electronic charge distribution. The present results suffice to demonstrate the practicability of this technique to measure the components of the polarizability listed above. However for accurate resolution of the vibrational and second moment contributions, refractive index data of still greater precision will be required. (orig.)

  4. Low-frequency photospheric and wind variability in the early-B supergiant HD2905

    DEFF Research Database (Denmark)

    Simon-Diaz, S.; Aerts, C.; Urbaneja, M. A.

    2018-01-01

    to the lack of adequate observations for a proper characterization of the complex spectroscopic and photometric variability occurring in these stars. Aims. Our goal is to detect, analyze, and interpret variability in the early-B-type supergiant HD2905 (kappa Cas, B1 Ia) using long-term, ground-based, high...... snapshot and time-dependent information about the stellar parameters and abundances by means of the FASTWIND stellar atmosphere code. Results. HD2905 is a spectroscopic variable with peak-to-peak amplitudes in the zero and first moments of the photospheric lines of up to 15% and 30 km s(-1), respectively....... Conclusions. Combined long-term uninterrupted space photometry with high-precision spectroscopy is the best strategy to unravel the complex low-frequency photospheric and wind variability of B supergiants. Three-dimensional (3D) simulations of waves and of convective motions in the sub-surface layers can shed...

  5. Competition H(D) kinetic isotope effects in the autoxidation of hydrocarbons.

    Science.gov (United States)

    Muchalski, Hubert; Levonyak, Alexander J; Xu, Libin; Ingold, Keith U; Porter, Ned A

    2015-01-14

    Hydrogen atom transfer is central to many important radical chain sequences. We report here a method for determination of both the primary and secondary isotope effects for symmetrical substrates by the use of NMR. Intramolecular competition reactions were carried out on substrates having an increasing number of deuterium atoms at symmetry-related sites. Products that arise from peroxyl radical abstraction at each position of the various substrates reflect the competition rates for H(D) abstraction. The primary KIE for autoxidation of tetralin was determined to be 15.9 ± 1.4, a value that exceeds the maximum predicted by differences in H(D) zero-point energies (∼7) and strongly suggests that H atom abstraction by the peroxyl radical occurs with substantial quantum mechanical tunneling.

  6. VizieR Online Data Catalog: Extrasolar planet HD 189733b whitelight curve (Crouzet+, 2014)

    Science.gov (United States)

    Crouzet, N.; McCullough, P. R.; Deming, D.; Madhusudhan, N.

    2017-05-01

    We used HST WFC3 with the newly implemented spatial scanning mode, developed in part to enable observations such as these (McCullough & MacKenty, 2012wfc..rept....8M). In this mode, a controlled scan is applied to the telescope during the exposure in a direction perpendicular to the wavelength dispersion direction (Figure 1). This technique is particularly efficient for bright stars such as HD 189733 (see McCullough et al. 2014ApJ...791...55M, for more details). One eclipse of HD 189733b was observed on 2013 June 24. The observations are divided into five HST orbits, the planetary eclipse occurring during the fourth orbit. In total, 159 exposures of 5.97 s each were acquired, corresponding to 32 exposures per orbit (except for the first orbit in which the first image is a direct image). (1 data file).

  7. Resonant ion-pair formation in electron collisions with HD+ and OH+

    International Nuclear Information System (INIS)

    Larson, Aa.; Djuric, N.; Zong, W.; Greene, C. H.; Orel, A. E.; Al-Khalili, A.; Derkatch, A. M.; Le Padellec, A.; Neau, A.; Rosen, S.

    2000-01-01

    Resonant ion-pair formation from collisions of electrons with electronic and vibronic ground-state diatomic molecular ions has been studied in the present work for HD + and OH + . The cross section for HD + has a magnitude of the order of 3x10 -19 cm 2 and is characterized by an energy threshold and 14 resolved peaks in the energy range up to 16 eV. A theoretical study confirms that the structures derive primarily from quantum interference of the multiple dissociation pathways. Measurements for OH + reveal that the cross section for H + and O - formation is lower than 10 -21 cm 2 at energies of 6 and 12 eV. (c) 2000 The American Physical Society

  8. Spectral analysis of the He-enriched sdO-star HD 127493

    Science.gov (United States)

    Dorsch, Matti; Latour, Marilyn; Heber, Ulrich

    2018-02-01

    The bright sdO star HD127493 is known to be of mixed H/He composition and excellent archival spectra covering both optical and ultraviolet ranges are available. UV spectra play a key role as they give access to many chemical species that do not show spectral lines in the optical, such as iron and nickel. This encouraged the quantitative spectral analysis of this prototypical mixed H/He composition sdO star. We determined atmospheric parameters for HD127493 in addition to the abundance of C, N, O, Si, S, Fe, and Ni in the atmosphere using non-LTE model atmospheres calculated with TLUSTY/SYNSPEC. A comparison between the parallax distance measured by Hipparcos and the derived spectroscopic distance indicate that the derived atmospheric parameters are realistic. From our metal abundance analysis, we find a strong CNO signature and enrichment in iron and nickel.

  9. Production of H,D(2s, 2p) by electron impact (0 - 2000 eV) on simple hydrogen containing molecules, ch. 2, A2

    International Nuclear Information System (INIS)

    Moehlman, G.R.; Heer, F.J. de

    1977-01-01

    Absolute emission cross sections of Ly-α (H,D(2p → 1s)) radiation have been determined for 0 - 2000 eV electrons incident on H 2 , HD, HCl, H 2 O, NH 3 and CH 4 . By means of the application of electric quenching, the excitation cross sections of H,D(2s) could be obtained from the increase of the resulting Ly-α radiation for these molecules. Only in the case of electrons on H 2 , D 2 and HD was excitation of H,D(2s) found

  10. Analysis of synovial fluid components of hydrarthrosis in long-term hemodialysis patients.

    Science.gov (United States)

    Shiota, E; Maekawa, M; Ohtani, M

    1999-01-01

    The synovial fluid components in long-term hemodialysis patients (HD; 43 knees in 43 patients) were investigated and compared with those in patients with osteoarthritis (OA; 21 knees in 21 patients) and rheumatoid arthritis (RA; 26 knees in 26 patients). The average ages in the three groups were, respectively, 60.7 years (range, 34-79 years), 63.2 years (range, 48-88 years), and 59.7 years (range, 37-76 years). The duration of hemodialysis in the HD group averaged 14.0 years (range, 4-24 years). The concentrations of hyaluronic acid, protein, and isomers of chondroitin sulfate (chondroitin 6-sulfate [C6S] and chondroitin 4-sulfate [C4S]) in the synovial fluid, and its viscosity were measured. Differences in each of the parameters were investigated according to disease clinical stage, roentgenological grade, and periods of dialysis in the HD group. The viscosity of the synovial fluid and the concentration of hyaluronic acid in HD patients were similar to those in OA patients; however, the C6S/C4S ratio in the synovial fluid of HD patients was similar to that in RA patients. The latter finding suggests that synovitis may be present in the hydrarthrosis of HD patients. The cause of this synovitis in HD patients remains to be elucidated.

  11. The peculiar A star HD 110066: a photographic region line identification study

    International Nuclear Information System (INIS)

    Adelman, S.J.

    1988-01-01

    A line identification study of the very sharp-lined peculiar A star HD 110066 has been performed using four high dispersion photographic region spectrograms. New species found include Al I, Si I, S II, Ti I, Co II, Zr II, Cd I, La II, Ce III, Gd III, Dy II, Er II and Tm II. The presence of these species is in accord with the continuity of the magnetic Ap star sequence. (author)

  12. Peculiar A star HD 43819 - A photographic region line-identification study

    International Nuclear Information System (INIS)

    Adelman, S.J.; The Citadel, Charleston, SC)

    1985-01-01

    A line identification study of the sharp-lined silicon star HD 43819 has been performed for the photographic region 3759-4924 A. Comparison of this star's spectrum with those of other silicon stars shows that it shares many of their apparent abundance anomalies. The TiII, CrII, FeI, and FeII spectra are well represented while the singly ionized rare earths are represented by at best a few lines per species. 21 references

  13. GLOBAL INTEGRATED ISR: A BETTER ORGANIZATIONAL CONSTRUCT FOR AIR FORCE LD/HD ISR

    Science.gov (United States)

    2017-04-06

    E-8 intelligence, surveillance, and reconnaissance (ISR) aircraft it refers to as Low Density/High Demand (LD/HD). Current worldwide demand for LD...would allow for the easy flow of missions across CCMD boundaries within, or even inside, the normal book process timeline without having to approach...Quarter 2007). Harvard , James W. "Airmen and Mission Command." Air and Space Power Journal, March - April 2013: 131-146. Headquarters Air Force, Air

  14. Specific heat and magnetization of RMn2(H,D)2

    International Nuclear Information System (INIS)

    Tarnawski, Z.; Kolwicz-Chodak, L.; Figiel, H.; Kim-Ngan, N.-T.H.; Havela, L.; Miliyanchuk, K.; Sechovsky, V.; Santava, E.; Sebek, J.

    2007-01-01

    The effect of hydrogen absorption on magnetic and thermodynamic properties of hydrides compounds RMn 2 (H,D) 2 (R = Y, Nd, Tb, Ho, and Er) have been investigated by performing specific heat and magnetization measurements in the temperature range of 2-320 K and in magnetic fields up to 9 T. The phase transition to the antiferromagnetic order accompanying a crystal structure transformation have been revealed by complicated-structure anomalies in specific heat and weak anomalies in magnetization

  15. The TERMS Project: Improved Orbital Parameters and Photometry of HD168443 and the Photometry Pipeline

    Science.gov (United States)

    Pilyavsky, Genady; Mahadevan, S.; Kane, S. R.; Howard, A. W.; Ciardi, D. R.; de Pree, C.; Dragomir, D.; Fischer, D.; Henry, G. W.; Jensen, E. L. N.; Laughlin, G.; Marlowe, H.; Rabus, M.; von Braun, K.; Wright, J. T.; Wang, X.

    2012-01-01

    The discovery of transiting planets around bright stars holds the potential to greatly enhance our understanding of planetary atmospheres. The Transit Ephemeris Refinement and Monitoring Survey (TERMS) project focuses on updating the ephemerides of known exoplanets, put tighter constraints on the orbital parameters and shrink the large errors on the predicted transit windows, enabling photometric monitoring to search for a transit signature. Here, we present the revised orbital parameters and the photometric coverage during a predicted transit window of HD168443b, a massive planet orbiting the bright star HD 168443 (V = 6.92) with a period of 58.11 days. The high eccentricity of the planetary orbit (e = 0.53) significantly enhances the a-priori transit probability (3.7%) from what is expected for a circular orbit (2.5%). The transit ephemeris was updated using refined orbital parameters from additional Keck-HIRES radial velocities. The photometry obtained at the 1 m telescope in Cerro Tololo Inter-American Observatory (CTIO) and the T8 0.8 m Automated Photometric Telescope (APT) at Fairborn Observatory achieved the necessary millimag precision. The expected change in flux (0.5%) for HD168443 was not observed during the predicted transit window, thus allowing us to rule out the transit and put tighter constrains on the orbital inclination of HD168443b. Additionally, we present the software used to analyze the CTIO data. Developed by the TERMS team, this IDL based package is a fast, precise, and easy to use program which has eliminated the need for external software and command line prompts by utilizing the functionality of a graphical user interface (GUI).

  16. HD 193793, a radio-emitting Wolf-Rayet binary star

    International Nuclear Information System (INIS)

    Florkowski, D.R.; Gottesman, S.T.

    1977-01-01

    The Wolf-Rayet binary HD 193793 has been observed as a weak, unresolved radio source. The observed flux densities do not agree with the predictions of the constant-mass-flow model of Wright and Barlow and Panagia and Felli. A variable-mass-flow model is suggested and an observational test is proposed. A comparison with γ 2 Vel is made, and the parameters affecting radio emission from Wolf-Rayet stars are briefly discussed. (author)

  17. Ultraviolet anomalies of the WASP-12 and HD 189733 systems: Trojan satellites as a plasma source

    Science.gov (United States)

    Kislyakova, Kristina; Pilat-Lohinger, Elke; Funk, Barbara; Lammer, Helmut; Fossati, Luca; Eggl, Siegfried; Schwarz, Richard; Boudyada, Mohammed; Erkaev, Nikolai

    2017-04-01

    We suggest an additional possible plasma source in the WASP-12 and HD189733b systems to explain part of the phenomena observed in ultraviolet (UV) light curves during planetary transits. In the proposed scenario, material originates from the molten surface of Trojan satellites on orbits near the Lagrange points L4 and L5. We show that the temperature at the orbital location of WASP-12b is high enough to melt the surface of rocky Trojans and to form shallow lava oceans on them. At the orbital distance of WASP-12b, this leads to the release of elements such as Mg and Ca, which are expected to surround the system. The predicted Mg and Ca outgassing rates from two Io-sized WASP-12b Trojans are ≈ 2.2 × 1027 s-1 and ≈ 2.2 × 1026 s-1, respectively. Trojan outgassing can lead to the observed lack of emission in MgII h&k and CaII H&K line cores of WASP-12. For HD 189733b, the mechanism is only marginally possible due to the lower temperature. The early ingress of HD 189733b observed in the far-UV (FUV) CII doublet couldn't be explained by this mechanism due to absence of carbon within elements outgassed by molten lava. We investigate the long-term stability region of WASP-12b and HD 189733b in case of planar and inclined motion of these satellites and show that unlike the classical exomoons orbiting the planet, Io-sized Trojans can be stable for the whole systems life time.

  18. Non-invasive acoustic-based monitoring of uranium in solution and H/D ratio

    Energy Technology Data Exchange (ETDEWEB)

    Pantea, Cristian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Beedle, Christopher Craig [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sinha, Dipen N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Lakis, Rollin Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-01

    The primary objective of this project is to adapt existing non-invasive acoustic techniques (Swept-Frequency Acoustic Interferometry and Gaussian-pulse acoustic technique) for the purpose of demonstrating the ability to quantify U or H/D ratios in solution. Furthermore, a successful demonstration will provide an easily implemented, low cost, and non-invasive method for remote and unattended uranium mass measurements for International Atomic Energy Agency (IAEA).

  19. Spectroscopic abundance analyses of the 3He stars HD 185330 and 3 Cen A

    Science.gov (United States)

    Sadakane, Kozo; Nishimura, Masayoshi

    2018-04-01

    Abundances of 21 elements in two 3He stars, HD 185330 and 3 Cen A, have been analysed relative to the well-studied sharp-lined B3 V star ι Her. Six elements (P, Ti, Mn, Fe, Ni, and Br) are over-abundant in these two peculiar stars, while six elements (C, O, Mg, Al, S, and Cl) are under-abundant. Absorption lines of the two rarely observed heavy elements Br II and Kr II are detected in both stars and these elements are both over-abundant. The centroid wavelengths of the Ca II infrared triplet lines in these stars are redshifted relative to those lines in ι Her and the presence of heavy isotopes of Ca (mass number 44-46) in these two stars is confirmed. In spite of these similarities, there are several remarkable differences in abundance pattern between these two stars. N is under-abundant in HD 185330, as in many Hg-Mn stars, while it is significantly over-abundant in 3 Cen A. P and Ga are both over-abundant in 3 Cen A, while only P is over-abundant and no trace of absorption line of Ga II can be found in HD 185330. Large over-abundances of Kr and Xe are found in both stars, while the abundance ratio Kr/Xe is significantly different between them (-1.4 dex in HD 185330 and +1.2 dex in 3 Cen A). Some physical explanations are needed to account for these qualitative differences.

  20. HD domain of SAMHD1 influences Vpx-induced degradation at a post-interaction step

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Jian; Hou, Jingwei; Zhao, Ke; Yu, Xiao-Fang; Du, Juan, E-mail: jdu@jlu.edu.cn

    2016-02-12

    Primate SAMHD1 proteins are potent inhibitors of viruses, including retroviruses such as HIV-1, HIV-2, and SIV. Vpx, a distinctive viral protein expressed by HIV-2 and some SIVs, induces SAMHD1 degradation by forming a Vpx-DCAF1-based ubiquitin ligase complex. Either the N- or the C-terminus of SAMHD1 is critical for Vpx-induced degradation, depending on the types of SAMHD1 and Vpx proteins. However, it was not fully understood whether other regions of SAMHD1 also contribute to its depletion by Vpx. In the present study, we report that SAMHD1 from chicken (SAMHD1{sub GG}) was not degraded by SIVmac Vpx, in contrast with results for human SAMHD1 (SAMHD1{sub HS}). Results regarding to SAMHD1{sub HS} and SAMHD1{sub GG} fusion proteins supported previous findings that the C-terminus of SAMHD1{sub HS} is essential for Vpx-induced degradation. Internal domain substitution, however, revealed that the HD domain also contributes to Vpx-mediated SAMHD1 degradation. Interestingly, the HD domain influenced Vpx-mediated SAMHD1 degradation without affecting Vpx-SAMHD1 interaction. Therefore, our findings revealed that factors in addition to Vpx-SAMHD1 binding influence the efficiency of Vpx-mediated SAMHD1 degradation. - Highlights: • SAMHD1{sub GG} from chicken could not be depleted by SIVmac Vpx. • The C-terminus of human SAMHD1{sub HS} is critical for its degradation by Vpx. • The HD domain is essential for Vpx-induced degradation of SAMHD1{sub HS}. • Altering the HD domain does not affect Vpx-SAMHD1 interaction.

  1. Time-series photometric spot modeling. I - Parameter study and application to HD 17433 = VY Arietis

    Science.gov (United States)

    Strassmeier, K. G.; Bopp, B. W.

    1992-01-01

    New UBVRI photometry of the active chromosphere binary HD 17433 (VY) Ari from 1987 through 1991 is presented, and the long-term and short-term spot behavior is studied. A 0.2 mag variation of the mean brightness and a maximum wave amplitude of up to 0.4 mag in 1988 are found. The newly measured photometric period of 16.42 d suggests asynchronous rotation of the primary component by about 30 percent.

  2. CO Gas Inside the Protoplanetary Disk Cavity in HD 142527: Disk Structure from ALMA

    OpenAIRE

    Perez, S.; Casassus, S.; Ménard, F.; Roman, P.; van der Plas, G.; Cieza, L.; Pinte, C.; Christiaens, Valentin; Hales, A. S.

    2014-01-01

    Inner cavities and annular gaps in circumstellar disks are possible signposts of giant planet formation. The young star HD 142527 hosts a massive protoplanetary disk with a large cavity that extends up to 140 AU from the central star, as seen in continuum images at infrared and millimeter wavelengths. Estimates of the survival of gas inside disk cavities are needed to discriminate between clearing scenarios. We present a spatially and spectrally resolved carbon monoxide isotopologue 2-1 line ...

  3. Approximate quantum differential cross section for the F + HD → HF + D and DF + H reactions

    International Nuclear Information System (INIS)

    Lee, K.T.; Bowman, J.M.

    1982-01-01

    In a previous paper we proposed a novel way to obtain approximate quantum mechanical differential cross sections. Here, we use this approximate method to study the reactions F + HD(nu = 0) → FH(nu' = 2) + D and F + DH(nu = 0) → DF(nu' = 3) + H. Backward and forward scattering are found for the first reaction and only backward scattering for the second one. These results agree qualitatively with experiment. 1 figure

  4. Electronic structure tautomerism, and mechanism of H-D exchange in imidazole aqueous solutions

    International Nuclear Information System (INIS)

    Borisov, Yu.A.; Vorob'eva, N.P.; Abronin, I.A.; Kolomiets, A.F.

    1988-01-01

    The imidazole electronic structure in a gaseous phase is studied taking into account the influence of solvation effects in aqueous solutions. Possible mechanisms of tautomeric transformations and H-D exchange reactions with water molecules are discussed. Using the quantum chemistry methods, it is shown that the intramolecular mechanism of imidazole isomerization in the gaseous phase and the aqueous solution is unprofitable, and the intermolecular mechanism can proceed through the stage of protonated and carbene form formation

  5. Reactions of CW Agents HD And GD with the Polymer Fabrics PVAM and CHEMCAT 41

    Science.gov (United States)

    2015-09-01

    D. Durst, “Qualitative Gas Chromatographic Characterization of Chemically Neutralized Chemical Warfare Agent Reaction Masses Produced During...based catalysts for decontamination of HD and G agents,” Proceedings of the 2003 Joint Service Scientific Conference on Chemical & Biological...thermal burden on the wearer by allowing heat and moisture transport. The garment prevents exposure to outside chemical weapons agents (CWAs) by a

  6. Locus-specific microemulsion catalysts for sulfur mustard (HD) chemical warfare agent decontamination.

    Science.gov (United States)

    Fallis, Ian A; Griffiths, Peter C; Cosgrove, Terence; Dreiss, Cecile A; Govan, Norman; Heenan, Richard K; Holden, Ian; Jenkins, Robert L; Mitchell, Stephen J; Notman, Stuart; Platts, Jamie A; Riches, James; Tatchell, Thomas

    2009-07-22

    The rates of catalytic oxidative decontamination of the chemical warfare agent (CWA) sulfur mustard (HD, bis(2-chlororethyl) sulfide) and a range (chloroethyl) sulfide simulants of variable lipophilicity have been examined using a hydrogen peroxide-based microemulsion system. SANS (small-angle neutron scattering), SAXS (small-angle X-ray scattering), PGSE-NMR (pulsed-gradient spin-echo NMR), fluorescence quenching, and electrospray mass spectroscopy (ESI-MS) were implemented to examine the distribution of HD, its simulants, and their oxidation/hydrolysis products in a model oil-in-water microemulsion. These measurements not only present a means of interpreting decontamination rates but also a rationale for the design of oxidation catalysts for these toxic materials. Here we show that by localizing manganese-Schiff base catalysts at the oil droplet-water interface or within the droplet core, a range of (chloroethyl) sulfides, including HD, spanning some 7 orders of octanol-water partition coefficient (K(ow)), may be oxidized with equal efficacy using dilute (5 wt. % of aqueous phase) hydrogen peroxide as a noncorrosive, environmentally benign oxidant (e.g., t(1/2) (HD) approximately 18 s, (2-chloroethyl phenyl sulfide, C(6)H(5)SCH(2)CH(2)Cl) approximately 15 s, (thiodiglycol, S(CH(2)CH(2)OH)(2)) approximately 19 s {20 degrees C}). Our observations demonstrate that by programming catalyst lipophilicity to colocalize catalyst and substrate, the inherent compartmentalization of the microemulsion can be exploited to achieve enhanced rates of reaction or to exert control over product selectivity. A combination of SANS, ESI-MS and fluorescence quenching measurements indicate that the enhanced catalytic activity is due to the locus of the catalyst and not a result of partial hydrolysis of the substrate.

  7. Spotted star mapping by light curve inversion: Tests and application to HD 12545

    Science.gov (United States)

    Kolbin, A. I.; Shimansky, V. V.

    2013-06-01

    A code for mapping the surfaces of spotted stars is developed. The concept of the code is to analyze rotational-modulated light curves. We simulate the process of reconstruction for the star surface and the results of simulation are presented. The reconstruction atrifacts caused by the ill-posed nature of the problem are deduced. The surface of the spotted component of system HD 12545 is mapped using the procedure.

  8. HD 140283: A Star in the Solar Neighborhood that Formed Shortly after the Big Bang

    Science.gov (United States)

    Bond, Howard E.; Nelan, Edmund P.; VandenBerg, Don A.; Schaefer, Gail H.; Harmer, Dianne

    2013-03-01

    HD 140283 is an extremely metal-deficient and high-velocity subgiant in the solar neighborhood, having a location in the Hertzsprung-Russell diagram where absolute magnitude is most sensitive to stellar age. Because it is bright, nearby, unreddened, and has a well-determined chemical composition, this star avoids most of the issues involved in age determinations for globular clusters. Using the Fine Guidance Sensors on the Hubble Space Telescope, we have measured a trigonometric parallax of 17.15 ± 0.14 mas for HD 140283, with an error one-fifth of that determined by the Hipparcos mission. Employing modern theoretical isochrones, which include effects of helium diffusion, revised nuclear reaction rates, and enhanced oxygen abundance, we use the precise distance to infer an age of 14.46 ± 0.31 Gyr. The quoted error includes only the uncertainty in the parallax, and is for adopted surface oxygen and iron abundances of [O/H] = -1.67 and [Fe/H] = -2.40. Uncertainties in the stellar parameters and chemical composition, especially the oxygen content, now contribute more to the error budget for the age of HD 140283 than does its distance, increasing the total uncertainty to about ±0.8 Gyr. Within the errors, the age of HD 140283 does not conflict with the age of the Universe, 13.77 ± 0.06 Gyr, based on the microwave background and Hubble constant, but it must have formed soon after the big bang. Based in part on observations made with the NASA/ESA Hubble Space Telescope, obtained by the Space Telescope Science Institute. STScI is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555.

  9. Classroon demonstration: Foucault s currents explored by the computer hard disc (HD

    Directory of Open Access Journals (Sweden)

    Jorge Roberto Pimentel

    2008-09-01

    Full Text Available This paper making an experimental exploration of Foucault s currents (eddy currents through a rotor magnetically coupled to computer hard disc (HD that is no longer being used. The set-up allows to illustrate in a stimulating way electromagnetism classes in High Schools for mean of the qualitative observations of the currents which are created as consequence of the movement of an electric conductor in a region where a magnetic field exists.

  10. R- and s-process nuclei in the early history of the galaxy: HD 122563

    International Nuclear Information System (INIS)

    Sneden, C.; Parthasarathy, M.

    1983-01-01

    New high-resolution, high signal-to-noise spectra in the blue and ultraviolet spectral regions have been obtained for the extremely metal-poor giant star HD 122563. A complete model atmosphere, spectrum synthesis analysis of this star has been performed, employing a large number of weak iron-peak species lines and laboratory oscillator strengths. Spectral features of many rare earth elements have been detected in the ultraviolet. The large overdeficiency of nearly a factor of 10 for the s-process element barium is confirmed and is shown to extend to the other s-process elements La, Ce, Pr, Nd, and Sm. The r-process elements Eu, Gd, Dy, and possibly Er and Yb are less deficient than the s-process elements but do exhibit lower ratios with respect to iron-peak elements than in the Sun. A supplementary differential analysis of HD 122563 with respect to the Sun shows that the heavy-element abundances are not very model-atmosphere dependent. The heavy-element abundances can be understood with nucleosynthesis models in which the progenitors of this star produce mainly r-process isotopes. A small contribution of the s-process to the creation of the elements Sr, Y, Zr, and possibly Ba is not ruled out, but such traditional s-process elements as La, Pr, and Nd appear to have been made in the r-process in stellar generations prior to the formation of HD 122563

  11. THE NASA-UC ETA-EARTH PROGRAM. I. A SUPER-EARTH ORBITING HD 7924

    International Nuclear Information System (INIS)

    Howard, Andrew W.; Marcy, Geoffrey W.; Johnson, John Asher; Fischer, Debra A.; Giguere, Matthew J.; Isaacson, Howard; Wright, Jason T.; Henry, Gregory W.; Valenti, Jeff A.; Anderson, Jay; Piskunov, Nikolai E.

    2009-01-01

    We report the discovery of the first low-mass planet to emerge from the NASA-UC Eta-Earth Program, a super-Earth orbiting the K0 dwarf HD 7924. Keplerian modeling of precise Doppler radial velocities reveals a planet with minimum mass M P sin i = 9.26 M + in a P = 5.398 d orbit. Based on Keck-HIRES measurements from 2001 to 2008, the planet is robustly detected with an estimated false alarm probability of less than 0.001. Photometric observations using the Automated Photometric Telescopes at Fairborn Observatory show that HD 7924 is photometrically constant over the radial velocity period to 0.19 mmag, supporting the existence of the planetary companion. No transits were detected down to a photometric limit of ∼0.5 mmag, eliminating transiting planets with a variety of compositions. HD 7924b is one of only eight planets detected by the radial velocity technique with M P sin i + and as such is a member of an emerging family of low-mass planets that together constrain theories of planet formation.

  12. Quantum Dynamics Study of the Isotopic Effect on Capture Reactions: HD, D2 + CH3

    Science.gov (United States)

    Wang, Dunyou; Kwak, Dochan (Technical Monitor)

    2002-01-01

    Time-dependent wave-packet-propagation calculations are reported for the isotopic reactions, HD + CH3 and D2 + CH3, in six degrees of freedom and for zero total angular momentum. Initial state selected reaction probabilities for different initial rotational-vibrational states are presented in this study. This study shows that excitations of the HD(D2) enhances the reactivities; whereas the excitations of the CH3 umbrella mode have the opposite effects. This is consistent with the reaction of H2 + CH3. The comparison of these three isotopic reactions also shows the isotopic effects in the initial-state-selected reaction probabilities. The cumulative reaction probabilities (CRP) are obtained by summing over initial-state-selected reaction probabilities. The energy-shift approximation to account for the contribution of degrees of freedom missing in the six dimensionality calculation is employed to obtain approximate full-dimensional CRPs. The rate constant comparison shows H2 + CH3 reaction has the biggest reactivity, then HD + CH3, and D2 + CH3 has the smallest.

  13. RESONANCES REQUIRED: DYNAMICAL ANALYSIS OF THE 24 Sex AND HD 200964 PLANETARY SYSTEMS

    Energy Technology Data Exchange (ETDEWEB)

    Wittenmyer, Robert A.; Horner, Jonathan; Tinney, C. G., E-mail: rob@phys.unsw.edu.au [Department of Astrophysics, School of Physics, Faculty of Science, University of New South Wales, NSW 2052 (Australia)

    2012-12-20

    We perform several suites of highly detailed dynamical simulations to investigate the architectures of the 24 Sextantis and HD 200964 planetary systems. The best-fit orbital solution for the two planets in the 24 Sex system places them on orbits with periods that lie very close to 2:1 commensurability, while that for the HD 200964 system places the two planets therein in orbits whose periods lie close to a 4:3 commensurability. In both cases, the proposed best-fit orbits are mutually crossing-a scenario that is only dynamically feasible if the planets are protected from close encounters by the effects of mutual mean-motion resonance (MMR). Our simulations reveal that the best-fit orbits for both systems lie within narrow islands of dynamical stability, and are surrounded by much larger regions of extreme instability. As such, we show that the planets are only feasible if they are currently trapped in mutual MMR-the 2:1 resonance in the case of 24 Sex b and c, and the 4:3 resonance in the case of HD 200964 b and c. In both cases, the region of stability is strongest and most pronounced when the planetary orbits are mutually coplanar. As the inclination of planet c with respect to planet b is increased, the stability of both systems rapidly collapses.

  14. A MULTIPLE SCATTERING POLARIZED RADIATIVE TRANSFER MODEL: APPLICATION TO HD 189733b

    Energy Technology Data Exchange (ETDEWEB)

    Kopparla, Pushkar; Yung, Yuk L. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA (United States); Natraj, Vijay; Swain, Mark R. [Jet Propulsion Laboratory (NASA-JPL), Pasadena, CA (United States); Zhang, Xi [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ (United States); Wiktorowicz, Sloane J., E-mail: pkk@gps.caltech.edu [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA (United States)

    2016-01-20

    We present a multiple scattering vector radiative transfer model that produces disk integrated, full phase polarized light curves for reflected light from an exoplanetary atmosphere. We validate our model against results from published analytical and computational models and discuss a small number of cases relevant to the existing and possible near-future observations of the exoplanet HD 189733b. HD 189733b is arguably the most well observed exoplanet to date and the only exoplanet to be observed in polarized light, yet it is debated if the planet’s atmosphere is cloudy or clear. We model reflected light from clear atmospheres with Rayleigh scattering, and cloudy or hazy atmospheres with Mie and fractal aggregate particles. We show that clear and cloudy atmospheres have large differences in polarized light as compared to simple flux measurements, though existing observations are insufficient to make this distinction. Futhermore, we show that atmospheres that are spatially inhomogeneous, such as being partially covered by clouds or hazes, exhibit larger contrasts in polarized light when compared to clear atmospheres. This effect can potentially be used to identify patchy clouds in exoplanets. Given a set of full phase polarimetric measurements, this model can constrain the geometric albedo, properties of scattering particles in the atmosphere, and the longitude of the ascending node of the orbit. The model is used to interpret new polarimetric observations of HD 189733b in a companion paper.

  15. New analysis indicates no thermal inversion in the atmosphere of HD 209458b

    International Nuclear Information System (INIS)

    Diamond-Lowe, Hannah; Stevenson, Kevin B.; Bean, Jacob L.; Line, Michael R.; Fortney, Jonathan J.

    2014-01-01

    An important focus of exoplanet research is the determination of the atmospheric temperature structure of strongly irradiated gas giant planets, or hot Jupiters. HD 209458b is the prototypical exoplanet for atmospheric thermal inversions, but this assertion does not take into account recently obtained data or newer data reduction techniques. We reexamine this claim by investigating all publicly available Spitzer Space Telescope secondary-eclipse photometric data of HD 209458b and performing a self-consistent analysis. We employ data reduction techniques that minimize stellar centroid variations, apply sophisticated models to known Spitzer systematics, and account for time-correlated noise in the data. We derive new secondary-eclipse depths of 0.119% ± 0.007%, 0.123% ± 0.006%, 0.134% ± 0.035%, and 0.215% ± 0.008% in the 3.6, 4.5, 5.8, and 8.0 μm bandpasses, respectively. We feed these results into a Bayesian atmospheric retrieval analysis and determine that it is unnecessary to invoke a thermal inversion to explain our secondary-eclipse depths. The data are well fitted by a temperature model that decreases monotonically between pressure levels of 1 and 0.01 bars. We conclude that there is no evidence for a thermal inversion in the atmosphere of HD 209458b.

  16. A pilot study of combined working memory and inhibition training for children with AD/HD.

    Science.gov (United States)

    Johnstone, Stuart J; Roodenrys, Steven; Phillips, Elise; Watt, Annele J; Mantz, Sharlene

    2010-03-01

    Building on recent favourable outcomes using working memory (WM) training, this study examined the behavioural and physiological effect of concurrent computer-based WM and inhibition training for children with attention-deficit hyperactivity disorder (AD/HD). Using a double-blind active-control design, 29 children with AD/HD completed a 5-week at-home training programme and pre- and post-training sessions which included the assessment of overt behaviour, resting EEG, as well as task performance, skin conductance level and event-related potentials (ERPs) during a Go/Nogo task. Results indicated that after training, children from the high-intensity training condition showed reduced frequency of inattention and hyperactivity symptoms. Although there were trends for improved Go/Nogo performance, increased arousal and specific training effects for the inhibition-related N2 ERP component, they failed to reach standard levels of statistical significance. Both the low- and high-intensity conditions showed resting EEG changes (increased delta, reduced alpha and theta activity) and improved early attention alerting to Go and Nogo stimuli, as indicated by the N1 ERP component, post-training. Despite limitations, this preliminary work indicates the potential for cognitive training that concurrently targets the interrelated processes of WM and inhibition to be used as a treatment for AD/HD.

  17. Water vapor in the spectrum of the extrasolar planet HD 189733b. II. The eclipse

    Energy Technology Data Exchange (ETDEWEB)

    Crouzet, Nicolas [Dunlap Institute for Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, Ontario M5S 3H4 (Canada); McCullough, Peter R. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Deming, Drake [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Madhusudhan, Nikku, E-mail: crouzet@dunlap.utoronto.ca [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom)

    2014-11-10

    Spectroscopic observations of exoplanets are crucial to infer the composition and properties of their atmospheres. HD 189733b is one of the most extensively studied exoplanets and is a cornerstone for hot Jupiter models. In this paper, we report the dayside emission spectrum of HD 189733b in the wavelength range 1.1-1.7 μm obtained with the Hubble Space Telescope Wide Field Camera 3 (WFC3) in spatial scan mode. The quality of the data is such that even a straightforward analysis yields a high-precision Poisson noise-limited spectrum: the median 1σ uncertainty is 57 ppm per 0.02 μm bin. We also build a white-light curve correcting for systematic effects and derive an absolute eclipse depth of 96 ± 39 ppm. The resulting spectrum shows marginal evidence for water vapor absorption, but can also be well explained by a blackbody spectrum. However, the combination of these WFC3 data with previous Spitzer photometric observations is best explained by a dayside atmosphere of HD 189733b with no thermal inversion and a nearly solar or subsolar H{sub 2}O abundance in a cloud-free atmosphere. Alternatively, this apparent subsolar abundance may be the result of clouds or hazes that future studies need to investigate.

  18. Evolutionary status of AA Doradus: still an enigma?

    International Nuclear Information System (INIS)

    Sarna, M.J.

    1985-01-01

    The evolutionary scenarios for AA Dor are reconsidered using new contraction times for degenerate red dwarfs. It is found that both types of models considered by Paczynski (1980) with the primary being either an hydrogen shell burning helium white dwarf or a double shell burning carbon-oxygen white dwarf are consistent with the available data. The second model requires a very narrow range of the initial parameters of the binary system. 26 refs. (author)

  19. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning, in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. View down the centre of a pickup or kicker. See also 7906189, 7906190, 7906583.

  20. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. Here we see the slotted electrodes partly pulled out of the outer casing. See also 7906189, 7906581X, 7896193.