WorldWideScience

Sample records for aa 2024-t3 substrate

  1. Influence of Process Parameters in the Friction Surfacing of AA 6082-T6 over AA 2024-T3

    OpenAIRE

    Gandra, J.; Pereira, D.; Miranda, R.M.; Vilaça, P.

    2013-01-01

    VK: T20309 Friction Surfacing is a solid state coating technique with applications in hardfacing, corrosion protection and repair. Since it doesn’t require the fusion of the materials involved, it is suitable to join aluminium alloys while avoiding several of their processing difficulties. The present study addresses the deposition of AA 6082-T6 coatings on AA 2024-T3 substrates, while focusing on the effect of process parameters, such as, axial force, rotation and travel speed. Sound alum...

  2. Blister Test for Measurements of Adhesion and Adhesion Degradation of Organic Polymers on AA2024-T3

    Science.gov (United States)

    Rincon Troconis, Brendy Carolina

    A key parameter for the performance of corrosion protective coatings applied to metals is adhesion. Surface preparation prior to coating application is known to be critical, but there is a lack of understanding of what controls adhesion. Numerous techniques have been developed in the last decades to measure the adhesion strength of coatings to metals. Nonetheless, they are generally non-quantitative, non-reproducible, performed in dry conditions, or overestimate adhesion. In this study, a quantitative and reproducible technique, the Blister Test (BT), is used. The BT offers the ability to study the effects of a range of parameters, including the presence or absence of a wetting liquid, and simulates the stress situation in the coating/substrate interface. The effects of roughness and surface topography were studied by the BT and Optical Profilometry, using AA2024-T3 substrates coated with polyvinyl butyral (PVB). Random abrasion generated a surface with lower average roughness than aligned abrasion due to the continual cross abrasion of the grooves. The BT could discern the effects of different mechanical treatments. An adhesion strength indicator was defined and found to be a useful parameter. The effectiveness of standard adhesion techniques such as ASTM D4541 (Pull-off Test) and ASTM D3359 (Tape Test) was compared to the BT. Also, different attempts to measure adhesion and adhesion degradation of organic polymers to AA2024-T3 were tested. The pull-off test does not produce adhesive failure across the entire interface, while the tape test is a very qualitative technique and does not discern between the effects of different coating systems on the adhesion performance. The BT produces adhesive failure of the primer studied, is very reproducible, and is able to rank different coating systems. Therefore, it was found to be superior to the others. The approaches tested for adhesion degradation were not aggressive enough to have a measurable effect. The effects of

  3. The corrosion protection of AA2024-T3 aluminium alloy by leaching of lithium-containing salts from organic coatings.

    Science.gov (United States)

    Visser, Peter; Liu, Yanwen; Zhou, Xiaorong; Hashimoto, Teruo; Thompson, George E; Lyon, Stuart B; van der Ven, Leendert G J; Mol, Arjan J M C; Terryn, Herman A

    2015-01-01

    Lithium carbonate and lithium oxalate were incorporated as leachable corrosion inhibitors in model organic coatings for the protection of AA2024-T3. The coated samples were artificially damaged with a scribe. It was found that the lithium-salts are able to leach from the organic coating and form a protective layer in the scribe on AA2024-T3 under neutral salt spray conditions. The present paper shows the first observation and analysis of these corrosion protective layers, generated from lithium-salt loaded organic coatings. The scribed areas were examined by scanning and transmission electron microscopy before and after neutral salt spray exposure (ASTM-B117). The protective layers typically consist of three different layered regions, including a relatively dense layer near the alloy substrate, a porous middle layer and a flake-shaped outer layer, with lithium uniformly distributed throughout all three layers. Scanning electron microscopy and white light interferometry surface roughness measurements demonstrate that the formation of the layer occurs rapidly and, therefore provides an effective inhibition mechanism. Based on the observation of this work, a mechanism is proposed for the formation of these protective layers.

  4. Comparison of fatigue crack growth of riveted and bonded aircraft lap joints made of Aluminium alloy 2024-T3 substrates - A numerical study

    Science.gov (United States)

    Pitta, S.; Rojas, J. I.; Crespo, D.

    2017-05-01

    Aircraft lap joints play an important role in minimizing the operational cost of airlines. Hence, airlines pay more attention to these technologies to improve efficiency. Namely, a major time consuming and costly process is maintenance of aircraft between the flights, for instance, to detect early formation of cracks, monitoring crack growth, and fixing the corresponding parts with joints, if necessary. This work is focused on the study of repairs of cracked aluminium alloy (AA) 2024-T3 plates to regain their original strength; particularly, cracked AA 2024-T3 substrate plates repaired with doublers of AA 2024-T3 with two configurations (riveted and with adhesive bonding) are analysed. The fatigue life of the substrate plates with cracks of 1, 2, 5, 10 and 12.7mm is computed using Fracture Analysis 3D (FRANC3D) tool. The stress intensity factors for the repaired AA 2024-T3 plates are computed for different crack lengths and compared using commercial FEA tool ABAQUS. The results for the bonded repairs showed significantly lower stress intensity factors compared with the riveted repairs. This improves the overall fatigue life of the bonded joint.

  5. Microstructure Stability During Creep of Friction Stir Welded AA2024-T3 Alloy

    Science.gov (United States)

    Regev, Michael; Rashkovsky, Tal; Cabibbo, Marcello; Spigarelli, Stefano

    2018-01-01

    The poor weldability of the AA2024 aluminum alloy limits its use in industrial applications. Because friction stir welding (FSW) is a non-fusion welding process, it seems to be a promising solution for welding this alloy. In the current study, FSW was applied to butt weld AA2024-T3 aluminum alloy plates. Creep tests were conducted at 250 and at 315 °C on both the parent material and the friction stir welded specimens. The microstructures of the welded and non-welded AA2024-T3 specimens before and after the creep tests were studied and compared. A comprehensive transmission electron microscopy study together with a high-resolution scanning electron microscopy study and energy-dispersive x-ray spectroscopy analysis was conducted to investigate the microstructure stability. The parent material seems to contain two kinds of Cu-rich precipitates—coarse precipitates of a few microns each and uniformly dispersed fine nanosized precipitates. Unlike the parent material, the crept specimens were found to contain the two kinds of precipitates mentioned above together with platelet-like precipitates. In addition, extensive decoration of the grain boundaries with precipitates was clearly observed in the crept specimens. Controlled aging experiments for up to 280 h at the relevant temperatures were conducted on both the parent material and the welded specimens in order to isolate the contribution of exposure to high temperatures to the microstructure changes. TEM study showed the development of dislocation networks into a cellular dislocation structure in the case of the parent metal. Changes in the dislocation structure as a function of the creep strain and the FSW process were recorded. A detailed creep data analysis was conducted, taking into account the instability of the microstructure.

  6. Multiple Crack Growth Prediction in AA2024-T3 Friction Stir Welded Joints, Including Manufacturing Effects

    DEFF Research Database (Denmark)

    Carlone, Pierpaolo; Citarella, Roberto; Sonne, Mads Rostgaard

    2016-01-01

    boundary element method (FEM-DBEM) procedure, coupling the welding process simulation to the subsequent crack growth assessment, is proposed and applied to simulate multiple crack propagation, with allowance for manufacturing effects. The friction stir butt welding process of the precipitation hardened AA......A great deal of attention is currently paid by several industries toward the friction stir welding process to realize lightweight structures. Within this aim, the realistic prediction of fatigue behavior of welded assemblies is a key factor. In this work an integrated finite element method - dual......2024-T3 alloy was simulated using a thermo-mechanical FEM model to predict the process induced residual stress field and material softening. The computed stress field was transferred to a DBEM environment and superimposed to the stress field produced by a remote fatigue traction load applied...

  7. Integrated FEM-DBEM simulation of crack propagation in AA2024-T3 FSW butt joints considering manufacturing effects

    DEFF Research Database (Denmark)

    Sonne, Mads Rostgaard; Carlone, P.; Citarella, R.

    2015-01-01

    This paper deals with a numerical and experimental investigation on the influence of residual stresses on fatigue crack growth in AA2024-T3 friction stir welded butt joints. An integrated FEM-DBEM procedure for the simulation of crack propagation is proposed and discussed. A numerical FEM model...... of the welding process of precipitation hardenable AA2024-T3 aluminum alloy is employed to infer the process induced residual stress field. The reliability of the FEM simulations with respect to the induced residual stresses is assessed comparing numerical outcomes with experimental data obtained by means...

  8. Evaluation of Various Depainting Processes on Mechanical Properties of 2024-T3 Aluminum Substrate

    Science.gov (United States)

    McGill, P.

    2001-01-01

    Alternate alkaline and neutral chemical paint strippers have been identified that, with respect to corrosion requirements, perform as well as or better than a methylene chloride baseline. These chemicals also, in general, meet corrosion acceptance criteria as specified in SAE MA 4872. Alternate acid chemical paint strippers have been identified that, with respect to corrosion requirements, perform as well as or better than a methylene chloride baseline. However, these chemicals do not generally meet corrosion acceptance criteria as specified in SAE MA 4872, especially in the areas of non-clad material performance and hydrogen embrittlement. Media blast methods reviewed in the study do not, in general, adversely affect fatigue performance or crack detectability of 2024-T3 substrate. Sodium bicarbonate stripping exhibited a tendency towards inhibiting crack detectability. These generalizations are based on a limited sample size and additional testing should be performed to characterize the response of specific substrates to specific processes.

  9. Anodic galvanostatic polarization of AA2024-T3 aircraft alloy in conventional mineral acids

    Energy Technology Data Exchange (ETDEWEB)

    Kozhukharov, S., E-mail: stephko1980@abv.bg [Department of Chemical Sciences, University of Chemical Technology and Metallurgy, 8 “Kliment Okhridski” Blvd, 1756, Sofia (Bulgaria); Girginov, Ch. [Department of Chemical Sciences, University of Chemical Technology and Metallurgy, 8 “Kliment Okhridski” Blvd, 1756, Sofia (Bulgaria); Avramova, I. [Institute of General and Inorganic Chemistry, Bulgarian Academy of Science, 11 “Georgi Bonchev” Str., 1113, Sofia (Bulgaria); Machkova, M. [Department of Chemical Sciences, University of Chemical Technology and Metallurgy, 8 “Kliment Okhridski” Blvd, 1756, Sofia (Bulgaria)

    2016-09-01

    The present study is devoted to the determination of the impact of the anodization of AA2024-T3 alloys in HCl, HNO{sub 3}, H{sub 2}SO{sub 4} or H{sub 3}PO{sub 4} on the samples’ surface morphology and properties. Subsequent systematic assessments were performed by Scanning Electron Microscopy (SEM), Energy Dispersion X-Ray Spectroscopy (EDX) and X-ray Photoelectron Spectroscopy (XPS). These observations were combined with Linear Voltammetry (LVA) and Electrochemical Impedance Spectroscopy (EIS) after 48 and 168 h of exposure to a 3.5% NaCl model corrosive medium. The main result is, that completely different effects were observed in accordance to the acid used. It was established that the monoprotonic acids have a deep destructive effect due to dissolution of the alloy components, whereas the polyprotonic ones possess either indistinguishable influence, or surface film formation. - Highlights: • AA2024 was polarized anodically in 15%{sub wt} acid solutions at 15 mA cm{sup −2} for 2 h. • Four mineral acids were selected for investigation: HCl, HNO{sub 3}, H{sub 2}SO{sub 4} and H{sub 3}PO{sub 4}. • SEM, EDX and XPS were applied for morphological description. • Electrochemical characterizations were performed by EIS and linear voltammetry. • The acid used predetermines completely different interaction with the AA2024 alloy.

  10. Numerical modeling of AA2024-T3 friction stir welding process for residual stress evaluation, including softening effects

    DEFF Research Database (Denmark)

    Sonne, Mads Rostgaard; Carlone, Pierpaolo; Palazzo, Gaetano S.

    2014-01-01

    In the present paper, a numerical finite element model of the precipitation hardenable AA2024-T3 aluminum alloy, consisting of a heat transfer analysis based on the Thermal Pseudo Mechanical model for heat generation, and a sequentially coupled quasi-static stress analysis is proposed. Metallurgi...

  11. Two-shell structured PMAA@CeO2nanocontainers loaded with 2-mercaptobenzothiazole for corrosion protection of damaged epoxy coated AA 2024-T3.

    Science.gov (United States)

    Balaskas, A C; Hashimoto, T; Curioni, M; Thompson, G E

    2017-05-04

    In this work, novel two-shell structured inhibitor-loaded poly(methacrylic acid)@cerium oxide (PMAA@CeO 2 ) nanocontainers were synthesised and characterized. The purpose of the nanocontainers is to increase the corrosion protection provided by an epoxy coating applied to an aerospace alloy (AA 2024-T3). The (PMAA@CeO 2 ) nanocontainers with diameters of 550 nm were synthesised by a four-step process with the method of distillation precipitation polymerization for the synthesis of the inner PMAA layer, and the sol-gel method for the development of the outer CeO 2 layer. The loaded nanocontainers were characterized by scanning and transmission electron microscopies. The corrosion protection properties of the epoxy coated AA 2024-T3 with 2-mercaptobenzothiazole (2-MBT) loaded PMAA@CeO 2 nanocontainers were evaluated with and without artificial scribes by electrochemical impedance spectroscopy (EIS). The results indicated that the epoxy coating containing the 2-MBT-loaded nanocontainers provided enhanced protection of the AA 2024-T3 substrate.

  12. Advancement in corrosion resistance of AA 2024-T3 through sol-gel coatings including nanocontainers

    Directory of Open Access Journals (Sweden)

    Kartsonakis Ioannis A.

    2017-01-01

    Full Text Available The current study investigates the effect of nanocontainers incorporation into sol-gel coatings for the protection improvement of aluminium alloys 2024-T3 against corrosion. The nanocontainers were synthesized via a combination of radical polymerization process and sol-gel technique. They consist of cerium and molybdenum oxides and loaded with the anodic corrosion inhibitor 2-mercaptobenzothiazole (MBT. The preparation of the coating matrix was accomplished using (3-glycidoxypropyltrimethoxysilane as precursor. These organic modified silicate based sol-gel films were evaluated for their corrosion behaviour as well as nanomechanical properties using electrochemical and nanoindentation techniques, respectively. The results reveal that the presence of loaded nanocontainers improved the corrosion protection of the coatings; outcome that can be attributed to either the increase coherence of the coating or the simultaneously inhibition action of cerium and molybdate ions together with the corrosion inhibitor MBT. Moreover, the addition of nanocontainers empty or loaded with inhibitor amount strengthens (increase of wear resistance the coating and decreases the coefficient of friction.

  13. Non-chromate deoxidation of AA2024-T3: Sodium bromate nitric acid (20 60 °C)

    Science.gov (United States)

    Harvey, T. G.; Hughes, A. E.; Hardin, S. G.; Nikpour, T.; Toh, S. K.; Boag, A.; McCulloch, D.; Horne, M.

    2008-03-01

    The effect of a non-chromate deoxidiser (bromate-nitric acid) on AA2024-T3 has been examined by SEM, TEM/EELS and XPS. At low temperatures (20 °C) the deoxidiser removed all intermetallics but had little effect on the surface oxide. At 40 °C, attack on the intermetallics was again extensive but there was also evidence of attack on the surface oxide covering the matrix after 10 min of immersion, leaving a roughened porous oxide. At 60 °C, removal of intermetallics was complete and longer immersion times resulted in a characteristic scalloped structure across the surface which became more pronounced with increasing immersion time.

  14. Structure and corrosion behavior of sputter deposited cerium oxide based coatings with various thickness on Al 2024-T3 alloy substrates

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yuanyuan [College of Materials Science and Engineering, Chongqing University, Chongqing 400045 (China); Materials Research Center, Department of Materials Science and Engineering, Missouri University of Science and Technology, Rolla, MO 65409 (United States); Huang, Jiamu, E-mail: huangjiamu@cqu.edu.cn [College of Materials Science and Engineering, Chongqing University, Chongqing 400045 (China); Claypool, James B.; Castano, Carlos E. [Materials Research Center, Department of Materials Science and Engineering, Missouri University of Science and Technology, Rolla, MO 65409 (United States); O’Keefe, Matthew J., E-mail: mjokeefe@mst.edu [Materials Research Center, Department of Materials Science and Engineering, Missouri University of Science and Technology, Rolla, MO 65409 (United States)

    2015-11-15

    Highlights: • Crystalline CeO{sub 2} coatings are deposited on Al 2024-T3 alloys by magnetron sputtering. • The crystal size and internal stress both increased with the thickness of CeO{sub 2} coating. • The ∼210 nm thick coating has the highest adhesion strength to the Al alloy substrate. • The ∼900 nm thick coating increased the corrosion resistance two orders of magnitude. • CeO{sub 2} coatings provide good cathodic inhibition for Al alloys by acting as physical barriers. - Abstract: Cerium oxide based coatings from ∼100 to ∼1400 nm in thickness were deposited onto Al 2024-T3 alloy substrates by magnetron sputtering of a 99.99% pure CeO{sub 2} target. The crystallite size of CeO{sub 2} coatings increased from 15 nm to 46 nm as the coating thickness increased from ∼100 nm to ∼1400 nm. The inhomogeneous lattice strain increased from 0.36% to 0.91% for the ∼100 nm to ∼900 nm thick coatings and slightly decreased to 0.89% for the ∼1400 nm thick coating. The highest adhesion strength to Al alloy substrates was for the ∼210 nm thick coating, due to a continuous film coverage and low internal stress. Electrochemical measurements indicated that sputter deposited crystalline CeO{sub 2} coatings acted as physical barriers that provide good cathodic inhibition for Al alloys in saline solution. The ∼900 nm thick CeO{sub 2} coated sample had the best corrosion performance that increased the corrosion resistance by two orders magnitude and lowered the cathodic current density 30 times compared to bare Al 2024-T3 substrates. The reduced defects and exposed surface, along with suppressed charge mobility, likely accounts for the improved corrosion performance as coating thickness increased from ∼100 nm to ∼900 nm. The corrosion performance decreased for ∼1400 nm thick coatings due in part to an increase in coating defects and porosity along with a decrease in adhesion strength.

  15. Protective film formation on AA2024-T3 aluminum alloy by leaching of lithium carbonate from an organic coating

    NARCIS (Netherlands)

    Liu, Y.; Visser, P.; Zhou, X.; Lyon, S.B.; Hashimoto, T.; Curioni, M.; Gholinia, A.; Thompson, G.E.; Smyth, G.; Gibbon, S.R.; Graham, D.; Mol, J.M.C.; Terryn, H.A.

    2015-01-01

    An investigation into corrosion inhibition properties of a primer coating containing lithium carbonate as corrosion inhibitive pigment for AA2024 aluminum alloy was conducted. It was found that, during neutral salt spray exposure, a protective film of about 0.2 to 1.5 ?m thickness formed within the

  16. Effects of aging temperature and time on the corrosion protection provided by trivalent chromium process coatings on AA2024-T3.

    Science.gov (United States)

    Li, Liangliang; Swain, Greg M

    2013-08-28

    The effects of aging temperature and time on the physical structure of and corrosion protection provided by trivalent chromium process (TCP) coatings on AA2024-T3 are reported. The TCP coating forms a partially blocking barrier layer on the alloy surface that consists of hydrated channels and or defects. It is through these channels and defects that ions and dissolved O2 can be transported to small areas of the underlying alloy. Reactions initiate at these sites, which can ultimately lead to undercutting of the coating and localized corrosion. We tested the hypothesis that collapsing the channels and or reducing the number of defects in the coating might be possible through post-deposition heat treatment, and that this would enhance the corrosion protection provided by the coating. This was tested by aging the TCP-coated AA2024 alloys in air overnight at room temperature (RT), 55, 100, or 150 °C. The TCP coating became dehydrated and thinner at the high temperatures (55 and 100 °C). This improved the corrosion protection as evidenced by a 2× increase in the charge transfer resistance. Aging at 150 °C caused excessive coating dehydration and shrinkage. This led to severe cracking and detachment of the coating from the surface. The TCP-coated AA2024 samples were also aged in air at RT from 1 to 7 days. There was no thinning of the coating, but the corrosion protection was enhanced with a longer aging period as evidenced by a 4× increase in the charge transfer resistance. The coating became more hydrophobic after aging at elevated temperature (up to 100 °C) and with aging time at RT as evidenced by an increased water contact angle from 7 to 100 °C.

  17. Modelling the residual stresses and microstructural evolution in Friction Stir Welding of AA2024-T3 including the Wagner-Kampmann precipitation model

    DEFF Research Database (Denmark)

    Sonne, Mads Rostgaard; Hattel, Jesper Henri

    In this work, a numerical finite element model for friction stir welding of 2024-T3 aluminum alloy, consisting of a heat transfer analysis and a sequentially coupled quasi-static stress analysis is proposed. Metallurgical softening of the material is properly considered and included...

  18. CORROSION RESISTANT SOL–GEL COATING ON 2024-T3 ALUMINUM

    Directory of Open Access Journals (Sweden)

    S. Yazdani

    2016-06-01

    Full Text Available The inherent reactivity of the Al–Cu alloys is such that their use for structural, marine, and aerospace components and structures would not be possible without prior application of a corrosion resistance system. Historically these corrosion resistance coatings were based on the use of chemicals containing Cr (VI compounds. Silane coatings are of increasing interest in industry due to their potential application for the replacement of current toxic hexavalent chromate based treatments. In this study, hydrophobic coating sol was prepared with methyltriethoxysilane (MTES, methanol (MeOH, and water (as 7M NH4OH at a molar ratio of 1:25:4.31 respectively. The coatings were applied by a dip-technique to 2024-T3 Al alloy, and subsequently cured at room temperature and there after heat treated in an oven at 150°C. The anticorrosion properties of the coatings within 3.5 wt% NaCl solution were studied by Tafel polarization technique. The sol–gel coating exhibited good anticorrosion properties providing an adherent protection film on the Al 2024-T3 substrate. The surface properties were characterized by water contact angle measurement, scanning electron microscopy (SEM, and the composition was studied by Fourier transform infrared spectroscopy (FTIR.

  19. Electrochemical study of modified cerium-silane bi-layer on Al alloy 2024-T3

    Energy Technology Data Exchange (ETDEWEB)

    Palomino, Luis M. [SurTec International R and D Center, Av. Dr. Jose Fornari, 1510 Sao Bernardo do Campo, 09790-400 Sao Paulo (Brazil); Suegama, Patricia H.; Aoki, Idalina V. [Chemical Engineering Department of the Polytechnic School of the Sao Paulo University. P.O. Box 61548, CEP: 05424-970 Sao Paulo, SP (Brazil); Montemor, M.F. [ICEMS, Instituto Superior Tecnico, Technical University of Lisbon, Av. Rovisco Pais, 1049-001 Lisboa (Portugal); De Melo, Hercilio G. [Chemical Engineering Department of the Polytechnic School of the Sao Paulo University. P.O. Box 61548, CEP: 05424-970 Sao Paulo, SP (Brazil)], E-mail: hgdemelo@usp.br

    2009-06-15

    In this paper, the performance of bis-1, 2-(triethoxysilyl) ethane (BTSE) as a pre-treatment to protect the AA 2024-T3 against corrosion has been investigated by electrochemical impedance spectroscopy (EIS), potentiodynamic polarization curves, and the scanning vibrating electrode technique (SVET). The microstructural and morphological characterizations were carried out via scanning electron microscopy and atomic force microscopy and the chemical composition evaluated using contact angle measurements and X-ray photoelectron spectroscopy (XPS). The electrochemical results showed that the additives improved the anticorrosion properties of the coating. The chemical characterization indicated that additives contribute to an increased degree of surface coverage, as well as to a more complete reticulation. The SVET results evidenced the self-healing abilities of Ce ions.

  20. Review and Study of Physics Driven Pitting Corrosion Modeling in 2024-T3 Aluminum Alloys (Postprint)

    Science.gov (United States)

    2015-05-01

    AFRL-RX-WP-JA-2015-0218 REVIEW AND STUDY OF PHYSICS DRIVEN PITTING CORROSION MODELING IN 2024-T3 ALUMINUM ALLOYS (POSTPRINT) Lingyu...2014 – 1 April 2015 4. TITLE AND SUBTITLE REVIEW AND STUDY OF PHYSICS DRIVEN PITTING CORROSION MODELING IN 2024-T3 ALUMINUM ALLOYS (POSTPRINT) 5a...turbines, marine structures and so on. In the work presented in this paper, we reviewed and studied several physics based pitting corrosion models that

  1. Experimental and Numerical Study of Needle Peening Effects in Aluminium Alloy 2024-T3 Sheets

    Science.gov (United States)

    Mendez Romero, Julio Alberto

    Peening of metallic components is an effective treatment used in aerospace and automotive applications to improve fatigue properties or to blend and repair localized damage. This process is typically carried out using metallic airborne media, called shot. However, different processes make use of different media, such is the case of hard, pneumatically powered needles of needle peening equipment. In order to obtain a better understanding of the effects of needle peening in the same context as shot peening, this research work had as an objective to study in detail the behavior of the needle peening equipment in order to characterize the process, design an experimental campaign to measure the effects of needle peening on AA2024-T3 and to develop and validate a Finite Element (FE) model capable of replicating the results of needle peening. The needle peening equipment prototype, called SPIKERRTM, was developed by Shockform Aeronautique Inc. The equipment was characterized by utilizing high-speed camera recording in order to study its behaviour by varying the operating pressure. The obtained collection of images was ran through a newly developed digital image algorithm, so as to quantify the needles' velocity and frequency. The impact velocity and impact frequency were determined for different equipment operating parameters. It was concluded that both the average impact velocity and the impact frequency increase as the pressure becomes larger. Behaviour anomalies among the different needles, such as frequency and velocity variations, were brought to light; these conclusions could be of interest to the manufacturer. Ideally, all of the needles should behave as similarly as possible so as to produce a more uniform process. The response to needle peening of AA2024-T3 in 1.6 mm thick sheet form was studied by needle peening test specimens with dimensions of an Almen strips using the SPIKERRTM. AA2024-T3 was selected since it was extensively studied at Ecole Polytechnique de

  2. The Effect of Graphene on the Protective Properties of Water-Based Epoxy Coatings on Al2024-T3

    Directory of Open Access Journals (Sweden)

    T. Monetta

    2017-01-01

    Full Text Available 0.5 and 1% wt. of graphene nanoflakes were added to an anticorrosive additives-free water-based epoxy resin applied to Al2024-T3 samples. Calorimetric (DSC and adhesion (cross-cut test tests indicated that the presence of graphene did not affect the polymerization process of the resin or its adhesion to the substrate while it had some effect on its wettability. Electrochemical Impedance Spectroscopy (EIS results obtained suggested that the addition of a small amount of graphene greatly enhanced the protective properties of the epoxy coating, retarding electrolytes absorption and reducing the total amount of adsorbed water. The latter occurrence suggests that the graphene effect on coating performances is related to both extended diffusion pathway length and graphene/matrix interaction due to the unique properties of graphene.

  3. Crack Initiation and Growth Behavior at Corrosion Pit in 2024-T3 Aluminum Alloy

    Science.gov (United States)

    2014-09-01

    fracture surfaces close to the corrosion pits. Because of planar slip dislocation mechanism these images exhibit a smooth region along the crack front...surfaces 0.5 mm away from corrosion pit, in which microstructure looks more rough due to wavy slip dislocation mechanism. 57 Figure 4.13b...CRACK INITIATION AND GROWTH BEHAVIOR AT CORROSION PIT IN 2024-T3 ALUMINUM ALLOY THESIS Al-Qahtani

  4. An experimental investigation of fatigue damage in aluminum 2024-T3 alloys

    Science.gov (United States)

    Ferguson, Milton W.

    1993-01-01

    Aluminum alloys are finding increasing use in the aerospace and automobile industries due to their attractive low density-high modulus and low density-high strength characteristics. Unfortunately, cyclic stress-strain deformation alters the microstructure of the material. These structural changes can lead to fatigue damage and ultimately service failure. Therefore, in order to assess the integrity of the alloy, a correlation between fatigue damage and a measurable microstructural property is needed. Aluminum 2024-T3, a commonly used commercial alloy, contains many grains (individual crystals) of various orientations. The sizes and orientations of these grains are known to affect the strength, hardness, and magnetic permeability of polycrystalline alloys and metals; therefore, perhaps a relationship between a grain property and the fatigue state can be established. Tension-compression cycling in aluminum alloys can also induce changes in their dislocation densities. These changes can be studied from measurements of the electrical resistivities of the materials. Consequently, the goals of this investigation were: to study the grain orientation of aluminum 2024-T3 and to seek a correlation between the grain orientation and the fatigue state of the material; and to measure the electrical resistivities of fatigued samples of aluminum 2024-T3 and to interpret the findings.

  5. Finite element modelling of aluminum alloy 2024-T3 under transverse impact loading

    Science.gov (United States)

    Abdullah, Ahmad Sufian; Kuntjoro, Wahyu; Yamin, A. F. M.

    2017-12-01

    Fiber metal laminate named GLARE is a new aerospace material which has great potential to be widely used in future lightweight aircraft. It consists of aluminum alloy 2024-T3 and glass-fiber reinforced laminate. In order to produce reliable finite element model of impact response or crashworthiness of structure made of GLARE, one can initially model and validate the finite element model of the impact response of its constituents separately. The objective of this study was to develop a reliable finite element model of aluminum alloy 2024-T3 under low velocity transverse impact loading using commercial software ABAQUS. Johnson-Cook plasticity and damage models were used to predict the alloy's material properties and impact behavior. The results of the finite element analysis were compared to the experiment that has similar material and impact conditions. Results showed good correlations in terms of impact forces, deformation and failure progressions which concluded that the finite element model of 2024-T3 aluminum alloy under low velocity transverse impact condition using Johnson-Cook plastic and damage models was reliable.

  6. Temperature distribution study during the friction stir welding process of Al2024-T3 aluminum alloy

    Science.gov (United States)

    Yau, Y. H.; Hussain, A.; Lalwani, R. K.; Chan, H. K.; Hakimi, N.

    2013-08-01

    Heat flux characteristics are critical to good quality welding obtained in the important engineering alloy Al2024-T3 by the friction stir welding (FSW) process. In the present study, thermocouples in three different configurations were affixed on the welding samples to measure the temperatures: in the first configuration, four thermocouples were placed at equivalent positions along one side of the welding direction; the second configuration involved two equivalent thermocouple locations on either side of the welding path; while the third configuration had all the thermocouples on one side of the layout but with unequal gaps from the welding line. A three-dimensional, non-linear ANSYS computational model, based on an approach applied to Al2024-T3 for the first time, was used to simulate the welding temperature profiles obtained experimentally. The experimental thermal profiles on the whole were found to be in agreement with those calculated by the ANSYS model. The broad agreement between the two kinds of profiles validates the basis for derivation of the simulation model and provides an approach for the FSW simulation in Al2024-T3 and is potentially more useful than models derived previously.

  7. The Effects of Net-Shape Machining on the Performance of Al 2024-T3 Subjected to Axial Tension-Tension Fatigue Loads

    Science.gov (United States)

    2010-08-01

    level design matrix for Al 2024-T3. Quality Levels Material Ra = 2 µm Ra = 6 µm Al2024 -T3 56 specimens 56 specimens A total of 112 aluminum...of the Al 2024-T3. Stress Amplitide (MPa), R = 0.1 Material Level 1 Level 2 Level 3 Level 4 Level 5 Level 6 Level 7 Al2024 -T3 83 93 124 140 175

  8. Friction stir spot welding of 2024-T3 aluminum alloy with SiC nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Paidar, Moslem; Sarab, Mahsa Laali [Islamic Azad University, Tehran (Iran, Islamic Republic of)

    2016-01-15

    In this study, the Friction stir spot welding (FSSW) of 2024-T3 aluminum alloy with 1.6 mm thickness was investigated. The effects of the silicon carbide (SiC) nanoparticles on the metallurgical and mechanical properties were discussed. The effects of particles on tension shear and wear tests were also investigated. The process was conducted at a constant rotational speed of 1000 rpm. Results showed that adding SiC nanoparticles to the weld during FSSW had a major effect on the mechanical properties. In fact, the addition of nanoparticles as barriers prevented grain growth in the Stir zone (SZ). The data obtained in the tensile-shear and wear tests showed that tensile-shear load and wear resistance increased with the addition of SiC nanoparticles, which was attributed to the fine grain size produced in the SZ.

  9. Electrosynthesized polyaniline for the corrosion protection of aluminum alloy 2024-T3

    Directory of Open Access Journals (Sweden)

    Huerta-Vilca Domingo

    2003-01-01

    Full Text Available Adherent polyaniline films on aluminum alloy 2024-T3 have been prepared by electrodeposition from aniline containing oxalic acid solution. The most appropriate method to prepare protective films was a successive galvanostatic deposition of 500 seconds. With this type of film, the open circuit potential of the coating shifted around 0.065V vs. SCE compared to the uncoated alloy. The polyaniline coatings can be considered as candidates to protect copper-rich (3 - 5% aluminum alloys by avoiding the galvanic couple between re-deposited copper on the surface and the bulk alloy. The performance of the polyaniline films was verified by immersion tests up to 2.5 months. It was good with formation of some aluminum oxides due to electrolyte permeation so, in order to optimize the performance a coating formulation would content an isolation topcoat.

  10. 3D Finite Element Modelling of Drilling Process of Al2024-T3 Alloy with solid tooling and Experimental Validation

    DEFF Research Database (Denmark)

    Davoudinejad, Ali; Tosello, Guido

    Drilling is an indispensable process for many manufacturing industries due to the importance of the process for assembling components. This study presents a 3D finite element modeling (3D FEM) approach for drilling process of aluminum 2024-T3. The 3D model of tool for two facet HSSCo and four facet...

  11. Analysis of the tool plunge in friction stir welding - comparison of aluminium alloys 2024 T3 and 2024 T351

    Directory of Open Access Journals (Sweden)

    Veljić Darko

    2016-01-01

    Full Text Available Temperature, plastic strain and heat generation during the plunge stage of the friction stir welding (FSW of high-strength aluminium alloys 2024 T3 and 2024 T351 are considered in this work. The plunging of the tool into the material is done at different rotating speeds. A three-dimensional finite element (FE model for thermomechanical simulation is developed. It is based on arbitrary Lagrangian-Eulerian formulation, and Johnson-Cook material law is used for modelling of material behaviour. From comparison of the numerical results for alloys 2024 T3 and 2024 T351, it can be seen that the former has more intensive heat generation from the plastic deformation, due to its higher strength. Friction heat generation is only slightly different for the two alloys. Therefore, temperatures in the working plate are higher in the alloy 2024 T3 for the same parameters of the plunge stage. Equivalent plastic strain is higher for 2024 T351 alloy, and the highest values are determined under the tool shoulder and around the tool pin. For the alloy 2024 T3, equivalent plastic strain is the highest in the influence zone of the tool pin. [Projekat Ministarstva nauke Republike Srbije, br. TR 34016 i br. TR 35006

  12. Influence of friction stir welding parameters on properties of 2024 T3 aluminium alloy joints

    Directory of Open Access Journals (Sweden)

    Eramah Abdsalam M.

    2014-01-01

    Full Text Available The aim of this work is to analyse the process of friction stir welding (FSW of 3mm thick aluminium plates made of high strength aluminium alloy - 2024 T3, as well as to assess the mechanical properties of the produced joints. FSW is a modern procedure which enables joining of similar and dissimilar materials in the solid state, by the combined action of heat and mechanical work. This paper presents an analysis of the experimental results obtained by testing the butt welded joints. Tensile strength of the produced joints is assessed, as well as the distribution of hardness, micro-and macrostructure through the joints (in the base material, nugget, heat affected zone and thermo-mechanically affected zone. Different combinations of the tool rotation speed and the welding speed are used, and the dependence of the properties of the joints on these parameters of welding technology is determined. [Projekat Ministarstva nauke Republike Srbije, br. TR 34018 i br. TR 35006

  13. An assessment of the small-crack effect for 2024-T3 aluminum alloy

    Science.gov (United States)

    Newman, J. C., Jr.; Swain, M. H.; Phillips, E. P.

    1986-01-01

    Data on small-crack behavior were obtained for a single-edge-notched tensile specimen made of 2024-T3 Al alloy and used to evaluate the capability of a semiempirical crack-growth and closure model to predict the fatigue life of notched specimens. Fatigue tests were conducted under either constant-amplitude loading (with stress ratios of 0.5, 0, -1, and -2) or spectrum loading, using a replication technique to record growth. It was found that small cracks exhibited the 'small-crack' effect in that they grew faster than large cracks when subjected to the same stress intensity factor range. Experimental small-crack growth rates agreed well with the model predictions. For making predictions of fatigue life, an initial surface defect void size of 3 x 12 x 0.4 microns was used in all calculations; predicted fatigue lives agreed well with experimentally determined values obtained in all tests. The crack-closure model indicated that the 'small-crack' effect on fatigue life was greatest in tests involving significant compressive loads.

  14. Evaluating protection systems against marine corrosion of aeronautic alloy Alclad 2024-T3

    Directory of Open Access Journals (Sweden)

    William Aperador Chaparro

    2011-05-01

    Full Text Available  This paper shows how two coating systems were obtained as an alternative for protection against corrosion of al clad 2024-T3which is used in battery compartment manufacture for T-41 aircraft. Such systems consist of three types of organic resin: a first layer of P-115 polyester resin as the first coating on both systems, and a second layer of Hetron 197-3 polyester resin in the first system and vinyl-ester resin in the second one. Scanning electron microscopy (SEM was used for surface morphology analysis, showing the roughness produced by surface treatment. The coatings were electrochemically characterised by electro chemical impedance spectroscopy (EIS and Tafel polarization curves; it was found that both systems had good performance against corrosion in a marine environment and the chemical surface preparation system had a superior protective pattern for Alodine5700 + 197-3 Hetron, a 1.42x10-12mpycorrosion rate being obtained while substratum rate was 1.59x10-7 mpy. 

  15. Effect of Surface Pretreatment on the Underpaint Corrosion of AA2024-T3 at Various Temperatures

    National Research Council Canada - National Science Library

    Little, D. A; Jakab, M. A; Scully, J. R

    2006-01-01

    .... The scribe-creep rate was accelerated at all temperatures especially by pretreatments that increased the concentration of surface Cu or left a high capacity for Cu-replating. Sodium hydroxide (NaOH...

  16. Characterization of fracture behavior of 2024-O and 2024-T3 aluminum alloys; Caracterizacion de la respuesta a fractura de las aleaciones de aluminio 2024-O y 2024-T3

    Energy Technology Data Exchange (ETDEWEB)

    Monsalve, A.; Morales, R.

    2004-07-01

    The fracture behavior of 2024-O (annealed) and 2024-T3 (precipitation hardened) aluminum alloys used in aeronautical applications have been characterized. The study of the annealed alloy was carried out through the concept of Essential Specific Work of Fracture, using the ESIS protocol. DENT (Double Edge Notch Tension) samples were used, varying the ligament length in order to determine the relationship between the essential specific work of fracture and the thickness of the material. In the case of 2024-T3 alloy, the essential specific work of fracture was determined only for low thicknesses, where the predominant conditions are plane stress. However, for this alloy, the results were not conclusive because of the high fracture toughness of these hardened alloys. Finally, the fracture surface of these alloys was characterized finding a ductile mechanism in the case of the annealed alloy and ductile-brittle mechanism in the case of the hardened alloy. (Author) 9 refs.

  17. 3D Finite Element Modelling of Drilling Process of Al2024-T3 Alloy with solid tooling and Experimental Validation

    DEFF Research Database (Denmark)

    Davoudinejad, Ali; Tosello, Guido

    2017-01-01

    Drilling is an indispensable process for many manufacturing industries due to its importance for assembling components. This study presents a 3D finite element modelling (3D FEM) approach for drilling process of aluminium 2024-T3. The 3D model of drilling tools for two facet HSSCo and four facet...... HSS were generated including their geometries. The simulations were carried out for both drills under different cutting conditions. The numerically obtained thrust forces were compared against experimental results. The tool stress distribution, chip formation and temperature distribution in the chip...... area were determined numerically. The results confirm the ability and advantage of 3D FE modelling of the drilling process....

  18. The effect of hardening laws and thermal softening on modeling residual stresses in FSW of aluminum alloy 2024-T3

    DEFF Research Database (Denmark)

    Sonne, Mads Rostgaard; Tutum, Cem Celal; Hattel, Jesper Henri

    2013-01-01

    were simulated and compared with experimentally obtained results for both temperatures and residual stresses (using the slitting method). The comparisons showed good agreement regarding temperatures whereas the residual stress comparisons indicated different sensitivities for the cold and hot welding...... or kinematic hardening together with the metallurgical softening model were applied in order to give a first impression of the tendencies in residual stresses in friction stir welds when choosing different hardening and softening behaviors. Secondly, real friction stir butt welding of aluminum alloy 2024-T3...

  19. Investigation on the corrosion behaviour and microstructure of 2024-T3 Al alloy treated via plasma electrolytic oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Fadaee, Hossein; Javidi, Mehdi, E-mail: mjavidi@yahoo.com

    2014-08-01

    Highlights: • Plasma electrolytic oxidation used to improve corrosion resistance of 2024-T3 alloy. • A conventional DC source with low applied voltage was considered for PEO. • Use of glycerin was effective in enhancement of corrosion resistance. • The surface morphology indicated coatings have a dense structure without cracking. • Degradation of coatings with immersion time was investigated. - Abstract: Plasma electrolytic oxidation treatment was performed on 2024-T3 aluminium alloy in a simple and inexpensive electrolyte. It was found that treatment time of 30 min resulted in the most noble corrosion potential and lowest corrosion current density. The surface and cross-sectional morphology indicated that the coating has a dense structure without any cracking. Furthermore, the result of X-ray diffraction analysis indicated that the coating was formed mainly from α-Al{sub 2}O{sub 3}, γ-Al{sub 2}O{sub 3}, Al{sub 3.21}Si{sub 0.47} and small amounts of amorphous phases. The presence of glycerine in the electrolyte composition resulted in not only stabilising the solution but also improving the corrosion resistance.

  20. STUDY THE EFFECTS OF PRESTRAINS IN UNIAXIAL TENSION ON THE FORMING LIMIT DIAGRAM OF ALUMINUM ALLOY SHEETS(2024 T3

    Directory of Open Access Journals (Sweden)

    Waleed J. Ali

    2013-05-01

    Full Text Available           The strain path for sheet metal may be changed during forming , this may be affect the forming limit curve (FLC . In this work the FLC before and after prestraining was determined for aluminum alloy (2024 T3 to study the effect of this type of prestraining and in different values on the FLC. This alloy was chosen because it is used widely , specially in aircraft structures .It was shown that the using of uniaxial tension prestrain affects the FLC . The major strain in right side is increased with the increasing in the prestrain , while in the left side the effect is small .  

  1. Effect of Multipath Laser Shock Processing on Microhardness, Surface Roughness, and Wear Resistance of 2024-T3 Al Alloy

    Directory of Open Access Journals (Sweden)

    Abdulhadi Kadhim

    2014-01-01

    Full Text Available Laser shock processing (LSP is an innovative surface treatment technique with high peak power, short pulse, and cold hardening for strengthening metal materials. LSP is based on the application of a high intensity pulsed laser beam (I>1 GW/cm2;  t<50 ns at the interface between the metallic target and the surrounding medium (a transparent confining material, normally water forcing a sudden vaporization of the metallic surface into a high temperature and density plasma that immediately develops inducing a shock wave propagating into the material. The shock wave induces plastic deformation and a residual stress distribution in the target material. In this paper we study the increase of microhardness and surface roughness with the increase of laser pulse energy in 2024-T3 Al alloy. The influence of the thickness of the confining layer (water on microhardness and surface roughness is also studied. In addition, the effect of LSP treatment with best conditions on wear behaviors of the alloy was investigated.

  2. Fracture Tests on Thin Sheet 2024-T3 Aluminum Alloy for Specimens with and Without Anti-Buckling Guides

    Science.gov (United States)

    Johnston, William M.; Newman, James C., Jr. (Technical Monitor)

    2001-01-01

    A series of fracture test were conducted to determine the effects of specimen type specimen width and buckling on the fracture behavior of cracked thin sheet (0.063 inch thick) 2024-T3 aluminum alloy. A summary of the experimental measurements is presented for fracture tests conducted on two specimen types and various widths. Middle-crack tension M(T) and compact tension C(T) specimens were tested in the L-T and T-L orientation with duplicate tests for each condition. Four widths (W= 3, 12, 24, and 40 inch) were tested for the middle-crack tension specimens, and three widths (W=2, 4, and 6 inch) were tested for the compact tension specimens. The M(T) specimens were tested in either a constrained (out-of-plane displacements restrained with antibuckling guides) or unconstrained conditions were the specimen was free to buckle out of plane Measurements were made of load against crack extension for all specimens.

  3. Effects of low fluence neutron bombardment on material properties of aluminum 2024 t-3 and aluminum wire

    Science.gov (United States)

    Reeves, Jesse Lee

    The purpose of this work was to explore the impact of neutron irradiation (1018 n/m2 to 1021 n/m 2) on the aluminum alloy 2024 T-3, and several corrosion resistant treatments commonly used. The irradiation was conducted in the Utah Nuclear Engineering Programs Reactor facility using the Fast Neutron Irradiation Facility (FNIF) with a 1 MeV equivalent beam and the Center Irradiator (CI) with average neutron energy of 0.58 MeV. Historically, materials tests have focused on mechanical failures occurring at very high fluence. These same tests have generally been conducted for pure materials: the limited research existing for alloyed materials focuses on power plant materials such as zircaloy and steel. This body of information is mainly used to avoid catastrophic performance failures. Small research and test reactors operating at low power will subject core materials to fluence from 1014 n/m2 to 1024 n/m2. Aluminum alloys are very common in these systems. Materials used in research reactors, such as aluminum, have been deemed adequate due to high radiation tolerance and low mechanical failure rates. While aluminum and its alloys are a well-defined set of materials in nonradiation environments, there are very little published data for them for low fluence neutron radiation. This work measured Al 2024's (T-3) thermal conductivity, electrical resistivity, oxide layer thickness, oxide/metal interface and corrosion resistance (using passive current density) for Alodine, Anodize type II, Anodize type III and native oxide. These measurements were taken before and after irradiation and results were examined. Over the course of 30 to 50 years, property changes will likely impact thermal diffusion, corrosion properties and electrical properties. Defining these changes may give future engineers the tools needed to safely justify life extensions and build inspection methods to identify pre-failure conditions.

  4. Numerical analysis of static performance comparison of friction stir welded versus riveted 2024-T3 aluminum alloy stiffened panels

    Science.gov (United States)

    Shao, Qing; He, Yuting; Zhang, Teng; Wu, Liming

    2014-07-01

    Most researches on the static performance of stiffened panel joined by friction stir welding(FSW) mainly focus on the compression stability rather than shear stability. To evaluate the potential of FSW as a replacement for traditional rivet fastening for stiffened panel assembly in aviation application, finite element method(FEM) is applied to compare compression and shear stability performances of FSW stiffened panels with stability performances of riveted stiffened panels. FEMs of 2024-T3 aluminum alloy FSW and riveted stiffened panels are developed and nonlinear static analysis method is applied to obtain buckling pattern, buckling load and load carrying capability of each panel model. The accuracy of each FEM of FSW stiffened panel is evaluated by stability experiment of FSW stiffened panel specimens with identical geometry and boundary condition and the accuracy of each FEM of riveted stiffened panel is evaluated by semi-empirical calculation formulas. It is found that FEMs without considering weld-induced initial imperfections notably overestimate the static strengths of FSW stiffened panels. FEM results show that, buckling patterns of both FSW and riveted compression stiffened panels represent local buckling of plate between stiffeners. The initial buckling waves of FSW stiffened panel emerge uniformly in each plate between stiffeners while those of riveted panel mainly emerge in the mid-plate. Buckling patterns of both FSW and riveted shear stiffened panels represent local buckling of plate close to the loading corner. FEM results indicate that, shear buckling of FSW stiffened panel is less sensitive to the initial imperfections than compression buckling. Load carrying capability of FSW stiffened panel is less sensitive to the initial imperfections than initial buckling. It can be concluded that buckling loads of FSW panels are a bit lower than those of riveted panels whereas carrying capabilities of FSW panels are almost equivalent to those of riveted

  5. Influence of Crack-Tip Configurations on the Fracture Response of 0.04-Inch Thick 2024-T3 Aluminum Alloy Sheet

    Science.gov (United States)

    Johnston, William M.; Newman, James C. (Technical Monitor)

    2002-01-01

    A series of fracture tests were conducted on Middle-crack tension M(T) and compact tension C(T) specimens to determine the effects of specimen type, specimen width, notch tip sharpness and buckling on the fracture behavior of cracked thin sheet (0.04 inch thick) 2024-T3 aluminum alloy material. A series of M(T) specimens were tested with three notch tip configurations: (1) a fatigue pre-cracked notch, (2) a 0.010-inch-diameter wire electrical discharge machined (EDM) notch, and (3) a EDM notch sharpened with a razor blade. The test procedures are discussed and the experimental results for failure stress, load vs. crack extension and the material stress-strain response are reported.

  6. Caraterização da reatividade das ligas de aluminio AA2024-T3 E AA7475-T651 soldadas por fricção (FSW).

    OpenAIRE

    Palumbo de Abreu, Caio

    2016-01-01

    Friction Stir Welding (FSW) is an efficient process of joining high strength aluminum alloys avoiding defects that are usually created when conventional welding techniques are used. The aircraft industry has shown great interest in this welding method, both for welding of similar or dissimilar alloys. However, this process causes microstructural changes that are dependent on the thermal or thermomechanical conditions applied. Electrical contact between zones of different microstructures, in t...

  7. Failure Mode Analysis of Aluminium Alloy 2024-T3 in Double-Lap Bolted Joints with Single and Double Fasteners; A Numerical and Experimental Study

    Directory of Open Access Journals (Sweden)

    Khosro Fallahnezhad

    2015-06-01

    Full Text Available This paper aims to study the mechanical behaviour and failure mode of Al 2024-T3 in double-lap bolted joints. To accomplish this, the effect of geometric parameters was investigated in both configurations of single and double fasteners. Using ABAQUS/Standard, a three-dimensional finite element model was developed and verified against the experimental results of the joints loaded in tension. In general, double bolt joints were found to have greater load carrying capacities than single bolt joints (by 40%–49%. In single bolt joints, the plate width had insignificant effect on the behaviour of the joint under tensile loading; whereas, increasing the distance of the hole from the edge, considerably enhanced the strength of the joint. In double bolt joints, changing the edge distance had almost no effect on the behaviour of the joint. However, increasing the plate width from 25.4 to 30 mm increased the load carrying capacity by 28%. This study showed that in single bolt connections, with increasing the edge distance, the failure mode can favourably shift from shear-out to bearing. Also, double bolt joints with wider plates (increased width can beneficially shift the failure mode from net-tension to bearing. The geometric parameters were found to play an important role in controlling the failure mode so that catastrophic failure modes of net-tension and shear-out can be prevented in bolted joint.

  8. Investigation of the corrosion behaviour of a bilayer cerium-silane pre-treatment on Al 2024-T3 in 0.1 M NaCl

    Energy Technology Data Exchange (ETDEWEB)

    Palomino, Luis E.M.; Suegama, Patricia H.; Aoki, Idalina V. [Polytechnic School of the Sao Paulo University (Brazil); Paszti, Zoltan [Institute of Surface Chemistry and Catalysis, Chemical Research Center, Hungarian Academy of Sciences, P.O. Box 1XXX, Budapest (Hungary); Melo, Hercilio G. de [Polytechnic School of the Sao Paulo University (Brazil)], E-mail: hgdemelo@usp.br

    2007-10-10

    In the last few years great efforts have been made in order to find environmentally friendly substitutes for Cr{sup 6+} pre-treatments applied to aluminium alloys used in the aircraft industry. In this work we have investigated the electrochemical response of a bilayer pre-treatment consisting of a Ce conversion bottom layer and a non-functional silane (bis-1,2-(triethoxysilyl) ethane (BTSE)) top layer applied on Al 2024-T3, and compared its behaviour with monolayer coated samples. The investigation was carried out in 0.1 M NaCl solution, and the electrochemical techniques employed were anodic polarization curves and electrochemical impedance spectroscopy (EIS). EIS experiments performed with bilayer coated samples have shown a continuous increase of the impedance response during the whole test period, which was interpreted on the basis of a pore blocking mechanism supported by scanning electron microscopy (SEM) images and equivalent circuit fitting. Moreover, the impedance of the bilayer coated samples was approximately one order of magnitude higher than that presented by monolayer coated ones. On the other hand, mechanical tests have evidenced the good adhesion of the silane layer to the Ce conversion layer, which can be likely attributed to a better linking between the silane molecules and the cerium bottom layer.

  9. Microstructure and mechanical properties of 2024-T3 and 7075-T6 aluminum alloys and austenitic stainless steel 304 after being exposed to hydrogen peroxide

    Science.gov (United States)

    Sofyan, Nofrijon Bin Imam

    The effect of hydrogen peroxide used as a decontaminant agent on selected aircraft metallic materials has been investigated. The work is divided into three sections; bacterial attachment behavior onto an austenitic stainless steel 304 surface; effect of decontamination process on the microstructure and mechanical properties of aircraft metallic structural materials of two aluminum alloys, i.e. 2024-T3 and 7075-T6, and an austenitic stainless steel 304 as used in galley and lavatory surfaces; and copper dissolution rate into hydrogen peroxide. With respect to bacterial attachment, the results show that surface roughness plays a role in the attachment of bacteria onto metallic surfaces at certain extent. However, when the contact angle of the liquid on a surface increased to a certain degree, detachment of bacteria on that surface became more difficult. In its relation to the decontamination process, the results show that a corrosion site, especially on the austenitic stainless steel 304 weld and its surrounding HAZ area, needs more attention because it could become a source or a harborage of bio-contaminant agent after either incidental or intentional bio-contaminant delivery. On the effect of the decontamination process on the microstructure and mechanical properties of aircraft metallic structural materials, the results show that microstructural effects are both relatively small in magnitude and confined to a region immediately adjacent to the exposed surface. No systematic effect is found on the tensile properties of the three alloys under the conditions examined. The results of this investigation are promising with respect to the application of vapor phase hydrogen peroxide as a decontaminant agent to civilian aircraft, in that even under the most severe circumstances that could occur; only very limited damage was observed. The results from the dissolution of copper by concentrated liquid hydrogen peroxide showed that the rate of copper dissolution increased for

  10. Integrated Modelling of Crack Propagation in AA2024-T3 FSW Butt Joints Considering The Residual Stresses from the Manufacturing Process

    DEFF Research Database (Denmark)

    Sonne, M. R.; Carlone, P.; Citarella, R.

    2015-01-01

    conducted to investigate the effect of shunting on nugget size in spot welding of HSLA steel sheets. Different cases with different spacing between weld spots have been examined. The nugget sizes have been measured by metallographic examination and have been compared with 3D finite element simulations......This research is focused on one of the problems frequently encountered in spot welding in industry. In many applications several spot welds are made close to each other. The spots made after the first spot may become smaller in size due to shunt effect. A numerical and experimental study has been....... The results of this study revealed that the shunt effect becomes negligible when the minimum weld spacing is about six times the electrode diameter. The results showed that the weld nugget diameter is more sensitive to shunt effect than the nugget height....

  11. Effect of welding parameters (plunge depths of shoulder, pin geometry, and tool rotational speed) on the failure mode and stir zone characteristics of friction stir spot welded aluminum 2024-T3 sheets

    Energy Technology Data Exchange (ETDEWEB)

    Paidar, Moslem; Sarab, Mahsa Lali; Taheri, Morteza; Khodabandeh, Alireza [Islamic Azad University, Tehran (Iran, Islamic Republic of)

    2015-11-15

    The main purpose of this study was to investigate the effect of welding parameters on the failure mode and stir zone characteristics of aluminum alloy 2024-T3 joined by friction stir spot welding. The welding parameters in this work are tool rotational speed, plunge depths of shoulder, and pin geometry. In accordance with the methods of previous investigations, the rotational speeds were set to 630 rpm to 2000 rpm. Two pin geometries with concave shoulder were used: triangular and cylindrical. The plunge depths of the shoulder were 0.3, 0.5 and 0.7 mm. The shoulder diameter and pin height for both geometries were 14 and 2.4 mm, respectively. The diameter of the cylindrical and triangular pins was 5 mm. Results show that the parameters mentioned earlier influence fracture mode under tension shear loading. Two different fracture modes were observed during the examinations. Low-penetration depths and low-rotational speeds lead to shear fracture, whereas high values of these factors cause the tension-shear fracture mode. Fracture of the lower sheet sometimes occurs at high rotational speeds.

  12. Galvanostatic response of AA2024 aluminium alloy in 3.5% NaCl ...

    Indian Academy of Sciences (India)

    and G E THOMPSON. Corrosion and Protection Centre, School of Materials, The University of Manchester, Manchester M13 9PL, UK. MS received 5 August 2015; accepted 15 April 2016. Abstract. Galvanostatic responses of AA2024T3 alloy in de-aerated and naturally aerated 3.5% NaCl solution have been investigated.

  13. Galvanostatic response of AA2024 aluminium alloy in 3.5% NaCl ...

    Indian Academy of Sciences (India)

    Galvanostatic responses of AA2024T3 alloy in de-aerated and naturally aerated 3.5% NaCl solution have been investigated. In the de-aerated condition, two distinct stages of polarization were revealed. From the first stage, the relationships between the pitting incubation time, pitting potential and applied current density for ...

  14. Assessment of the Contour Method for 2-D Cross Sectional Residual Stress Measurements of Friction Stir Welded Parts of AA2024-T3—Numerical and Experimental Comparison

    DEFF Research Database (Denmark)

    Sonne, Mads Rostgaard; Carlone, Pierpaolo; Hattel, Jesper Henri

    2017-01-01

    The contour method is one of the newest techniques for obtaining residual stress fields from friction stir welded (FSW) parts, experimentally. This method has many advantages; however, edge effects coming from the process itself might introduce artifacts in the obtained results, and this was slig......The contour method is one of the newest techniques for obtaining residual stress fields from friction stir welded (FSW) parts, experimentally. This method has many advantages; however, edge effects coming from the process itself might introduce artifacts in the obtained results......, and consequently this should not be interpreted as a misleading result of the contour method. Edge effects from the cutting process involved in the contour method should, however, be taken into consideration, most likely resulting in the residual stresses observed near the surfaces of the cross section being less...

  15. Effect of the Cold-Sprayed Aluminum Coating-Substrate Interface Morphology on Bond Strength for Aircraft Repair Application

    Science.gov (United States)

    Blochet, Quentin; Delloro, Francesco; N'Guyen, Franck; Jeulin, Dominique; Borit, François; Jeandin, Michel

    2017-04-01

    This article is dealing with the effects of surface preparation of the substrate on aluminum cold-sprayed coating bond strength. Different sets of AA2024-T3 specimens have been coated with pure Al 1050 feedstock powder, using a conventional cold spray coating technique. The sets were grit-blasted (GB) before coating. The study focuses on substrate surface topography evolution before coating and coating-substrate interface morphology after coating. To study coating adhesion by LASAT® technique for each set, specimens with and without preceding GB treatment were tested in load-controlled conditions. Then, several techniques were used to evaluate the effects of substrate surface treatment on the final coating mechanical properties. Irregularities induced by the GB treatment modify significantly the interface morphology. Results showed that particle anchoring was improved dramatically by the presence of craters. The substrate surface was characterized by numerous anchors. Numerical simulation results exhibited the increasing deformation of particle onto the grit-blasted surface. In addition, results showed a strong relationship between the coating-substrate bond strength on the deposited material and surface preparation.

  16. Evolution of substrate specificity in bacterial AA10 lytic polysaccharide monooxygenases.

    Science.gov (United States)

    Book, Adam J; Yennamalli, Ragothaman M; Takasuka, Taichi E; Currie, Cameron R; Phillips, George N; Fox, Brian G

    2014-01-01

    Understanding the diversity of lignocellulose-degrading enzymes in nature will provide insights for the improvement of cellulolytic enzyme cocktails used in the biofuels industry. Two families of enzymes, fungal AA9 and bacterial AA10, have recently been characterized as crystalline cellulose or chitin-cleaving lytic polysaccharide monooxygenases (LPMOs). Here we analyze the sequences, structures, and evolution of LPMOs to understand the factors that may influence substrate specificity both within and between these enzyme families. Comparative analysis of sequences, solved structures, and homology models from AA9 and AA10 LPMO families demonstrated that, although these two LPMO families are highly conserved, structurally they have minimal sequence similarity outside the active site residues. Phylogenetic analysis of the AA10 family identified clades with putative chitinolytic and cellulolytic activities. Estimation of the rate of synonymous versus non-synonymous substitutions (dN/dS) within two major AA10 subclades showed distinct selective pressures between putative cellulolytic genes (subclade A) and CBP21-like chitinolytic genes (subclade D). Estimation of site-specific selection demonstrated that changes in the active sites were strongly negatively selected in all subclades. Furthermore, all codons in the subclade D had dN/dS values of less than 0.7, whereas codons in the cellulolytic subclade had dN/dS values of greater than 1.5. Positively selected codons were enriched at sites localized on the surface of the protein adjacent to the active site. The structural similarity but absence of significant sequence similarity between AA9 and AA10 families suggests that these enzyme families share an ancient ancestral protein. Combined analysis of amino acid sites under Darwinian selection and structural homology modeling identified a subclade of AA10 with diversifying selection at different surfaces, potentially used for cellulose-binding and protein

  17. Influência da Espessura do Filme Polimérico Intermediário na Resistência Mecânica de Juntas Híbridas de Alumínio 2024-T3 e CF-PPS Produzidas por União Pontual por Fricção

    Directory of Open Access Journals (Sweden)

    Natália M. André

    2016-03-01

    Full Text Available Resumo A União Pontual por Fricção (FSpJ é uma técnica inovadora para união de estruturas híbridas metal-polímero e baseia-se na geração de calor por fricção. Juntas de alumínio 2024-T3 e compósito laminado de poli(sulfeto de fenileno com fibra de carbono (CF-PPS foram produzidas com filme intermediário de PPS. Duas espessuras de filme foram investigadas: 100 e 500 µm. Ensaios de cisalhamento sob tração demonstraram que as juntas com filmes de 100 µm são mais resistentes (2093 ± 180 N em relação às juntas com filme de 500 µm (708 ± 69 N. Adicionalmente, as superfícies de fratura das juntas revelaram áreas de união maiores para as juntas com filmes de 100 µm (53 ± 2 contra 40 ± 1 mm2. Para o filme mais fino, a extensão do amolecimento devido ao calor friccional é maior. Consequentemente, a baixa viscosidade atingida com a fusão do polímero favorece a molhabilidade das superfícies dos componentes da junta pelo PPS amolecido, resultando em melhor adesão entre as partes. Ademais, análises microestruturais demonstraram que a formação do cerne metálico e a interdifusão das moléculas de PPS entre compósito e filme também são favorecidas. Portanto, concluiu-se que a adição do filme mais fino produziu juntas mais resistentes.

  18. Microstructure and anisotropic mechanical behavior of friction stir welded AA2024 alloy sheets

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhihan [State Key Laboratory of Solidification Processing, Shaanxi Key Laboratory of Friction Welding Technologies, Northwestern Polytechnical University, Xi' an 710072, Shaanxi (China); Li, Wenya, E-mail: liwy@nwpu.edu.cn [State Key Laboratory of Solidification Processing, Shaanxi Key Laboratory of Friction Welding Technologies, Northwestern Polytechnical University, Xi' an 710072, Shaanxi (China); Li, Jinglong [State Key Laboratory of Solidification Processing, Shaanxi Key Laboratory of Friction Welding Technologies, Northwestern Polytechnical University, Xi' an 710072, Shaanxi (China); Chao, Y.J. [Department of Mechanical Engineering, University of South Carolina, Columbia, SC 29208 (United States); Vairis, A. [Mechanical Engineering Department, TEI of Crete, Heraklion, Crete 71004 (Greece)

    2015-09-15

    The anisotropic mechanical properties of friction stir welded (FSW) AA2024-T3 alloy joints were investigated based on the uniaxial tensile tests. The joint microstructure was examined by using electron back-scattered diffraction and transmission electron microscope. Results show that the evident anisotropic failure and yielding are present in the FSW joints. With the increase of loading angle from 0° to 90° the ultimate tensile strength and elongation of the specimens consistently decrease, or at first decrease and then increase, depending on the FSW process parameters. The specimen cut from the weld direction, i.e. a loading angle of 0°, exhibits the highest strength and elongation. - Highlights: • Microstructure and anisotropy of friction stir welded joints were studied. • The evident anisotropic failure and yielding are present in joints. • The lowest yield stress and UTS are at 45° and 60° loadings, respectively. • Rotation speed heavily impact on the anisotropy of joints.

  19. An evaluation of the pressure proof test concept for 2024-T3 aluminium alloy sheet

    Science.gov (United States)

    Dawicke, D. S.; Poe, C. C., Jr.; Newman, J. C.; Harris, C. E.

    1991-01-01

    The concept of pressure proof testing of fuselage structures with fatigue cracks to insure structural integrity was evaluated from a fracture mechanics viewpoint. A generic analytical and experimental investigation was conducted on uniaxially loaded flat panels with crack configurations and stress levels typical of longitudinal lap splice joints in commercial transport aircraft fuselages. The results revealed that the remaining fatigue life after a proof cycle was longer than that without the proof cycle because of crack growth retardation due to increased crack closure. However, based on a crack length that is slightly less than the critical value at the maximum proof stress, the minimum assured life or proof test interval must be no more than 550 pressure cycles for a 1.33 proof factor and 1530 pressure cycles for a 1.5 proof factor to prevent in-flight failures.

  20. The Effect of Hole Quality on the Fatigue Life of 2024-T3 Aluminum Alloy Sheet

    Science.gov (United States)

    Everett, Richard A., Jr.

    2004-01-01

    This paper presents the results of a study whose main objective was to determine which type of fabrication process would least affect the fatigue life of an open-hole structural detail. Since the open-hole detail is often the fundamental building block for determining the stress concentration of built-up structural parts, it is important to understand any factor that can affect the fatigue life of an open hole. A test program of constant-amplitude fatigue tests was conducted on five different sets of test specimens each made using a different hole fabrication process. Three of the sets used different mechanical drilling procedures while a fourth and fifth set were mechanically drilled and then chemically polished. Two sets of specimens were also tested under spectrum loading to aid in understanding the effects of residual compressive stresses on fatigue life. Three conclusions were made from this study. One, the residual compressive stresses caused by the hole-drilling process increased the fatigue life by two to three times over specimens that were chemically polished after the holes were drilled. Second, the chemical polishing process does not appear to adversely affect the fatigue life. Third, the chemical polishing process will produce a stress-state adjacent to the hole that has insignificant machining residual stresses.

  1. An alternate to chromate conversion coatings for the corrosion protection of aluminum 2024-T3

    Science.gov (United States)

    Guo, Ruiguang

    Corrosion of high-strength aluminum alloys used for airspace application is an expensive and serious problem. The most significant environmental factor contributing to the corrosion of these alloys is water condensed from humid air and contaminated with soluble chloride salts. The Al 2024 series used for aircraft are particularly susceptible to corrosion in aqueous chloride solutions due to alloying constituents such as copper and other impurities. Chromates are efficient inhibitors of corrosion of aluminum in near neutral aqueous environments containing aggressive anions such as chlorides. Usually, aluminum alloys are initially protected by chromate conversion coatings. Additional polymer coatings are sometimes added during exposure to corrosive atmospheres such as marine environments. Although chromate coatings are widely used, they require the use of noxious solutions, so they have always presented effluent disposal problems. There are health and safety concerns over the use of chromates due to their toxicity and carcinogenic nature and, as a consequence, the environmental and health risks associated with the use of such coatings will be restricted in the future. It was these health and safety concerns that led to the development of alternative non-toxic coating processes with comparable adhesion properties and corrosion protection. A variety of process technologies are under development and are vying for acceptance in industrial markets. As an alternate conversion coating, a new titanate conversion coating was systematically researched and developed. Research concentrated on producing passive surfaces from a simple titanate solution using an immersion process. The corrosion resistance of the treated surface has been evaluated using simple, rapid electrochemical techniques as well as a more long-term salt spray test. Passivation by titanate conversion treatment exhibits many similarities to chromate conversion treatment. Based on this study of corrosion protection of the titanate coating formed at different conditions, a possible formation mechanism of a titanate coating is proposed. A conclusion may be drawn that titanate coating seems to be a viable alternative to chromate coatings.

  2. Joint Test Protocol: Environmentally Friendly Zirconium Oxide Pretreatment Demonstration

    Science.gov (United States)

    2013-12-01

    This change in pH results in the precipitation and subsequent bonding of zirconium oxide and additives to the surface of the substrate. The...that will be exposed to a corrosive environment known to cause stress-corrosion cracking, such as sodium hydroxide for carbon steel or chloride ions...Substrate descriptions and test specimen codes. Specimen Code Alloy Name Composition M1 AA2024-T3 (bare) 4.5% copper, 1.5% magnesium 0.6

  3. On the Improvement of AA2024 Wear Properties through the Deposition of a Cold-Sprayed Titanium Coating

    Directory of Open Access Journals (Sweden)

    Antonello Astarita

    2016-08-01

    Full Text Available This paper deals with the study of the enhancement of the tribological properties of AA2024 through the deposition of a titanium coating. In particular two different coatings were studied: (1 untreated titanium coating; and (2 post-deposition laser-treated titanium coating. Titanium grade 2 powders were deposited onto an aluminium alloy AA2024-T3 sheet through the cold gas dynamic spray process. The selective laser post treatment was carried out by using a 220 W diode laser to further enhance the wear properties of the coating. Tribo-tests were executed to analyse the tribological behaviour of materials in contact with an alternative moving counterpart under a controlled normal load. Four different samples were tested to assess the effectiveness of the treatments: untreated aluminium sheets, titanium grade 2 sheets, as-sprayed titanium powders and the laser-treated coating layer. The results obtained proved the effectiveness of the coating in improving the tribological behaviour of the AA2024. In particular the laser-treated coating showed the best results in terms of both the friction coefficient and mass lost. The laser treatment promotes a change of the wear mechanism, switching from a severe adhesive wear, resulting in galling, to an abrasive wear mechanism.

  4. Mineralogical Transformation and Electrochemical Nature of Magnesium-Rich Primers during Natural Weathering

    Directory of Open Access Journals (Sweden)

    Shashi S. Pathak

    2014-07-01

    Full Text Available Magnesium-rich primers (MgRP have generated great interest as a promising alternative to chromium-based primers for the protection of aluminum substrates but their performance during exterior exposure has not been well documented. This paper focuses on the evaluation of MgRP during natural weathering to gain insight into its mineralogical phase transformation and electrochemical nature. Control studies were conducted on Mg and AA2024-T3 coupons. The results indicate that Mg particles in MgRP transform into a variety of hydroxide, carbonate, and hydroxy carbonates. During natural weathering, CO2 inhibited the dissolution of both Mg and AA2024-T3 as a result of protective carbonate layer formation in the coating.

  5. Site-saturation engineering of lysine 47 in cyclodextrin glycosyltransferase from Paenibacillus macerans to enhance substrate specificity towards maltodextrin for enzymatic synthesis of 2-O-D-glucopyranosyl-L-ascorbic acid (AA-2G).

    Science.gov (United States)

    Han, Ruizhi; Liu, Long; Shin, Hyun-dong; Chen, Rachel R; Du, Guocheng; Chen, Jian

    2013-07-01

    In this work, the site-saturation engineering of lysine 47 in cyclodextrin glycosyltransferase (CGTase) from Paenibacillus macerans was conducted to improve the specificity of CGTase towards maltodextrin, which can be used as a cheap and easily soluble glycosyl donor for the enzymatic synthesis of 2-O-D-glucopyranosyl-L-ascorbic acid (AA-2G) by CGTase. When using maltodextrin as glycosyl donor, four mutants K47F (lysine→ phenylalanine), K47L (lysine→ leucine), K47V (lysine→ valine) and K47W (lysine→ tryptophan) showed higher AA-2G yield as compared with that produced by the wild-type CGTase. The transformation conditions (temperature, pH and the mass ratio of L-ascorbic acid to maltodextrin) were optimized and the highest titer of AA-2G produced by the mutant K47L could reach 1.97 g/l, which was 64.2% higher than that (1.20 g/l) produced by the wild-type CGTase. The reaction kinetics analysis confirmed the enhanced maltodextrin specificity, and it was also found that compared with the wild-type CGTase, the four mutants had relatively lower cyclization activities and higher disproportionation activities, which was favorable for AA-2G synthesis. The mechanism responsible for the enhanced substrate specificity was further explored by structure modeling and it was indicated that the enhancement of maltodextrin specificity may be due to the short residue chain and the removal of hydrogen bonding interactions between the side chain of residue 47 and the sugar at -3 subsite. Here the obtained mutant CGTases, especially the K47L, has a great potential in the production of AA-2G with maltodextrin as a cheap and easily soluble substrate.

  6. A silanol-based nanocomposite coating for protection of AA-2024 aluminium alloy

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, E.; Pavez, J.; Azocar, I.; Zagal, J.H. [Departamento de Quimica de los Materiales, Facultad de Quimica y Biologia, Universidad de Santiago de Chile, Avenida Bernardo O' Higgins 3363, Casilla 40, Correo 33, Santiago (Chile); Zhou, X. [Corrosion and Protection Centre, School of Materials, University of Manchester, Manchester M13 9PL (United Kingdom); Melo, F. [Departamento de Fisica, Facultad de Ciencias, Universidad de Santiago de Santiago de Chile, Avenida Bernardo O' Higgins 3363, Santiago (Chile); Thompson, G.E. [Corrosion and Protection Centre, School of Materials, University of Manchester, Manchester M13 9PL (United Kingdom); Paez, M.A., E-mail: maritza.paez@usach.cl [Departamento de Quimica de los Materiales, Facultad de Quimica y Biologia, Universidad de Santiago de Chile, Avenida Bernardo O' Higgins 3363, Casilla 40, Correo 33, Santiago (Chile)

    2011-09-01

    Highlights: {center_dot} A new silanol-based hybrid coating has been synthesized. {center_dot} The incorporation of CeO{sub 2} and ZrO{sub 2} nanoparticles into the coating greatly improves the corrosion resistance of the coated aluminium alloy. {center_dot} The effectiveness of the coating is increasingly evident for long term exposure to the sodium chloride solution. {center_dot} The silanol-based nanocomposite coatings have self-healing ability. - Abstract: A new hybrid sol-gel type film, composed of tetraethylorthosilicate (TEOS) and tetraocthylorthosilicate (TEOCS), and modified with different nanoparticle systems, has been investigated as a coating for protection of AA-2024-T3 aluminium alloy. The nanoparticle systems considered were either ZrO{sub 2} or CeO{sub 2} or their combination{sub .} The zirconia nanoparticles were prepared from a Zr (IV) propoxide sol (TPOZ), using an organic stabilizer, and the CeO{sub 2} nanoparticles were developed spontaneously after adding cerium nitrate solution to the hybrid sol. The chemical composition and the structure of the hybrid sol-gel films were examined by X-ray photoelectron spectroscopy (XPS), scanning electron microscopy (SEM) and atomic force microscopy (AFM). The corrosion resistance of the coated AA-2024 alloy was examined by potentiodynamic polarization. The results revealed that, for short exposure times in the electrolyte, incorporation of ZrO{sub 2} or CeO{sub 2} nanoparticles in the hybrid film does not provide an increase in the corrosion resistance of the coated AA-2024 alloy. Further, the resistance was significantly reduced by increasing the nanoparticle content. Conversely, by incorporating both nanoparticles (ZrO{sub 2} and CeO{sub 2}), the corrosion resistance of the resulting hybrid films increased slightly. The behavior changed significantly when the coated alloy was exposed to the electrolyte for 5 days. The corrosion resistance of the coatings, unmodified and modified with CeO{sub 2} or Zr

  7. Morphology and Mechanism of Benign Inhibitors

    Science.gov (United States)

    2009-01-01

    Al2024 -T3 ingot was purchased from McMaster-Carr Supply Company (Aurora, OH. USA). The composition of AA2024 is 3.8 to 4.9 Cu, 1.2 to 1.8 Mg, 0.3...crystal (111) wafers with a thickness of 1 mm and diameter of 5 in were used for AA2024 e-beam evaporation. The Al2024 -T3 ingot was purchased from

  8. Embedded reference electrodes for corrosion potential monitoring, electrochemical characterization, and controlled-potential cathodic protection

    Science.gov (United States)

    Merten, Bobbi Jo Elizabeth

    A thin wire Ag/AgCl reference electrode was prepared using 50 mum Ag wire in dilute FeCl3. The wire was embedded beneath the polyurethane topcoat of two sacrificial coating systems to monitor their corrosion potential. This is the first report of a reference electrode embedded between organic coating layers to monitor substrate health. The embedded reference electrode (ERE) successfully monitored the corrosion potential of Mg primer on AA 2024-T3 for 800 days of constant immersion in dilute Harrison's solution. Zn primer on steel had low accuracy in comparison. This is in part due to short circuiting by Zn oxidation products, which are much more conductive than Mg corrosion products. Data interpretation was improved through statistical analysis. On average, ERE corrosion potentials are 0.1 to 0.2 V and 0.2 to 0.3 V more positive than a saturated calomel electrode (SCE) in solution for AA 2024-T3 and steel coating systems, respectively. Further research may confirm that ERE obtains corrosion potential information not possible by an exterior, conventional reference electrode. The ERE is stable under polarization. AA 2024-T3 was polarized to -0.95 V vs ERE to emulate controlled potential cathodic protection (CPCP) applications. Polarizations of -0.75 V vs ERE are recommended for future experiments to minimize cathodic delamination. The ERE was utilized to analyze coating mixtures of lithium carbonate, magnesium nitrate, and Mg metal on AA2024-T3. Corrosion potential, low frequency impedance by electrochemical impedance spectroscopy (EIS), and noise resistance by electrochemical noise method (ENM) were reported. Coating performance ranking is consistent with standard electrochemical characterization and visual analyses. The results suggest anti-corrosion resistance superior to a standard Mg primer following 1600 hours of B117 salt spray. Both lithium carbonate and magnesium nitrate are necessary to achieve corrosion protection. Unique corrosion protective coatings for

  9. Olaniyi, AA

    African Journals Online (AJOL)

    Olaniyi, AA. Vol 14 (2009) - Articles Phytochemical and Anti-sickling Activities of Terminalia catappa Linn. Abstract PDF. ISSN: 1118-1028. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact ...

  10. Adejumo, AA

    African Journals Online (AJOL)

    Adejumo, AA. Vol 6, No 2 (2014) - Articles Assessment of Tourists Flow and Revenue Generation in Kainji Lake National Park, Nigeria Abstract PDF. ISSN: 2141-1778. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and ...

  11. Wornyo, AA

    African Journals Online (AJOL)

    Wornyo, AA. Vol 2, No 1 (2012) - Articles Addressing the Difficulties of Learners in the Reading Class Abstract. ISSN: 2026-6081. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL ...

  12. Abia, AA

    African Journals Online (AJOL)

    Abia, AA. Vol 4, No 6 (2010) - Articles Studies on the kinetics and intraparticle diffusivities of BOD, colour and TSS reduction from palm oil mill effluent (POME) using boiler fly ash. Abstract PDF. ISSN: 1996-0786. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  13. The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

    Energy Technology Data Exchange (ETDEWEB)

    Kubota, Akira [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Bainy, Afonso C.D. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Departamento de Bioquímica, CCB, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Woodin, Bruce R.; Goldstone, Jared V. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States)

    2013-10-01

    The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

  14. Investigations in situ des mécanismes de corrosion élémentaires durant le traitement de surface des alliages Al-Cu et Al-Cu-Li

    OpenAIRE

    Gharbi, Oumaïma

    2016-01-01

    This PhD thesis focused on the study of aluminum alloys, particularly the AA2024-T3 and AA2050-T3. The Al-Cu-Mg based alloy (AA2024-T3) are used for decades in the field of aerospace for its lightness and excellent mechanical properties are progressively replaced by and Al-Cu-Li (AA2050-T3) alloys. Nevertheless, they exhibit a highly heterogeneous microstructure, making them sensitive to corrosion. Several surface treatments formulations, such as coatings, have been developed, with the aim of...

  15. (Anogeissus Leiocarpus) Timber *BELLO, AA; JIMOH, AA

    African Journals Online (AJOL)

    PROF HORSFALL

    and Phytochemistry, p. 107. Jimoh, AA (1990). Fan palm as a Reinforcement in. Concrete Elements. M.Eng. Thesis, Department of Civil Engineering, University of Ilorin, Ilorin,. Nigeria. Jimoh, AA (2005). Ultimate Strength Design of. Axially Loaded Ayin (Anogeissus leiocarpus). Timber Columns. Journal of Applied Science ...

  16. Structures of aminoacylase 3 in complex with acetylated substrates

    Science.gov (United States)

    Hsieh, Jennifer M.; Tsirulnikov, Kirill; Sawaya, Michael R.; Magilnick, Nathaniel; Abuladze, Natalia; Kurtz, Ira; Abramson, Jeff; Pushkin, Alexander

    2010-01-01

    Trichloroethylene (TCE) is one of the most widespread environmental contaminants, which is metabolized to N-acetyl-S-1,2-dichlorovinyl-l-cysteine (NA-DCVC) before being excreted in the urine. Alternatively, NA-DCVC can be deacetylated by aminoacylase 3 (AA3), an enzyme that is highly expressed in the kidney, liver, and brain. NA-DCVC deacetylation initiates the transformation into toxic products that ultimately causes acute renal failure. AA3 inhibition is therefore a target of interest to prevent TCE induced nephrotoxicity. Here we report the crystal structure of recombinant mouse AA3 (mAA3) in the presence of its acetate byproduct and two substrates: Nα-acetyl-l-tyrosine and NA-DCVC. These structures, in conjunction with biochemical data, indicated that AA3 mediates substrate specificity through van der Waals interactions providing a dynamic interaction interface, which facilitates a diverse range of substrates. PMID:20921362

  17. Aa Ah Nak

    Science.gov (United States)

    Tha, Na Gya; Wus, Thay

    2017-01-01

    In this article, Aa Ah Nak, the authors' methodology presents not only various reflections but also diverse contradictions about the Aa Nii language as well as language revitalization. This article explores language foundation and how the Aa Nii language revitalization is inextricably linked to the genocide and resulting historic trauma pervasive…

  18. Antiproton Accumulator (AA)

    CERN Multimedia

    Photographic Service

    1980-01-01

    The AA in its final stage of construction, before it disappeared from view under concrete shielding. Antiprotons were first injected, stochastically cooled and accumulated in July 1980. From 1981 on, the AA provided antiprotons for collisions with protons, first in the ISR, then in the SPS Collider. From 1983 on, it also sent antiprotons, via the PS, to the Low-Energy Antiproton Ring (LEAR). The AA was dismantled in 1997 and shipped to Japan.

  19. AA under construction

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The AA at an early stage of construction, in the newly built AA-Hall. Cable-trays already outline the shape of the accumulator ring. To the right are huge cable-drums for the pulse-forming-network (PFN) of the injection kicker. Seeing this picture, can one imagine that only 8 months later beams were circulating in the completed accumulator ring ?

  20. AA magnet measurement team

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    Quickly improvised measurement equipment for the AA (Antiproton Accumulator) was all the tight schedule permitted, but the high motivation of the team made up for the lack of convenience. From left to right: Roy Billinge (Joint AA Project Leader, the other one was Simon van der Meer); Bruno Autin, Brian Pincott, Colin Johnson.

  1. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec

  2. Offshore Substrate

    Data.gov (United States)

    California Department of Resources — This shapefile displays the distribution of substrate types from Pt. Arena to Pt. Sal in central/northern California. Originally this data consisted of seven paper...

  3. Geomagnetic aa Indices

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa indices are the continuation of the series beginning in the year 1868. A full description of these indices is given in the International...

  4. AL SAHLI, AA; OKOLI, JU

    African Journals Online (AJOL)

    ADOWIE PERE

    bioline.org.br/ja. The Use of Soil Palynomorphs in Forensics. *. 1. ABDULRAHAMAN, AA;. 2. AL SAHLI, AA;. 1. OKOLI, JU. 1Applied Plant Anatomy and Wood Technology Laboratory, Department of Plant Biology, University of Ilorin, Ilorin, Nigeria.

  5. Electrochemical Evaluation of Corrosion Inhibiting Layers Formed in a Defect from Lithium-Leaching Organic Coatings

    NARCIS (Netherlands)

    Visser, P.; Meeusen, M.; Gonzalez Garcia, Y.; Terryn, H.A.; Mol, J.M.C.

    2017-01-01

    This work presents the electrochemical evaluation of protective layers generated in a coating defect from lithium-leaching organic coatings on AA2024-T3 aluminum alloys as a function of neutral salt spray exposure time. Electrochemical impedance spectroscopy was used to study the electrochemical

  6. The Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    Section 06 - 08*) of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A vacuum-tank, two bending magnets (BST06 and BST07 in blue) with a quadrupole (QDN07, in red) in between, another vacuum-tank, a wide quadrupole (QFW08) and a further tank . The tanks are covered with heating tape for bake-out. The tank left of BST06 contained the stack core pickup for stochastic cooling (see 7906193, 7906190, 8005051), the two other tanks served mainly as vacuum chambers in the region where the beam was large. Peter Zettwoch works on BST06. *) see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984)

  7. AA, bending magnet, BLG

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The very particular lattice of the AA required 2 types of dipole (bending magnets; BLG, long and narrow; BST, short and wide). The BLG had a steel length of 4.70 m, a good field width of 0.24 m, and a weight of about 70 t. Jean-Claude Brunet inspects the lower half of a BLG. For the BST magnets see 7811105 and 8006036.

  8. The Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    A section of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A large vacuum-tank, a quadrupole (QDN09*), a bending magnet (BST08), another vacuum-tank, a wide quadrupole (QFW08) and (in the background) a further bending magnet (BST08). The tanks are covered with heating tape for bake-out. The tank left of QDN09 contained the kickers for stochastic pre-cooling (see 790621, 8002234, 8002637X), the other one served mainly as vacuum chamber in the region where the beam was large. Peter Zettwoch works on QFW08. * see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984) See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  9. Power electronics substrate for direct substrate cooling

    Science.gov (United States)

    Le, Khiet [Mission Viejo, CA; Ward, Terence G [Redondo Beach, CA; Mann, Brooks S [Redondo Beach, CA; Yankoski, Edward P [Corona, CA; Smith, Gregory S [Woodland Hills, CA

    2012-05-01

    Systems and apparatus are provided for power electronics substrates adapted for direct substrate cooling. A power electronics substrate comprises a first surface configured to have electrical circuitry disposed thereon, a second surface, and a plurality of physical features on the second surface. The physical features are configured to promote a turbulent boundary layer in a coolant impinged upon the second surface.

  10. AAS 227: Day 2

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new

  11. AAS 227: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto

  12. AAS 227: Day 3

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over

  13. AAS 228: Day 4

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note: Lastweek we were at the 228th AAS Meeting in San Diego, CA. Here is a final post aboutselectedevents on the last day of the meeting, written by authors fromastrobites.com, a grad-student collaborative project with which we recently announced a new partnership! Starting in July,keep an eye out for astrobites postsat AAS Nova in between Highlights(i.e., on Tuesdays and Thursdays).Were excited to be working together to bring you more recent astronomy research from AAS journals!Extrasolar Planets: Detection (by Leonardo dos Santos)Thursdays first session on exoplanets was about detecting these distant worlds, and the opening talk was given by Robert Siverd (Las Cumbres Observatory). He describes the NRES, a network of spectrographs that will look for exoplanets using the radial velocity method. One of the coolest aspects of this instrument is that it will feature an on the fly scheduling system that will perform observations as efficiently as possible. The spectrograph is still being tested, but a unit will be deployed at CTIO later this year.@lcogt contracted by @NASA_TESS for follow up of their candidates. #aas228 Jessie Christiansen (@aussiastronomer) June 16, 2016Measuring the depths of transits and eclipses in Spitzer has been problematic in the past, since the Spitzer instrument IRAC (InfraRed Array Camera) has a non-uniform response in its detectors pixels. But, as reported by James Ingalls (Spitzer Science Center, Caltech), observers are circumventing this issue by using what they call the staring mode (avoiding large pointing jumps) and an algorithm to pick sweet spot pixels. Moreover, the results from the IRAC Data Challenge are helping to better understand its behavior. Giuseppe Morello (University College London), on the other hand, explained how his research group gets rid of instrumental effects from IRAC using machine learning. This method removes systematics from exoplanet transit data no matter if the noise source is from an instrument or

  14. FIB-SEM investigation of trapped intermetallic particles in anodic oxide films on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.

    2011-01-01

    Purpose - The purpose of this investigation is to understand the structure of trapped intermetallics particles and localized composition changes in the anodized anodic oxide film on AA1050 aluminium substrates. Design/methodology/approach - The morphology and composition of Fe-containing intermet...

  15. AAS 227: Day 4

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt

  16. Identification of AaCASPS7, an effector caspase in Aedes albopictus.

    Science.gov (United States)

    Feng, Lingyan; Liu, Hao; Li, Xiaomei; Qiao, Jialu; Wang, Shengya; Guo, Deyin; Liu, Qingzhen

    2016-11-15

    Aedes albopictus mosquito is a vector of various arboviruses and is becoming a significant threat to public health due to its rapid global expansion. Several reports suggest that apoptosis could be a factor limiting arbovirus infection in mosquitoes. Thus, it is significant to identify apoptosis pathway and study the correlation between apoptosis and virus infection in mosquitoes. Apoptosis is a type of programmed cell death that plays a vital role in immunity, development, and tissue homeostasis. Caspases are a family of conserved proteases playing important roles in apoptosis. In this study, we identified Aedes albopictus AaCASPS7, a caspase shared high identity with dipteran insect drICE orthologs. Phylogenetic analysis showed the closest relative of AaCASPS7 was Aedes aegypti AeCASPS7. AaCASPS7 displayed several features that were typical of an effector caspase and showed significant activity to effector caspase substrates. Aacasps7 transcripts were expressed ubiquitously in developmental and adult stages in Aedes albopictus mosquitoes. Transient expression of AaCASPS7 induced caspase-dependent apoptosis in C6/36 cells. Taken together the above data, this study identified a novel caspase, AaCASPS7, which might function as an apoptotic caspase. Further study the function of AaCASPS7 would facilitate better understanding the apoptotic mechanism in Aedes albopictus mosquito. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. A.A., constructivism, and reflecting teams.

    Science.gov (United States)

    Nevels, B

    1997-12-01

    Numerous studies and clinical anecdotes reveal a relationship between attendance at A.A. meetings and/or degree of involvement in A.A. and maintenance of sobriety. Hypotheses as to how A.A. and/or the A.A. meeting is helpful to its members have ranged from a focus on factors common to all therapy groups, to aspects of A.A. "treatment" which are behavioral in nature. Presented here is another way of understanding A.A.'s effectiveness within the frame of more recent, constructivistic approaches to family therapy. In particular, the A.A. topic meeting is compared to the reflecting team concept of Tom Anderson.

  18. Laboratory Astrophysics Division of the AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-01-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  19. Effectiveness of high speed instrument and air abrasion on different dental substrates.

    Science.gov (United States)

    Antunes, Lívia Azeredo Alves; Pedro, Rafael Lima; Vieira, Aurea Simone Barrôso; Maia, Lucianne Cople

    2008-01-01

    The aim of this study was to compare the effectiveness of high speed (HS) and air abrasion (AA) instruments on groups of teeth (deciduous, permanent, bovine), in terms of preparation time, topography and presence of smear layer. Each group consisted of 5 teeth that had their buccal/lingual surfaces prepared by using either HS or AA. All procedures were standardized and timed. The teeth were then sectioned and prepared for evaluation of both the topography and the presence of smear layer by scanning electron microscopy. As regards preparation time, HS yielded preparations 1.5 times quicker than AA did on the three types of dental substrates (Wilcoxon test, p dental substrate, particularly in deciduous teeth (Mann-Whitney test with Bonferoni's correction, p 0.05) in all substrates, but with different formations. In conclusion, the HS instrument was found to be more rapid than the AA. No difference was found between the three dental substrates as regards both the topography and the presence of smear layer. The differences found in the present study were only in relation to the effects of each instrument used.

  20. A Novel Colletotrichum graminicola Raffinose Oxidase in the AA5 Family.

    Science.gov (United States)

    Andberg, Martina; Mollerup, Filip; Parikka, Kirsti; Koutaniemi, Sanna; Boer, Harry; Juvonen, Minna; Master, Emma; Tenkanen, Maija; Kruus, Kristiina

    2017-10-15

    We describe here the identification and characterization of a copper radical oxidase from auxiliary activities family 5 (AA5_2) that was distinguished by showing preferential activity toward raffinose. Despite the biotechnological potential of carbohydrate oxidases from family AA5, very few members have been characterized. The gene encoding raffinose oxidase from Colletotrichum graminicola (CgRaOx; EC 1.1.3.-) was identified utilizing a bioinformatics approach based on the known modular structure of a characterized AA5_2 galactose oxidase. CgRaOx was expressed in Pichia pastoris, and the purified enzyme displayed the highest activity on the trisaccharide raffinose, whereas the activity on the disaccharide melibiose was three times lower and more than ten times lower activity was detected on d-galactose at a 300 mM substrate concentration. Thus, the substrate preference of CgRaOx was distinguished clearly from the substrate preferences of the known galactose oxidases. The site of oxidation for raffinose was studied by 1H nuclear magnetic resonance and mass spectrometry, and we confirmed that the hydroxyl group at the C-6 position was oxidized to an aldehyde and that in addition uronic acid was produced as a side product. A new electrospray ionization mass spectrometry method for the identification of C-6 oxidized products was developed, and the formation mechanism of the uronic acid was studied. CgRaOx presented a novel activity pattern in the AA5 family.IMPORTANCE Currently, there are only a few characterized members of the CAZy AA5 protein family. These enzymes are interesting from an application point of view because of their ability to utilize the cheap and abundant oxidant O2 without the requirement of complex cofactors such as FAD or NAD(P). Here, we present the identification and characterization of a novel AA5 member from Colletotrichum graminicola As discussed in the present study, the bioinformatics approach using the modular structure of galactose oxidase

  1. Transmission of systemic AA amyloidosis in animals.

    Science.gov (United States)

    Murakami, T; Ishiguro, N; Higuchi, K

    2014-03-01

    Amyloidoses are a group of protein-misfolding disorders that are characterized by the deposition of amyloid fibrils in organs and/or tissues. In reactive amyloid A (AA) amyloidosis, serum AA (SAA) protein forms deposits in mice, domestic and wild animals, and humans that experience chronic inflammation. AA amyloid fibrils are abnormal β-sheet-rich forms of the serum precursor SAA, with conformational changes that promote fibril formation. Extracellular deposition of amyloid fibrils causes disease in affected animals. Recent findings suggest that AA amyloidosis could be transmissible. Similar to the pathogenesis of transmissible prion diseases, amyloid fibrils induce a seeding-nucleation process that may lead to development of AA amyloidosis. We review studies of possible transmission in bovine, avian, mouse, and cheetah AA amyloidosis.

  2. Transmission of Systemic AA Amyloidosis in Animals

    OpenAIRE

    Murakami, T.; Ishiguro, N; Higuchi, K.

    2014-01-01

    Amyloidoses are a group of protein-misfolding disorders that are characterized by the deposition of amyloid fibrils in organs and/or tissues. In reactive amyloid A (AA) amyloidosis, serum AA (SAA) protein forms deposits in mice, domestic and wild animals, and humans that experience chronic inflammation. AA amyloid fibrils are abnormal beta-sheet-rich forms of the serum precursor SAA, with conformational changes that promote fibril formation. Extracellular deposition of amyloid fibrils causes ...

  3. Bioconversion of novel substrate Saccharum spontaneum, a weedy material, into ethanol by Pichia stipitis NCIM3498.

    Science.gov (United States)

    Chandel, Anuj K; Singh, Om V; Rao, L Venkateswar; Chandrasekhar, G; Narasu, M Lakshmi

    2011-01-01

    Rising fuel prices and environmental issues have paved the way for the exploration of cellulosic ethanol. However, challenges involving substrate hydrolysis and cost-effectiveness still limit the efficient bioconversion and utilization of cellulosic ethanol. We aimed to evaluate a cheaper and abundantly available wild sugarcane variety, Saccharum spontaneum, as the raw substrate for bioconversion of ethanol by Pichia stipitis NCIM3498. Three different strategies for substrate hydrolysis using acid (dilute sulfuric acid) and alkali (dilute sodium hydroxide) and aqueous ammonia (AA) treatment followed by enzymatic hydrolysis were studied. A maximum of 631.5±3.25 mg/g sugars with 89.38% hydrolytic efficiency (HE) could be achieved after enzymatic hydrolysis of AA-pretreated S. spontaneum. All the substrate hydrolysates were evaluated for ethanol conversion in batches by P. stipitis. The microbial fermentation of released sugars into ethanol showed (g/g) 0.36±0.011, 0.384±0.022, 0.391±0.02, and 0.40±0.01 yield from detoxified acid hydrolysate and acid-, NaOH- and AA-pretreated substrate S. spontaneum enzymatic hydrolysates, respectively. Copyright © 2010 Elsevier Ltd. All rights reserved.

  4. Effectiveness of high speed instrument and air abrasion on different dental substrates

    Directory of Open Access Journals (Sweden)

    Lívia Azeredo Alves Antunes

    2008-09-01

    Full Text Available The aim of this study was to compare the effectiveness of high speed (HS and air abrasion (AA instruments on groups of teeth (deciduous, permanent, bovine, in terms of preparation time, topography and presence of smear layer. Each group consisted of 5 teeth that had their buccal/lingual surfaces prepared by using either HS or AA. All procedures were standardized and timed. The teeth were then sectioned and prepared for evaluation of both the topography and the presence of smear layer by scanning electron microscopy. As regards preparation time, HS yielded preparations 1.5 times quicker than AA did on the three types of dental substrates (Wilcoxon test, p 0.05 in all substrates, but with different formations. In conclusion, the HS instrument was found to be more rapid than the AA. No difference was found between the three dental substrates as regards both the topography and the presence of smear layer. The differences found in the present study were only in relation to the effects of each instrument used.

  5. Lamination sheet of AA BST magnet

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.

  6. AA, closed orbit observation pickup

    CERN Multimedia

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. See also 8001372, 8010042, 8010045

  7. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles QFW, at maximum dispersion. See also 8001372, 8001383, 8010045

  8. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. Werner Sax contemplates his achievement. See also 8001383, 8010042, 8010045.

  9. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles, QFW, at maximum dispersion. See also 8001372,8001383, 8010042

  10. Site Directed Nucleation and Growth of Ceramic Films on Metallic Surfaces

    Science.gov (United States)

    2009-04-30

    surfaces such as AA2024-T3, AA7075-T6, Ti6Al4V and 316L alloys. - The bioceramic material has been determined to include nanoscale folia, prismatic...formation by observing folia and prismatic development on different metal alloy surfaces ( Ti6Al4V , 7075-T6 aluminum, and 316L stainless steel...alloy discs and foils for implantation Polished (1 m finish) titanium ( Ti6Al4V -grade 5) and aluminum (AA7075-T6) and 316L stainless steel discs (Ti

  11. AAS 228: Day 3 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our

  12. Multiple alternative substrate kinetics.

    Science.gov (United States)

    Anderson, Vernon E

    2015-11-01

    The specificity of enzymes for their respective substrates has been a focal point of enzyme kinetics since the initial characterization of metabolic chemistry. Various processes to quantify an enzyme's specificity using kinetics have been utilized over the decades. Fersht's definition of the ratio kcat/Km for two different substrates as the "specificity constant" (ref [7]), based on the premise that the important specificity existed when the substrates were competing in the same reaction, has become a consensus standard for enzymes obeying Michaelis-Menten kinetics. The expansion of the theory for the determination of the relative specificity constants for a very large number of competing substrates, e.g. those present in a combinatorial library, in a single reaction mixture has been developed in this contribution. The ratio of kcat/Km for isotopologs has also become a standard in mechanistic enzymology where kinetic isotope effects have been measured by the development of internal competition experiments with extreme precision. This contribution extends the theory of kinetic isotope effects to internal competition between three isotopologs present at non-tracer concentrations in the same reaction mix. This article is part of a special issue titled: Enzyme Transition States from Theory and Experiment. Published by Elsevier B.V.

  13. Robust plasmonic substrates

    DEFF Research Database (Denmark)

    Kostiučenko, Oksana; Fiutowski, Jacek; Tamulevicius, Tomas

    2014-01-01

    Robustness is a key issue for the applications of plasmonic substrates such as tip-enhanced Raman spectroscopy, surface-enhanced spectroscopies, enhanced optical biosensing, optical and optoelectronic plasmonic nanosensors and others. A novel approach for the fabrication of robust plasmonic...

  14. Effect of supplementation of arachidonic acid (AA) or a combination of AA plus docosahexaenoic acid on breastmilk fatty acid composition

    NARCIS (Netherlands)

    Smit, EN; Koopmann, M; Boersma, ER; Muskiet, FAJ

    We investigated whether supplementation with arachidonic acid (20:4 omega 6; AA), ora combination of AA and docosahexaenoic acid (22:6 omega 3; DHA) would affect human milk polyunsaturated fatty acid (PUFA) composition. Ten women were daily supplemented with 300 mg AA, eight with 300 mg AA, 110 mg

  15. AAS 228: Day 1 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the

  16. First circulating beam in the AA

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.56 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are too numerous to name them all, but the 3 most prominent ones are at the centre (left to right): Roy Billinge (Joint AA Project Leader, with his hand on the control box), Eifionydd Jones (white shirt), Simon van der Meer (spiritus rector and Joint AA Project Leader). The first antiprotons were injected, made to circulate and cooled soon after, on 14 July 1980.

  17. Obesity is a significant susceptibility factor for idiopathic AA amyloidosis.

    Science.gov (United States)

    Blank, Norbert; Hegenbart, Ute; Dietrich, Sascha; Brune, Maik; Beimler, Jörg; Röcken, Christoph; Müller-Tidow, Carsten; Lorenz, Hanns-Martin; Schönland, Stefan O

    2018-01-24

    To investigate obesity as susceptibility factor in patients with idiopathic AA amyloidosis. Clinical, biochemical and genetic data were obtained from 146 patients with AA amyloidosis. Control groups comprised 40 patients with long-standing inflammatory diseases without AA amyloidosis and 56 controls without any inflammatory disease. Patients with AA amyloidosis had either familial Mediterranean fever (FMF) or long-standing rheumatic diseases as underlying inflammatory disease (n = 111, median age 46 years). However, in a significant proportion of patients with AA amyloidosis no primary disease was identified (idiopathic AA; n = 37, median age 60 years). Patients with idiopathic AA amyloidosis were more obese and older than patients with AA amyloidosis secondary to FMF or rheumatic diseases. Serum leptin levels correlated with the body mass index (BMI) in all types of AA amyloidosis. Elevated leptin levels of more than 30 µg/l were detected in 18% of FMF/rheumatic + AA amyloidosis and in 40% of patients with idiopathic AA amyloidosis (p = .018). Finally, the SAA1 polymorphism was confirmed as a susceptibility factor for AA amyloidosis irrespective of the type of the disease. Obesity, age and the SAA1 polymorphism are susceptibility factors for idiopathic AA amyloidosis. Recent advances in treatment of FMF and rheumatic disorders will decrease the incidence of AA amyloidosis due to these diseases. Idiopathic AA, however, might be an emerging problem in the ageing and increasingly obese population.

  18. Electrochemical investigation of powder coatings and their application to magnesium-rich primers for corrosion protection

    Science.gov (United States)

    Orgon, Casey Roy

    Corrosion is the decomposition of metal and metal alloys which threatens the integrity of man-made structures. One of the more efficient methods of delaying the corrosion process in metals is by coatings. In this work, the durability of two polyester powder coatings were investigated for corrosion protection of AA-2024-T3. Polyester powder coatings crosslinked by either triglycidyl isocyanurate (TGIC) or beta-hydroxyalkyl amide (HAA) compounds were prepared and investigated for barrier protection of metal substrates by electrochemical impedance spectroscopy (EIS). Polyester-TGIC coatings were found to provide better long-term protection, which can be attributed to the increased mechanical strength and higher concentration of crosslinking in the coating films. Additionally, the polyester powder coatings, along with a fusion bonded epoxy (FBE) were investigated for their compatibility as a topcoat for magnesium-rich primers (MgRP). Under proper application conditions, powder topcoats were successfully applied to cured MgRP while corrosion protection mechanisms of each system were maintained.

  19. Poly(2,5-bis(N-Methyl-N-HexylaminoPhenylene Vinylene (BAM-PPV as Pretreatment Coating for Aerospace Applications: Laboratory and Field Studies

    Directory of Open Access Journals (Sweden)

    Peter Zarras

    2014-12-01

    Full Text Available In this study, an electroactive polymer (EAP, poly(2,5-bis(N-methyl-N-hexylaminophenylene vinylene (BAM-PPV was investigated as a potential alternative surface pretreatment for hexavalent chromium (Cr(VI-based aerospace coatings. BAM-PPV was tested as a pretreatment coating on an aerospace aluminum alloy (AA2024-T3 substrate in combination with a non-Cr(VI epoxy primer and a polyurethane Advanced Performance Coating (APC topcoat. This testing was undertaken to determine BAM-PPV’s adhesion, corrosion-inhibition, compatibility and survivability in laboratory testing and during outdoor field-testing. BAM-PPV showed excellent adhesion and acceptable corrosion performance in laboratory testing. The BAM-PPV aerospace coating system (BAM-PPV, non-Cr(VI epoxy primer and polyurethane APC topcoat was field tested for one year on the rear hatch door of the United States Air Force C-5 cargo plane. After one year of field testing there was no evidence of delamination or corrosion of the BAM-PPV aerospace coating system.

  20. A Nacreous Self-Assembled Nanolaminate for Corrosion Resistance on 2024-Al Alloy

    OpenAIRE

    Gordon, Matthew

    2001-01-01

    Nanometer thick layers of clay and polymer were formed on mica, silicon, and aluminum 2024-T3 alloy using alternating solutions of positively and negatively charged polymer and clay, respectively. Atomic force microscopy was used to observe the morphology of the composite films on mica and silicon. It was found that solution concentrations of clay above 0.02 weight percent lead to the uncontrolled deposition of clay platelets on the substrateâ s surface. By using solution concentrations o...

  1. checkCIF/PLATON report Datablock: aa

    Indian Academy of Sciences (India)

    THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW PROCEDURE. FOR PUBLICATION, IT SHOULD NOT REPLACE THE EXPERTISE OF AN EXPERIENCED. CRYSTALLOGRAPHIC REFEREE. No syntax errors found. CIF dictionary Interpreting this report. Datablock: aa. Bond precision:.

  2. Magnetic horn of the Antiproton Accumulator (AA)

    CERN Multimedia

    Photographic Service

    1988-01-01

    In the 1960s, the invention of this "current sheet lens" has helped to greatly improve the flux of neutrino beams. It was used again at the AA, collecting antiprotons from the production target at angles too large to fit into the acceptance of the AA. It was machined from aluminium to a thickness of 1.4 mm and pulsed at 400 kA for 15 microseconds (half-sine).

  3. Detection of AA76, a Common Form of Amyloid A Protein, as a Way of Diagnosing AA Amyloidosis.

    Science.gov (United States)

    Sato, Junji; Okuda, Yasuaki; Kuroda, Takeshi; Yamada, Toshiyuki

    2016-01-01

    Reactive amyloid deposits consist of amyloid A (AA) proteins, the degradation products of serum amyloid A (SAA). Since the most common species of AA is the amino terminal portion produced by cleavage between residues 76 and 77 of SAA (AA76), the presence of AA76 in tissues could be a consequence of AA amyloid deposition. This study assessed the diagnostic significance of the detection of AA76 for AA amyloidosis using two different approaches. Biopsy specimens (n=130 from 54 subjects) from gastroduodenal mucosa or abdominal fat (n=9 from 9 subjects) of patients who had already been diagnosed with or were suspected of having AA amyloidosis were used. Fixed mucosal sections were subjected to immunohistochemistry using a newly developed antibody recognizing the carboxyl terminal end of AA76 (anti-AA76). The non-fixed materials from gastroduodenal mucosa or abdominal fat were subjected to immunoblotting for detection of the size of AA76. Among the gastroduodenal specimens (n=115) from already diagnosed patients, the positive rates of Congo red staining, immunohistochemistry using anti-AA76, and immunoblotting were 68.4%, 73.0%, and 92.2%, respectively. The anti-AA76 did not stain the supposed SAA in the blood or leakage, which was stained by anti-SAA antibody. AA76 was not detected either by immunohistochemistry or by immunoblot in the materials from patients in whom AA amyloidosis had been ruled out. In the abdominal fat, the immunoblot detected AA76 in 8 materials from 8 already diagnosed patients and did not in 1 patient whose gastroduodenal mucosa was negative. In conclusion, the detection of AA76 may alter the ability to diagnose AA amyloidosis. In immunohistochemistry for fixed specimens, the new anti-AA76 antibody can improve the specificity. Immunoblot for non-fixed materials, which can considerably improve the sensitivity, should be beneficial for small materials like abdominal fat. © 2016 by the Association of Clinical Scientists, Inc.

  4. Chromium-free conversion coatings based on inorganic salts (Zr/Ti/Mn/Mo) for aluminum alloys used in aircraft applications

    Energy Technology Data Exchange (ETDEWEB)

    Santa Coloma, P., E-mail: patricia.santacoloma@tecnalia.com [TECNALIA Research & Innovation, Parque Tecnológico de San Sebastián, Mikeletegi Pasealekua 2, E-20009 Donostia-San Sebastián, Gipuzkoa (Spain); Izagirre, U.; Belaustegi, Y.; Jorcin, J.B.; Cano, F.J. [TECNALIA Research & Innovation, Parque Tecnológico de San Sebastián, Mikeletegi Pasealekua 2, E-20009 Donostia-San Sebastián, Gipuzkoa (Spain); Lapeña, N. [Boeing Research & Technology Europe, S.L.U., Avenida Sur del Aeropuerto de Barajas 38, Building 4 – 3rd Floor, E-28042 Madrid (Spain)

    2015-08-01

    Highlights: • Chromium-free conversion coatings for corrosion protection of aluminum alloys. • Salt spray and potentiodynamic sweep tests to study the corrosion behavior. • Local deposits on Cu-rich intermetallic particles enhanced corrosion resistance. • Surface characterization to relate bath's composition and corrosion resistance. • Best corrosion protection with conversion baths without titanium salts. - Abstract: Novel chromium-free conversion coatings based on Zr/Ti/Mn/Mo compounds were developed at a pilot scale to improve the corrosion resistance of the AA2024-T3 and AA7075-T6 aluminum alloys for aircraft applications. The influence of the presence of Zr and Ti in the Zr/Ti/Mn/Mo conversion bath's formulation on the corrosion resistance of the coated alloys was investigated. The corrosion resistance provided by the conversion coatings was evaluated by salt spray exposure and potentiodynamic sweeps. Optical and scanning electron microscopy coupled with energy dispersive spectroscopy (SEM/EDS) and atomic force microscopy (AFM) operating in the Kelvin Probe mode (SKPFM) were used to provide microstructural information of the coated samples that achieved the best results in the corrosion tests. The salt spray test evidenced the higher corrosion resistance of the coated samples compared to the bare surfaces for both alloys. The potentiodynamic tests showed that the corrosion current density decreased for coated AA7075-T6 and AA2024-T3 alloys, which indicated an obvious improvement of the corrosion resistance with all the processes for both alloys. Although the corrosion resistance of the coated samples appeared to be higher for the alloy AA7075-T6 than for the alloy AA2024-T3, both alloys achieved the best corrosion protection with the coatings deposited from conversion bath formulations containing no titanium salts. The microscopy analysis on the coated AA7075-T6 samples revealed that a local deposition of Zr compounds and, possibly, an

  5. Nitrification in a zeoponic substrate

    Science.gov (United States)

    McGilloway, R. L.; Weaver, R. W.; Ming, D. W.; Gruener, J. E.

    2003-01-01

    Clinoptilolite is a zeolite mineral with high cation exchange capacity used in zeoponic substrates that have been proposed as a solid medium for growing plants or as a fertilizer material. The kinetics of nitrification has not been measured for NH4+ saturated zeoponic substrate. Experiments were conducted to evaluate the production of NO2- and NO3-, and nitrifier populations in zeoponic substrates. Small columns were filled with zeoponic substrate inoculated with a commercial inoculum or soil enrichment culture of nitrifying bacteria. In addition to column studies, a growth chamber study was conducted to evaluate the kinetics of nitrification in zeoponic substrates used to grow radishes (Raphanus sativus L.). The zeoponic substrate provided a readily available source of NH4+, and nitrifying bacteria were active in the substrate. Ammonium oxidation rates in column studies ranged from 5 to 10 micrograms N g-1 substrate h-1, and NO2- oxidation rates were 2 to 9.5 micrograms N g-1 substrate h-1. Rates determined from the growth chamber study were approximately 1.2 micrograms N g-1 substrate h-1. Quantities of NH4+ oxidized to NO2- and NO3- in inoculated zeoponic substrate were in excess of plant up-take. Acidification as a result of NH4+ oxidation resulted in a pH decline, and the zeoponic substrate showed limited buffering capacity.

  6. AAS 228: Day 3 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session 2015 Newton Lacy Pierce Prize Lecture: The Elephant in the Room: Effects of Distant, Massive Companions on Planetary System Architectures (by Leonardo dos Santos)The first session on Wednesday at 228th AAS Meeting was the Newton Lacy Pierce Prize Lecture by Heather Knutson (California Institute of Technology). This talk featured a broad range of research efforts on exoplanets, with the main focus on how we study the composition of their atmospheres, and how multi-body interactions carve the structure of the planetary systems we observe.One of her first points is the well-known idea that the Solar System is an oddball, compared to the exoplanet systems we have found so far: most of these systems contain hot Jupiters and mini-Neptunes at very close-in orbits around their host stars. Moreover, even when studying their transmission spectra, it is difficult to know the exact composition of their atmospheres.Knutson: it is difficult to constrain atmospheric composition of exoplanets (H-poor or H-rich+clouds?) #aas228pic.twitter.com/LdyN4o9RC7 astrobites (@astrobites) June 15, 2016The main proposal on how these systems formed is the migration scenario. In order to validate this idea, Dr. Knutson and her group The Friends of Hot Jupiters study systems with close-in gas giants and their frequency of binary companions, which are supposed to be the main culprits causing gas-giant migration. They found that approximately half of the observed systems have long-distance companions, providing strong validation of the migration scenario. Moreover, Dr. Knutson speculates that wide binaries have more

  7. Solid substrate fermentation

    Energy Technology Data Exchange (ETDEWEB)

    Tengerdy, R.P.

    1985-04-01

    Solid Substrate Fermentation (SSF) describes the microbiological tranformation of biological materials in their natural state, in contrast with liquid or submerged fermentations which are carried out in dilute solutions or slurries. The most important industrial microorganisms used in SSF are filamentous fungi and the critical factors in their growth are the control of the moisture level and the temperature. Traditionally, most SSFs are conducted in shallow trays (so that heat build up is avoided) and stacked in a moist chamber, however, the modern SSF should be able to mix large amounts of substrate for a uniform fermentation, maximum automization scale-up of the process, continuous operation and fermentation control and a promising new design is the Helical screw fermenter. At the present time SSF is used in the production of foods (e.g. mushrooms and oriental foods) in municipal, agricultural and industrial solid waste disposal and in the production of enzymes and speciality chemicals but it does not seem likely that it will replace prevalent liquid fermentation technologies. 29 references.

  8. AAS 228: Day 1 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session: From Space Archeology to Serving the World Today: A 20-year Journey from the Jungles of Guatemala to a Network of Satellite Remote Sensing Facilities Around the World(by Michael Zevin)In the conferences second plenary session, NASAs Daniel Irwin turned the eyes of the conference back to Earth by highlighting the huge impact that NASA missions play in protecting and developing our own planet.Daniel Irwin: using satellite imagery to detect differences in vegetation and find ancient Mayan cities. #aas228 pic.twitter.com/9LFPQdCHTM astrobites (@astrobites) June 13, 2016Irwin came to be involved in NASA through his work mapping Guatemalan jungles, where he would spend 22 days at a time exploring the treacherous jungles on foot armed with a 1st generation GPS, a compass, and a machete. A colleague introduced Irwin to the satellite imagery thathe was exploring, demonstratinghow these images are a strong complement to field work. The sharing of this satellite data with nearby villages helped to show the encroachment of agriculture and the necessity of connecting space to the village. Satellite imagery also played a role in archeological endeavors, uncovering dozens of Mayan cities that have been buried for over a millennia by vegetation, and it provided evidence that the fall of the Mayan civilization may have been due to massive deforestation that ledto drought.Glacial retreat in Chile imaged by ISERV.Irwin displayed the constellation of NASAs Earth-monitoring satellites that have played an integral role in conserving our planet and alerting the world of natural disasters. He also showed

  9. The AA disappearing under concrete shielding

    CERN Multimedia

    CERN PhotoLab

    1982-01-01

    When the AA started up in July 1980, the machine stood freely in its hall, providing visitors with a view through the large window in the AA Control Room. The target area, in which the high-intensity 26 GeV/c proton beam from the PS hit the production target, was heavily shielded, not only towards the outside but also towards the AA-Hall. However, electrons and pions emanating from the target with the same momentum as the antiprotons, but much more numerous, accompanied these through the injection line into the AA ring. The pions decayed with a half-time corresponding to approximately a revolution period (540 ns), whereas the electrons lost energy through synchrotron radiation and ended up on the vacuum chamber wall. Electrons and pions produced the dominant component of the radiation level in the hall and the control room. With operation times far exceeding original expectations, the AA had to be buried under concrete shielding in order to reduce the radiation level by an order of magnitude.

  10. Features of Men with Anabolic-Androgenic Steroid Dependence: A Comparison With Nondependent AAS Users and With AAS Nonusers

    Science.gov (United States)

    Kanayama, Gen; Hudson, James I.; Pope, Harrison G.

    2009-01-01

    Background Anabolic-androgenic steroid (AAS) dependence has been a recognized syndrome for some 20 years, but remains poorly understood. Methods We evaluated three groups of experienced male weightlifters: 1) men reporting no history of AAS use (N = 72); 2) nondependent AAS users reporting no history of AAS dependence (N = 42); and 3) men meeting adapted DSM-IV criteria for current or past AAS dependence (N = 20). We assessed demographic indices, lifetime history of psychiatric disorders by the Structured Clinical Interview for DSM-IV, variables related to AAS use, and results from drug tests of urine and hair. Results Nondependent AAS users showed no significant differences from AAS nonusers on any variable assessed. Dependent AAS users, however, differed substantially from both other groups on many measures. Notably, they reported a more frequent history of conduct disorder than nondependent AAS users (odds ratio [95% CI]: 8.0 [1.7, 38.0]) or AAS nonusers (13.1 [2.8, 60.4]) and a much higher lifetime prevalence of opioid abuse and dependence than either comparison group (odds ratios 6.3 [1.2, 34.5] and 18.6 [3.0, 116.8], respectively). Conclusions Men with AAS dependence, unlike nondependent AAS users or AAS nonusers, showed a distinctive pattern of comorbid psychopathology, overlapping with that of individuals with other forms of substance dependence. AAS dependence showed a particularly strong association with opioid dependence – an observation that recalls recent animal data suggesting similarities in AAS and opioid brain reward mechanisms. Individuals with AAS dependence and individuals with “classical” substance dependence may possibly harbor similar underlying biological and neuropsychological vulnerabilities. PMID:19339124

  11. Longitudinal study of experimental induction of AA amyloidosis in mice seeded with homologous and heterologous AA fibrils.

    Science.gov (United States)

    Muhammad, Naeem; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka

    2016-09-01

    To investigate pathogenesis and kinetics of experimentally induced murine AA amyloidosis seeded with homologous (murine) and heterologous (bovine) AA fibrils. Experimental AA amyloidosis was induced by administration of inflammatory stimulus and preformed AA fibrils to a total of 111 female C57/Black mice. In this longitudinal study, heterologous (bovine) as well as homologous (murine) AA fibrils were injected intraperitoneally to mice in various combinations. Re-stimulation was done at 120 or 300 days post first inoculation. To analyze the intensity of amyloid depositions in mice organs, immunohistochemical techniques and image J software were used. Assessment of cytokines level in sera was done using a Mouse Th1/Th2/Th17 Cytokine CBA Kit. Incidence and severity of AA amyloidosis were quite low in mice inoculated with heterologous bovine AA fibrils than homologous murine one. Homologous AA fibrils administration at first and second inoculation caused maximum amount of amyloid depositions and severe systemic form of amyloidosis. Increase in the level of pro-inflammatory cytokine IL-6 was observed after first inoculation, while second inoculation caused a further increase in the level of anti-inflammatory cytokine IL-10. AA amyloidosis can be induced by heterologous as well as homologous AA fibrils. Severity of AA amyloidosis induced with homologous AA fibrils is higher compared to heterologous AA fibrils.

  12. Flow Injection and Atomic Absorption Spectrometry (FI-AAS) -

    DEFF Research Database (Denmark)

    Hansen, Elo Harald

    1996-01-01

    absorption spectrometry (AAS). Initially with flame-AAS (fAAS) procedures, later for hydride generation (HG) techniques, and most recently in combination with electrothermal AAS (ETAAS). The common denominator for all these procedures is the inherently precise and strictly reproducible timing in FI from...... the point of sample injection/introduction to the point of detection. Hence, in FI-fAAS this feature allows not only to obtain improved repeatability but also improved accuracy, and because the wash to sample ratio is high it permits the handling of samples with elevated salt contents - which...... of (especially HG- forming) elements. In the words of the one of the authorities of AAS and foremost pioneers of FI-AAS - Professor Z. L. Fang, who is the author on two recently published monographs on this hyphenated technique - the impact of FI on AAS is "so dramatic" that it has brought "new vitality...

  13. 40 CFR Appendix A to Subpart Aa of... - Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA

    Science.gov (United States)

    2010-07-01

    ... (40 CFR Part 63, Subpart A) to Subpart AA A Appendix A to Subpart AA of Part 63 Protection of... Hazardous Air Pollutants From Phosphoric Acid Manufacturing Plants Pt. 63, Subpt. AA, App. A Appendix A to Subpart AA of Part 63—Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA 40 CFR...

  14. Rare earth conversion coatings grown on AA6061 aluminum alloys. Corrosion studies

    Energy Technology Data Exchange (ETDEWEB)

    Brachetti S, S. B. [Instituto Tecnologico de Ciudad Madero, Av. 1o. de Mayo y Sor Juana I. de la Cruz, Col. Los Mangos, 89440 Ciudad Madero, Tanaulipas (Mexico); Dominguez C, M. A.; Torres H, A. M.; Onofre B, E. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada - Altamira, Carretera Tampico-Puerto Industrial Altamira Km. 14.5, 89600 Altamira, Tamaulipas (Mexico); De la Cruz H, W., E-mail: mdominguezc@ipn.mx [UNAM, Centro de Nanociencias y Nanotecnologia, Apdo. Postal 2681, 22800 Ensenada, Baja California (Mexico)

    2014-07-01

    The present work is aimed to investigate the corrosion resistance of rare earth protective coatings deposited by spontaneous deposition on AA6061 aluminum alloy substrates. Coatings were deposited from water-based Ce(NO{sub 3}){sub 3} and La(NO{sub 3}){sub 3} solutions by varing parameters such as rare earth solution concentration, bath temperature and immersion time. The values of the Tafel slopes indicate that the cathodic process is favored by concentration polarization rather than activation polarization. Chemical and morphological characterizations of the surface before and after electrochemical evaluations were performed by X-ray photoelectron spectroscopy and scanning electron microscopy. (Author)

  15. 7 CFR 51.596 - U.S. Grade AA.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. Grade AA. 51.596 Section 51.596 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Consumer Standards for Celery Stalks Grades § 51.596 U.S. Grade AA. U.S. Grade AA shall consist of stalks...

  16. SERS substrate and a method of providing a SERS substrate

    DEFF Research Database (Denmark)

    2011-01-01

    Source: US2011116089A A substrate primarily for SERS determination, the substrate has a number of elongate elements with a density of at least 1x108 elongate elements per cm2 and having metal coated tips. When the elements may be made to lean toward each other, such as by providing a drop...

  17. Laser deposition of (Cu + Mo) alloying reinforcements on AA1200 substrate for corrosion improvement

    CSIR Research Space (South Africa)

    Popoola, API

    2011-10-01

    Full Text Available . Solidification of the laser induced melt pool led to the precipitation of different intermetallic compounds. Characterisation of the resultant microstructure was carried out by optical and scanning electron microscopes. X-ray diffraction and energy dispersive...

  18. AAS 228: Day 2 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.The Limits of Scientific Cosmology: Setting the Stage: Accepted Facts, and Testing Limitations in Theory and Data (by Gourav Khullar)With a stellar lineup of speakers to talk about current and future prospects of cosmology and its limits (or lack thereof), the first session kicked off with talks by Risa Wechsler, Joseph Silk, and Sean Carroll (his talk on Multiverses is described below, by Nathan Sanders). Risa set the stage with an elaborate description of the current accepted facts in the era of precision cosmology including the standard model of concordance cosmology, described by seven parameters and an accepted Lambda-CDM paradigm (with a cosmological constant and cold dark matter). The talk stressed on the fact that all these parameters are understood to a percent order precision, which is a remarkable deviation from the time in 1990s when according to Risa, Alan Guth never thought that any of these numbers could be measured precisely!Risa Wechsler describing our current constraints on what Dark Matter could constitute.Joseph Silk discussing limits on cosmological parameters.The CMB measurements, Big Bang Nucleosynthesis estimates and galaxy clustering statistics all contribute to locking down the description of our universe. She emphasized on the tensions between different probes to measure expansion rate H0 of the universe, and small scale predictions of cold dark matter simulations, but she is hopeful that these shall be resolved eventually. Joe Silk followed this up with his interpretation of trying to understand our place in the universe and placing limits on different parameters and

  19. Overview of the Antiproton Accumulator (AA)

    CERN Multimedia

    1982-01-01

    See photo 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  20. Overall view of AA in Bld. 193

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  1. AA, mating of BST magnet halves

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

  2. Overall view of AA (Bld 193)

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  3. AA, sandwich line with magnetic horn

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Continuation from 8010293: Finally, the sandwich line with the horn is placed on the ground, for the horn to be inspected and, if needed, exchanged for a new one. The whole procedure was trained with several members of the AA team, for quick and safe handling, and to share the radiation dose amongst them.

  4. Lovastatin inhibits formation of AA amyloid.

    NARCIS (Netherlands)

    Hilst, J.C.H. van der; Kluve-Beckerman, B.; Bodar, E.J.; Meer, J.W.M. van der; Drenth, J.P.H.; Simon, A.

    2008-01-01

    Amyloid A (AA) amyloidosis is a severe complication of many chronic inflammatory disorders, including the hereditary periodic fever syndromes. However, in one of these periodic fever syndromes, the hyper IgD and periodic fever syndrome, amyloidosis is rare despite vigorous, recurring inflammation.

  5. AA, vacuum tank for stochastic precooling

    CERN Document Server

    CERN PhotoLab

    1979-01-01

    The vaccum tank in which the fast stochastic precooling kicker was installed. It is clad with heating jackets for bake-out to 200 deg C, indispensable for reaching the operational vacuum of 7E-11 Torr. Alain Poncet, responsible for AA vacuum, is looking on. See also 7910268, 8002234.

  6. Investigation of photocatalytic activity of titanium dioxide deposited on metallic substrates by DC magnetron sputtering

    DEFF Research Database (Denmark)

    Daviðsdóttir, Svava; Canulescu, Stela; Dirscherl, Kai

    2013-01-01

    The photocatalytic properties of titanium dioxide (TiO2) coating in the anatase crystalline structure deposited on aluminium AA1050 alloy and stainless steel S316L substrates were investigated. The coating was prepared by DC magnetron sputtering. The microstructure and surface morphology of the c......The photocatalytic properties of titanium dioxide (TiO2) coating in the anatase crystalline structure deposited on aluminium AA1050 alloy and stainless steel S316L substrates were investigated. The coating was prepared by DC magnetron sputtering. The microstructure and surface morphology...... of the coating were investigated using Scanning Electron Microscopy (SEM), Atomic Force Microscopy (AFM), Glow Discharge Optical Emission Spectroscopy (GDOES), and X-Ray Diffraction (XRD). The photocatalytic behaviour was studied using electrochemical methods such as open circuit potential measurements, linear...... sweep voltammetry, impedance measurements. The microstructure and surface morphology of the coating were similar irrespective of the nature of the substrate, while the photocatalytic behaviour was found to vary depending on the substrate type. In general the TiO2 coating on stainless steel was shown...

  7. AAS 228: Day 2 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session (Day 1) The Galaxy Zoo(by Benny Tsang)Galaxy Zoo was so hot that the servers hosting the galaxy images got melted down soon after being launched.Kevin Schawinski from ETH Zurich took us on a tour ofhis wonderful Galaxy Zoo. It is a huge zoo with about a quarter million zookeepers, they are citizen astronomers who collaboratively classify galaxies by their looks as an attempt to understand galaxy evolution. The big question that is being answered is: how do blue, actively star-forming galaxies evolve into red, quiescent (non-star-forming) galaxies? The Zoo helped reveal that blue galaxies turn into red galaxies via two possible paths galaxies might run out of supply of gas and shut off star formation slowly; or they could merge with one another and turn off star formation by destroying the gas reservoir rapidly!The Galaxy Zoo project also led to the discoveries of:Green Peas: they are the living fossils of galaxy evolution; compact, bright, green galaxies that are actively forming starsOverlapping galaxies: they are pairs of galaxies that are separated physically but happen to lie on the same line of sight; they provide excellent laboratories for studying dust extinctionHannys Voorwerp: an unusual object named after Hanny the discoverer, which is believed to be the first detection of quasar light echoThe idea of Galaxy Zoo in getting help from citizen scientists was further extended into an award-winningproject known as the Zooniverse, which is an online platform for streamlined crowd-sourcing for scientific research that requires human input. The future of astronomy is going to be

  8. Heterotrophic bacterial growth and substrate utilization in the oligotrophic Eastern Mediterranean (Aegean Sea

    Directory of Open Access Journals (Sweden)

    U. CHRISTAKI

    2003-06-01

    Full Text Available Heterotrophic bacterial growth and substrate utilization were studied in March and September of 1997 in the oligotrophic Aegean Sea. Maximum velocities of ectoproteolytic activity (ectoaminopeptidase ctivity, EAP, as well as amino acid assimilation and respiration rates (AA-A, AA-R were measured along with bacterial production (protein synthesis. At the northern stations which are influenced by the input of the Black Sea waters, rates at 5 m depth of EAP, AA-A and bacterial production were 2 to 3 times higher than at southern stations. Influenced by the Black Sea water, mean bacterial numbers in the 0-100 m layer showed typical oceanic concentrations averaging 0.7 x 10 6 cells ml -1 . These values, along with low bacterial production rates (30 ng C l -1 h -1 implied slow growth for bacteria and/or that a large number among them were inactive. Neither bacterial abundance nor production were correlated with primary production. The percentage of amino acids respired was higher in September compared to March, particularly in the northern Aegean (mean 69 %. The enzyme kinetic analysis showed a biphasic model, the transition between the high and low affinity enzymes being obtained at 50 ΜM. Ectoaminopeptidase activity was weakly correlated with bacterial production (p < 0.05, but strongly correlated with respiration rates of amino acids (p < 0.001, suggesting that the substrate used was devoted to maintain energy requirements.

  9. Substrate integrated antennas and arrays

    CERN Document Server

    Cheng, Yu Jian

    2015-01-01

    Substrate Integrated Antennas and Arrays provides a single source for cutting-edge information on substrate integrated circuits (SICs), substrate integrated waveguide (SIW) feeding networks, SIW slot array antennas, SIC traveling-wave antennas, SIW feeding antennas, SIW monopulse antennas, and SIW multibeam antennas. Inspired by the author's extensive research, this comprehensive book:Describes a revolutionary SIC-based antenna technique with the potential to replace existing antenna technologiesExamines theoretical and experimental results connected to electrical and mechanical performanceExp

  10. Direct cooled power electronics substrate

    Science.gov (United States)

    Wiles, Randy H [Powell, TN; Wereszczak, Andrew A [Oak Ridge, TN; Ayers, Curtis W [Kingston, TN; Lowe, Kirk T [Knoxville, TN

    2010-09-14

    The disclosure describes directly cooling a three-dimensional, direct metallization (DM) layer in a power electronics device. To enable sufficient cooling, coolant flow channels are formed within the ceramic substrate. The direct metallization layer (typically copper) may be bonded to the ceramic substrate, and semiconductor chips (such as IGBT and diodes) may be soldered or sintered onto the direct metallization layer to form a power electronics module. Multiple modules may be attached to cooling headers that provide in-flow and out-flow of coolant through the channels in the ceramic substrate. The modules and cooling header assembly are preferably sized to fit inside the core of a toroidal shaped capacitor.

  11. Substrate noise coupling in RFICs

    CERN Document Server

    Helmy, Ahmed

    2008-01-01

    Substrate Noise Coupling in RFICs addresses substrate noise coupling in RF and mixed signal ICs when used in a system on chip (SoC) containing digital ICs as well. This trend of integrating RF, mixed signal ICs with large digital ICs is found in many of today's commercial ICs such as single chip Wi-Fi or Bluetooth solutions and is expected to grow rapidly in the future. The book reports modeling and simulation techniques for substrate noise coupling effects in RFICs and introduces isolation structures and design guides to mitigate such effects with the ultimate goal of enhancing the yield of R

  12. High cycle fatigue of AA6082 and AA6063 aluminum extrusions

    Science.gov (United States)

    Nanninga, Nicholas E.

    The high cycle fatigue behavior of hollow extruded AA6082 and AA6063 aluminum extrusions has been studied. Hollow extruded aluminum profiles can be processed into intricate shapes, and may be suitable replacements for fatigue critical automotive applications requiring reduced weight. There are several features inherent in hollow aluminum extrusions, such as seam welds, charge welds, microstructural variations and die lines. The effects of such extrusion variables on high cycle fatigue properties were studied by taking specimens from an actual car bumper extrusion. It appears that extrusion die lines create large anisotropy differences in fatigue properties, while welds themselves have little effect on fatigue lives. Removal of die lines greatly increased fatigue properties of AA6082 specimens taken transverse to the extrusion direction. Without die lines, anisotropy in fatigue properties between AA6082 specimens taken longitudinal and transverse to the extrusion direction, was significantly reduced, and properties associated with the orientation of the microstructure appears to be isotropic. A fibrous microstructure for AA6082 specimens showed great improvements in fatigue behavior. The effects of elevated temperatures and exposure of specimens to NaCl solutions was also studied. Exposure to the salt solution greatly reduced the fatigue lives of specimens, while elevated temperatures showed more moderate reductions in fatigue lives.

  13. Open Access: Current Status, AAS Perspectives

    Science.gov (United States)

    Marvel, Kevin B.; Biemesderfer, Chris

    Open Access, defined as the free provision of information by science publishers, is not likely to be mandated by law anytime soon in the United States. A collaborative effort, initiated by the House Science Committee, to come to some consensus within the scientific publishing enterprise has resulted in the release of the so-called "Roundtable Recommendations". These will serve as a working model moving forward on fundamental shared starting points for both publishers and authors as well as the Open Access community. The AAS' delayed open access model for publishing is flexible, supportive of our discipline and equitably distributes the cost of publishing to authors and readers. The AAS can support this flexible model because it is not dependent on journal revenues for the support of its member-focused activities.

  14. Substrate preferences in laying hens

    OpenAIRE

    Jong, de, M.J.M.; Reenen, van, C.G.

    2005-01-01

    We investigated the substrate preference of laying hens with respect to dustbathing and foraging behaviour, in order to determine which resources should be provided in laying hen housing systems for the expression of these behaviours. The consumer demand approach was used to study the strength of preference. Hens had to push a weighted door to enter choice pens with either a wire floor, sand, wood shavings or peat moss as substrate. Twelve Isa-Brown hens, reared on battery cages, successfully...

  15. Coated substrate apparatus and method

    Energy Technology Data Exchange (ETDEWEB)

    Bao, Zhenan; Diao, Ying; Mannsfeld, Stefan Christian Bernhardt; Tee, Chee-Keong; Becerril-Garcia, Hector A.; Zhou, Yan

    2018-01-09

    A coated substrate is formed with aligned objects such as small molecules, macromolecules and nanoscale particulates, such as inorganic, organic or inorganic/organic hybrid materials. In accordance with one or more embodiments, an apparatus or method involves an applicator having at least one surface patterned with protruded or indented features, and a coated substrate including a solution-based layer of objects having features and morphology attributes arranged as a function of the protruded or indented features.

  16. First circulating beam in the AA

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.5 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are to numerous to name them all. Heribert Koziol, apparently asleep, is answering the call from an impatient director. See also 8007094.

  17. AA, assembly of wide bending magnet

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.

  18. AA, inner conductor of a magnetic horn

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    At the start-up of the AA and during its initial operation, magnetic horns focused the antiprotons emanating from the production target. These "current-sheet lenses" had a thin inner conductor (for minimum absorption of antiprotons), machined from aluminium to wall thicknesses of 0.7 or 1 mm. The half-sine pulses rose to 150 kA in 8 microsec. The angular acceptance was 50 mrad.

  19. Wooden Model of Wide AA Bending Magnet

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    The very particular lattice of the AA required 2 types of dipoles (bending magnets: BLG, long and narrow; BST, short and wide). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see a wooden model, built in 1978, to gain dimensional experience with such a monster.

  20. Data Behind the Figures in AAS Journals

    Science.gov (United States)

    Biemesderfer, Chris

    2013-01-01

    Substantial amounts of digital data are produced in the scientific enterprise, and much of it is carefully analyzed and processed. Often resulting from a good deal of intellectual effort, many of these highly-processed products are published in the scholarly literature. Many of these data - or more precisely, representations of these data - are committed to the scholarly record in the forms of figures and tables that appear within articles: the AAS journals publish more than 30,000 figures and nearly 10,000 tables each year. For more than a decade, the AAS journals have accepted machine-readable tables that provide the data behind (some of) the tables, and recently the journals have started to encourage the submission of the data behind figures. (See the related poster by Greg Schwarz.) During this time, the journals have been refining techniques for acquiring and managing the digital data that underlie figures and tables. In 2012 the AAS was awarded a grant by the US NSF so that the journals can extend the methods for providing access to these data objects, through a deeper collaboration with the VO and with organizations like DataCite, and by spearheading discussions about the formats and metadata that will best facilitate long-term data management and access. An important component of these activities is educating scientists about the importance and benefits of making such data sets available.

  1. AAS Publishing News: Astronomical Software Citation Workshop

    Science.gov (United States)

    Kohler, Susanna

    2015-07-01

    Do you write code for your research? Use astronomical software? Do you wish there were a better way of citing, sharing, archiving, or discovering software for astronomy research? You're not alone! In April 2015, AAS's publishing team joined other leaders in the astronomical software community in a meeting funded by the Sloan Foundation, with the purpose of discussing these issues and potential solutions. In attendance were representatives from academic astronomy, publishing, libraries, for-profit software sharing platforms, telescope facilities, and grantmaking institutions. The goal of the group was to establish “protocols, policies, and platforms for astronomical software citation, sharing, and archiving,” in the hopes of encouraging a set of normalized standards across the field. The AAS is now collaborating with leaders at GitHub to write grant proposals for a project to develop strategies for software discoverability and citation, in astronomy and beyond. If this topic interests you, you can find more details in this document released by the group after the meeting: http://astronomy-software-index.github.io/2015-workshop/ The group hopes to move this project forward with input and support from the broader community. Please share the above document, discuss it on social media using the hashtag #astroware (so that your conversations can be found!), or send private comments to julie.steffen@aas.org.

  2. Simon van der Meer in the AA Control Room

    CERN Multimedia

    CERN PhotoLab

    1984-01-01

    Simon van der Meer, spiritus rector of the Antiproton Accumulator, in the AA Control Room. Inventor of stochastic cooling, on which the AA was based, and of the magnetic horn, with which the antiprotons were focused, he also wrote most of the software with which the AA was controlled, and spent uncountable numbers of hours in this chair to tickle the AA to top performance. 8 months after this picture was taken, he received, in October 1984, the Nobel prize, together with Carlo Rubbia, the moving force behind the whole Proton-Antiproton Collider project that led to the discovery, in 1983, of the W and Z intermediate bosons.

  3. Enhancement of wear and ballistic resistance of armour grade AA7075 aluminium alloy using friction stir processing

    Directory of Open Access Journals (Sweden)

    I. Sudhakar

    2015-03-01

    Full Text Available Industrial applications of aluminium and its alloys are restricted because of their poor tribological properties. Thermal spraying, laser surfacing, electron beam welding are the most widely used techniques to alter the surface morphology of base metal. Preliminary studies reveal that the coating and layering of aluminium alloys with ceramic particles enhance the ballistic resistance. Furthermore, among aluminium alloys, 7075 aluminium alloy exhibits high strength which can be compared to that of steels and has profound applications in the designing of lightweight fortification structures and integrated protection systems. Having limitations such as poor bond integrity, formation of detrimental phases and interfacial reaction between reinforcement and substrate using fusion route to deposit hard particles paves the way to adopt friction stir processing for fabricating surface composites using different sizes of boron carbide particles as reinforcement on armour grade 7075 aluminium alloy as matrix in the present investigation. Wear and ballistic tests were carried out to assess the performance of friction stir processed AA7075 alloy. Significant improvement in wear resistance of friction stir processed surface composites is attributed to the change in wear mechanism from abrasion to adhesion. It has also been observed that the surface metal matrix composites have shown better ballistic resistance compared to the substrate AA7075 alloy. Addition of solid lubricant MoS2 has reduced the depth of penetration of the projectile to half that of base metal AA7075 alloy. For the first time, the friction stir processing technique was successfully used to improve the wear and ballistic resistances of armour grade high strength AA7075 alloy.

  4. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-177 97% ...

  5. NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0048 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-163 91% ...

  6. NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0048 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 1e-163 91% ...

  7. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74196.1| 5-HT1A [Drosophila melanogaster] gb|AAS74220.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74309.1| 5-HT1A [Drosophila melanogaster] gb|AAS74310.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74335.1| 5-HT1A [Drosophila melanogaster] AAS74196.1 1e-176 97% ...

  8. NCBI nr-aa BLAST: CBRC-DMEL-02-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0054 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 0.0 100% ...

  9. Selective Laser Treatment on Cold-Sprayed Titanium Coatings: Numerical Modeling and Experimental Analysis

    Science.gov (United States)

    Carlone, Pierpaolo; Astarita, Antonello; Rubino, Felice; Pasquino, Nicola; Aprea, Paolo

    2016-12-01

    In this paper, a selective laser post-deposition on pure grade II titanium coatings, cold-sprayed on AA2024-T3 sheets, was experimentally and numerically investigated. Morphological features, microstructure, and chemical composition of the treated zone were assessed by means of optical microscopy, scanning electron microscopy, and energy dispersive X-ray spectrometry. Microhardness measurements were also carried out to evaluate the mechanical properties of the coating. A numerical model of the laser treatment was implemented and solved to simulate the process and discuss the experimental outcomes. Obtained results highlighted the key role played by heat input and dimensional features on the effectiveness of the treatment.

  10. Substrate curvature regulates cell migration.

    Science.gov (United States)

    He, Xiuxiu; Jiang, Yi

    2017-05-23

    Cell migration is essential in many aspects of biology. Many basic migration processes, including adhesion, membrane protrusion and tension, cytoskeletal polymerization, and contraction, have to act in concert to regulate cell migration. At the same time, substrate topography modulates these processes. In this work, we study how substrate curvature at micrometer scale regulates cell motility. We have developed a 3D mechanical model of single cell migration and simulated migration on curved substrates with different curvatures. The simulation results show that cell migration is more persistent on concave surfaces than on convex surfaces. We have further calculated analytically the cell shape and protrusion force for cells on curved substrates. We have shown that while cells spread out more on convex surfaces than on concave ones, the protrusion force magnitude in the direction of migration is larger on concave surfaces than on convex ones. These results offer a novel biomechanical explanation to substrate curvature regulation of cell migration: geometric constrains bias the direction of the protrusion force and facilitates persistent migration on concave surfaces.

  11. Structural and biochemical characterization of the broad substrate specificity of Bacteroides thetaiotaomicron commensal sialidase.

    Science.gov (United States)

    Park, Kwang-Hyun; Kim, Min-Gyu; Ahn, Hee-Jeong; Lee, Dae-Han; Kim, Jin-Hyo; Kim, Young-Wan; Woo, Eui-Jeon

    2013-08-01

    Sialidases release the terminal sialic acid residue from a wide range of sialic acid-containing polysaccharides. Bacteroides thetaiotaomicron, a symbiotic commensal microbe, resides in and dominates the human intestinal tract. We characterized the recombinant sialidase from B. thetaiotaomicron (BTSA) and demonstrated that it has broad substrate specificity with a relative activity of 97, 100 and 64 for 2,3-, 2,6- and 2,8-linked sialic substrates, respectively. The hydrolysis activity of BTSA was inhibited by a transition state analogue, 2-deoxy-2,3-dehydro-N-acetyl neuraminic acid, by competitive inhibition with a Ki value of 35μM. The structure of BSTA was determined at a resolution of 2.3Å. This structure exhibited a unique carbohydrate-binding domain (CBM) at its N-terminus (a.a. 23-190) that is adjacent to the catalytic domain (a.a. 191-535). The catalytic domain has a conserved arginine triad with a wide-open entrance for the substrate that exposes the catalytic residue to the surface. Unlike other pathogenic sialidases, the polysaccharide-binding site in the CBM is near the active site and possibly holds and positions the polysaccharide substrate directly at the active site. The structural feature of a wide substrate-binding groove and closer proximity of the polysaccharide-binding site to the active site could be a unique signature of the commensal sialidase BTSA and provide a molecular basis for its pharmaceutical application. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Porous substrates filled with nanomaterials

    Science.gov (United States)

    Worsley, Marcus A.; Baumann, Theodore F.; Satcher, Jr., Joe H.; Stadermann, Michael

    2014-08-19

    A composition comprising: at least one porous carbon monolith, such as a carbon aerogel, comprising internal pores, and at least one nanomaterial, such as carbon nanotubes, disposed uniformly throughout the internal pores. The nanomaterial can be disposed in the middle of the monolith. In addition, a method for making a monolithic solid with both high surface area and good bulk electrical conductivity is provided. A porous substrate having a thickness of 100 microns or more and comprising macropores throughout its thickness is prepared. At least one catalyst is deposited inside the porous substrate. Subsequently, chemical vapor deposition is used to uniformly deposit a nanomaterial in the macropores throughout the thickness of the porous substrate. Applications include electrical energy storage, such as batteries and capacitors, and hydrogen storage.

  13. Plastic Substrates for Flexible Displays

    Science.gov (United States)

    Ito, Hisashi; Oka, Wataru; Goto, Hideki; Umeda, Hideo

    2006-05-01

    New flexible fibrous glass-reinforced plastic (FRP) substrates for flat panel displays were developed. Optimizing the composition of the FRP by adjusting the difference in refractive index between a matrix resin and a glass fiber enabled the coexistence of a high transparency and a low coefficient of thermal expansion (CTE). An excellent smooth surface morphology was confirmed by the formulation of a coating resin. The stability of moisture impermeability depended on the surface smoothness and adhesion between a barrier layer and the coating layer. The moisture permeation rates of barrier substrates were below detection limits (<0.01 g m-2 day-1) on standard measurement equipment.

  14. AAS Special Session: Policy Making in Astronomy

    Science.gov (United States)

    Cardelli, J. A.; Massa, D.

    1995-12-01

    The professional astronomical community today is more diverse than at any time in its history. Individuals participating in creative research programs can be found in a wide range of positions. This type of diversity, which mixes research, education, and service (e.g. contract) work, represents the strength of contemporary astronomy. While recognizing the unavoidable reductions in funding and restructuring of organizations like NASA, it is imperative that the significance of the current diversity be considered during these processes. Creative ideas are one of the cornerstones of quality research, and they can originate anywhere. Consequently, it is essential that adequate research resources remain available for free and open competition by all astronomers. Our goal in this session is to bring together officials from the AAS, NASA, and the NSF to discuss how the policy and decision making process operates and whether it should be changed to better serve the general needs of the professional astronomical community. Examples of the issues we believe are important include: In establishing new policy, how can the needs of the average research astronomer be better addressed? How could input from such astronomers be provided to those who craft NASA/NSF policy? How can/should the AAS serve as an interface between policy/decision making bodies and its membership? Should the AAS membership become more actively/effectively involved in the decision making process and, if so, how? More information on this session and related issues can be found at the Association of Research Astronomers Home Page: http://www.phy.vill.edu/astro/faculty/ara/ara_home.htm

  15. Evolution of geomagnetic aa index near sunspot minimum

    Directory of Open Access Journals (Sweden)

    R. P. Kane

    2002-10-01

    Full Text Available The smoothed values of the minima of sunspot number Rz and the geomagnetic index aa were compared for sunspot cycles 12–23. In one cycle, aa(min occurred earlier than Rz(min, but remained at that low from a few months before Rz(min to a few months after Rz(min. In two cycles, Rz(min and aa(min coincided within a month or two. In nine cycles, aa(min occurred more than three months later than Rz(min. The aa(min coincided with the minima of some solar radio emission indices originating in the solar corona. For sunspot cycles 21, 22, 23, the minimum of solar wind velocity V occurred 0–9 months later than the aa(min. The minimum of solar wind total magnetic field B occurred near Rz(min. The solar wind ion density N had maxima (instead of minima near Rz(min, and again near Rz(max, indicating a  ~5-year periodicity, instead of an 11-year periodicity. The maxima of aa, V and B occurred near Rz(max and/or later in the declining phase of Rz. The aa index was very well correlated with the functions BV and BV 2.Key words. Geomagnetism and paleomagnetism (time variations, diurnal to secular – time variations, secular and long term Interplanetary physics (interplanetary magnetic field

  16. NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0001 gb|AAS74960.1| 5-HT2 [Drosophila melanogaster] gb|AAS74962.1| 5-HT2 [Drosophila... melanogaster] gb|AAS74964.1| 5-HT2 [Drosophila melanogaster] gb|AAS74966.1| 5-HT2 [Drosophila... melanogaster] gb|AAS74970.1| 5-HT2 [Drosophila melanogaster] gb|AAS74972.1| 5-HT2 [Drosophila melanogaster]... gb|AAS74976.1| 5-HT2 [Drosophila melanogaster] gb|AAS74978.1| 5-HT2 [Drosophila ...melanogaster] gb|AAS74979.1| 5-HT2 [Drosophila melanogaster] gb|AAS74980.1| 5-HT2 [Drosophila melanogaster] gb|AAS74981.1| 5-HT2 [Dro

  17. AA, Inner Conductor of Magnetic Horn

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    Antiprotons emerging at large angles from the production target (hit by an intense 26 GeV proton beam from the PS), were focused into the acceptance of the injection line of the AA by means of a "magnetic horn" (current-sheet lens). Here we see an early protype of the horn's inner conductor, machined from solid aluminium to a thickness of less than 1 mm. The 1st version had to withstand pulses of 150 kA, 15 us long, every 2.4 s. See 8801040 for a later version.

  18. Wooden Model of Wide AA Bending Magnet

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    The very particular lattice of the AA required 2 types of dipoles (bending magnets: BLG, long and narrow; BST, short and wide). A wide one had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. A wooden model was build in 1978, to gain dimensional experience. Here, Peter Zettwoch, one of the largest men at CERN at that time, is putting a hand in the mouth of the wooden BST monster.

  19. Phonon scattering in graphene over substrate steps

    DEFF Research Database (Denmark)

    Sevincli, Haldun; Brandbyge, Mads

    2014-01-01

    We calculate the effect on phonon transport of substrate-induced bends in graphene. We consider bending induced by an abrupt kink in the substrate, and provide results for different step-heights and substrate interaction strengths. We find that individual substrate steps reduce thermal conductance...

  20. Droplet dynamics on patterned substrates

    Indian Academy of Sciences (India)

    ... comprising hydrophobic and hydrophilic stripes can depend sensitively on the dynamical pathway by which the state is reached. We also consider a substrate covered with micron-scale posts and investigate how this can lead to superhydrophobic behaviour. Finally we model how a Namibian desert beetle collects water ...

  1. Modeling graphene-substrate interactions

    NARCIS (Netherlands)

    Amlaki, T.

    2016-01-01

    In this thesis I focussed on the interactions between graphene-like materials (grapheme and germanene) and various substrates. The attractive properties of graphene like a high carrier mobility, its single-atomic thickness and its theoretical magic have made graphene a very popular and promising

  2. Neurobiological Substrates of Tourette's Disorder

    NARCIS (Netherlands)

    Leckman, James F.; Bloch, Michael H.; Smith, Megan E.; Larabi, Daouia; Hampson, Michelle

    Objective: This article reviews the available scientific literature concerning the neurobiological substrates of Tourette's disorder (TD). Methods: The electronic databases of PubMed, ScienceDirect, and PsycINFO were searched for relevant studies using relevant search terms. Results:

  3. Neuronal substrate of eating disorders

    OpenAIRE

    Timofeeva, Elena; Calvez, Juliane

    2014-01-01

    Eating disorders are devastating and life-threatening psychiatric diseases. Although clinical and experimental investigations have significantly progressed in discovering the neuronal causes of eating disorders, the exact neuronal and molecular mechanisms of the development and maintenance of these pathologies are not fully understood. The complexity of the neuronal substrate of eating disorders hampers progress in revealing the precise mechanisms. The present re...

  4. States' Flexibility Waiver Plans for Alternate Assessments Based on Alternate Achievement Standards (AA-AAS). Synthesis Report 96

    Science.gov (United States)

    Lazarus, Sheryl S.; Edwards, Lynn M.; Thurlow, Martha L.; Hodgson, Jennifer R.

    2014-01-01

    All states have alternate assessments based on alternate achievement standards (AA-AAS) for students with the most significant cognitive disabilities. For accountability purposes, the Elementary and Secondary Education Act (ESEA) allows up to 1% of students to be counted as proficient with this assessment option. In 2011 the U.S. Department of…

  5. The Cry48Aa-Cry49Aa binary toxin from Bacillus sphaericus exhibits highly restricted target specificity.

    Science.gov (United States)

    Jones, Gareth W; Wirth, Margaret C; Monnerat, Rose G; Berry, Colin

    2008-09-01

    The Cry48Aa/Cry49Aa binary toxin of Bacillus sphaericus was recently discovered by its ability to kill Culex quinquefasciatus mosquito larvae through a novel interaction between its two components. We have investigated the target specificity of this toxin and show it to be non-toxic to coleopteran, lepidopteran and other dipteran insects, including closely related Aedes and Anopheles mosquitoes. This represents an unusually restricted target range for crystal toxins from either B. sphaericus or Bacillus thuringiensis. Gut extracts from Culex and Aedes larvae show differential processing of the Cry48Aa protein, with the location of cleavage sites in Culex reflecting those previously shown for the activation of Cry4 toxins in mosquitoes. Pre-activation of Cry48Aa/Cry49Aa with Culex extracts, however, fails to induce toxicity to Aedes larvae. Co-administration of Cry49Aa with Cry4Aa gives higher than predicted toxicity, perhaps suggesting weak synergism against Culex larvae between Cry49Aa and other three-domain Cry toxins.

  6. A DNA sequence recognition loop on APOBEC3A controls substrate specificity.

    Directory of Open Access Journals (Sweden)

    Eric C Logue

    Full Text Available APOBEC3A (A3A, one of the seven-member APOBEC3 family of cytidine deaminases, lacks strong antiviral activity against lentiviruses but is a potent inhibitor of adeno-associated virus and endogenous retroelements. In this report, we characterize the biochemical properties of mammalian cell-produced and catalytically active E. coli-produced A3A. The enzyme binds to single-stranded DNA with a Kd of 150 nM and forms dimeric and monomeric fractions. A3A, unlike APOBEC3G (A3G, deaminates DNA substrates nonprocessively. Using a panel of oligonucleotides that contained all possible trinucleotide contexts, we identified the preferred target sequence as TC (A/G. Based on a three-dimensional model of A3A, we identified a putative binding groove that contains residues with the potential to bind substrate DNA and to influence target sequence specificity. Taking advantage of the sequence similarity to the catalytic domain of A3G, we generated A3A/A3G chimeric proteins and analyzed their target site preference. We identified a recognition loop that altered A3A sequence specificity, broadening its target sequence preference. Mutation of amino acids in the predicted DNA binding groove prevented substrate binding, confirming the role of this groove in substrate binding. These findings shed light on how APOBEC3 proteins bind their substrate and determine which sites to deaminate.

  7. PREFACE: Cell-substrate interactions Cell-substrate interactions

    Science.gov (United States)

    Gardel, Margaret; Schwarz, Ulrich

    2010-05-01

    One of the most striking achievements of evolution is the ability to build cellular systems that are both robust and dynamic. Taken by themselves, both properties are obvious requirements: robustness reflects the fact that cells are there to survive, and dynamics is required to adapt to changing environments. However, it is by no means trivial to understand how these two requirements can be implemented simultaneously in a physical system. The long and difficult quest to build adaptive materials is testimony to the inherent difficulty of this goal. Here materials science can learn a lot from nature, because cellular systems show that robustness and dynamics can be achieved in a synergetic fashion. For example, the capabilities of tissues to repair and regenerate are still unsurpassed in the world of synthetic materials. One of the most important aspects of the way biological cells adapt to their environment is their adhesive interaction with the substrate. Numerous aspects of the physiology of metazoan cells, including survival, proliferation, differentiation and migration, require the formation of adhesions to the cell substrate, typically an extracellular matrix protein. Adhesions guide these diverse processes both by mediating force transmission from the cell to the substrate and by controlling biochemical signaling pathways. While the study of cell-substrate adhesions is a mature field in cell biology, a quantitative biophysical understanding of how the interactions of the individual molecular components give rise to the rich dynamics and mechanical behaviors observed for cell-substrate adhesions has started to emerge only over the last decade or so. The recent growth of research activities on cell-substrate interactions was strongly driven by the introduction of new physical techniques for surface engineering into traditional cell biological work with cell culture. For example, microcontact printing of adhesive patterns was used to show that cell fate depends

  8. _. AA~ AA, _ _

    Indian Academy of Sciences (India)

    cussed, a rare quality in present day text books. This book is a must in every science lover's book shelf. Though the book is supposed to be on soap bubbles, Boys .... units of measurement, as the unfamiliar metric terminology would have distracted the attention of the majority for whom this book is intended, who have spent ...

  9. Experimental investigation of hardness of FSW and TIG joints of Aluminium alloys of AA7075 and AA6061

    Directory of Open Access Journals (Sweden)

    Chetan Patil

    2016-07-01

    Full Text Available This paper reports hardness testing conducted on welded butt joints by FSW and TIG welding process on similar and dissimilar aluminium alloys. FSW joints were produced for similar alloys of AA7075T651 and dissimilar alloys of AA7075T651- AA6061T6. The Friction stir welds of AA7075 & AA6061 aluminium alloy were produced at different tool rotational speeds of 650,700, 800, 900, 1000 and transverse speed of 30, 35, 40 mm/min. TIG welding was conducted along the rolling direction of similar and dissimilar aluminium plates. The Brinell hardness testing techniques were employed to conduct the tests; these tests were conducted on the welds to ascertain the joint integrity before characterization to have an idea of the quality of the welds

  10. Design Engineering and Support Program (DESP). Delivery Order RZ16: Effects On Mechanical Properties From Laser Paint Stripping

    Science.gov (United States)

    2005-02-01

    Al2024 -T3 Clad Yield Tensile Strength Results. B -4 PLCRS and Reference Data Average Percentage of Elongation Results, 2024-T3 Clad 0 2 4 6 8...B3. PLCRS and Reference Data Metallic Al2024 -T3 Clad Elongation Results. B -5 PLCRS and Reference Data Average Ultimate Tensile Strength

  11. Corrosion and nanomechanical behaviors of plasma electrolytic oxidation coated AA7020-T6 aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    Venugopal, A., E-mail: arjun_venu@hotmail.com [Materials and Metallurgy Group, Materials and Mechanical Entity, Vikram Sarabhai Space Centre, Thiruvananthapuram (India); Srinath, J. [Materials and Metallurgy Group, Materials and Mechanical Entity, Vikram Sarabhai Space Centre, Thiruvananthapuram (India); Rama Krishna, L. [International Advanced Research Centre for Powder Metallurgy and New Materials (ARCI), Balapur P.O., Hyderabad 500005 (India); Ramesh Narayanan, P.; Sharma, S.C.; Venkitakrishnan, P.V. [Materials and Metallurgy Group, Materials and Mechanical Entity, Vikram Sarabhai Space Centre, Thiruvananthapuram (India)

    2016-04-13

    Alumina coating was deposited on AA7020 aluminum alloy by plasma electrolytic oxidation (PEO) method. The corrosion, stress corrosion cracking (SCC) and nano-mechanical behaviors were examined by means of potentiodynamic polarization, slow strain rate test (SSRT) and nano-indentation tests. Potentiodynamic polarization (PP) was used to evaluate the corrosion resistance of the coating and slow strain rate test (SSRT) was used for evaluating the environmental cracking resistance in 3.5% NaCl solution. The mechanical properties (hardness and elastic modulus) were obtained from each indentation as a function of the penetration depth across the coating cross section. The above results were compared with similar PEO coated aluminum and magnesium alloys. Results indicated that PEO coating on AA7020 alloy significantly improved the corrosion resistance. However the environmental cracking resistance was found to be only marginal. The hardness and elastic modulus values were found to be much higher when compared to the base metal and similar PEO coated 7075 aluminum alloys. The fabricated coating also exhibited good adhesive strength with the substrate similar to other PEO coated aluminum alloys reported in the literature.

  12. Targeting fatty acid amide hydrolase and transient receptor potential vanilloid-1 simultaneously to modulate colonic motility and visceral sensation in the mouse: A pharmacological intervention with N-arachidonoyl-serotonin (AA-5-HT).

    Science.gov (United States)

    Bashashati, M; Fichna, J; Piscitelli, F; Capasso, R; Izzo, A A; Sibaev, A; Timmermans, J-P; Cenac, N; Vergnolle, N; Di Marzo, V; Storr, M

    2017-12-01

    Endocannabinoid anandamide (AEA) inhibits intestinal motility and visceral pain, but it may also be proalgesic through transient receptor potential vanilloid-1 (TRPV1). AEA is degraded by fatty acid amide hydrolase (FAAH). This study explored whether dual inhibition of FAAH and TRPV1 reduces diarrhea and abdominal pain. Immunostaining was performed on myenteric plexus of the mouse colon. The effects of the dual FAAH/TRPV1 inhibitor AA-5-HT on electrically induced contractility, excitatory junction potential (EJP) and fast (f) and slow (s) inhibitory junction potentials (IJP) in the mouse colon, colonic propulsion and visceromotor response (VMR) to rectal distension were studied. The colonic levels of endocannabinoids and fatty acid amides were measured. CB1-positive neurons exhibited TRPV1; only some TRPV1 positive neurons did not express CB1. CB1 and FAAH did not colocalize. AA-5-HT (100 nM-10 μM) decreased colonic contractility by ~60%; this effect was abolished by TRPV1 antagonist 5'-IRTX, but not by CB1 antagonist, SR141716. AA-5-HT (1 μM-10 μM) inhibited EJP by ~30% and IJPs by ~50%. The effects of AA-5-HT on junction potentials were reversed by SR141716 and 5`-IRTX. AA-5-HT (20 mg/kg; i.p.) inhibited colonic propulsion by ~30%; SR141716 but not 5`-IRTX reversed this effect. AA-5-HT decreased VMR by ~50%-60%; these effects were not blocked by SR141716 or 5`-IRTX. AA-5-HT increased AEA in the colon. The effects of AA-5-HT on visceral sensation and colonic motility are differentially mediated by CB1, TRPV1 and non-CB1/TRPV1 mechanisms, possibly reflecting the distinct neuromodulatory roles of endocannabinoid and endovanilloid FAAH substrates in the mouse intestine. © 2017 John Wiley & Sons Ltd.

  13. NCBI nr-aa BLAST: CBRC-GGAL-35-0091 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0091 ref|ZP_01791635.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenza...e PittAA] gb|EDK06802.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenzae PittAA] ZP_01791635.1 2e-08 34% ...

  14. NCBI nr-aa BLAST: CBRC-PTRO-27-0055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0055 ref|ZP_01791635.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenza...e PittAA] gb|EDK06802.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenzae PittAA] ZP_01791635.1 8e-09 53% ...

  15. NCBI nr-aa BLAST: CBRC-ACAR-01-0367 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0367 ref|ZP_01790024.1| hypothetical protein CGSHiAA_05974 [Haemophilus influenza...e PittAA] gb|EDK08288.1| hypothetical protein CGSHiAA_05974 [Haemophilus influenzae PittAA] ZP_01790024.1 4.0 29% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-07-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0022 ref|ZP_01789747.1| hypothetical protein CGSHiAA_08330 [Haemophilus influenza...e PittAA] gb|EDK08473.1| hypothetical protein CGSHiAA_08330 [Haemophilus influenzae PittAA] ZP_01789747.1 2e-14 23% ...

  17. NCBI nr-aa BLAST: CBRC-RNOR-15-0027 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-15-0027 ref|ZP_01791635.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenza...e PittAA] gb|EDK06802.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenzae PittAA] ZP_01791635.1 2e-30 98% ...

  18. NCBI nr-aa BLAST: CBRC-PTRO-02-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-02-0026 ref|ZP_01791635.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenza...e PittAA] gb|EDK06802.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenzae PittAA] ZP_01791635.1 8e-09 50% ...

  19. NCBI nr-aa BLAST: CBRC-RNOR-08-0315 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-08-0315 ref|ZP_01791635.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenza...e PittAA] gb|EDK06802.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenzae PittAA] ZP_01791635.1 8e-25 73% ...

  20. NCBI nr-aa BLAST: CBRC-HSAP-02-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-02-0029 ref|ZP_01791635.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenza...e PittAA] gb|EDK06802.1| hypothetical protein CGSHiAA_09967 [Haemophilus influenzae PittAA] ZP_01791635.1 5e-11 48% ...

  1. A novel Cry9Aa with increased toxicity for Spodoptera exigua (Hübner)

    NARCIS (Netherlands)

    Naimov, S.; Nedyalkova, R.; Staykov, N.; Weemen-Hendriks, M.; Minkov, I.; Maagd, de R.A.

    2014-01-01

    Cry9Aa, produced by Bacillus thuringiensis is reported to be not active against Spodoptera exigua (beet armyworm). In this study we have cloned a new cry9Aa5 gene encoding a protoxin with increased activity against S. exigua as compared to Cry9Aa1. When aligned to Cry9Aa1, four amino acid

  2. Methods of repairing a substrate

    Science.gov (United States)

    Riedell, James A. (Inventor); Easler, Timothy E. (Inventor)

    2011-01-01

    A precursor of a ceramic adhesive suitable for use in a vacuum, thermal, and microgravity environment. The precursor of the ceramic adhesive includes a silicon-based, preceramic polymer and at least one ceramic powder selected from the group consisting of aluminum oxide, aluminum nitride, boron carbide, boron oxide, boron nitride, hafnium boride, hafnium carbide, hafnium oxide, lithium aluminate, molybdenum silicide, niobium carbide, niobium nitride, silicon boride, silicon carbide, silicon oxide, silicon nitride, tin oxide, tantalum boride, tantalum carbide, tantalum oxide, tantalum nitride, titanium boride, titanium carbide, titanium oxide, titanium nitride, yttrium oxide, zirconium boride, zirconium carbide, zirconium oxide, and zirconium silicate. Methods of forming the ceramic adhesive and of repairing a substrate in a vacuum and microgravity environment are also disclosed, as is a substrate repaired with the ceramic adhesive.

  3. Network visualization by semantic substrates.

    Science.gov (United States)

    Shneiderman, Ben; Aris, Aleks

    2006-01-01

    Networks have remained a challenge for information visualization designers because of the complex issues of node and link layout coupled with the rich set of tasks that users present. This paper offers a strategy based on two principles: (1) layouts are based on user-defined semantic substrates, which are non-overlapping regions in which node placement is based on node attributes, (2) users interactively adjust sliders to control link visibility to limit clutter and thus ensure comprehensibility of source and destination. Scalability is further facilitated by user control of which nodes are visible. We illustrate our semantic substrates approach as implemented in NVSS 1.0 with legal precedent data for up to 1122 court cases in three regions with 7645 legal citations.

  4. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74185.1| 5-HT1A [Drosophila melanogaster] gb|AAS74209.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74210.1| 5-HT1A [Drosophila melanogaster] gb|AAS74211.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74224.1| 5-HT1A [Drosophila melanogaster] gb|AAS74234.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74254.1| 5-HT1A [Drosophila melanogaster] gb|AAS74258.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74262.1| 5-HT1A [Drosophila melanogaster] gb|AAS74278.1| 5-HT1A [Drosophila mela

  5. NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0049 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

  6. NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila... melanogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila... melanogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila ...melanogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-156 96% ...

  7. NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0056 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

  8. NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0049 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  9. NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0053 gb|AAS74380.1| 5-HT1B [Drosophila melanogaster] gb|AAS74382.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74389.1| 5-HT1B [Drosophila melanogaster] gb|AAS74402.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74403.1| 5-HT1B [Drosophila melanogaster] gb|AAS74405.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74406.1| 5-HT1B [Drosophila melanogaster] gb|AAS74411.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74412.1| 5-HT1B [Drosophila melanogaster] gb|AAS74413.1| 5-HT1B [Drosophila mela

  10. NCBI nr-aa BLAST: CBRC-DMEL-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila... melanogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila... melanogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila ...melanogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-165 100% ...

  11. NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0056 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila... melanogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  12. The postprandial use of dietary amino acids as an energy substrate is delayed after the deamination process in rats adapted for 2 weeks to a high protein diet.

    Science.gov (United States)

    Fromentin, Claire; Azzout-Marniche, Dalila; Tomé, Daniel; Even, Patrick; Luengo, Catherine; Piedcoq, Julien; Fromentin, Gilles; Gaudichon, Claire

    2011-05-01

    The aim of this study was to determine the contribution of dietary amino acids (AA) to energy metabolism under high protein (HP) diets, using a double tracer method to follow simultaneously the metabolic fate of α-amino groups and carbon skeletons. Sixty-seven male Wistar rats were fed a normal (NP) or HP diet for 14 days. Fifteen of them were equipped with a permanent catheter. On day 15, after fasting overnight, they received a 4-g meal extrinsically labeled with a mixture of 20 U-[(15)N]-[(13)C] AA. Energy metabolism, dietary AA deamination and oxidation and their transfer to plasma glucose were measured kinetically for 4 h in the catheterized rats. The transfer of dietary AA to liver glycogen was determined at 4 h. The digestive kinetics of dietary AA, their transfer into liver AA and proteins and the liver glycogen content were measured in the 52 other rats that were killed sequentially hourly over a 4-h period. [(15)N] and [(13)C] kinetics in the splanchnic protein pools were perfectly similar. Deamination increased fivefold in HP rats compared to NP rats. In the latter, all deaminated AA were oxidized. In HP rats, the oxidation rate was slower than deamination, so that half of the deaminated AA was non-oxidized within 4 h. Non-oxidized carbon skeletons were poorly sequestrated in glycogen, although there was a significant postprandial production of hepatic glycogen. Our results strongly suggest that excess dietary AA-derived carbon skeletons above the ATP production capacity, are temporarily retained in intermediate metabolic pools until the oxidative capacities of the liver are no longer overwhelmed by an excess of substrates.

  13. Cytopathological effects of Bacillus sphaericus Cry48Aa/Cry49Aa toxin on binary toxin-susceptible and -resistant Culex quinquefasciatus larvae.

    Science.gov (United States)

    de Melo, Janaina Viana; Jones, Gareth Wyn; Berry, Colin; Vasconcelos, Romero Henrique Teixeira; de Oliveira, Cláudia Maria Fontes; Furtado, André Freire; Peixoto, Christina Alves; Silva-Filha, Maria Helena Neves Lobo

    2009-07-01

    The Cry48Aa/Cry49Aa mosquitocidal two-component toxin was recently characterized from Bacillus sphaericus strain IAB59 and is uniquely composed of a three-domain Cry protein toxin (Cry48Aa) and a binary (Bin) toxin-like protein (Cry49Aa). Its mode of action has not been elucidated, but a remarkable feature of this protein is the high toxicity against species from the Culex complex, besides its capacity to overcome Culex resistance to the Bin toxin, the major insecticidal factor in B. sphaericus-based larvicides. The goal of this work was to investigate the ultrastructural effects of Cry48Aa/Cry49Aa on midgut cells of Bin-toxin-susceptible and -resistant Culex quinquefasciatus larvae. The major cytopathological effects observed after Cry48Aa/Cry49Aa treatment were intense mitochondrial vacuolation, breakdown of endoplasmic reticulum, production of cytoplasmic vacuoles, and microvillus disruption. These effects were similar in Bin-toxin-susceptible and -resistant larvae and demonstrated that Cry48Aa/Cry49Aa toxin interacts with and displays toxic effects on cells lacking receptors for the Bin toxin, while B. sphaericus IAB59-resistant larvae did not show mortality after treatment with Cry48Aa/Cry49Aa toxin. The cytopathological alterations in Bin-toxin-resistant larvae provoked by Cry48Aa/Cry49Aa treatment were similar to those observed when larvae were exposed to a synergistic mixture of Bin/Cry11Aa toxins. Such effects seemed to result from a combined action of Cry-like and Bin-like toxins. The complex effects caused by Cry48Aa/Cry49Aa provide evidence for the potential of these toxins as active ingredients of a new generation of biolarvicides that conjugate insecticidal factors with distinct sites of action, in order to manage mosquito resistance.

  14. Corrosion issues of powder coated AA6060 aluminium profiles

    DEFF Research Database (Denmark)

    Din, Rameez Ud; Valgarðsson, Smári; Jellesen, Morten Stendahl

    2015-01-01

    In this study detailed microstructural investigation of the reason for unexpected corrosion of powder coated aluminium alloy AA6060 windows profiles has been performed. The results from this study reveals that the failure of the window profiles was originated from the surface defects present...... on the extruded AA6060 aluminium profile after metallurgical process prior to powder coating. Surface defects are produced due to intermetallic particles in the alloy, which disturb the flow during the extrusion process. The corrosion mechanism leading to the failure of the powder coated AA6060 aluminium profiles...

  15. Software papers and citation in the AAS Journals

    Science.gov (United States)

    Robitaille, Thomas; Lintott, Chris

    2018-01-01

    At the start of 2016, AAS Publishing released a policy statement that officially opened the door for papers describing novel software to be published in the AAS Journals without a requirement for novel results to also be included. This statement also describes how the use of software should be cited in articles. In this talk, I will give an overview of this policy and will give an overview of the growth of software papers and software citation in AAS Journals over the last two years.

  16. Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease

    OpenAIRE

    Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi

    2008-01-01

    AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were differen...

  17. AA, shims and washers on quadrupole ends

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    Due to the fact that much of the field of the quadrupoles was outside the iron (in particular with the wide quadrupoles) and that thus the fields of quadrupoles and bending magnets interacted, the lattice properties of the AA could not be predicted with the required accuracy. After a first running period in 1980, during which detailed measurements were made with proton test beams, corrections to the quadrupoles were made in 1981, in the form of laminated shims at the ends of the poles, and with steel washers. With the latter ones, further refinements were made in an iterative procedure with measurements on the circulating beam. This eventually resulted, amongst other things, in a very low chromaticity, with the Q-values being constant to within +- 0.001 over the total momentum range of 6 %. Here we see the shims and washers on a narrow qudrupole (QFN, QDN). See also 8103203, 8103204, 8103205, 8103206.

  18. Carbon Nanotube Patterning on a Metal Substrate

    Science.gov (United States)

    Nguyen, Cattien V. (Inventor)

    2016-01-01

    A CNT electron source, a method of manufacturing a CNT electron source, and a solar cell utilizing a CNT patterned sculptured substrate are disclosed. Embodiments utilize a metal substrate which enables CNTs to be grown directly from the substrate. An inhibitor may be applied to the metal substrate to inhibit growth of CNTs from the metal substrate. The inhibitor may be precisely applied to the metal substrate in any pattern, thereby enabling the positioning of the CNT groupings to be more precisely controlled. The surface roughness of the metal substrate may be varied to control the density of the CNTs within each CNT grouping. Further, an absorber layer and an acceptor layer may be applied to the CNT electron source to form a solar cell, where a voltage potential may be generated between the acceptor layer and the metal substrate in response to sunlight exposure.

  19. A synergistic combination of tetraethylorthosilicate and multiphosphonic acid offers excellent corrosion protection to AA1100 aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    Dalmoro, Viviane [Instituto de Química, Universidade Federal do Rio Grande do Sul (UFRGS) Av. Bento Gonçalves 9500 - CEP 91501-970, Porto Alegre, RS (Brazil); Departament d’Enginyeria Química, ETSEIB, Universitat Politècnica de Catalunya (UPC), Avda. Diagonal 647, Barcelona E-08028 (Spain); Center for Research in Nano-Engineering (CRnE), Universitat Politècnica de Catalunya (UPC), Campus Sud, Edifici C’, C/Pasqual i Vila s/n, Barcelona E-08028 (Spain); Santos, João H.Z. dos [Instituto de Química, Universidade Federal do Rio Grande do Sul (UFRGS) Av. Bento Gonçalves 9500 - CEP 91501-970, Porto Alegre, RS (Brazil); Armelin, Elaine, E-mail: elaine.armelin@upc.edu [Departament d’Enginyeria Química, ETSEIB, Universitat Politècnica de Catalunya (UPC), Avda. Diagonal 647, Barcelona E-08028 (Spain); Center for Research in Nano-Engineering (CRnE), Universitat Politècnica de Catalunya (UPC), Campus Sud, Edifici C’, C/Pasqual i Vila s/n, Barcelona E-08028 (Spain); Alemán, Carlos, E-mail: carlos.aleman@upc.edu [Departament d’Enginyeria Química, ETSEIB, Universitat Politècnica de Catalunya (UPC), Avda. Diagonal 647, Barcelona E-08028 (Spain); Center for Research in Nano-Engineering (CRnE), Universitat Politècnica de Catalunya (UPC), Campus Sud, Edifici C’, C/Pasqual i Vila s/n, Barcelona E-08028 (Spain); and others

    2013-05-15

    This work describes a new mechanism for the incorporation of organophosphonic acid into silane self-assembly monolayers, which has been used to protect AA1100 aluminum alloy. The protection improvement has been attributed to the fact that phosphonic structures promote the formation of strongly bonded and densely packed monolayer films, which show higher surface coverage and better adhesion than conventional silane systems. In order to evaluate the linking chemistry offered by phosphonic groups, two functionalized organophosphonic groups have been employed, 1,2-diaminoethanetetrakis methylenephosphonic acid (EDTPO) and aminotrimethylenephosphonic acid (ATMP), and combined with tetraethylorthosilicate (TEOS) films prepared by sol–gel synthesis. Results suggest that phosphonic acids may interact with the surface through a monodentate and bidentate coordination mode and, in addition, form one or more strong and stable linkages with silicon through non-hydrolysable bonds. Therefore, the incorporation of a very low concentration of phosphonic acids on TEOS solutions favors the complete coverage of the aluminum substrate during the silanization process, which is not possible using TEOS alone. The linking capacity of phosphonic acid has been investigated by FTIR-RA spectroscopy, SEM and EDX analysis, X-ray photoelectron spectroscopy (XPS), and quantum mechanical calculations. Finally, electrochemical impedance spectroscopy has been used to study the corrosion protection revealing that EDTPO-containing films afforded more protection to the AA1100 substrate than ATMP-containing films.

  20. Lead induced intergranular fracture in aluminum alloy AA6262

    NARCIS (Netherlands)

    De Hosson, JTM

    2003-01-01

    The influence of lead on the fracture behavior of aluminum alloy AA6262 is investigated. Under certain conditions, the mode of fracture changes from transgranular microvoid coalescence to an intergranular mechanism. Three different intergranular fracture mechanisms are observed: liquid metal

  1. Effect of pressurized steam on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Ambat, Rajan

    2012-01-01

    Purpose - The purpose of this paper is to understand the effect of pressurized steam on surface changes, structures of intermetallic particles and corrosion behavior of AA1050 aluminium. Design/methodology/approach - Industrially pure aluminium (AA1050, 99.5 per cent) surfaces were exposed...... measurements were used to study corrosion behavior. Findings - A 590?nm boehmite oxide layer was generated on AA1050 associated with partially dissolved and/or fallen off Fe-containing intermetallic particles after exposure to pressurized steam. A significant reduction (25 times) in anodic and cathodic...... reactivities was observed due to the formation of the compact oxide layer. Originality/value - This paper reveals a detailed investigation of how pressurized steam can affect the corrosion behaviour of AA1050 aluminium and the structure of Fe-containing intermetallic particles....

  2. (PCL/AA) hydrogel for controlled drug delivery

    Indian Academy of Sciences (India)

    Administrator

    acrylic acid (PCL/AA) hydrogels have been developed using ethylene glycol dimethacrylate (EGDMA) as a cross-linker and benzoyl peroxide as initiator. For these prepared hydrogels swelling studies, sol–gel fraction analysis and porosity.

  3. A&A Painting and Restoration Co., Inc. Information Sheet

    Science.gov (United States)

    A&A Painting and Restoration Co., Inc. (the Company) is located in Great Mills, Maryland. The settlement involves renovation activities conducted at properties constructed prior to 1978, located in Drayden, Maryland.

  4. Effect of heating on the stability of amyloid A (AA) fibrils and the intra- and cross-species transmission of AA amyloidosis.

    Science.gov (United States)

    Ogawa, Saki; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka

    2015-01-01

    Amyloid A (AA) amyloidosis is a protein misfolding disease characterized by extracellular deposition of AA fibrils. AA fibrils are found in several tissues from food animals with AA amyloidosis. For hygienic purposes, heating is widely used to inactivate microbes in food, but it is uncertain whether heating is sufficient to inactivate AA fibrils and prevent intra- or cross-species transmission. We examined the effect of heating (at 60 °C or 100 °C) and autoclaving (at 121 °C or 135 °C) on murine and bovine AA fibrils using Western blot analysis, transmission electron microscopy (TEM), and mouse model transmission experiments. TEM revealed that a mixture of AA fibrils and amorphous aggregates appeared after heating at 100 °C, whereas autoclaving at 135 °C produced large amorphous aggregates. AA fibrils retained antigen specificity in Western blot analysis when heated at 100 °C or autoclaved at 121 °C, but not when autoclaved at 135 °C. Transmissible pathogenicity of murine and bovine AA fibrils subjected to heating (at 60 °C or 100 °C) was significantly stimulated and resulted in amyloid deposition in mice. Autoclaving of murine AA fibrils at 121 °C or 135 °C significantly decreased amyloid deposition. Moreover, amyloid deposition in mice injected with murine AA fibrils was more severe than that in mice injected with bovine AA fibrils. Bovine AA fibrils autoclaved at 121 °C or 135 °C did not induce amyloid deposition in mice. These results suggest that AA fibrils are relatively heat stable and that similar to prions, autoclaving at 135 °C is required to destroy the pathogenicity of AA fibrils. These findings may contribute to the prevention of AA fibril transmission through food materials to different animals and especially to humans.

  5. Förpackning av keramiska substrat

    OpenAIRE

    Karlsson, Jan

    2008-01-01

    Detta examensarbete handlar om forpackning av keramiska substrat. Canning ar det universella namnet pa forpackning av keramiska substrat. Keramiska substrat kan vara katalysatorer eller partikelfilter som anvands som ett efterbehandlingssystem i bensin och Diesel applikationer. Examensarbetet genomfordes hos Scania CV AB. I installationsprocessen sveps en keramisk fibermatta runt det keramiska substratet. Substratet inkapslas sedan med ett metalholje. Rapporten inleds med att beskriva olika i...

  6. A new lime material for container substrates

    Science.gov (United States)

    The primary component in greenhouse potting substrates is sphagnum peatmoss. Substrate solution pH of non-amended peatmoss ranges from 4.0 to 4.5. Ideal pH for most greenhouse floriculture crops ranges from 5.8 to 6.2. Dolomitic lime is most often used to elevate substrate pH in peatmoss-based me...

  7. SUPPLEMENTARY INFORMATION Indicators for suicide substrate ...

    Indian Academy of Sciences (India)

    Jatinder

    The usual trend is to apply QSSA to a system with high substrate concentration. But, QSSA, i.e., steadiness in intermediate concentration, may even be achieved at high and even comparable enzyme-substrate ratio. Whether a system will attain a steady state depends not only on the high substrate concentration, but also on ...

  8. Applications of Hyperbolic Metamaterial Substrates

    Directory of Open Access Journals (Sweden)

    Yu Guo

    2012-01-01

    Full Text Available We review the properties of hyperbolic metamaterials and show that they are promising candidates as substrates for nanoimaging, nanosensing, fluorescence engineering, and controlling thermal emission. Hyperbolic metamaterials can support unique bulk modes, tunable surface plasmon polaritons, and surface hyperbolic states (Dyakonov plasmons that can be used for a variety of applications. We compare the effective medium predictions with practical realizations of hyperbolic metamaterials to show their potential for radiative decay engineering, bioimaging, subsurface sensing, metaplasmonics, and super-Planckian thermal emission.

  9. Superhydrophobicity enhancement through substrate flexibility

    Science.gov (United States)

    Vasileiou, Thomas; Gerber, Julia; Prautzsch, Jana; Schutzius, Thomas; Poulikakos, Dimos

    2017-11-01

    Inspired by manifestations in nature, micro/nanoengineering superhydrophobic surfaces has been the focus of much work. Generally, hydrophobicity is increased through the combined effects of surface texturing and chemistry; being durable, rigid substrate materials are the norm. However, many natural and technical materials are flexible, and the resulting effect on hydrophobicity has been largely unexplored. Here, we show that the rational tuning of flexibility can work collaboratively with the surface micro/nanotexture to enhance liquid repellency performance, defined by impalement and breakup resistance, contact time reduction, and restitution coefficient increase. Reduction in substrate stiffness and areal density imparts immediate acceleration and intrinsic responsiveness to impacting droplets, mitigating the collision and lowering the impalement probability by 60 % without the need for active actuation. We demonstrate the above discoveries with materials ranging from thin steel or polymer sheets to butterfly wings. Partial support of the Swiss National Science Foundation under Grant 162565 and the European Research Council under Advanced Grant 669908 (INTICE) is acknowledged.

  10. Substrate mediated enzyme prodrug therapy.

    Directory of Open Access Journals (Sweden)

    Betina Fejerskov

    Full Text Available In this report, we detail Substrate Mediated Enzyme Prodrug Therapy (SMEPT as a novel approach in drug delivery which relies on enzyme-functionalized cell culture substrates to achieve a localized conversion of benign prodrug(s into active therapeutics with subsequent delivery to adhering cells or adjacent tissues. For proof-of-concept SMEPT, we use surface adhered micro-structured physical hydrogels based on poly(vinyl alcohol, β-glucuronidase enzyme and glucuronide prodrugs. We demonstrate enzymatic activity mediated by the assembled hydrogel samples and illustrate arms of control over rate of release of model fluorescent cargo. SMEPT was not impaired by adhering cells and afforded facile time - and dose - dependent uptake of the in situ generated fluorescent cargo by hepatic cells, HepG2. With the use of a glucuronide derivative of an anticancer drug, SN-38, SMEPT afforded a decrease in cell viability to a level similar to that achieved using parent drug. Finally, dose response was achieved using SMEPT and administration of judiciously chosen concentration of SN-38 glucuronide prodrug thus revealing external control over drug delivery using drug eluting surface. We believe that this highly adaptable concept will find use in diverse biomedical applications, specifically surface mediated drug delivery and tissue engineering.

  11. Method For Producing Mechanically Flexible Silicon Substrate

    KAUST Repository

    Hussain, Muhammad Mustafa

    2014-08-28

    A method for making a mechanically flexible silicon substrate is disclosed. In one embodiment, the method includes providing a silicon substrate. The method further includes forming a first etch stop layer in the silicon substrate and forming a second etch stop layer in the silicon substrate. The method also includes forming one or more trenches over the first etch stop layer and the second etch stop layer. The method further includes removing the silicon substrate between the first etch stop layer and the second etch stop layer.

  12. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74195.1| 5-HT1A [Drosophila melanogaster] gb|AAS74276.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74292.1| 5-HT1A [Drosophila melanogaster] gb|AAS74298.1| 5-HT1A [Drosophila... melanogaster] gb|AAS74303.1| 5-HT1A [Drosophila melanogaster] gb|AAS74304.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74321.1| 5-HT1A [Drosophila melanogaster] gb|AAS74359.1| 5-HT1A [Drosophila melanogaster] AAS74195.1 1e-176 97% ...

  13. Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease.

    Science.gov (United States)

    Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi

    2008-05-20

    AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were different from those of the liver with regard to molecular weight and shape and had greater transmissibility. The infectious activity of fecal AA amyloid fibrils was reduced or abolished by the protein denaturants 6 M guanidine.HCl and formic acid or by AA immunodepletion. Thus, we propose that feces are a vehicle of transmission that may accelerate AA amyloidosis in captive cheetah populations. These results provide a pathogenesis for AA amyloidosis and suggest possible measures for rescuing cheetahs from extinction.

  14. The Effect of Composite Patches on the Failure of Adhesively-Bonded Joints Under Bending Moment

    Science.gov (United States)

    Akpinar, Salih

    2013-12-01

    In this study, it was aimed to compare mechanical behavior of double-strap joints with aluminum (AA2024-T3) or 16-ply laminate of carbon/epoxy composite (T300/934) patches of different orientation angles at their overlap area subjected to bending moment. For this purpose, AA2024-T3 aluminum was used as adherend, while the adhesive was a two-part paste (DP 460). Six different types of joint samples were subjected to bending moment. The effect of patch material on failure load and stress distribution was examined experimentally and numerically. In the numerical analysis, the composite patches were assumed to behave linearly elastic, while adherend and adhesive layers were assumed to be nonlinear. It was found that the data obtained from 3-D finite element analysis were coherent with experimental results. Meanwhile, experiments showed that fiber orientation angles of the patches markedly affected the failure load of joints, failure mode and stress distributions appeared in adhesive and composite.

  15. Computational Investigation of Hardness Evolution During Friction-Stir Welding of AA5083 and AA2139 Aluminum Alloys

    Science.gov (United States)

    2011-01-01

    M.J. Starink, Precipitates and Intermetallic Phases in 972Precipitation Hardening Al-Cu-Mg-(Li) Based Alloys, Int. Mater. Rev., 9732005, 50, p 193...REPORT Computational Investigation of Hardness Evolution During Friction-Stir Welding of AA5083 and AA2139 Aluminum Alloys 14. ABSTRACT 16. SECURITY...CLASSIFICATION OF: A fully coupled thermo-mechanical finite-element analysis of the friction-stir welding (FSW) process developed in our previous work

  16. Superhydrophobicity enhancement through substrate flexibility.

    Science.gov (United States)

    Vasileiou, Thomas; Gerber, Julia; Prautzsch, Jana; Schutzius, Thomas M; Poulikakos, Dimos

    2016-11-22

    Inspired by manifestations in nature, microengineering and nanoengineering of synthetic materials to achieve superhydrophobicity has been the focus of much work. Generally, hydrophobicity is enhanced through the combined effects of surface texturing and chemistry; being durable, rigid materials are the norm. However, many natural and technical surfaces are flexible, and the resulting effect on hydrophobicity has been largely ignored. Here, we show that the rational tuning of flexibility can work synergistically with the surface microtexture or nanotexture to enhance liquid repellency performance, characterized by impalement and breakup resistance, contact time reduction, and restitution coefficient increase. Reduction in substrate areal density and stiffness imparts immediate acceleration and intrinsic responsiveness to impacting droplets (∼350 × g), mitigating the collision and lowering the impalement probability by ∼60% without the need for active actuation. Furthermore, we exemplify the above discoveries with materials ranging from man-made (thin steel or polymer sheets) to nature-made (butterfly wings).

  17. Kandungan merkuri pada substrat dasar di kawasan muara Krueng Sabee, Krueng Panga, dan Krueng Teunom, Kabupaten Aceh Jaya

    Directory of Open Access Journals (Sweden)

    Syahrul Purnawan

    2017-12-01

    Full Text Available The objective of this study was to determine the mercury content in sediment in the waters of Aceh Jaya coastal. The research was carried out in the Estuary of Krueng Sabee, Panga, and Teunom River on October 2015. Samples were analyzed using the Atomic Absorption Spectrophotometer (AAS at the Laboratory of Chemistry, Mathematics and Natural Sciences Faculty, Syiah Kuala University. It was found that the Hg content in sediment of Krueng Sabee, Panga, and Teunom were 0.76, 0.68, and 1.03 mg/kg, respectively. Hg metal content in the sediment at all stations remained below the threshold. Despite,  the correlation between Hg content and sediment size in this study was weak, but there was a tendency the finer sediment size the higher Hg content found in sediment. However, heavy metal from water was easier to be deposed and embedded in fine sediment. Tujuan dilakukannya penelitian ini adalah untuk mengetahui sebaran logam berat merkuri (Hg yang terkandung pada substrat dasar di beberapa muara sungai Kabupaten Aceh Jaya. Pengambilan data dilakukan pada Bulan Oktober 2015 di Krueng Sabee, Krueng Panga, dan Krueng Teunom. Sampel substrat diambil berdasarkan metode coring menggunakan pipa paralon, Atomic Absorption Spectrophotometer (AAS atau Spektrofotometer Serapan Atom digunakan untuk mendapatkan data kandungan logam berat Hg pada substrat, sementara metode ayak basah digunakan untuk mendapatkan data ukuran butiran. Kandungan merkuri (Hg dalam substrat Krueng Sabee, Krueng Panga, dan Krueng Teunom masing-masing adalah 0,76; 0,68 dan 1,03 mg/kg. Terlihat kecenderungan substrat dengan butiran yang halus mengandung kadar merkuri yang lebih tinggi, dimana sifat merkuri yang mudah berikatan dengan zat organik mempermudah pengendapan pada bentuk butiran yang halus.

  18. Experimental transmission of AA amyloidosis by injecting the AA amyloid protein into interleukin-1 receptor antagonist knockout (IL-1raKO) mice.

    Science.gov (United States)

    Watanabe, K; Uchida, K; Chambers, J K; Tei, M; Shoji, A; Ushio, N; Nakayama, H

    2015-05-01

    The incidence of AA amyloidosis is high in humans with rheumatoid arthritis and several animal species, including cats and cattle with prolonged inflammation. AA amyloidosis can be experimentally induced in mice using severe inflammatory stimuli and a coinjection of AA amyloid; however, difficulties have been associated with transmitting AA amyloidosis to a different animal species, and this has been attributed to the "species barrier." The interleukin-1 receptor antagonist knockout (IL-1raKO) mouse, a rodent model of human rheumatoid arthritis, has been used in the transmission of AA amyloid. When IL-1raKO and BALB/c mice were intraperitoneally injected with mouse AA amyloid together with a subcutaneous pretreatment of 2% AgNO3, all mice from both strains that were injected with crude or purified murine AA amyloid developed AA amyloidosis. However, the amyloid index, which was determined by the intensity of AA amyloid deposition, was significantly higher in IL-1raKO mice than in BALB/c mice. When IL-1raKO and BALB/c mice were injected with crude or purified bovine AA amyloid together with the pretreatment, 83% (5/6 cases) and 38% (3/8 cases) of IL-1raKO mice and 17% (1/6 cases) and 0% (0/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. Similarly, when IL-1raKO and BALB/c mice were injected with crude or purified feline AA amyloid, 33% (2/6 cases) and 88% (7/8 cases) of IL-1raKO mice and 0% (0/6 cases) and 29% (2/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. These results indicated that IL-1raKO mice are a useful animal model for investigating AA amyloidogenesis. © The Author(s) 2014.

  19. Quality Of Electrophotographic Prints On Foil Substrates

    Directory of Open Access Journals (Sweden)

    Rozália Szentgyörgyvölgyi

    2011-05-01

    Full Text Available Electrophotographic printing uses many types of substrates, our study focuses on plastic substrates. Six types ofregular and self-adhesive foil substrates were chosen to be printed using two electrophotographic presses: XeroxColour 1000 Press and Canon imagePress C7000VP. A test chart containing tone value scales and a set of samplesfor profiling was created, spectrophotomety and densitometry was applied to obtain the optical and colorimetricproperties of the substrates investigated. Xerox Color 1000 Press produced larger densities and tone value increaseon every type of substrate. The largest TVI values and reproducible colour gamut was observed on the smoothestfoil in case of both presses. Large colour differences were found between patches of full tone process colors on thedifferent substrates investigated.

  20. Observations of AA Tau requested to schedule XMM-Newton

    Science.gov (United States)

    Waagen, Elizabeth O.

    2013-08-01

    Dr. Hans Moritz Guenther (Harvard-Smithsonian Center for Astrophysics) has requested nightly observations of the classical T Tauri star AA Tau in order to schedule x-ray observations with XMM-Newton that have been planned for between 2013 August 15 and September 15. The purpose of the AAVSO observations is to determine whether AA Tau is at a suitable magnitude for the satellite observations. Taurus is difficult to observe during this time period but that is exactly why AAVSO assistance is needed! AA Tau is a morning object, and also, many of the professional ground-based telescopes are offline because of the US southwest monsoon season. Since it is critical to know the brightness of AA Tau, AAVSO observations will be truly essential. Nightly visual and snapshot (not more than once per night) observations beginning now and continuing through September 20 are needed. Coverage beginning ahead of the XMM window is requested because there is a one- to two-week lead time for the target to be inserted into the telescope schedule. Continuing the nightly observations a few days beyond the end of the XMM window will give better optical context for the x-ray data. AA Tau ranges between ~12.8V and ~16.1V; since December 2011 or earlier it has been at ~14.5V. The most recent observation in the AAVSO International Database shows it at 14.779V on 2013 Feb 5 (J. Roe, Bourbon, MO). Dr. Guenther writes, "AA Tau is surrounded by a thick accretion disk which is seen nearly edge-on. For decades the light curve of AA Tau showed regular eclipsing events when the accretion funnel rotated through the line of sight. However, earlier this year J. Bouvier and his group found that this behavior changed dramatically: AA Tau now seems to be deeply absorbed all the time (V band 14.5 mag). In collaboration with this group we will perform X-ray observations of AA Tau with the XMM-Newton satellite." Finder charts with sequence may be created using the AAVSO Variable Star Plo! tter (http

  1. The Pasadena Recommendations: Five Years After AAS Endorsement

    Science.gov (United States)

    Knezek, Patricia; Frattare, L.; Ulvestad, J.

    2010-01-01

    It has been five years since the AAS Council unanimously endorsed the document, known as "Equity Now: The Pasadena Recommendations for Gender Equality in Astronomy," in January 2005. This document was the main product of the conference entitled "Women in Astronomy II: Ten Years After” (WIA II), held in June 2003 in Pasadena, CA. Participants of that 2003 meeting assessed the progress for women in science, offering insights into causes of the slower advancement of women, and discussed strategies to accelerate the achievement of equality. These insights and strategies were then incorporated into the "Pasadena Recommendations" by the CSWA. It was subsequently released to the entire AAS community for review and comments prior to its endorsement by the AAS. We will discuss the Recommendations and their impact since the endorsement by the AAS, including the process that is in place for organizations and departments to formally endorse the Pasadena Recommendations, thus making an organizational commitment to their implementation (see http://www.aas.org/cswa/pasadena_endorse.html).

  2. Flexible three-dimensional printed antenna substrates

    Directory of Open Access Journals (Sweden)

    Syed Sheheryar Bukhari

    2015-08-01

    Full Text Available Flexible heterogeneous substrates have been constructed, using three-dimensional printing in a single process, by introducing air-filled slots. These substrates have been used to substantially reduce the substrate losses for a flexible microstrip patch antenna causing an increase in its radiation efficiency. By combining transverse magnetic (TM10 and TM01 modes the bandwidth of this antenna has also been increased.

  3. Phase-vanishing halolactonization of neat substrates

    OpenAIRE

    Windmon, Nicole; Dragojlovic, Veljko

    2008-01-01

    Summary Phase-vanishing reactions are triphasic reactions which involve a reagent, a liquid perfluoroalkane as a phase screen and a substrate. The perfluoroalkane does not dissolve any of the reactants and is used to separate them. Halolactonization of neat substrates under phase-vanishing conditions avoids use of both solvents and basic reaction conditions. Both γ,δ-alkenoic acids as well as the corresponding methyl esters are suitable substrates for phase-vanishing halolactonizations. The r...

  4. Experimental induction and oral transmission of avian AA amyloidosis in vaccinated white hens.

    Science.gov (United States)

    Murakami, Tomoaki; Muhammad, Naeem; Inoshima, Yasuo; Yanai, Tokuma; Goryo, Masanobu; Ishiguro, Naotaka

    2013-06-01

    Avian AA amyloidosis is commonly observed in adult birds afflicted with bacterial infections or chronic inflammatory disorders. Experimental AA amyloidosis in birds can be induced by repeated inflammatory stimulation, such as injection with casein or vaccination with oil-emulsified bacterins. However, the transmission of amyloidosis among avian species has not been studied well to date. In the present study, we confirm the potential induction of avian AA amyloidosis by inoculation of Salmonella enteritidis (SE) vaccine or Mycoplasma gallisepticum vaccine. To determine the transmission of chicken AA amyloidosis among white hens, we induced experimental AA amyloidosis in vaccinated chickens by intravenous or oral administration of chicken AA fibrils. Amyloid deposits were observed in chickens injected with SE and inoculated with chicken AA fibrils intravenously (21/26: 81%) and orally (8/12: 67%). These results suggest that chicken AA amyloidosis can be induced by vaccinations, and may be transmitted among like species by oral administration.

  5. Dancing drops over vibrating substrates

    Science.gov (United States)

    Borcia, Rodica; Borcia, Ion Dan; Helbig, Markus; Meier, Martin; Egbers, Christoph; Bestehorn, Michael

    2017-04-01

    We study the motion of a liquid drop on a solid plate simultaneously submitted to horizontal and vertical harmonic vibrations. The investigation is done via a phase field model earlier developed for describing static and dynamic contact angles. The density field is nearly constant in every bulk region (ρ = 1 in the liquid phase, ρ ≈ 0 in the vapor phase) and varies continuously from one phase to the other with a rapid but smooth variation across the interfaces. Complicated explicit boundary conditions along the interface are avoided and captured implicitly by gradient terms of ρ in the hydrodynamic basic equations. The contact angle θ is controlled through the density at the solid substrate ρ S , a free parameter varying between 0 and 1 [R. Borcia, I.D. Borcia, M. Bestehorn, Phys. Rev. E 78, 066307 (2008)]. We emphasize the swaying and the spreading modes, earlier theoretically identified by Benilov and Billingham via a shallow-water model for drops climbing uphill along an inclined plane oscillating vertically [E.S. Benilov, J. Billingham, J. Fluid Mech. 674, 93 (2011)]. The numerical phase field simulations will be completed by experiments. Some ways to prevent the release of the dancing drops along a hydrophobic surface into the gas atmosphere are also discussed in this paper.

  6. Carnosinases, Their Substrates and Diseases

    Directory of Open Access Journals (Sweden)

    Francesco Bellia

    2014-02-01

    Full Text Available Carnosinases are Xaa-His dipeptidases that play diverse functions throughout all kingdoms of life. Human isoforms of carnosinase (CN1 and CN2 under appropriate conditions catalyze the hydrolysis of the dipeptides carnosine (β-alanyl-L-histidine and homocarnosine (γ-aminobutyryl-L-histidine. Alterations of serum carnosinase (CN1 activity has been associated with several pathological conditions, such as neurological disorders, chronic diseases and cancer. For this reason the use of carnosinase levels as a biomarker in cerebrospinal fluid (CSF has been questioned. The hydrolysis of imidazole-related dipeptides in prokaryotes and eukaryotes is also catalyzed by aminoacyl-histidine dipeptidases like PepD (EC 3.4.13.3, PepV (EC 3.4.13.19 and anserinase (EC 3.4.13.5. The review deals with the structure and function of this class of enzymes in physiological and pathological conditions. The main substrates of these enzymes, i.e., carnosine, homocarnosine and anserine (β-alanyl-3-methyl-L-histidine will also be described.

  7. Data of evolutionary structure change: 1N3AA-2NOZA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available EEAHKALCILPGVGTKVADCICLMALDKPQAVPVQVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQ ...EEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTT--AKGPCPQTNKELGNFFRSLWGPYAGWAFAVLFSADL-- ...> 2NOZA WHPTT--AKGPC -- ...> 1N3AA WHPTTSQAKGPS

  8. Identification of Eps15 as antigen recognized by the monoclonal antibodies aa2 and ab52 of the Wuerzburg Hybridoma Library against Drosophila brain.

    Directory of Open Access Journals (Sweden)

    Partho Halder

    Full Text Available The Wuerzburg Hybridoma Library against the Drosophila brain represents a collection of around 200 monoclonal antibodies that bind to specific structures in the Drosophila brain. Here we describe the immunohistochemical staining patterns, the Western blot signals of one- and two-dimensional electrophoretic separation, and the mass spectrometric characterization of the target protein candidates recognized by the monoclonal antibodies aa2 and ab52 from the library. Analysis of a mutant of a candidate gene identified the Drosophila homolog of the Epidermal growth factor receptor Pathway Substrate clone 15 (Eps15 as the antigen for these two antibodies.

  9. Displaying Now-Understanding: The Finnish Change-of-State Token "aa"

    Science.gov (United States)

    Koivisto, Aino

    2015-01-01

    This article discusses the use of the Finnish change-of-state token "aa" that has previously not been identified. The central claim is that even though "aa" indicates a cognitive shift experienced by the speaker, it does not function as a receipt of new information. Instead, the token "aa" indicates that the speaker…

  10. An Analysis of the Rise and Fall of the AA-MAS Policy

    Science.gov (United States)

    Lazarus, Sheryl S.; Thurlow, Martha L.; Ysseldyke, James E.; Edwards, Lynn M.

    2015-01-01

    In 2005, to address concerns about students who might fall in the "gap" between the regular assessment and the alternate assessment based on alternate achievement standards (AA-AAS), the U.S. Department of Education announced that states could develop alternate assessments based on modified achievement standards (AA-MAS). This article…

  11. Surface Modification of Nanocellulose Substrates

    Science.gov (United States)

    Zoppe, Justin Orazio

    Cellulose fibers constitute an important renewable raw material that is utilized in many commercial applications in non-food, paper, textiles and composite materials. Chemical functionalization is an important approach for improving the properties of cellulose based materials. Different approaches are used to graft polymeric chains onto cellulose substrates, which can be classified by two principal routes, namely 'grafting onto' or 'grafting from' methods. Never-dried cellulose nanocrystals (CNCs) or nanowhiskers produced from sulfuric acid hydrolysis of ramie fibers were used as substrates for surface chemical functionalization with various macromolecules. In addition, the use of cellulose nanocrystals to reinforce poly(epsilon-caprolactone) (PCL) nanofibers was studied. Chemical grafting with low molecular weight polycaprolactone diol onto cellulose nanocrystals was carried out in an attempt to improve the interfacial adhesion with the fiber matrix. Significant improvements in the mechanical properties of the nanofibers after reinforcement with unmodified cellulose nanocrystals were confirmed. Fiber webs from PCL reinforced with 2.5% unmodified CNCs showed ca. 1.5-fold increase in Young's modulus and ultimate strength compared to PCL webs. The CNCs were also grafted with poly(N-isopropylacrylamide) (poly(NiPAAm)) brushes via surface-initiated single-electron transfer living radical polymerization (SI-SETLRP) under various conditions at room temperature. The grafting process depended on the initiator and/or monomer concentrations used. No observable damage occurred to the CNCs after grafting, as determined by X-ray diffraction. Size exclusion chromatography analyses of polymer chains cleaved from the cellulose nanocrystals indicated that a higher degree of polymerization was achieved by increasing initiator or monomer loading, most likely caused by local heterogeneities yielding higher rates of polymerization. In addition, the colloidal stability and thermo

  12. [A rare concurrence of polymyalgia rheumatica and AA-amyloidosis].

    Science.gov (United States)

    Radenska-Lopovok, S G; Kotenko, O N; Frolova, N F; Zagrebneva, A I; Stolyarevich, E S; Volodina, E V; Chervinko, V I; Kryukov, E V; Zubkin, M L

    2017-01-01

    Polymyalgia rheumatica (PMR) is a rare chronic inflammatory disease. It predominantly affects the elderly. The disease has a slow onset, pain and stiffness in the muscles of the shoulder and pelvic girdle, fever, weight loss, and a high acute-phase inflammatory response. The disease is concurrent with giant cell arteritis in a quarter of cases, which allows some authors to consider them as two different manifestations of the same pathological process. The kidneys are rarely involved. This disease is rarely complicated by AA amyloidosis. The authors describe a case of RPM in a patient who has developed secondary AA amyloidosis.

  13. Wear Behaviour of Carbon Nanotubes Reinforced Nanocrystalline AA 4032 Composites

    Science.gov (United States)

    Senthil Saravanari, M. S.; Kumaresh Babu, S. P.; Sivaprasad, K.

    2016-09-01

    The present paper emphasizes the friction and wear properties of Carbon Nanotubes reinforced AA 4032 nanocomposites prepared by powder metallurgy technique. CNTs are multi-wall in nature and prepared by electric arc discharge method. Multi-walled CNTs are blended with AA 4032 elemental powders and compaction followed by sintering to get bulk nanocomposites. The strength of the composites has been evaluated by microhardness and the surface contact between the nanocomposites and EN 32 steel has been evaluated by Pin on disk tester. The results are proven that reinforcement of CNTs play a major role in the enhancement of hardness and wear.

  14. Outcomes From AAS Hack Day at the 227th AAS Meeting

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts

  15. Direct transfer of graphene onto flexible substrates.

    Science.gov (United States)

    Martins, Luiz G P; Song, Yi; Zeng, Tingying; Dresselhaus, Mildred S; Kong, Jing; Araujo, Paulo T

    2013-10-29

    In this paper we explore the direct transfer via lamination of chemical vapor deposition graphene onto different flexible substrates. The transfer method investigated here is fast, simple, and does not require an intermediate transfer membrane, such as polymethylmethacrylate, which needs to be removed afterward. Various substrates of general interest in research and industry were studied in this work, including polytetrafluoroethylene filter membranes, PVC, cellulose nitrate/cellulose acetate filter membranes, polycarbonate, paraffin, polyethylene terephthalate, paper, and cloth. By comparing the properties of these substrates, two critical factors to ensure a successful transfer on bare substrates were identified: the substrate's hydrophobicity and good contact between the substrate and graphene. For substrates that do not satisfy those requirements, polymethylmethacrylate can be used as a surface modifier or glue to ensure successful transfer. Our results can be applied to facilitate current processes and open up directions for applications of chemical vapor deposition graphene on flexible substrates. A broad range of applications can be envisioned, including fabrication of graphene devices for opto/organic electronics, graphene membranes for gas/liquid separation, and ubiquitous electronics with graphene.

  16. Cellulose Nanofiber Composite Substrates for Flexible Electronics

    Science.gov (United States)

    Ronald Sabo; Jung-Hun Seo; Zhenqiang Ma

    2012-01-01

    Flexible electronics have a large number of potential applications including malleable displays and wearable computers. The current research into high-speed, flexible electronic substrates employs the use of plastics for the flexible substrate, but these plastics typically have drawbacks, such as high thermal expansion coefficients. Transparent films made from...

  17. Metal oxide nanorod arrays on monolithic substrates

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Pu-Xian; Guo, Yanbing; Ren, Zheng

    2018-01-02

    A metal oxide nanorod array structure according to embodiments disclosed herein includes a monolithic substrate having a surface and multiple channels, an interface layer bonded to the surface of the substrate, and a metal oxide nanorod array coupled to the substrate surface via the interface layer. The metal oxide can include ceria, zinc oxide, tin oxide, alumina, zirconia, cobalt oxide, and gallium oxide. The substrate can include a glass substrate, a plastic substrate, a silicon substrate, a ceramic monolith, and a stainless steel monolith. The ceramic can include cordierite, alumina, tin oxide, and titania. The nanorod array structure can include a perovskite shell, such as a lanthanum-based transition metal oxide, or a metal oxide shell, such as ceria, zinc oxide, tin oxide, alumina, zirconia, cobalt oxide, and gallium oxide, or a coating of metal particles, such as platinum, gold, palladium, rhodium, and ruthenium, over each metal oxide nanorod. Structures can be bonded to the surface of a substrate and resist erosion if exposed to high velocity flow rates.

  18. Alternative substrates for cultivating oyster mushrooms ( Pleurotus ...

    African Journals Online (AJOL)

    Wheat straw has generally been used as the main substrate for cultivating oyster mushrooms (Pleurotus ostreatus); however, in South Africa it is becoming expensive for small-scale farmers to utilise. Therefore, the main objective of the study was to investigate the use of alternative, but suitable substrates for planting oyster ...

  19. Microbial growth and substrate utilization kinetics | Okpokwasili ...

    African Journals Online (AJOL)

    Microbial growth on and utilization of environmental contaminants as substrates have been studied by many researchers. Most times, substrate utilization results in removal of chemical contaminant, increase in microbial biomass and subsequent biodegradation of the contaminant. These are all aimed at detoxification of the ...

  20. Organism-substrate relationships in lowland streams

    NARCIS (Netherlands)

    Tolkamp, H.H.

    1980-01-01

    A field and laboratory study on the microdistribution of bottom dwelling macroinvertebrates to investigate the role of the stream substrate In the development and preservation of the macroinvertebrate communities in natural, undisturbed lowland streams is described. Field data on bottom substrates

  1. AFM plough YBCO micro bridges: substrate effects

    CSIR Research Space (South Africa)

    Elkaseh, A

    2009-04-01

    Full Text Available AFM nanolithography was used as a novel cutting technique to define micro-size YBCO superconducting constrictions. Researchers studied the substrate effects on MgO and STO substrates and showed that the observed Shapiro steps from the bridges on STO...

  2. Substrate Deformation Curvatures Due to Film Mismatch Strain for Spatially Varying Substrate and Film Thicknesses (Preprint)

    Science.gov (United States)

    2017-04-13

    AFRL-RX-WP-JA-2017-0338 SUBSTRATE DEFORMATION CURVATURES DUE TO FILM MISMATCH STRAIN FOR SPATIALLY VARYING SUBSTRATE AND FILM ...22 July 2013 – 13 March 2017 4. TITLE AND SUBTITLE SUBSTRATE DEFORMATION CURVATURES DUE TO FILM MISMATCH STRAIN FOR SPATIALLY VARYING SUBSTRATE...AND FILM THICKNESSES (PREPRINT) 5a. CONTRACT NUMBER IN-HOUSE 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 1) Craig P

  3. A signal-substrate match in the substrate-borne component of a multimodal courtship display

    Directory of Open Access Journals (Sweden)

    Damian O. ELIAS, Andrew C. MASON, Eileen A. HEBETS

    2010-06-01

    Full Text Available The environment can impose strong limitations on the efficacy of signal transmission. In particular, for vibratory communication, the signaling environment is often extremely heterogeneous at very small scales. Nevertheless, natural selection is expected to select for signals well-suited to effective transmission. Here, we test for substrate-dependent signal efficacy in the wolf spider Schizocosa stridulans Stratton 1991. We first explore the transmission characteristics of this important signaling modality by playing recorded substrate-borne signals through three different substrates (leaf litter, pine litter, and red clay and measuring the propagated signal. We found that the substrate-borne signal of S. stridulans attenuates the least on leaf litter, the substrate upon which the species is naturally found. Next, by assessing mating success with artificially muted and non-muted males across different signaling substrates (leaf litter, pine litter, and sand, we explored the relationship between substrate-borne signaling and substrate for mating success. We found that muted males were unsuccessful in obtaining copulations regardless of substrate, while mating success was dependent on the signaling substrate for non-muted males. For non-muted males, more males copulated on leaf litter than any other substrate. Taken together, these results confirm the importance of substrate-borne signaling in S. stridulans and suggest a match between signal properties and signal efficacy – leaf litter transmits the signal most effectively and males are most successful in obtaining copulations on leaf litter [Current Zoology 56 (3: 370–378, 2010].

  4. Electron mobility calculation for graphene on substrates

    Energy Technology Data Exchange (ETDEWEB)

    Hirai, Hideki; Ogawa, Matsuto [Department of Electrical and Electronic Engineering, Graduate School of Engineering, Kobe University, 1-1, Rokko-dai, Nada-ku, Kobe 657-8501 (Japan); Tsuchiya, Hideaki, E-mail: tsuchiya@eedept.kobe-u.ac.jp [Department of Electrical and Electronic Engineering, Graduate School of Engineering, Kobe University, 1-1, Rokko-dai, Nada-ku, Kobe 657-8501 (Japan); Japan Science and Technology Agency, CREST, Chiyoda, Tokyo 102-0075 (Japan); Kamakura, Yoshinari; Mori, Nobuya [Japan Science and Technology Agency, CREST, Chiyoda, Tokyo 102-0075 (Japan); Division of Electrical, Electronic and Information Engineering, Graduate School of Engineering, Osaka University, Suita, Osaka 565-0871 (Japan)

    2014-08-28

    By a semiclassical Monte Carlo method, the electron mobility in graphene is calculated for three different substrates: SiO{sub 2}, HfO{sub 2}, and hexagonal boron nitride (h-BN). The calculations account for polar and non-polar surface optical phonon (OP) scatterings induced by the substrates and charged impurity (CI) scattering, in addition to intrinsic phonon scattering in pristine graphene. It is found that HfO{sub 2} is unsuitable as a substrate, because the surface OP scattering of the substrate significantly degrades the electron mobility. The mobility on the SiO{sub 2} and h-BN substrates decreases due to CI scattering. However, the mobility on the h-BN substrate exhibits a high electron mobility of 170 000 cm{sup 2}/(V·s) for electron densities less than 10{sup 12 }cm{sup −2}. Therefore, h-BN should be an appealing substrate for graphene devices, as confirmed experimentally.

  5. Modelling substrate specificity and enantioselectivity for lipases and esterases by substrate-imprinted docking

    Directory of Open Access Journals (Sweden)

    Tyagi Sadhna

    2009-06-01

    Full Text Available Abstract Background Previously, ways to adapt docking programs that were developed for modelling inhibitor-receptor interaction have been explored. Two main issues were discussed. First, when trying to model catalysis a reaction intermediate of the substrate is expected to provide more valid information than the ground state of the substrate. Second, the incorporation of protein flexibility is essential for reliable predictions. Results Here we present a predictive and robust method to model substrate specificity and enantioselectivity of lipases and esterases that uses reaction intermediates and incorporates protein flexibility. Substrate-imprinted docking starts with covalent docking of reaction intermediates, followed by geometry optimisation of the resulting enzyme-substrate complex. After a second round of docking the same substrate into the geometry-optimised structures, productive poses are identified by geometric filter criteria and ranked by their docking scores. Substrate-imprinted docking was applied in order to model (i enantioselectivity of Candida antarctica lipase B and a W104A mutant, (ii enantioselectivity and substrate specificity of Candida rugosa lipase and Burkholderia cepacia lipase, and (iii substrate specificity of an acetyl- and a butyrylcholine esterase toward the substrates acetyl- and butyrylcholine. Conclusion The experimentally observed differences in selectivity and specificity of the enzymes were reproduced with an accuracy of 81%. The method was robust toward small differences in initial structures (different crystallisation conditions or a co-crystallised ligand, although large displacements of catalytic residues often resulted in substrate poses that did not pass the geometric filter criteria.

  6. The effect of atmospheric corona treatment on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.

    2010-01-01

    The effect of atmospheric corona discharge on AM 050 aluminium surface was investigated using electrochemical polarization, SEM-EDX, FIB-SEM. and XPS. The corona treatment was performed with varying time (1, 5, and 15 min) in atmospheric air. A 200 nm oxide layer was generated on AA1050 after...

  7. Impact toughness of laser alloyed aluminium AA1200 alloys

    CSIR Research Space (South Africa)

    Mabhali, Luyolo AB

    2013-08-01

    Full Text Available Laser surface alloying of aluminium AA1200 was performed with a 4kW Nd:YAG laser and impact resistance of the alloys was investigated. The alloying powders were a mixture of Ni, Ti and SiC in different proportions. Surfaces reinforced...

  8. Churg-Strauss syndrome associated with AA amyloidosis: a case ...

    African Journals Online (AJOL)

    Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/μL), positive ...

  9. Systemic AA amyloidosis in the red fox (Vulpes vulpes).

    Science.gov (United States)

    Rising, Anna; Cederlund, Ella; Palmberg, Carina; Uhlhorn, Henrik; Gaunitz, Stefan; Nordling, Kerstin; Ågren, Erik; Ihse, Elisabet; Westermark, Gunilla T; Tjernberg, Lars; Jörnvall, Hans; Johansson, Jan; Westermark, Per

    2017-11-01

    Amyloid A (AA) amyloidosis occurs spontaneously in many mammals and birds, but the prevalence varies considerably among different species, and even among subgroups of the same species. The Blue fox and the Gray fox seem to be resistant to the development of AA amyloidosis, while Island foxes have a high prevalence of the disease. Herein, we report on the identification of AA amyloidosis in the Red fox (Vulpes vulpes). Edman degradation and tandem MS analysis of proteolyzed amyloid protein revealed that the amyloid partly was composed of full-length SAA. Its amino acid sequence was determined and found to consist of 111 amino acid residues. Based on inter-species sequence comparisons we found four residue exchanges (Ser31, Lys63, Leu71, Lys72) between the Red and Blue fox SAAs. Lys63 seems unique to the Red fox SAA. We found no obvious explanation to how these exchanges might correlate with the reported differences in SAA amyloidogenicity. Furthermore, in contrast to fibrils from many other mammalian species, the isolated amyloid fibrils from Red fox did not seed AA amyloidosis in a mouse model. © 2017 The Protein Society.

  10. Contribution to comprehensive study of aluminium alloy Aa 5083 ...

    African Journals Online (AJOL)

    Corrosion induced by elemental mercury in aqueous media of industrial Aluminium alloys AA5083 used in heat exchanger industries of natural gas liquefaction has been studied by linear sweep voltammétry on rotating amalgamated disk electrode. Corrosion process depends on: • Chemical processes of amalgamation of ...

  11. Making ET AAS Determination Less Dependent on Vapourization ...

    African Journals Online (AJOL)

    NICO

    bGerman Aerospace Center, PT-SW, 12489 Berlin, Germany. Received 4 December 2012, revised 5 May 2013, accepted 7 May 2013. ABSTRACT. The quantification of the analytes in ET AAS is normally attained by the measurement and integration of transient absorbance. High degree of atomization and constant vapour ...

  12. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. See also 7906190, 7906193.

  13. Three body abrasion of laser surface alloyed aluminium AA1200

    CSIR Research Space (South Africa)

    Mabhali, Luyolo AB

    2012-06-01

    Full Text Available Laser surface alloying of aluminium AA1200 was performed with a 4 kW Nd:YAG laser to improve the abrasion wear resistance. Aluminium surfaces reinforced with metal matrix composites and intermetallic phases were achieved. The phases present depended...

  14. Abuse assessment screen (AAS) questionnaire: the Greek validation.

    Science.gov (United States)

    Antoniou, E; Ioannidi-Kapolou, E; Daglas, M; Vivilaki, V; Karamitros, D; Dafermos, G; Iatrakis, V

    2010-01-01

    Domestic violence is a social problem with increasing dimensions worldwide. The various forms of abuse and especially violence during pregnancy have not been sufficiently studied by the Greek scientific community. The aim of this study was to translate, culturally adapt and validate a special research tool that can be used by health professionals as a diagnostic tool for violence during pregnancy. The Abuse Assessment Screen (AAS) questionnaire was chosen as a screening tool. The questionnaire was translated into Greek in accordance with the procedure suggested by the 'Trust Scientific Advisory Committee', followed by the cultural adaptation of the questionnaire to the Greek reality. Specific psychometric tests were used for the validation of the questionnaire in order to assess the questionnaire's reliability and validity, and a factor analysis was also carried out. The internal consistency for all the parties who were questioned (n = 262), as expressed by Cronbach's alpha coefficient for the AAS, was 0.806 which is quite satisfactory and the results of our study suggest that the Greek translation of the AAS has a high correlation index compared to relevant international studies. The AAS questionnaire in the Greek version seems to be a reliable and valid tool for the diagnosis of violence during pregnancy.

  15. Systemic AA amyloidosis in captive cheetahs (Acinonyx jubatus).

    Science.gov (United States)

    Papendick, R E; Munson, L; O'Brien, T D; Johnson, K H

    1997-11-01

    Ongoing disease surveillance of necropsied captive cheetahs (Acinonyx jubatus) (n = 141) revealed a high prevalence of renal amyloidosis (n = 54 [38%]; age 1 to 16 years). The prevalence increased from 20% in pre- 1990 necropsies to 70% of cheetahs necropsied in 1995. In 74% of the cheetahs with amyloidosis, renal failure was determined to be the sole or partial cause of death. Papillary necrosis was seen only in affected cheetahs and involved 25% of these animals. Amyloid was present predominantly in the medullary interstitium, with minimal glomerular involvement. The amyloid deposits were immunohistochemically identified as AA type using antisera to both human and canine protein AA. A high percentage (52%) of animals with renal amyloid also had subsinusoidal hepatic AA amyloid deposits. Inflammatory diseases were identified in 100% of affected cheetahs. The most common inflammatory disease was chronic lymphoplasmacytic gastritis. The prevalence and severity of gastritis was higher in cheetahs with amyloidosis, and the prevalence of severe gastritis increased from 16% to 43%, coinciding with the increase in prevalence of amyloidosis. These findings suggest that cheetahs have a high prevalence of systemic amyloidosis in response to inflammation and that renal amyloidosis is an increasingly significant cause of morbidity and mortality in captive cheetah populations. Factors of potential importance in the apparent high prevalence of AA amyloidosis in cheetahs are currently being investigated in our laboratories.

  16. Metallic coatings on silicon substrates, and methods of forming metallic coatings on silicon substrates

    Science.gov (United States)

    Branagan, Daniel J [Idaho Falls, ID; Hyde, Timothy A [Idaho Falls, ID; Fincke, James R [Los Alamos, NM

    2008-03-11

    The invention includes methods of forming a metallic coating on a substrate which contains silicon. A metallic glass layer is formed over a silicon surface of the substrate. The invention includes methods of protecting a silicon substrate. The substrate is provided within a deposition chamber along with a deposition target. Material from the deposition target is deposited over at least a portion of the silicon substrate to form a protective layer or structure which contains metallic glass. The metallic glass comprises iron and one or more of B, Si, P and C. The invention includes structures which have a substrate containing silicon and a metallic layer over the substrate. The metallic layer contains less than or equal to about 2 weight % carbon and has a hardness of at least 9.2 GPa. The metallic layer can have an amorphous microstructure or can be devitrified to have a nanocrystalline microstructure.

  17. Core-corona PSt/P(BA-AA) composite particles by two-stage emulsion polymerization

    Science.gov (United States)

    Xie, Delong; Ren, Xiaolin; Zhang, Xinya; Liao, Shijun

    2016-03-01

    Raspberry-shaped composite particles with polystyrene (PSt) as core and poly(n-butyl acrylate-co-acrylic acid) (P(BA-AA)) as corona were synthesized via emulsion polymerization. The random copolymer, P(BA-AA), was pre-prepared and used as a polymeric surfactant, its emulsifying properties adjusted by changing the mass ratio of BA and AA. The morphology of the resulting core-corona composite particles, P(St/P(BA-AA)), could be regulated and controlled by varying the concentrations of P(BA-AA) or the mass ratio of BA:AA in P(BA-AA). The experimental results indicate that 3.0-6.0 wt% of P(BA-AA) is required to obtain stable composite emulsions, and P(BA-AA) with a mass ratio of BA:AA = 1:2 is able to generate distinct core-corona structures. A mechanism of composite particle formation is proposed based on the high affinity between the PSt core and the hydrophobic segments of P(BA-A). The regular morphology of the colloidal film is expected to facilitate potential application of core-corona particles in the field of light scattering. Furthermore, the diversity of core-corona particles can be expanded by replacing P(BA-AA) corona particles with other amphiphilic particles.

  18. Implantable biomedical devices on bioresorbable substrates

    Science.gov (United States)

    Rogers, John A; Kim, Dae-Hyeong; Omenetto, Fiorenzo; Kaplan, David L; Litt, Brian; Viventi, Jonathan; Huang, Yonggang; Amsden, Jason

    2014-03-04

    Provided herein are implantable biomedical devices, methods of administering implantable biomedical devices, methods of making implantable biomedical devices, and methods of using implantable biomedical devices to actuate a target tissue or sense a parameter associated with the target tissue in a biological environment. Each implantable biomedical device comprises a bioresorbable substrate, an electronic device having a plurality of inorganic semiconductor components supported by the bioresorbable substrate, and a barrier layer encapsulating at least a portion of the inorganic semiconductor components. Upon contact with a biological environment the bioresorbable substrate is at least partially resorbed, thereby establishing conformal contact between the implantable biomedical device and the target tissue in the biological environment.

  19. Study of Carbon Nanotube-Substrate Interaction

    Directory of Open Access Journals (Sweden)

    Jaqueline S. Soares

    2012-01-01

    Full Text Available Environmental effects are very important in nanoscience and nanotechnology. This work reviews the importance of the substrate in single-wall carbon nanotube properties. Contact with a substrate can modify the nanotube properties, and such interactions have been broadly studied as either a negative aspect or a solution for developing carbon nanotube-based nanotechnologies. This paper discusses both theoretical and experimental studies where the interaction between the carbon nanotubes and the substrate affects the structural, electronic, and vibrational properties of the tubes.

  20. Mass spectrometry-assisted protease substrate screening

    DEFF Research Database (Denmark)

    Schlüter, Hartmut; Rykl, Jana; Thiemann, Joachim

    2007-01-01

    Since sequencing of the human genome was completed, more than 500 genes have been annotated as proteases. Exploring the physiological role of each protease requires the identification of their natural substrates. However, the endogenous substrates of many of the human proteases are as yet unknown......-phase chromatography they are analyzed by tandem mass spectrometry and the substrates identified by database searching. The proof of principle in this study is demonstrated by incubating immobilized human plasma proteins with thrombin and by identifying by tandem mass spectrometry the fibrinopeptides, released...

  1. A Status Report on the AAS Astronomy Ambassadors Program

    Science.gov (United States)

    Fienberg, Richard Tresch; Fraknoi, Andrew; Gurton, Suzanne; Hurst, Anna; Schatz, Dennis L.

    2014-06-01

    The American Astronomical Society, in partnership with the Astronomical Society of the Pacific (ASP), has launched a series of professional-development workshops and a community of practice designed to improve early-career astronomers’ ability to communicate effectively with students and the public. Called AAS Astronomy Ambassadors, the program provides training and mentoring for young astronomers, from advanced undergraduates to beginning faculty; it also provides them access to resources and a network of contacts within the astronomy education and public outreach (EPO) community. Ambassadors are provided with a library of outreach activities and resource materials suitable for a range of venues and audiences. For much of this library we are using resources developed by organizations such as the ASP, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. After a period of evaluation and revision, the program’s “Menu of Outreach Opportunities for Science Education” (MOOSE) is now posted on the AAS website at http://aas.org/outreach/moose-menu-outreach-opportunities-science-education.The first two Astronomy Ambassadors workshops were held at AAS meetings in January 2013 and January 2014; each served 30 young astronomers chosen from about twice that many applicants. Web-based follow-up activities are being provided through a website at the ASP designed to keep cohorts of educators trained in their programs in touch with one another. The AAS is exploring ways to fund additional workshops at future winter meetings; suggestions are most welcome. Meanwhile, the Astronomy Ambassadors trained to date have logged more than 150 outreach events, reaching many thousands of children and adults across the U.S. and Canada.

  2. AA amyloidosis: Mount Sinai experience, 1997-2012.

    Science.gov (United States)

    Bunker, Daniel; Gorevic, Peter

    2012-01-01

    AA amyloidosis is a systemic disease characterized by the extracellular deposition of amyloid fibrils derived from the acute-phase reactant serum amyloid A protein. It is typically a consequence of chronic inflammatory conditions like rheumatoid arthritis or Crohn's disease, although more patients are being identified who have more unusual causes or no known inflammatory stimulus. We performed a retrospective chart review of all patients with AA amyloidosis seen at Mount Sinai during the period of 1997-2012. Particular attention was paid to the patients' underlying diseases, extent of organ involvement, levels of inflammatory markers and proinflammatory cytokines, presence of pyrin gene mutations, and outcomes. Forty-three patients were seen at Mount Sinai with AA amyloidosis during this period. The most common underlying diseases were rheumatoid arthritis (21%) and Crohn's disease (16%), though 21% of patients were considered to have idiopathic AA amyloid after an extensive search found no underlying inflammatory disease. Almost all patients (95%) had renal involvement based on biopsy or clinical criteria, with 19 patients (44%) eventually requiring dialysis and 5 (12%) undergoing renal transplantation. Inflammatory markers were elevated in most patients; however, interleukin-6 was the only consistently elevated cytokine. Three patients (of 9 tested) were found to be positive for the E148Q pyrin gene mutation. Our study confirms the increasing number of patients being seen with idiopathic AA amyloidosis. More research is needed to determine if these patients have an underlying genetic susceptibility encoded in pyrin or other genes. Our study also confirms the dominance of renal disease in this population. The elevated levels of interleukin-6, in comparison with other cytokines, could represent a therapeutic target. © 2012 Mount Sinai School of Medicine.

  3. Protein digestibility evaluations of meat and fish substrates using laboratory, avian, and ileally cannulated dog assays.

    Science.gov (United States)

    Faber, T A; Bechtel, P J; Hernot, D C; Parsons, C M; Swanson, K S; Smiley, S; Fahey, G C

    2010-04-01

    Meat and fish serve as important protein sources in the companion animal diet; however, limited protein digestibility data are available for assessing protein digestibility differences among good-quality protein sources. Beef loin, pork loin, chicken breast, pollock fillet, and salmon fillet were evaluated for composition, protein digestibility, and AA bioavailability using the immobilized digestive enzyme assay, cecectomized rooster assay, and ileally cannulated dog assay. Pollock contained the greatest amount of CP, total essential AA (TEAA), and total nonessential AA (TNEAA; DM basis; 96.9, 38.6, and 50.3%, respectively). Salmon contained the next greatest amounts (92.8, 36.4, and 44.6%), followed by chicken (90.3, 36.1, 43.2%). Beef had the least CP content (82.7%), but had slightly greater TEAA and TNEAA concentrations (33.9, 42.0%) compared with pork (86.2, 33.6, 41.3%). Immobilized digestive enzyme assay values were greatest for pollock fillet (0.71) and least for chicken breast (0.52). Beef loin, pork loin, and salmon fillet were similar (0.63, 0.62, and 0.64, respectively). Standardized TEAA and TNEAA digestibility coefficients, evaluated using the cecectomized rooster assay, were greatest (P protein source. No significant differences (P > 0.05) were found in ileal digestibility of protein. Values ranged from 88.9% for chicken to 90.5% for pork loin and pollock fillet. Ileal TEAA and TNEAA coefficients were not different among test substrates, with values between 91.7 and 92.7%, and 88.8 and 90.4%, respectively. Total tract CP apparent digestibility values ranged from 94.4 to 94.8%, with no differences noted among treatments. Despite marked differences in composition and predicted and standardized digestibility values, when the protein sources were added to diets at a concentration of approximately 30% (25% of total energy intake), no differences in test protein substrates were noted in either ileal or total tract nutrient digestibility.

  4. Wafer bonded virtual substrate and method for forming the same

    Science.gov (United States)

    Atwater, Jr., Harry A. (Inventor); Zahler, James M. (Inventor); Morral, Anna Fontcuberta i (Inventor)

    2007-01-01

    A method of forming a virtual substrate comprised of an optoelectronic device substrate and handle substrate comprises the steps of initiating bonding of the device substrate to the handle substrate, improving or increasing the mechanical strength of the device and handle substrates, and thinning the device substrate to leave a single-crystal film on the virtual substrate such as by exfoliation of a device film from the device substrate. The handle substrate is typically Si or other inexpensive common substrate material, while the optoelectronic device substrate is formed of more expensive and specialized electro-optic material. Using the methodology of the invention a wide variety of thin film electro-optic materials of high quality can be bonded to inexpensive substrates which serve as the mechanical support for an optoelectronic device layer fabricated in the thin film electro-optic material.

  5. Flexible and foldable paper-substrate thermoelectric generator (teg)

    KAUST Repository

    Rojas, Jhonathan Prieto

    2017-08-24

    Flexible and foldable paper-substrate thermoelectric generators (TEGs) and methods for making the paper-substrate TEGs are disclosed. A method includes depositing a plurality of thermocouples in series on a paper substrate to create a paper-substrate TEG, wherein the plurality of thermocouples is deposited between two contact points of the paper-substrate TEG. The method may also include setting the power density and maximum achievable temperature gradient of the paper-substrate TEG by folding the paper-substrate TEG. A paper-substrate TEG apparatus may include a paper substrate and a plurality of thermocouples deposited in series on the paper substrate between two contact points of the paper-substrate TEG, wherein the power density and maximum achievable temperature gradient of the paper-substrate TEG is set by folding the paper-substrate TEG.

  6. Property Evaluation of Friction Stir Welded Dissimilar Metals : AA6101-T6 and AA1350 Aluminium Alloys

    Directory of Open Access Journals (Sweden)

    Rajendran ASHOK KUMAR

    2017-02-01

    Full Text Available Next to copper, aluminium alloys are widely used in electrical industries, because of their high electrical conductivity. AA6101-T6 and AA1350 aluminium alloys are widely used in electrical bus bars. As these alloys are joined by mechanical fasteners in electrical bus bars, the conductive area has been reduced. To avoid this problem, they should be joined without removal of metal as well as their properties. Friction stir welding technique is mainly invented for joining similar and dissimilar aluminium alloys. In this investigation, friction stir welding of AA6101-T6 and AA1350 aluminium alloys was done by varying tool traversing speed, rotational speed and tilt angle with hexagonal pin profiled tool. The analysis of variance was employed to study the effect of above parameters on mechanical properties of welded joints. From the experimental results, it is observed that welded joint with the combination of 1070 rpm rotating speed, 78 mm/min traversing speed and 2° tilt angle provides better mechanical properties. Analysis of variance shows that most significant impact on tensile strength is made by variation in tool rotating speed while tool tilt angle makes the most significant impact on elongation and bending strength.DOI: http://dx.doi.org/10.5755/j01.ms.23.1.14132

  7. The substrate specificity of phospholipase A

    NARCIS (Netherlands)

    Deenen, L.L.M. van; Haas, Gerard H. de

    1963-01-01

    Investigations on variously modified analogues of phospholipids elucidated the following substrate characteristics for phospholipase A (Crotalus adamanteus). 1. 1. Within the class of α-phosphoglycerides -isomers are readily hydrolysed, while -α-phospholipids appeared not to be attacked. 2.

  8. Delamination of compressed films on curved substrates

    Science.gov (United States)

    Hutchinson, John W.

    2001-09-01

    Delamination is considered for thin elastic films that are bonded to cylindrical substrates and subject to an equi-biaxial compressive pre-stress. Results for both positive and negative curvatures are obtained. The film buckles or deflects (depending on the sign of the curvature) away from the substrate inducing mixed mode stress intensities at the edge of the delamination. The energy release rate and combination of modal stress intensities at the delamination edges are determined. Steady-state propagation of delamination blisters is analyzed for both axial and circumferential propagation directions. The results depend strongly on the substrate curvature. Circumferential propagation is suppressed when the curvature is negative, but is favored when the curvature is positive. Axial propagation can occur for both positive and negative curvature substrates.

  9. A semisynthetic epitope for kinase substrates.

    Science.gov (United States)

    Allen, Jasmina J; Li, Manqing; Brinkworth, Craig S; Paulson, Jennifer L; Wang, Dan; Hübner, Anette; Chou, Wen-Hai; Davis, Roger J; Burlingame, Alma L; Messing, Robert O; Katayama, Carol D; Hedrick, Stephen M; Shokat, Kevan M

    2007-06-01

    The ubiquitous nature of protein phosphorylation makes it challenging to map kinase-substrate relationships, which is a necessary step toward defining signaling network architecture. To trace the activity of individual kinases, we developed a semisynthetic reaction scheme, which results in the affinity tagging of substrates of the kinase in question. First, a kinase, engineered to use a bio-orthogonal ATPgammaS analog, catalyzes thiophosphorylation of its direct substrates. Second, alkylation of thiophosphorylated serine, threonine or tyrosine residues creates an epitope for thiophosphate ester-specific antibodies. We demonstrated the generality of semisynthetic epitope construction with 13 diverse kinases: JNK1, p38alpha MAPK, Erk1, Erk2, Akt1, PKCdelta, PKCepsilon, Cdk1/cyclinB, CK1, Cdc5, GSK3beta, Src and Abl. Application of this approach, in cells isolated from a mouse that expressed endogenous levels of an analog-specific (AS) kinase (Erk2), allowed purification of a direct Erk2 substrate.

  10. THE SYNTHESIS OF A TETRADECAPEPTIDE RENIN SUBSTRATE

    Science.gov (United States)

    Skeggs, Leonard T.; Lentz, Kenneth E.; Kahn, Joseph R.; Shumway, Norman P.

    1958-01-01

    A tetradecapeptide renin substrate having a biological activity comparable to the natural product and similar chemical properties has been synthesized by means of the carbobenzyloxyl azide and mixed anhydride methods. PMID:13575666

  11. Pressure-Sensitive Paint: Effect of Substrate

    Science.gov (United States)

    Quinn, Mark Kenneth; Yang, Leichao; Kontis, Konstantinos

    2011-01-01

    There are numerous ways in which pressure-sensitive paint can be applied to a surface. The choice of substrate and application method can greatly affect the results obtained. The current study examines the different methods of applying pressure-sensitive paint to a surface. One polymer-based and two porous substrates (anodized aluminum and thin-layer chromatography plates) are investigated and compared for luminescent output, pressure sensitivity, temperature sensitivity and photodegradation. Two luminophores [tris-Bathophenanthroline Ruthenium(II) Perchlorate and Platinum-tetrakis (pentafluorophenyl) Porphyrin] will also be compared in all three of the substrates. The results show the applicability of the different substrates and luminophores to different testing environments. PMID:22247685

  12. Phase-vanishing halolactonization of neat substrates.

    Science.gov (United States)

    Windmon, Nicole; Dragojlovic, Veljko

    2008-01-01

    Phase-vanishing reactions are triphasic reactions which involve a reagent, a liquid perfluoroalkane as a phase screen and a substrate. The perfluoroalkane does not dissolve any of the reactants and is used to separate them. Halolactonization of neat substrates under phase-vanishing conditions avoids use of both solvents and basic reaction conditions. Both gamma,delta-alkenoic acids as well as the corresponding methyl esters are suitable substrates for phase-vanishing halolactonizations. The reaction works well both on solid and liquid substrates and the products are obtained in good to excellent yields, particularly in the case of rigid bicyclic systems. Bromine (Br(2)) and iodine monochloride (ICl) are suitable electrophiles for bromolactonization and iodolactonization, respectively. Although in some cases iodine gave satisfactory yields of the corresponding iodolactone, it is generally inferior to iodine monochloride.

  13. Phase-vanishing halolactonization of neat substrates

    Directory of Open Access Journals (Sweden)

    2008-08-01

    Full Text Available Phase-vanishing reactions are triphasic reactions which involve a reagent, a liquid perfluoroalkane as a phase screen and a substrate. The perfluoroalkane does not dissolve any of the reactants and is used to separate them. Halolactonization of neat substrates under phase-vanishing conditions avoids use of both solvents and basic reaction conditions. Both γ,δ-alkenoic acids as well as the corresponding methyl esters are suitable substrates for phase-vanishing halolactonizations. The reaction works well both on solid and liquid substrates and the products are obtained in good to excellent yields, particularly in the case of rigid bicyclic systems. Bromine (Br2 and iodine monochloride (ICl are suitable electrophiles for bromolactonization and iodolactonization, respectively. Although in some cases iodine gave satisfactory yields of the corresponding iodolactone, it is generally inferior to iodine monochloride.

  14. Iron films deposited on porous alumina substrates

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, Yasuhiro, E-mail: yyasu@rs.kagu.tus.ac.jp; Tanabe, Kenichi; Nishida, Naoki [Tokyo University of Science (Japan); Kobayashi, Yoshio [The University of Electro-Communications (Japan)

    2016-12-15

    Iron films were deposited on porous alumina substrates using an arc plasma gun. The pore sizes (120 – 250 nm) of the substrates were controlled by changing the temperature during the anodic oxidation of aluminum plates. Iron atoms penetrated into pores with diameters of less than 160 nm, and were stabilized by forming γ-Fe, whereas α-Fe was produced as a flat plane covering the pores. For porous alumina substrates with pore sizes larger than 200 nm, the deposited iron films contained many defects and the resulting α-Fe had smaller hyperfine magnetic fields. In addition, only a very small amount of γ-Fe was obtained. It was demonstrated that the composition and structure of an iron film can be affected by the surface morphology of the porous alumina substrate on which the film is grown.

  15. Flexible Substrates Comparison for Pled Technology

    Science.gov (United States)

    Nenna, G.; Miscioscia, R.; Tassini, P.; Minarini, C.; Vacca, P.; Valentino, O.

    2008-08-01

    Flexible substrate displays are critical to organic electronics, e-paper's and e-ink's development. Many different types of materials are under investigation, including glass, polymer films and metallic foils. In this work we report a comparison study of polymer films as flexible substrates for polymer light emitting diodes (PLEDs) technology. The selected polymer substrates are two thermoplastic semi-crystalline polymers (PET and PEN) and a high Tg material that cannot be melt processed (PAR). Firstly, the chosen films were characterized in morphology and optical properties with the aim to confirm their suitability for optoelectronic applications. Transmittance was analysed by UV-Vis spectrophotometry and roughness by a surface profilometer. Finally, the surface energy of substrates (untreated and after UV-ozone treatment) was estimated by contact angle measurements in order to evaluate their wettability for active materials deposition.

  16. Flexible electrowetting and electrowetting on flexible substrates

    Science.gov (United States)

    Steckl, Andrew J.; You, Han; Kim, Duk-Young

    2011-03-01

    Electrowetting (EW) technology is shown to be quite flexible in operation and able to operate on flexible substrates. Complementary ON/OFF characteristics of EW devices have been obtained through a plasma irradiation and annealing process. This enables the design of EW array operation in a reduced power mode. Examples of EW operation on flexible substrates are discussed. This includes paper, plastic and metal substrates. Prototypes of flexible EW arrays on plastic substrates are demonstrated to switch reversibly by applying a low voltage difference (20 V). The array operation is maintained even when the display is mechanically flexed. These results indicate the promise of flexible EW devices for mobile and other devices, including video rate flexible e-paper.

  17. Flexible SERS Substrates: Challenges and Opportunities

    Science.gov (United States)

    2016-01-28

    photochemistry of three types of molecules isolated in alkanethiolate SAMs: the photoisomerization of azobenzene , the photo-isomerization of dihydroazulene...and the photoreaction of anthracene derivatives . The opportunities and challenges of employing flexible SERS substrates to further improve these

  18. Mueller matrix characterization of flexible plastic substrates

    Science.gov (United States)

    Hong, Nina; Synowicki, Ron A.; Hilfiker, James N.

    2017-11-01

    This work reports on Mueller matrix spectroscopic ellipsometry characterization of various flexible plastic substrates that are optically anisotropic with varying degrees of birefringence. The samples are divided into three groups according to the suggested characterization strategy: low birefringence, high birefringence, and twisted birefringence. The first group includes poly(methyl methacrylate) and cyclic olefin copolymer substrates. These are modeled with biaxial anisotropy for the real part of the refractive index while the imaginary part is approximated as isotropic due to small light absorption. The second group includes polyethylene terephthalate and polyethylene naphthalate substrates, which are modeled with biaxial anisotropy for both real and imaginary refractive indices. Lastly, a polyimide substrate is described as two birefringent layers with twisted in-plane orientation.

  19. Improved corrosion protection of aluminum alloys by low-temperature plasma interface engineering

    Science.gov (United States)

    Reddy, Chandra Mudupu

    The System Approach Interface Engineering (SAIE) concept was employed to develop corrosion protection processes for aluminum (Al) alloys by application of a low temperature plasma interface engineering technique with a cathodic electrocoat (E-coat) as the primary layer coating. The SAIE concept emphasizes that the corrosion protection property of the coated system for Al alloys depends on the total system rather than any good corrosion protection component of the system. The cathodic E-coated SAIE plasma pretreatments on Alclad 2024-T3, 2024-T3 bare and 7075-T6 bare alloys showed excellent corrosion resistance property when tested by SO2 and Prohesion salt spray tests. These systems out performed the conventional conversion coated controls, chromate conversion coated then Deft primer coated (CC Deft) and chromate conversion coated then cathodic E-coated (CC E-coat) in both the corrosion testes. The corrosion protection by SAIE systems depends on three major factors; (1) improved barrier characteristics of E-coat, (2) water insensitive adhesion of E-coat to plasma polymers deposited in a DC discharge and (3) creating a stable surface oxide layer by plasma treatment or chemical cleaning. Different chemical pretreatments were employed to create a stable barrier type aluminum oxide layer on the surfaces of the substrates prior to plasma polymer deposition. The surface analysis showed that these pretreatments depend on the type of alloy and surface chemistry. As received surfaces with acetone wipe and plasma cleaning of the organic contaminants was found to be best for Alclad 2024-T3 alloy. Chemical alkaline cleaning for 2024-T3 bare and alkaline cleaning followed by deoxidization for 7075-T6 bare alloy were necessary. The adhesion of the cathodic E-coat was improved by surface energy matching techniques by deposition of various plasma polymer films of trimethylsilane (TMS) and mixtures of TMS with O2, H2, and N2. The adhesion performance evaluated by the N

  20. TITANIA-COATINGS ON STRONGLY PASSIVATED SUBSTRATES

    OpenAIRE

    Haenni, W.; Hintermann, H.; Morel, D.; Simmen, A.

    1989-01-01

    Titanium oxide can be deposited by pyrolysis of the corresponding alkoxide on metallic substrates after their preoxidation by water-vapor. To improve adhesion, the natural oxide film has first to be removed mechanically and/or chemically from the strongly passivated substrates, such as aluminium, titanium, alloys thereof, stainless steel and super-alloys. To completely remove the oxide film on AISI 316L stainless steel and similar alloys, chemical vapor etching is necessary. The preoxidation ...

  1. Substrates and method for determining enzymes

    Science.gov (United States)

    Smith, R.E.; Bissell, E.R.

    1981-10-13

    A method is disclosed for determining the presence of an enzyme in a biological fluid, which includes the steps of contacting the fluid with a synthetic chromogenic substrate, which is an amino acid derivative of 7-amino-4-trifluoromethylcoumarin; incubating the substrate-containing fluid to effect enzymatic hydrolysis; and fluorometrically determining the presence of the free 7-amino-4-trifluoromethylcoumarin chromophore in the hydrolyzate. No Drawings

  2. Biochemicalmethane potential (BMP) of solid organic substrates

    DEFF Research Database (Denmark)

    Raposo, F.; Fernández-Cegrí, V.; de la Rubia, M.A.

    2011-01-01

    BACKGROUND: This paper describes results obtained for different participating research groups in an interlaboratory study related to biochemical methane potential (BMP). In this research work, all experimental conditions influencing the test such as inoculum, substrate characteristics and experim......BACKGROUND: This paper describes results obtained for different participating research groups in an interlaboratory study related to biochemical methane potential (BMP). In this research work, all experimental conditions influencing the test such as inoculum, substrate characteristics...

  3. Wet etching methods for perovskite substrates

    NARCIS (Netherlands)

    Leca, V.; Rijnders, Augustinus J.H.M.; Koster, Gertjan; Blank, David H.A.; Rogalla, Horst

    2000-01-01

    In oxide electronics substrates with atomically flat terraces are a request for growing high-quality epitaxial thin films. In this paper results on chemical etching of some substrates with perovskite, ABO3, structure (e.g., SrTiO3, LSAT - the (LaAlO3)0.3(Sr2AlTaO6)0.35 solid solution, and NdGaO3)

  4. RF transmission lines on silicon substrates

    OpenAIRE

    Ponchak, George E.

    1999-01-01

    A review of RF transmission lines on silicon substrates is presented. Through measurements and calculated results, it is shown that attenuation is dominated by conductor loss if silicon substrates with a resistivity greater than 2500 Q-cm are used. Si passivation layers affect the transmission line attenuation; however, measured results demonstrate that passivation layers do not necessarily increase attenuation. If standard, low resistivity Si wafers must be used, alternative transmission lin...

  5. Use of waste material in cultivation substrates

    Directory of Open Access Journals (Sweden)

    Petr Salaš

    2004-01-01

    Full Text Available Gardeners' practical experience and experimental work prove the affirmation that the used substrate is a very important base for the production of quality nursery products. It is important to emphasis the complexity and synergy of all factors influencing the ecosystem and there mutual relations. Physical, chemical and biological properties do not separately affect the growth and development of plants. In addition, the relations are not statical but differ in relation with other factors changes. This article is dealing with the possibility to use waste material from timber processing in cultivation substrates. The large scale use of such substrates would enable people to reach a relative independence from peat substrates, of which the global reserve is gradually decreasing.Our research activities focus on the use of bark. The basic problems of a bark substrate are easy dehydration and unbalanced nutrition of trees and shrubs. The suggested and experimented cultivation technology solves these problems. It is based on the cultivation of woody species in bark substrates, using modern irrigation systems, slow release fertilisers (Silvamix Forte and special soil conditioners (TerraCottem. This technology was tested on the following species of trees and shrubs: Malus and Buxus.

  6. Alternative substrates for higher mushrooms mycelia cultivation

    Directory of Open Access Journals (Sweden)

    TETIANA KRUPODOROVA

    2015-12-01

    Full Text Available Cultivation of 29 species of higher mushroom mycelia on alternative substrates – wastes of Ukrainian oil-fat industry, has been investigated. The amount of mushroom mycelia obtaining on 12 investigated substrates varied significantly, from 1.0 g/L to 22.9 g/L on the 14th day of cultivation. The superficial cultivation adopted in this study allows for easy to choose appropriate medium (substrate for mycelia production. Alternative substrates (compared to glucose-peptone-yeast medium were selected for all studied species, from soybean cake – most suitable for the mycelial growth of 24 species, to walnut cake − suitable only for 2 species. The utilization of substrates has been evaluated by biological efficiency. The best index of biological efficiency varied from 19.0% to 41.6% depending on the mushroom species. It was established high biological efficiency of mycelia cultivation on substrates: wheat seed cake – Pleurotus djamor, Lyophyllum shimeji, Crinipellis schevczenkovi, Phellinus igniarius, Spongipellis litschaueri; oat seed cake – Ganoderma applanatum and G. lucidum; soybean cake – Hohenbuehelia myxotricha, Trametes versicolor, Morchella esculenta, Cordyceps sinensis, C. militaris, and Agrocybe aegerita; rape seed cake – Auriporia aurea; camelina seed cake – Fomes fomentarius. The cultivation of these species are perspective as a biotechnological process of agricultural wastes converted into mycelia, which could be used in different forms of products with therapeutic action: powder or tablets nutraceuticals or ingredients for functional foods.

  7. Manufacturing Process for OLED Integrated Substrate

    Energy Technology Data Exchange (ETDEWEB)

    Hung, Cheng-Hung [Vitro Flat Glass LLC, Cheswick, PA (United States). Glass Technology Center

    2017-03-31

    The main objective of this project was to develop a low-cost integrated substrate for rigid OLED solid-state lighting produced at a manufacturing scale. The integrated substrates could include combinations of soda lime glass substrate, light extraction layer, and an anode layer (i.e., Transparent Conductive Oxide, TCO). Over the 3+ year course of the project, the scope of work was revised to focus on the development of a glass substrates with an internal light extraction (IEL) layer. A manufacturing-scale float glass on-line particle embedding process capable of producing an IEL glass substrate having a thickness of less than 1.7mm and an area larger than 500mm x 400mm was demonstrated. Substrates measuring 470mm x 370mm were used in the OLED manufacturing process for fabricating OLED lighting panels in single pixel devices as large as 120.5mm x 120.5mm. The measured light extraction efficiency (calculated as external quantum efficiency, EQE) for on-line produced IEL samples (>50%) met the project’s initial goal.

  8. Increased intraventricular pressures are as harmful as the electrophysiological substrate of heart failure in favoring sustained reentry in the swine heart.

    Science.gov (United States)

    Quintanilla, Jorge G; Moreno, Javier; Archondo, Tamara; Usandizaga, Elena; Molina-Morúa, Roberto; Rodríguez-Bobada, Cruz; González, Pablo; García-Torrent, María Jesús; Filgueiras-Rama, David; Pérez-Castellano, Nicasio; Macaya, Carlos; Pérez-Villacastín, Julián

    2015-10-01

    Heart failure (HF) electrophysiological remodeling (HF-ER) often includes the effect of chronically increased intraventricular pressures (IVPs) and promotes ventricular tachycardia/ventricular fibrillation (VT/VF). In addition, acutely increased IVPs have been associated with a higher rate of VT/VF episodes in chronic HF. We hypothesized that increased IVPs and/or an ionic-imbalanced (acidified), catecholamine-rich (adrenergic) milieu (AA milieu) may contribute as much as HF-ER to the substrate for reentry in HF. We used a porcine model of tachycardiomyopathy and evaluated the individual/combined contributions of (1) increased IVPs, (2) HF-ER, and (3) an AA milieu. HF-ER was induced in 7 pigs by rapid pacing. Seven pigs were used as controls. Hearts were isolated and Langendorff perfused. Programmed ventricular stimulation was conducted under low or increased IVP and normal/AA milieu (4 combinations). Epicardial optical mapping was used to quantify conduction velocity (CV), action potential duration (APD), and dispersion of repolarization (DoR). HF-ER decreased CV (-34%; P = .002) and increased APD (11%; P = .024) and DoR (21%; P = .007). Increased IVP amplified DoR (36%; P 6-fold). By magnifying DoR, decreasing CV, and shortening APD, increased IVP was as harmful as HF-ER in favoring the substrate for sustained reentry in this model. The AA milieu contributed to a much lesser extent. Thus, a stricter control of IVP might be postulated as a useful add-on antiarrhythmic strategy in HF. Copyright © 2015 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.

  9. Effective corrosion protection of AA6061 aluminum alloy by sputtered Al-Ce coatings

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez-Crespo, M.A., E-mail: mdominguezc@ipn.m [Instituto Politecnico Nacional, GIPMAT CICATA-Altamira, km 14.5, Carretera Tampico-Puerto Industrial Altamira, C.P. 89600 Altamira, Tamps (Mexico); Torres-Huerta, A.M. [Instituto Politecnico Nacional, GIPMAT CICATA-Altamira, km 14.5, Carretera Tampico-Puerto Industrial Altamira, C.P. 89600 Altamira, Tamps (Mexico); Rodil, S.E. [Instituto de Investigacion en Materiales, Universidad Nacional Autonoma de Mexico, Circuito Exterior s/n, Ciudad Universitaria, Del. Coyoacan, C.P. 04510 Mexico, D.F. (Mexico); Ramirez-Meneses, E. [Instituto Politecnico Nacional, GIPMAT CICATA-Altamira, km 14.5, Carretera Tampico-Puerto Industrial Altamira, C.P. 89600 Altamira, Tamps (Mexico); Suarez-Velazquez, G.G. [Alumna del PTA del CICATA-Altamira IPN, km 14.5, Carretera Tampico-Puerto Industrial Altamira, C.P. 89600 Altamira, Tamps (Mexico); Hernandez-Perez, M.A. [Instituto Politecnico Nacional, ESIQIE, C.P. 07738 Mexico, D.F. (Mexico)

    2009-12-30

    Al-Ce coatings were deposited on silicon and AA6061 aluminum alloy substrates by DC magnetron sputtering using aluminum in combination with pure cerium targets. The materials were characterized by X-ray diffraction (XRD), atomic force microscopy (AFM), scanning electron microscopy (SEM), high resolution transmission electron microscopy (HRTEM) and electrochemical impedance spectroscopy (EIS) in order to consider their application as high corrosion resistance coatings. The corrosion behavior of the films was studied using a NaCl aqueous solution (3.5 wt%). As for the characterization results, an apparent amorphous phase of aluminum oxide with small cerium compounds embedded in the matrix was detected by the X-ray diffraction patterns and HRTEM on the deposited films at 200 W and 4 Pa. At these conditions, AFM and SEM images evidenced crack-free coatings with low-roughness nanometric structures and columnar growth. EIS and Tafel results converged to indicate an inhibition of the corrosion reactions. The film displayed good stability in the aggressive medium and after 1 day of exposure underwent very little degradation. The variations in the impedance and Tafel characteristics were found to occur as a function of cerium content, which provokes important changes in the film protective properties.

  10. Nanomechanics of hard films on compliant substrates.

    Energy Technology Data Exchange (ETDEWEB)

    Reedy, Earl David, Jr. (Sandia National Laboratories, Albuquerque, NM); Emerson, John Allen (Sandia National Laboratories, Albuquerque, NM); Bahr, David F. (Washington State University, Pullman, WA); Moody, Neville Reid; Zhou, Xiao Wang; Hales, Lucas (University of Minnesota, Minneapolis, MN); Adams, David Price (Sandia National Laboratories, Albuquerque, NM); Yeager,John (Washington State University, Pullman, WA); Nyugen, Thao D. (Johns Hopkins University, Baltimore, MD); Corona, Edmundo (Sandia National Laboratories, Albuquerque, NM); Kennedy, Marian S. (Clemson University, Clemson, SC); Cordill, Megan J. (Erich Schmid Institute, Leoben, Austria)

    2009-09-01

    Development of flexible thin film systems for biomedical, homeland security and environmental sensing applications has increased dramatically in recent years [1,2,3,4]. These systems typically combine traditional semiconductor technology with new flexible substrates, allowing for both the high electron mobility of semiconductors and the flexibility of polymers. The devices have the ability to be easily integrated into components and show promise for advanced design concepts, ranging from innovative microelectronics to MEMS and NEMS devices. These devices often contain layers of thin polymer, ceramic and metallic films where differing properties can lead to large residual stresses [5]. As long as the films remain substrate-bonded, they may deform far beyond their freestanding counterpart. Once debonded, substrate constraint disappears leading to film failure where compressive stresses can lead to wrinkling, delamination, and buckling [6,7,8] while tensile stresses can lead to film fracture and decohesion [9,10,11]. In all cases, performance depends on film adhesion. Experimentally it is difficult to measure adhesion. It is often studied using tape [12], pull off [13,14,15], and peel tests [16,17]. More recent techniques for measuring adhesion include scratch testing [18,19,20,21], four point bending [22,23,24], indentation [25,26,27], spontaneous blisters [28,29] and stressed overlayers [7,26,30,31,32,33]. Nevertheless, sample design and test techniques must be tailored for each system. There is a large body of elastic thin film fracture and elastic contact mechanics solutions for elastic films on rigid substrates in the published literature [5,7,34,35,36]. More recent work has extended these solutions to films on compliant substrates and show that increasing compliance markedly changes fracture energies compared with rigid elastic solution results [37,38]. However, the introduction of inelastic substrate response significantly complicates the problem [10,39,40]. As

  11. Influence of the laser pre-quenched substrate on an electroplated chromium coating/steel substrate

    Science.gov (United States)

    Chen, Xuejun; Yan, Qian; Ma, Qian

    2017-05-01

    The chromium coatings were electroplated onto a laser pre-quenched steel substrate to improve the interfacial adhesion properties of chromium coating/steel substrate system. The influence of laser pre-treatment on the substrate, coating as well as interface was investigated by using microstructure characterization, hardness testing, tensile testing and finite element analysis. An apparent boundary line instead of an interlayer was identified between chromium coating/pre-quenched steel substrate. The Vickers hardness and yield strength of steel substrate were significantly improved after laser pre-quenching. The fracture toughness of chromium coating was increased by about 28.6% compared to the un-treated counterpart. The energy release rate for an interfacial crack in the chromium coating/laser-quenched substrate was smaller than that in the untreated specimen. These results may help understand the life prolongation mechanism for the laser pre-quenched chromium/coated steel parts.

  12. Role and mechanism of AT1-AA in the pathogenesis of HELLP syndrome.

    Science.gov (United States)

    Bu, Shurui; Wang, Yuxian; Sun, Shuqing; Zheng, Yanqian; Jin, Zhu; Zhi, Jianming

    2018-01-10

    HELLP syndrome remains a leading cause of maternal and neonatal mortality and morbidity worldwide, which symptoms include hemolysis, elevated liver enzymes and low platelet count. The objective of this study was to determine whether HELLP is associated with AT1-AA. The positive rate and titer of AT1-AA in plasma from pregnant women were determined, and the correlation of AT1-AA titer with the grade of HELLP was analyzed. A HELLP rat model established by intravenous injection of AT1-AA. Our experimental results show the AT1-AA titer and positive rate were significantly higher in HELLP group, and AT1-AA titer were positively correlated with the level of TNF-α and ET-1 in plasma and the grade of HELLP syndrome. The results of animal experiments showed that the typical features of HELLP in the pregnant rats after AT1-AA injection. The levels of TNF-α and ET-1 in plasma and liver tissue were significantly increased in AT1-AA-treated rats compared with control rats. The HELLP syndrome induced by AT1-AA was attenuated markedly after administration of losartan. These data support the hypothesis that one the potential pathway that AT1-AA induce damage to capillary endothelial cells and liver during pregnancy is through activation of TNF-α and ET-1.

  13. Adverse effects of doping with anabolic androgenic steroids (AAS) in competitive athletics, recreational sports and bodybuilding.

    Science.gov (United States)

    Vorona, Elena; Nieschlag, Eberhard

    2018-02-19

    Despite the fact that sports organizations and legislators have introduced various mechanisms to discourage athletes from using performance and appearance enhancing substances a high percentage of athletes admits to their unabated application. In competitive athletics, bodybuilding and in recreational sports anabolic androgenic steroids (AAS) continue to be the substances most abused. This review summarizes the side effects of AAS abuse on organs and system functions in both sexes. High doses of AAS cause a significant increase of erythrocytes und haemoglobin concentration, which may lead to thromboembolism, intracardiac thrombosis and stroke. Long-term AAS abusers have a higher incidence of arrhythmias, atherosclerosis, concentric left-ventricular myocardial hypertrophy with impaired diastolic function and also sudden cardiac death. Changes of liver function and structure, up to hepatocellular carcinoma, have been described, mainly in cases of chronic misuse of 17α-alkylated AAS. Sleeplessness, increased irritability, depressive mood status are often observed in AAS abuse. In former AAS abusers depression, anxiety and melancholy may persist for many years. Due to negative feedback in the regulation of the hypothalamic-pituitary-gonadal axis AAS can cause reversible suppression of spermatogenesis up to azoospermia. In women the changes most often caused by AAS abuse are hirsutism, irreversible deepening of voice, dysmenorrhoea, secondary amenorrhoea with anovulation and infertility. AAS abuse notwithstanding, under clinical conditions testosterone remains the most important hormone for substitution therapy of male hypogonadism.

  14. Atomically flat single terminated oxide substrate surfaces

    Science.gov (United States)

    Biswas, Abhijit; Yang, Chan-Ho; Ramesh, Ramamoorthy; Jeong, Yoon H.

    2017-05-01

    Scientific interest in atomically controlled layer-by-layer fabrication of transition metal oxide thin films and heterostructures has increased intensely in recent decades for basic physics reasons as well as for technological applications. This trend has to do, in part, with the coming post-Moore era, and functional oxide electronics could be regarded as a viable alternative for the current semiconductor electronics. Furthermore, the interface of transition metal oxides is exposing many new emergent phenomena and is increasingly becoming a playground for testing new ideas in condensed matter physics. To achieve high quality epitaxial thin films and heterostructures of transition metal oxides with atomically controlled interfaces, one critical requirement is the use of atomically flat single terminated oxide substrates since the atomic arrangements and the reaction chemistry of the topmost surface layer of substrates determine the growth and consequent properties of the overlying films. Achieving the atomically flat and chemically single terminated surface state of commercially available substrates, however, requires judicious efforts because the surface of as-received substrates is of chemically mixed nature and also often polar. In this review, we summarize the surface treatment procedures to accomplish atomically flat surfaces with single terminating layer for various metal oxide substrates. We particularly focus on the substrates with lattice constant ranging from 4.00 Å to 3.70 Å, as the lattice constant of most perovskite materials falls into this range. For materials outside the range, one can utilize the substrates to induce compressive or tensile strain on the films and explore new states not available in bulk. The substrates covered in this review, which have been chosen with commercial availability and, most importantly, experimental practicality as a criterion, are KTaO3, REScO3 (RE = Rare-earth elements), SrTiO3, La0.18Sr0.82Al0.59Ta0.41O3 (LSAT), Nd

  15. Co-expression and synergism analysis of Vip3Aa29 and Cyt2Aa3 insecticidal proteins from Bacillus thuringiensis.

    Science.gov (United States)

    Yu, Xiumei; Liu, Tao; Sun, Zhiguang; Guan, Peng; Zhu, Jun; Wang, Shiquan; Li, Shuangcheng; Deng, Qiming; Wang, Lingxia; Zheng, Aiping; Li, Ping

    2012-04-01

    Vegetative insecticidal protein (Vip3) from Bacillus thuringiensis shows high activity against lepidopteran insects. Cytolytic δ-endotoxin (Cyt) also has high toxicity to dipteran larvae and synergism with other crystal proteins (Cry), but synergism between Cyt and Vip3 proteins has not been tested. We analyzed for synergism between Cyt2Aa3 and Vip3Aa29. Both cyt2Aa3 and vip3Aa29 genes were co-expressed in Escherichia coli strain BL21 carried on vector pCOLADuet-1. Vip3Aa29 showed insecticidal activity against Chilo suppressalis and Spodoptera exigua, with 50% lethal concentration (LC(50)) at 24.0 and 36.6 μg ml(-1), respectively. It could also inhibit Helicoverpa armigera growth, with 50% inhibition concentration at 22.6 μg ml(-1). While Cyt2Aa3 was toxic to Culex quinquefasciatus (LC(50): 0.53 μg ml(-1)) and Chironomus tepperi (LC(50): 36 μg ml(-1)), it did not inhibit C. suppressalis, S. exigua, and H. armigera. However, the co-expression of Cyt2Aa3 and Vip3Aa29 showed synergistic effect on C. suppressalis and S. exigua, and the individual activities were strengthened 3.35- and 4.34-fold, respectively. The co-expression had no synergism against C. tepperi and H. armigera, but exerted some antagonistic effect on Cx. quinquefasciatus. The synergism between Cyt2Aa and Vip3Aa was thus discovered for the first time, which confirmed that Cyt toxin can enhance the toxicity of other toxins against some non-target insects. By synergism analysis, the effectiveness of microbial insecticides can be verified.

  16. Review of SERS Substrates for Chemical Sensing

    Directory of Open Access Journals (Sweden)

    Pamela A. Mosier-Boss

    2017-06-01

    Full Text Available The SERS effect was initially discovered in the 1970s. Early research focused on understanding the phenomenon and increasing enhancement to achieve single molecule detection. From the mid-1980s to early 1990s, research started to move away from obtaining a fundamental understanding of the phenomenon to the exploration of analytical applications. At the same time, significant developments occurred in the field of photonics that led to the advent of inexpensive, robust, compact, field-deployable Raman systems. The 1990s also saw rapid development in nanoscience. This convergence of technologies (photonics and nanoscience has led to accelerated development of SERS substrates to detect a wide range of chemical and biological analytes. It would be a monumental task to discuss all the different kinds of SERS substrates that have been explored. Likewise, it would be impossible to discuss the use of SERS for both chemical and biological detection. Instead, a review of the most common metallic (Ag, Cu, and Au SERS substrates for chemical detection only is discussed, as well as SERS substrates that are commercially available. Other issues with SERS for chemical detection have been selectivity, reversibility, and reusability of the substrates. How these issues have been addressed is also discussed in this review.

  17. Colloidal Drop Deposition on Porous Substrates

    Science.gov (United States)

    Sun, Ying; Pack, Min; Hu, Han; Kim, Dong-Ook; Yang, Xin

    2015-11-01

    Printable electronics and in particular paper and textile-based electronics have fueled research in inkjet printing on porous substrates. On nonporous substrates, the particle motion of the particles and evaporation of the solvent are the two main mechanisms that drive the final deposition morphology. For porous substrates another factor, mainly infiltration, adds a layer of complexity to the deposition patterns that has not yet been elucidated in literature. In this study, a high-speed camera was used to capture the imbibition of picoliter-sized polystyrene nanoparticles in water droplets into nano-porous anodic aluminum oxide substrates of various porosities and wettabilities. For water, the infiltration rate is much faster than both evaporation and particle motion and thus when the substrate fully imbibes the droplet, the well-known ``coffee ring'' is suppressed. However, when a residual droplet forms upon the termination of the infiltration regime, the competing particle motion and evaporation regimes, tP and tEI respectively, define the critical time scales for which the coffee ring will be formed (tP /tEI 1). National Science Foundation under Grant No. CMMI-1401438.

  18. Multistructural biomimetic substrates for controlled cellular differentiation

    Science.gov (United States)

    Orza, Anamaria I.; Mihu, Carmen; Soritau, Olga; Diudea, Mircea; Florea, Adrian; Matei, Horea; Balici, Stefana; Mudalige, Thilak; Kanarpardy, Ganesh K.; Biris, Alexandru S.

    2014-02-01

    Multidimensional scaffolds are considered to be ideal candidates for regenerative medicine and tissue engineering based on their potential to provide an excellent microenvironment and direct the fate of the cultured cells. More recently, the use of stem cells in medicine has opened a new technological opportunity for controlled tissue formation. However, the mechanism through which the substrate directs the differentiation of stem cells is still rather unclear. Data concerning its specific surface chemistry, topology, and its signaling ability need to be further understood and analyzed. In our study, atomic force microscopy was used to study the stiffness, roughness, and topology of the collagen (Coll) and metallized collagen (MC) substrates, proposed as an excellent substrate for regenerative medicine. The importance of signaling molecules was studied by constructing a new hybrid signaling substrate that contains both collagen and laminin extracellular matrix (ECM) proteins. The cellular response—such as attachment capability, proliferation and cardiac and neuronal phenotype expression on the metallized and non-metallized hybrid substrates (collagen + laminin)—was studied using MTT viability assay and immunohistochemistry studies. Our findings indicate that such hybrid materials could play an important role in the regeneration of complex tissues.

  19. Cold metal transfer welding of AA1050 aluminum thin sheets

    OpenAIRE

    İrizalp,Alaattin Ozan; Durmuş,Hülya; Yüksel, Nilay; Türkmen,İlyas

    2016-01-01

    ABSTRACT This study was aimed to investigate the welding parameters on mechanical behavior of 2 mm thick AA1050 sheet materials joined by cold metal transfer (CMT) method. Macro structural examination showed that decreasing heat input decreased the pore size in the weld metal. Tensile test was applied and failure occurred in heat affected zone of aluminum sheet metal. Maximum tensile strength was found in the sample with minimum heat input. Heat affected zone was observed explicitly in the sa...

  20. Lead induced intergranular fracture in aluminum alloy AA6262

    OpenAIRE

    De Hosson, JTM

    2003-01-01

    The influence of lead on the fracture behavior of aluminum alloy AA6262 is investigated. Under certain conditions, the mode of fracture changes from transgranular microvoid coalescence to an intergranular mechanism. Three different intergranular fracture mechanisms are observed: liquid metal embrittlement, dynamic embrittlement at temperatures below the melting temperature of lead, and intergranular microvoid coalescence. An attempt is made to examine the dependence of these three mechanisms ...

  1. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. Here we see the slotted electrodes partly pulled out of the outer casing. See also 7906189, 7906581X, 7896193.

  2. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning, in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. View down the centre of a pickup or kicker. See also 7906189, 7906190, 7906583.

  3. Natural Aging Behaviour Of AA6111 Aluminium | Quainoo | Ghana ...

    African Journals Online (AJOL)

    de microdureté, la calorimétrie de balayage différentiel (CBD), la microscopie électronique à balayage (MEB) et l\\'analyse radioscopique. Les résultats montrent que AA6111 atteint une solidité monotone après approximativement 120 h de vieillissement naturel. La microstructure consiste d\\'une matrice d\\' aluminium et les ...

  4. Wooden models of an AA quadrupole between bending magnets

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    At two points in the AA lattice, a quadrupole (QDN, defocusing, narrow) was tightly wedged between two bending magnets (BST, short, wide). This picture of wooden models lets one imagine the strong interaction between their magnetic fields. There was no way one could calculate with the necessary accuracy the magnetic effects and their consequences for the machine optics. The necessary corrections were made after measurements with a circulating beam, in a tedious iterative procedure, with corrrection coils and shims.

  5. Bacillus thuringiensis Cry1Aa toxin-binding region of Bombyx mori aminopeptidase N.

    Science.gov (United States)

    Yaoi, K; Nakanishi, K; Kadotani, T; Imamura, M; Koizumi, N; Iwahana, H; Sato, R

    1999-12-17

    The Bacillus thuringiensis Cry1Aa toxin-binding region of Bombyx mori aminopeptidase N (APN) was analyzed, to better understand the molecular mechanism of susceptibility to the toxin and the development of resistance in insects. APN was digested with lysylendopeptidase and the ability of the resulting fragments to bind to Cry1Aa and 1Ac toxins was examined. The binding abilities of the two toxins to these fragments were different. The Cry1Aa toxin bound to the fragment containing 40-Asp to 313-Lys, suggesting that the Cry1Aa toxin-binding site is located in the region between 40-Asp and 313-Lys, while Cry1Ac toxin bound exclusively to mature APN. Next, recombinant APN of various lengths was expressed in Escherichia coli cells and its ability to bind to Cry1Aa toxin was examined. The results localized the Cry1Aa toxin binding to the region between 135-Ile and 198-Pro.

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-0749 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0749 pdb|2QW9|A Chain A, Crystal Structure Of Bovine Hsc70 (1-394aa)in... The Apo State pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State pdb|2QWL|A Chain A, Crystal Structure... Of Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWL|B Chain B, Crystal Structure Of ...Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWM|A Chain A, Crystal Structure Of B...ovine Hsc70 (1-394aa)in The AdpVi State pdb|2QWM|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The AdpVi State 2QW9 1e-116 83% ...

  7. NCBI nr-aa BLAST: CBRC-MEUG-01-0807 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0807 pdb|2QW9|A Chain A, Crystal Structure Of Bovine Hsc70 (1-394aa)in... The Apo State pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State pdb|2QWL|A Chain A, Crystal Structure... Of Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWL|B Chain B, Crystal Structure Of ...Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWM|A Chain A, Crystal Structure Of B...ovine Hsc70 (1-394aa)in The AdpVi State pdb|2QWM|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The AdpVi State 2QW9 1e-139 85% ...

  8. NCBI nr-aa BLAST: CBRC-TTRU-01-0305 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0305 pdb|2QW9|A Chain A, Crystal Structure Of Bovine Hsc70 (1-394aa)in... The Apo State pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State pdb|2QWL|A Chain A, Crystal Structure... Of Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWL|B Chain B, Crystal Structure Of ...Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWM|A Chain A, Crystal Structure Of B...ovine Hsc70 (1-394aa)in The AdpVi State pdb|2QWM|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The AdpVi State 2QW9 1e-117 91% ...

  9. NCBI nr-aa BLAST: CBRC-TSYR-01-0154 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0154 pdb|2QW9|A Chain A, Crystal Structure Of Bovine Hsc70 (1-394aa)in... The Apo State pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State pdb|2QWL|A Chain A, Crystal Structure... Of Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWL|B Chain B, Crystal Structure Of ...Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWM|A Chain A, Crystal Structure Of B...ovine Hsc70 (1-394aa)in The AdpVi State pdb|2QWM|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The AdpVi State 2QW9 0.0 94% ...

  10. NCBI nr-aa BLAST: CBRC-GGOR-01-0919 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0919 pdb|2QW9|A Chain A, Crystal Structure Of Bovine Hsc70 (1-394aa)in... The Apo State pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State pdb|2QWL|A Chain A, Crystal Structure... Of Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWL|B Chain B, Crystal Structure Of ...Bovine Hsc70 (1-394aa)in The Adp State pdb|2QWM|A Chain A, Crystal Structure Of B...ovine Hsc70 (1-394aa)in The AdpVi State pdb|2QWM|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The AdpVi State 2QW9 1e-155 89% ...

  11. Microstructural characterization of fly ash particulate reinforced AA6063 aluminium alloy for aerospace applications

    Science.gov (United States)

    Razzaq, A. M.; Majid, D. L. Abang Abdul; Ishak, M. R.; Uday, M. B.

    2017-12-01

    Aluminium-fly ash (FA) particulate reinforced composites (AA6063-FA) have been used in automotive and aerospace industries because of their low density and good mechanical properties. Three different weight fraction of FA: 2%, 4% and 6% are added to AA6063 alloy using compocasting method. The effect of FA particulates on microstructure, density and compression strength of AA6063- FA composites are investigated. Field Emission Scanning Electron Microscope (FESEM) micrographs reveal that the FA particulates are uniformly distributed in AA6063 alloy. The results also show that density, compression strength and microstructure of the AA6063-FA composites are significantly influenced by the FA amount. The increase in the weight fraction of FA will improve the microstructure and enhance the compression strength. The density of AA6063-FA composites decreases as the incorporation of FA increases.

  12. Long-term biases in geomagnetic K and aa indices

    Science.gov (United States)

    Love, J.J.

    2011-01-01

    Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0-2009.0, solar cycles 11-23. The K data show persistent biases, especially for high (low) K-activity levels at British (Australian) observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4. ?? 2011 Author(s).

  13. Characterizing the Constitutive Properties of AA7075 for Hot Forming

    Science.gov (United States)

    Omer, K.; Kim, S.; Butcher, C.; Worswick, M.

    2017-09-01

    The work presented herein investigates the constitutive properties of AA7075 as it undergoes a hot stamping/die quenching process. Tensile specimens were solutionized inside a heated furnace set to 470°C. Once solutionized, the samples were quenched to an intermediate temperature using a vortex air chiller at a minimum rate of 52°C/s. Tensile tests were conducted at steady state temperatures of 470, 400, 300, 200, 115 and 25°C. This solutionizing and subsequent quenching process replicated the temperature cycle and quench rates representative of a die quenching operation. The results of the tensile test were analyzed with digital imaging correlation using an area reduction approach. The area reduction approach approximated the cross-sectional area of the tensile specimen as it necked. The approach allowed for the true stress-strain response to be calculated well past the initial necking point. The resulting true stress-strain curves showed that the AA7075 samples experienced almost no hardening at 470°C. As steady state temperature decreased, the rate of hardening as well as overall material strength increased. The true stress strain curves were fit to a modified version of the extended Voce constitutive model. The resulting fits can be used in a finite element model to predict the behaviour of an AA7075 blank during a die quenching operation.

  14. Renal Involvement in AA Amyloidosis: Clinical Outcomes and Survival

    Directory of Open Access Journals (Sweden)

    Murvet Yilmaz

    2013-03-01

    Full Text Available Background: The natural history of AA amyloidosis is typically progressive, leading to multiple organ failure and death. We analyzed the etiology as well as clinical and laboratory features of patients with biopsy-proven AA amyloidosis and evaluated the ultimate outcome. Methods: Seventy-three patients (24 female; mean age 41.85±15.89 years were analyzed retrospectively. Demographic, clinical and laboratory features were studied and the outcome was assessed. Results: Familial Mediterranean Fever and tuberculosis were the most frequent causes of amyloidosis. Mean serum creatinine and proteinuria at diagnosis were 4.65±4.89 mg/dl and 8.04±6.09 g/day, respectively; and stage I, II, III, IV and V renal disease were present in 19.2%, 13.7%, 16.4%, 11%, and 39.7% of the patients, respectively. ESRD developed in 16 patients during the follow-up period. All of the ESRD patients started a dialysis programme. Thirty patients (41% died during the follow-up period; median patient survival was 35.9±6.12 months. Old age, tuberculosis etiology, advanced renal disease and low serum albumin levels were associated with a worse prognosis. Serum albumin was a predictor of mortality in logistic regression analysis. Conclusion: The ultimate outcome of the patients with AA amyloidosis is poor, possibly due to the late referral to the nephrology clinics. Early referral may be helpful to improve prognosis.

  15. Effects of Friction Stir Welding Speed on AA2195 alloy

    Directory of Open Access Journals (Sweden)

    Lee Ho-Sung

    2016-01-01

    Full Text Available The application of friction stir welding (FSW to aerospace has grown rapidly due to the high efficiency and environmental friendly nature of the process. FSW is achieved by plastic flow of frictionally heated material in solid state and offers many advantages of avoiding hot cracking and limiting component distortion. Recently low density, high modulus and high strength AA2195 are used as substitute for conventional aluminum alloys since the weight saving is critical in aerospace applications. One of the problems for this alloy is weld metal porosity formation leading to hot cracking. Combination of FSW and AA2195 provides synergy effect to improve mechanical properties and weight saving of aerospace structure such as cryogenic fuel tanks for launch systems. The objective of this paper is to investigate the effect of friction stir welding speed on mechanical and microstructural properties of AA2195. The friction stir welded materials were joined with four different tool rotation speeds (350~800 rpm and five welding speeds (120~360 mm/min, which are the two prime welding parameters in this process.

  16. Generalized cytochrome P450-mediated oxidation and oxygenation reactions in aromatic substrates with activated N-H, O-H, C-H, or S-H substituents.

    Science.gov (United States)

    Koymans, L; Donné-Op den Kelder, G M; te Koppele, J M; Vermeulen, N P

    1993-06-01

    1. The general mechanism of metabolic oxidation of substrates by cytochromes P450 (P450s) appears to consist of sequential one-electron oxidation steps rather than of a single concerted transfer of activated oxygen species from P450 to substrates. 2. In case of the acetanilides paracetamol (PAR), phenacetin (PHEN), and 4-chloro-acetanilide (4-CLAA), the first one-electron oxidation step consists of a hydrogen abstraction from the acetylamino nitrogen and/or from the other side-chain substituent on the aromatic ring. The substrate radicals thus formed delocalize their spin and the respective reactive centres of the substrate radical recombine with a P450 iron-bound hydroxyl radical to either yield oxygenated metabolites, or undergo a second hydrogen abstraction forming dehydrogenated products. By this mechanism, the formation of all known oxidative metabolites of PAR, PHEN, and 4-ClAA can be explained. Furthermore, this mechanism is consistent with all available experimental data on [18O]PAR/PHEN, [2H]PAR, and [14C]PHEN. 3. The oxidative metabolic reactions proposed for the acetanilides PAR, PHEN, and 4-ClAA are used to generalize P450-mediated oxidations of these and other acetanilides, such as analogues of PAR and 2-N-acetyl-aminofluorene. 4. A further generalization of the hydrogen abstraction, spin delocalization, radical recombination concept is derived for other aromatic substrates with abstractable hydrogen atoms, notably those with activated N-H, O-H, C-H, or S-H bonds directly attached to the aromatic nucleus.

  17. Ultrastable gold substrates for electron cryomicroscopy

    Science.gov (United States)

    Russo, Christopher J; Passmore, Lori A

    2015-01-01

    Despite recent advances, the structures of many proteins cannot be determined by electron cryomicroscopy because the individual proteins move during irradiation. This blurs the images so they cannot be aligned with each other to calculate a 3D density. Much of this movement stems from instabilities in the carbon substrates used to support frozen samples in the microscope. Here we demonstrate a new gold specimen support that nearly eliminates substrate motion during irradiation. This increases the sub-nanometer image contrast such that α-helices of individual proteins are resolved. With this improvement we determine the structure of apoferritin, a smooth, octahedral shell of α–helical subunits that is particularly difficult to solve by electron microscopy. This advance in substrate design will enable the solution of currently intractable protein structures. PMID:25504723

  18. Plasma jet printing for flexible substrates

    Energy Technology Data Exchange (ETDEWEB)

    Gandhiraman, Ram P.; Singh, Eric; Diaz-Cartagena, Diana C.; Koehne, Jessica; Meyyappan, M. [Center for Nanotechnology, NASA Ames Research Center, Moffett Field, California 94035 (United States); Nordlund, Dennis [Stanford Synchrotron Radiation Lightsource, SLAC National Accelerator Laboratory, Menlo Park, California 94025 (United States)

    2016-03-21

    Recent interest in flexible electronics and wearable devices has created a demand for fast and highly repeatable printing processes suitable for device manufacturing. Robust printing technology is critical for the integration of sensors and other devices on flexible substrates such as paper and textile. An atmospheric pressure plasma-based printing process has been developed to deposit different types of nanomaterials on flexible substrates. Multiwalled carbon nanotubes were deposited on paper to demonstrate site-selective deposition as well as direct printing without any type of patterning. Plasma-printed nanotubes were compared with non-plasma-printed samples under similar gas flow and other experimental conditions and found to be denser with higher conductivity. The utility of the nanotubes on the paper substrate as a biosensor and chemical sensor was demonstrated by the detection of dopamine, a neurotransmitter, and ammonia, respectively.

  19. Substrate recognition by ribonucleoprotein ribonuclease MRP.

    Science.gov (United States)

    Esakova, Olga; Perederina, Anna; Quan, Chao; Berezin, Igor; Krasilnikov, Andrey S

    2011-02-01

    The ribonucleoprotein complex ribonuclease (RNase) MRP is a site-specific endoribonuclease essential for the survival of the eukaryotic cell. RNase MRP closely resembles RNase P (a universal endoribonuclease responsible for the maturation of the 5' ends of tRNA) but recognizes distinct substrates including pre-rRNA and mRNA. Here we report the results of an in vitro selection of Saccharomyces cerevisiae RNase MRP substrates starting from a pool of random sequences. The results indicate that RNase MRP cleaves single-stranded RNA and is sensitive to sequences in the immediate vicinity of the cleavage site requiring a cytosine at the position +4 relative to the cleavage site. Structural implications of the differences in substrate recognition by RNases P and MRP are discussed.

  20. Formation of indium-doped zinc oxide thin films using chemical spray techniques: The importance of acetic acid content in the aerosol solution and the substrate temperature for enhancing electrical transport

    Energy Technology Data Exchange (ETDEWEB)

    Castaneda, L. [Centro de Ciencias Aplicadas y Desarrollo Tecnologico, Universidad Nacional Autonoma de Mexico, Apartado Postal 70-186, 04510, D.F. (Mexico); Departamento de Fisica y Matematicas, Division de Estudios Disciplinares, Universidad Iberoamericana, Av. Prolongacion Paseo de la Reforma 880, Santa Fe 012100, D.F. (Mexico); Garcia-Valenzuela, A. [Centro de Ciencias Aplicadas y Desarrollo Tecnologico, Universidad Nacional Autonoma de Mexico, Apartado Postal 70-186, 04510, D.F. (Mexico); Zironi, E.P. [Instituto de Fisica, Universidad Nacional Autonoma de Mexico, Apartado Postal 20-364, 01000, D.F. (Mexico); Canetas-Ortega, J. [Instituto de Fisica, Universidad Nacional Autonoma de Mexico, Apartado Postal 20-364, 01000, D.F. (Mexico); Terrones, M. [Advanced Materials Department, IPICYT, Camino a la Presa San Jose 2055, Col. Lomas 4a. seccion, San Luis Potosi 78216 (Mexico) and Departamento de Fisica y Matematicas, Division de Estudios Disciplinares, Universidad Iberoamericana, Av. Prolongacion Paseo de la Reforma 880, Santa Fe 012100, D.F. (Mexico)]. E-mail: mterrones@ipicyt.edu.mx; Maldonado, A. [Depto. de Ing. Electrica, CINVESTAV IPN, SEES, Ap. Postal 14740, Mexico D.F. 07000 (Mexico)

    2006-05-01

    Indium-doped zinc oxide (ZnO:In) thin films were grown on glass substrates using the chemical spray technique. The effects of the acetic acid content in the starting solution (c {sub AA}), as well as the substrate temperature (T {sub S}), were studied. Our results demonstrate that when c {sub AA} is extremely low, the resistivity values of the zinc oxide (ZnO) thin films become relatively high (in the order of 4 x 10{sup -2} {omega} cm). When the c {sub AA} is increased at a fixed temperature, the resistivity of the films decreases, reaching values as low as 4 x 10{sup -3} {omega} cm for thin films deposited at 525 deg. C. The electron mobility could also increase to a maximum value of 10.5 cm{sup 2}/(V s) for films deposited at 500 deg. C. We also observed an enhancement in the electrical transport properties of the films by varying T {sub S}; the lowest resistivity values occurred in films deposited at T {sub S} between 475 and 525 deg. C. In addition, the relative intensity of the diffraction peaks associated with the crystallographic planes is strongly affected by the c {sub AA} concentration. X-ray diffraction studies reveal the polycrystalline nature of the films exhibiting a hexagonal wurtzite type, with a preferential orientation of the film depending on the acetic acid concentration. Film morphology was also affected by varying c {sub AA}, as grains with distinct geometrical shapes were observed. Finally, the optical transmittance of all these films was found to be higher than 85%.

  1. 7 CFR 51.1176 - U.S. Grade AA Juice (Double A).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. Grade AA Juice (Double A). 51.1176 Section 51... of Common Sweet Oranges (citrus Sinensis (l) Osbeck) § 51.1176 U.S. Grade AA Juice (Double A). Any.... Grade AA Juice (Double A)”: (a) Each lot of fruit shall contain an average of not less than 5 gallons...

  2. Direct-Cooled Power Electronics Substrate

    Energy Technology Data Exchange (ETDEWEB)

    Wiles, R.; Ayers, C.; Wereszczak, A.

    2008-12-23

    The goal of the Direct-Cooled Power Electronics Substrate project is to reduce the size and weight of the heat sink for power electronics used in hybrid electric vehicles (HEVs) and plug-in hybrid electric vehicles (PHEVs). The concept proposed in this project was to develop an innovative power electronics mounting structure, model it, and perform both thermal and mechanical finite-element analysis (FEA). This concept involved integrating cooling channels within the direct-bonded copper (DBC) substrate and strategically locating these channels underneath the power electronic devices. This arrangement would then be directly cooled by water-ethylene glycol (WEG), essentially eliminating the conventional heat sink and associated heat flow path. The concept was evaluated to determine its manufacturability, its compatibility with WEG, and the potential to reduce size and weight while directly cooling the DBC and associated electronics with a coolant temperature of 105 C. This concept does not provide direct cooling to the electronics, only direct cooling inside the DBC substrate itself. These designs will take into account issues such as containment of the fluid (separation from the electronics) and synergy with the whole power inverter design architecture. In FY 2008, mechanical modeling of substrate and inverter core designs as well as thermal and mechanical stress FEA modeling of the substrate designs was performed, along with research into manufacturing capabilities and methods that will support the substrate designs. In FY 2009, a preferred design(s) will be fabricated and laboratory validation testing will be completed. In FY 2010, based on the previous years laboratory testing, the mechanical design will be modified and the next generation will be built and tested in an operating inverter prototype.

  3. High alcohol production by solid substrate fermentation from starchy substrates using thermotolerant Saccharomyces cerevisiae

    Energy Technology Data Exchange (ETDEWEB)

    Sree, N.K.; Sridhar, M.; Suresh, K.; Rao, L.V. [Department of Microbiology, Osmania University, Hyderabad 500007, Andhra Pradesh (India)

    1999-06-01

    Solid Substrate Fermentation system (SSF) was used to produce ethanol from various starchy substrates like sweet sorghum, sweet potato, wheat flour, rice starch, soluble starch and potato starch using thermotolerant yeast isolate (VS{sub 3}) by simultaneous saccharification and fermentation process. Alcohol produced was estimated by gas chromatography after an incubation time of 96 hrs at 37 C and 42 C. More ethanol was produced from rice starch and sweet sorghum. The maximum amount of ethanol produced from these substrates using VS{sub 3} was 10 g/100 g and 3.5 g/100 g substrate (rice starch) and 8.2 g and 7.5 g/100 g substrate (sweet sorghum) at 37 C and 42 C respectively. (orig.) With 2 figs., 1 tab., 12 refs.

  4. Effect of substrate on the results of measuring coating thickness according to radiation scattered by substrate

    Energy Technology Data Exchange (ETDEWEB)

    Nedavnij, O.I.; Khripunov, L.Z. (Tomskij Politekhnicheskij Inst. (USSR). Nauchno-Issledovatel' skij Inst. Ehlektronnoj Introskopii)

    1984-01-01

    The effect of a substrate on the results of measuring tantalum coating thickness in two-layer compositions according to gamma radiation scattered by the substrate is studied. It is shown that by means of an albedo-radiometer realizing the physical model absorber-scatterer one can determine the thickness (application uniformity) of tantalum coatings up to 150-300 ..mu..m depending on the substrate material (plexiglas, aluminium, iron, copper). In case of testing coatings on substrates of alloys and high-alloy steels in order to ensure high accuracy of measurement it is expedient with the above albedo-radiometer to determine the value of the backscattered radiation flux for the substrate before coating application.

  5. RF Transmission Lines on Silicon Substrates

    Science.gov (United States)

    Ponchak, George E.

    1999-01-01

    A review of RF transmission lines on silicon substrates is presented. Through measurements and calculated results, it is shown that attenuation is dominated by conductor loss if silicon substrates with a resistivity greater than 2500 Ohm-cm are used. Si passivation layers affect the transmission line attenuation; however, measured results demonstrate that passivation layers do not necessarily increase attenuation. If standard, low resistivity Si wafers must be used, alternative transmission lines such as thin film microstrip and Co-Planar Waveguide (CPW) on thick polyimide layers must be used. Measured results presented here show that low loss per unit length is achievable with these transmission lines.

  6. Hybrid stretchable circuits on silicone substrate

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, A., E-mail: adam.1.robinson@nokia.com; Aziz, A., E-mail: a.aziz1@lancaster.ac.uk [Nanoscience Centre, University of Cambridge, Cambridge CB01FF (United Kingdom); Liu, Q.; Suo, Z. [School of Engineering and Applied Sciences and Kavli Institute for Bionano Science and Technology, Harvard University, Cambridge, Massachusetts 02138 (United States); Lacour, S. P., E-mail: stephanie.lacour@epfl.ch [Centre for Neuroprosthetics and Laboratory for Soft Bioelectronics Interfaces, School of Engineering, Ecole Polytechnique Fédérale de Lausanne, Lausanne 1015 (Switzerland)

    2014-04-14

    When rigid and stretchable components are integrated onto a single elastic carrier substrate, large strain heterogeneities appear in the vicinity of the deformable-non-deformable interfaces. In this paper, we report on a generic approach to manufacture hybrid stretchable circuits where commercial electronic components can be mounted on a stretchable circuit board. Similar to printed circuit board development, the components are electrically bonded on the elastic substrate and interconnected with stretchable electrical traces. The substrate—a silicone matrix carrying concentric rigid disks—ensures both the circuit elasticity and the mechanical integrity of the most fragile materials.

  7. Spontaneous, Experimentally Induced, and Transmissible AA Amyloidosis in Japanese Quail ( Coturnix japonica).

    Science.gov (United States)

    Nakayama, Yumi; Kamiie, Junichi; Watanabe, Gen; Suzuki, Kazuhiko; Murakami, Tomoaki

    2017-11-01

    The authors describe a spontaneous case of amyloid A (AA) amyloidosis in an adult female Japanese quail ( Coturnix japonica). The bird developed AA amyloidosis secondary to chronic peritonitis caused by a Gram-negative bacillus infection. Mild amyloid deposition was also identified in the intestinal tract of apparently healthy adult individuals, suggesting that quail may develop intestinal amyloidosis with age. Based on these observations, it was hypothesized that quail can develop AA amyloidosis following inflammatory stimulation with lipopolysaccharide (LPS). Therefore, adult quail were repeatedly injected with LPS and the development of AA amyloidosis was confirmed. The amyloid deposition in this model increased when quail amyloid was intravenously injected as an amyloid-enhancing factor. The experiments were repeated with young quail, but amyloid deposits were not observed following LPS injections. However, AA amyloidosis did develop when quail amyloid was injected in addition to LPS. These results indicated that adult quail develop AA amyloidosis after inflammatory stimulation with LPS. Furthermore, quail AA amyloidosis was shown to have transmissibility regardless of age. Interestingly, the authors found that administration of chicken amyloid fibrils also induced AA amyloidosis in young quail. This is the first report of cross-species transmission of avian AA amyloidosis.

  8. Microstructure, mechanical properties and texture of an AA6061/AA5754 composite fabricated by cross accumulative roll bonding

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, K., E-mail: kevin.verstraete@u-psud.fr [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Helbert, A.L. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Brisset, F. [Université Paris-Sud, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Benoit, A.; Paillard, P. [Institut des Matériaux Jean Rouxel (IMN), UMR 6502, Polytech’Nantes, Nantes Cedex (France); Baudin, T. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France)

    2015-07-29

    AA6061 alloy is a widely used material in the automotive and aerospace industries, but is prone to hot cracking, which limits its weldability. To prevent this phenomenon, the AA6061/AA5754 composite was formed using a severe plastic deformation technique, Cross Accumulative Roll Bonding (CARB), at an elevated temperature (350 °C) to ensure good bonding between layers. This technique was efficient to maintain a small grain size, even under the process temperature conditions, and consequently, preserve good mechanical properties. The composite had better mechanical properties than the initial aluminium alloys. Microstructure and texture remained stable after two cycles and yield stress tended towards an equal value in the rolling and the transverse directions. After two cycles, the main component was the {001}〈110〉 rotated Cube, which was maintained for up to 10 cycles. Diffusion was more effective as the strain increased. Finally, a tungsten inert gas (TIG) welding process was performed on the composite and confirmed resistance to hot cracking.

  9. Comparison of calculated and experimentally determined SID of CP and AA in complex diets differing in AA contents for grower finisher pigs.

    Science.gov (United States)

    Büsing, K; Berk, A; Müller, S; Kieckhäven, S; Krüger, K; Zeyner, A

    2017-10-01

    In practice, the content of standardized ileal digestible AA in complex feeds for pigs is calculated on the basis of tabulated values for individual feedstuffs. It comes into question, however, whether this truly reflects an accurate content based upon the estimate made for the individual feedstuffs. The objective of this study was to compare standardized ileal digestibility (SID) of crude protein (CP) and selected AA in complex feeds for grower and finisher pigs either calculated or experimentally determined. Six diets with increasing AA levels were prepared for grower (BW from 30 to 70 kg) and finisher (BW from 70 to 120 kg) feed. Crystalline L-lys, DL-met and L-thr were added to both diets, L-trp and L-val only to the grower feed. SID of both CP and AA was calculated from feed tables and experimentally determined in six adult minipigs (MINILEWE) with ileorectal anastomosis. With increasing AA levels, experimentally determined SID of supplemented AA increased (p AA via tabulated values for individual feedstuffs, however, seems to be acceptable for practical use. Journal of Animal Physiology and Animal Nutrition © 2017 Blackwell Verlag GmbH.

  10. Substrate bias voltage and deposition temperature dependence on ...

    Indian Academy of Sciences (India)

    ... on Si (100) substrate. Deposition at higher substrate temperature causes the film to react with Si forming silicides at the film/Si substrate interface. Ti film undergoes a microstructural transition from hexagonal plate-like to round-shaped grains as the substrate temperature was raised from 300 to 50 °C during film deposition ...

  11. HIV-1 protease substrate-groove: Role in substrate recognition and inhibitor resistance.

    Science.gov (United States)

    Laco, Gary S

    2015-11-01

    A key target in the treatment of HIV-1/AIDS has been the viral protease. Here we first studied in silico the evolution of protease resistance. Primary active site resistance mutations were found to weaken interactions between protease and both inhibitor and substrate P4-P4' residues. We next studied the effects of secondary resistance mutations, often distant from the active site, on protease binding to inhibitors and substrates. Those secondary mutations contributed to the rise of multi-drug resistance while also enhancing viral replicative capacity. Here many secondary resistance mutations were found in the HIV-1 protease substrate-grooves, one on each face of the symmetrical protease dimer. The protease active site binds substrate P4-P4' residues, while the substrate-groove allows the protease to bind residues P12-P5/P5'-P12', for a total of twenty-four residues. The substrate-groove secondary resistance mutations were found to compensate for the loss of interactions between the inhibitor resistant protease active site and substrate P4-P4' residues, due to primary resistance mutations, by increasing interactions with substrate P12-P5/P5'-P12' residues. In vitro experiments demonstrated that a multi-drug resistant protease with substrate-groove resistance mutations was slower than wild-type protease in cleaving a peptide substrate, which did not allow for substrate-groove interactions, while it had similar activity as wild-type protease when using a Gag polyprotein in which cleavage-site P12-P5/P5'-P12' residues could be bound by the protease substrate-grooves. When the Gag MA/CA cleavage site P12-P5/P5'-P12' residues were mutated the multi-drug resistant protease cleaved the mutant Gag significantly slower, indicating the importance of the protease S-grooves in binding to substrate. Copyright © 2015 Elsevier B.V. and Société Française de Biochimie et Biologie Moléculaire (SFBBM). All rights reserved.

  12. Friction Surface Cladding of AA1050 on AA2024-T351; influence of clad layer thickness and tool rotation rate

    NARCIS (Netherlands)

    Liu, Shaojie; Bor, Teunis Cornelis; Geijselaers, Hubertus J.M.; Akkerman, Remko

    2015-01-01

    Friction Surfacing Cladding (FSC) is a recently developed solid state process to deposit thin metallic clad layers on a substrate. The process employs a rotating tool with a central opening to supply clad material and support the distribution and bonding of the clad material to the substrate. The

  13. Biodegradation of hydrocarbons exploiting spent substrate from ...

    African Journals Online (AJOL)

    SAM

    2014-08-13

    Aug 13, 2014 ... Biodegradation of hydrocarbons exploiting spent substrate from Pleurotus ostreatus in agricultural soils. A. Mauricio-Gutiérrez1, T. Jiménez-Salgado2, A. Tapia-Hernández2, J. Cavazos-Arroyo1 and. B. Pérez-Armendáriz1*. 1Interdisciplinary Research and Consulting, Autonomus Popular University of State ...

  14. Compliant substrate technology for dissimilar epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    FLORO,JERROLD A.; LEE,STEPHEN R.; FOLLSTAEDT,DAVID M.; KLEM,JOHN F.

    2000-03-01

    Strained-layer semiconductor films offer tremendous potential with regards to optoelectronic applications for high speed communications, mobile communications, sensing, and novel logic devices. It is an unfortunate reality that many of the possible film/substrate combinations that could be exploited technologically are off limits because of large differences in lattice parameters, chemical compatibilities, or thermal expansion rates. These mechanical, chemical, and thermal incompatibilities manifest themselves primarily in terms of lattice defects such as dislocations and antiphase boundaries, and in some cases through enhanced surface roughness. An additional limitation, from a production point of view, is money. Device manufacturers as a rule want the cheapest substrate possible. Freeing the heteroepitaxial world of the bonds of (near) lattice matching would vastly expand the types of working devices that could be grown. As a result, a great deal of effort has been expended finding schemes to integrate dissimilar film/substrate materials while preserving the perfection of the film layer. One such scheme receiving significant attention lately is the so-called compliant substrate approach.

  15. Cathodoluminescence Microscopy of nanostructures on glass substrates

    NARCIS (Netherlands)

    Narvaez, A.C.; Weppelman, I.G.C.; Moerland, R.J.; Liv, N.; Zonnevylle, A.C.; Kruit, P.; Hoogenboom, J.P.

    2013-01-01

    Cathodoluminescence (CL) microscopy is an emerging analysis technique in the fields of biology and photonics, where it is used for the characterization of nanometer sized structures. For these applications, the use of transparent substrates might be highly preferred, but the detection of CL from

  16. Robust fabric substrates for photonic textile applications

    NARCIS (Netherlands)

    Van Pieterson, L.; Bouten, P.C.P.; Kriege, J.C.; Bhattacharya, R.

    2010-01-01

    A fabric substrate is described for electronic textile with robust interwoven connections between the conductive yarns in it. The fabric's robustness, as a function of the electrical reliability of its conductive yarn connections, is shown to hold over large deformations.This fabric is then used to

  17. Hydrolysis kinetics of dissolved polymer substrates

    NARCIS (Netherlands)

    Sanders, W.T.M.; Zeeman, G.; Lettinga, G.

    2002-01-01

    In this paper, the relation between the hydrolysis rate of dissolved polymer substrates and sludge concentration was investigated in two ways, viz. by laboratory experiments and by computer simulations. In the simulations, the hydrolysis of dissolved polymer components was regarded as a general

  18. Bicarbonate is a recycling substrate for cyanase.

    Science.gov (United States)

    Johnson, W V; Anderson, P M

    1987-07-05

    Cyanase is an inducible enzyme in Escherichia coli that catalyzes bicarbonate-dependent decomposition of cyanate to ammonia and bicarbonate. Previous studies provided evidence that carbamate is an initial product and that the kinetic mechanism is rapid equilibrium random (bicarbonate serving as substrate as opposed to activator); the following mechanism was proposed (Anderson, P. M. (1980) Biochemistry 19, 2282-2888; Anderson, P. M., and Little, R. M. (1986) Biochemistry 25, 1621-1626). (formula; see text) Direct evidence for this mechanism was obtained in this study by 1) determining whether CO2 or HCO3- serves as substrate and is formed as product, 2) identifying the products formed from [14C]HCO3- and [14C] OCN-, 3) identifying the products formed from [13C] HCO3- and [12C]OCN- in the presence of [18O]H2O, and 4) determining whether 18O from [18O]HCO3- is incorporated into CO2 derived from OCN-. Bicarbonate (not CO2) is the substrate. Carbon dioxide (not HCO3-) is produced in stoichiometric amounts from both HCO3- and OCN-. 18O from [18O]H2O is not incorporated into CO2 formed from either HCO3- or OCN-. Oxygen-18 from [18O]HCO3- is incorporated into CO2 derived from OCN-. These results support the above mechanism, indicating that decomposition of cyanate catalyzed by cyanase is not a hydrolysis reaction and that bicarbonate functions as a recycling substrate.

  19. Bicarbonate is a recycling substrate for cyanase

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, W.V.; Anderson, P.M.

    1987-05-01

    Cyanase catalyzes HCO/sub 3//sup -/-dependent decomposition of cyanate to NH/sub 4//sup +/ and HCO/sub 3//sup -/. Previous studies provided evidence that carbamate is an initial product and that the kinetic mechanism is rapid equilibrium random (HCO/sub 3//sup -/ serving as substrate as opposed to activator). Direct evidence for this mechanism was obtained in this study by (1) identifying the products formed from (/sup 14/C)HCO/sub 3//sup -/ or (/sup 14/C)OCN/sup -/, (2) identifying the products formed from (/sup 13/C)HCO/sub 3//sup -/ in the presence of (/sup 18/O)H/sub 2/O, and (3) determining whether CO/sub 2/ or HCO/sub 3//sup -/ serve as substrate and are formed as product. Carbon dioxide (not HCO/sub 3//sup -/) is produced in stoichiometric amounts from both HCO/sub 3//sup -/ and OCN/sup -/. Bicarbonate (not CO/sub 2/) is the substrate. Oxygen-18 from (/sup 18/O)H/sub 2/O is not incorporated into CO/sub 2/ formed from either HCO/sub 3//sup -/ or OCN/sup -/. These results indicate that decomposition of cyanate is not a hydrolysis reaction and that HCO/sub 3//sup -/ functions as a substrate.

  20. Effects of substrates, different pretreatment protocols and ...

    African Journals Online (AJOL)

    Three substrates (forest top soil, river sand and a mixture of forest top soil and river sand) and 18 pre-germination treatments including a control (untreated seeds), a mechanical scarification, six heat treatments which were done by soaking seeds in hot water (100 °C) for different lengths of time, and ten acid scarifications ...

  1. Influence of substrate modulus on gecko adhesion

    Science.gov (United States)

    Klittich, Mena R.; Wilson, Michael C.; Bernard, Craig; Rodrigo, Rochelle M.; Keith, Austin J.; Niewiarowski, Peter H.; Dhinojwala, Ali

    2017-01-01

    The gecko adhesion system fascinates biologists and materials scientists alike for its strong, reversible, glue-free, dry adhesion. Understanding the adhesion system’s performance on various surfaces can give clues as to gecko behaviour, as well as towards designing synthetic adhesive mimics. Geckos encounter a variety of surfaces in their natural habitats; tropical geckos, such as Gekko gecko, encounter hard, rough tree trunks as well as soft, flexible leaves. While gecko adhesion on hard surfaces has been extensively studied, little work has been done on soft surfaces. Here, we investigate for the first time the influence of macroscale and nanoscale substrate modulus on whole animal adhesion on two different substrates (cellulose acetate and polydimethylsiloxane) in air and find that across 5 orders of magnitude in macroscale modulus, there is no change in adhesion. On the nanoscale, however, gecko adhesion is shown to depend on substrate modulus. This suggests that low surface-layer modulus may inhibit the gecko adhesion system, independent of other influencing factors such as macroscale composite modulus and surface energy. Understanding the limits of gecko adhesion is vital for clarifying adhesive mechanisms and in the design of synthetic adhesives for soft substrates (including for biomedical applications and wearable electronics). PMID:28287647

  2. Transferring substrates to the 26S proteasome

    DEFF Research Database (Denmark)

    Hartmann-Petersen, Rasmus; Seeger, Michael; Gordon, Colin

    2003-01-01

    Ubiquitin-dependent protein degradation is not only involved in the recycling of amino acids from damaged or misfolded proteins but also represents an essential and deftly controlled mechanism for modulating the levels of key regulatory proteins. Chains of ubiquitin conjugated to a substrate prot...

  3. Influence of substrate modulus on gecko adhesion

    Science.gov (United States)

    Klittich, Mena R.; Wilson, Michael C.; Bernard, Craig; Rodrigo, Rochelle M.; Keith, Austin J.; Niewiarowski, Peter H.; Dhinojwala, Ali

    2017-03-01

    The gecko adhesion system fascinates biologists and materials scientists alike for its strong, reversible, glue-free, dry adhesion. Understanding the adhesion system’s performance on various surfaces can give clues as to gecko behaviour, as well as towards designing synthetic adhesive mimics. Geckos encounter a variety of surfaces in their natural habitats; tropical geckos, such as Gekko gecko, encounter hard, rough tree trunks as well as soft, flexible leaves. While gecko adhesion on hard surfaces has been extensively studied, little work has been done on soft surfaces. Here, we investigate for the first time the influence of macroscale and nanoscale substrate modulus on whole animal adhesion on two different substrates (cellulose acetate and polydimethylsiloxane) in air and find that across 5 orders of magnitude in macroscale modulus, there is no change in adhesion. On the nanoscale, however, gecko adhesion is shown to depend on substrate modulus. This suggests that low surface-layer modulus may inhibit the gecko adhesion system, independent of other influencing factors such as macroscale composite modulus and surface energy. Understanding the limits of gecko adhesion is vital for clarifying adhesive mechanisms and in the design of synthetic adhesives for soft substrates (including for biomedical applications and wearable electronics).

  4. MIXED SUBSTRATES IN ENVIRONMENT AND BIOTECHNOLOGICAL PROCESSES

    Directory of Open Access Journals (Sweden)

    T. P. Pirog

    2013-12-01

    Full Text Available The modern literature and own experimental data on the use of substrates’ mixtures for intensification of microbial synthesis technologies of practically valuable fermentation products (ethanol, lactic acid, butanediol, primary (amino acids, n-hydroxybenzoate, triglycerides and secondary (lovastatin, surfactants metabolites as well as for intensification of biodegradation of aromatic xenobiotics (benzene, cresols, phenols, toluene and pesticides (dimethoate are presented. Special attention is paid on the molecular mechanisms that were established in recent years and underlying the phenomenon catabolic repression in Gram-positive (Bacillus subtilis and Gram-negative (Pseudomonas, Escherichia coli bacteria and yeast Saccharomyces cerevisiae, and on the use of these data to develop technologies for utilization of plant biomass to produce industrially important metabolites. The survival strategies of heterotrophic microorganisms in natural oligotrophic environments are considered, including the simultaneous use of multiple substrates, allowing improved kinetic characteristics that give them a competitive advantage, also provided significant metabolic/physiological flexibility. The own experimental data on the use of mixtures of growth substrates for the intensification of surfactants’ synthesis of Rhodococcus erythropolis IMV Ac-5017 and Acinetobacter calcoaceticus IMV B-7241 are summarized. The dependence of the synthesis of surfactants in a mixture of energy excess (hexadecane and energy deficient (glycerol, ethanol substrates on the way of inoculum preparation, concentration of mono-substrates in the mixture, and their molar ratio were determined.

  5. The effect of pH and role of Ni 2+ in zinc phosphating of 2024-Al alloy . Part II: Microscopic studies with SEM and SAM

    Science.gov (United States)

    Akhtar, A. S.; Susac, D.; Wong, P. C.; Mitchell, K. A. R.

    2006-11-01

    Coatings formed on 2024-T3 aluminum alloy were studied by scanning electron microscopy (SEM) and scanning Auger microscopy (SAM) after dipping in zinc phosphating (ZPO) baths at different acidities, with or without the Ni2+ additive. The objective was to learn more about the ZPO coating mechanism on the different microstructural regions of 2024-T3. When the initial coating solution pH is 4 (optimal acidity), a slower etching rate at the Al-Cu-Fe-Mn intermetallic particle causes significant precipitation of ZnO, which differs from the coating on other regions of the surface where phosphate predominates. The larger crystals (∼μm dimension) on the matrix and the Al-Cu-Mg particle contain more phosphate compared to other areas on the surface. When Ni2+ is added to the coating solution, the Al-Cu-Mg particle is more thickly coated compared to when the Ni2+ is not present. The slower rate of precipitation when Ni2+ is present in the coating solution increases the exposure of the alloy substrate to the acidic environment, so allowing more dissolution of Mg and Al from the Al-Cu-Mg particle. This results in the particle becoming more cathodic in nature, and therefore more coating deposits at this location. Evidence from SAM supports the presence of NiAl2O4, hypothesized in Part I, forming at coating pores later in the process.

  6. Microsolvation of the acetanilide cation (AA(+)) in a nonpolar solvent: IR spectra of AA(+)-L(n) clusters (L = He, Ar, N2; n ≤ 10).

    Science.gov (United States)

    Schmies, Matthias; Patzer, Alexander; Schütz, Markus; Miyazaki, Mitsuhiko; Fujii, Masaaki; Dopfer, Otto

    2014-05-07

    Infrared photodissociation (IRPD) spectra of mass-selected cluster ions of acetanilide (N-phenylacetamide), AA(+)-Ln, with the ligands L = He (n = 1-2), Ar (n = 1-7), and N2 (n = 1-10) are recorded in the hydride stretch (amide A, νNH, νCH) and fingerprint (amide I-III) ranges of AA(+) in its (2)A'' ground electronic state. Cold AA(+)-Ln clusters are generated in an electron impact ion source, which predominantly produces the most stable isomer of a given cluster ion. Systematic vibrational frequency shifts of the N-H stretch fundamentals (νNH) provide detailed information about the sequential microsolvation process of AA(+) in a nonpolar (L = He and Ar) and quadrupolar (L = N2) solvent. In the most stable AA(+)-Ln clusters, the first ligand forms a hydrogen bond (H-bond) with the N-H proton of trans-AA(+) (t-AA(+)), whereas further ligands bind weakly to the aromatic ring (π-stacking). There is no experimental evidence for complexes with the less stable cis-AA(+) isomer. Quantum chemical calculations at the M06-2X/aug-cc-pVTZ level confirm the cluster growth sequence derived from the IR spectra. The calculated binding energies of De(H) = 720 and 1227 cm(-1) for H-bonded and De(π) = 585 and 715 cm(-1) for π-bonded Ar and N2 ligands in t-AA(+)-L are consistent with the observed photofragmentation branching ratios of AA(+)-Ln. Comparison between charged and neutral AA((+))-L dimers indicates that ionization switches the preferred ion-ligand binding motif from π-stacking to H-bonding. Electron removal from the HOMO of AA(+) delocalized over both the aromatic ring and the amide group significantly strengthens the C[double bond, length as m-dash]O bond and weakens the N-H bond of the amide group.

  7. Bulk density and relationship air/water of horticultural substrate

    OpenAIRE

    Fernandes,Carolina; Corá, José Eduardo

    2004-01-01

    Change on substrate bulk density during the growing period may negatively affect other substrate physical properties and, consequently, plant growth. The objectives of this research were 1) to characterize physical properties of two horticultural substrates (S1 and S2), 2) to evaluate the effect of different bulk densities values of those substrates on their air/water relationship, and 3) to develop mathematical functions to estimate the air/water relationship by increasing substrates bulk de...

  8. Surprisingly high substrate specificities observed in complex biofilms

    DEFF Research Database (Denmark)

    Nierychlo, Marta; Kindaichi, Tomonori; Kragelund, Caroline

    to investigate the cell-specific in situ substrate uptake pattern of different bacteria. Different substrates were tested by combination of Microautoradiography and Fluorescence in situ Hybridization. Conditions applied (different substrate concentrations, starvation, induction with specific substrates, multiple...... by selection for different specialized species. We hypothesized that bacteria growing in natural environment express strongly conserved substrate specificity which is independent on short-term (few hours) variations in growth conditions. In this study, biofilm from Aalborg wastewater treatment plant was used...

  9. AaERF1 positively regulates the resistance to Botrytis cinerea in Artemisia annua.

    Directory of Open Access Journals (Sweden)

    Xu Lu

    Full Text Available Plants are sessile organisms, and they can not move away under abiotic or biotic stresses. Thus plants have evolved a set of genes that response to adverse environment to modulate gene expression. In this study, we characterized and functionally studied an ERF transcription factor from Artemisia annua, AaERF1, which plays an important role in biotic stress responses. The AaERF1 promoter had been cloned and GUS staining results of AaERF1 promoter-GUS transgenic A. annua showed that AaERF1 is expressed ubiquitiously in all organs. Several putative cis-acting elements such as W-box, TGA-box and Py-rich element, which are involved in defense responsiveness, are present in the promoter. The expression of AaERF1 can be induced vigorously by methyl jasmonate as well as by ethephon and wounding, implying that AaERF1 may activate some of the defense genes via the jasmonic acid and ethylene signaling pathways of A. annua. The results of electrophoretic mobility shift assay (EMSA and yeast one-hybrid experiments showed that AaERF1 was able to bind to the GCC box cis-acting element in vitro and in yeast. Ectopic expression of AaERF1 could enhance the expression levels of the defense marker genes PLANT DEFENSIN1.2 (PDF1.2 and BASIC CHITINASE (ChiB, and increase the resistance to Botrytis cinerea in the 35S::AaERF1 transgenic Arabidopsis. The down-regulated expression level of AaERF1 evidently reduced the resistance to B. cinerea in A. annua. The overall results showed that AaERF1 positively regulated the resistance to B. cinerea in A. annua.

  10. Unmasking tandem site interaction in human acetylcholinesterase. Substrate activation with a cationic acetanilide substrate.

    Science.gov (United States)

    Johnson, Joseph L; Cusack, Bernadette; Davies, Matthew P; Fauq, Abdul; Rosenberry, Terrone L

    2003-05-13

    Acetylcholinesterase (AChE) contains a narrow and deep active site gorge with two sites of ligand binding, an acylation site (or A-site) at the base of the gorge, and a peripheral site (or P-site) near the gorge entrance. The P-site contributes to catalytic efficiency by transiently binding substrates on their way to the acylation site, where a short-lived acyl enzyme intermediate is produced. A conformational interaction between the A- and P-sites has recently been found to modulate ligand affinities. We now demonstrate that this interaction is of functional importance by showing that the acetylation rate constant of a substrate bound to the A-site is increased by a factor a when a second molecule of substrate binds to the P-site. This demonstration became feasible through the introduction of a new acetanilide substrate analogue of acetylcholine, 3-(acetamido)-N,N,N-trimethylanilinium (ATMA), for which a = 4. This substrate has a low acetylation rate constant and equilibrates with the catalytic site, allowing a tractable algebraic solution to the rate equation for substrate hydrolysis. ATMA affinities for the A- and P-sites deduced from the kinetic analysis were confirmed by fluorescence titration with thioflavin T as a reporter ligand. Values of a >1 give rise to a hydrolysis profile called substrate activation, and the AChE site-specific mutant W86F, and to a lesser extent wild-type human AChE itself, showed substrate activation with acetylthiocholine as the substrate. Substrate activation was incorporated into a previous catalytic scheme for AChE in which a bound P-site ligand can also block product dissociation from the A-site, and two additional features of the AChE catalytic pathway were revealed. First, the ability of a bound P-site ligand to increase the substrate acetylation rate constant varied with the structure of the ligand: thioflavin T accelerated ATMA acetylation by a factor a(2) of 1.3, while propidium failed to accelerate. Second, catalytic rate

  11. Direct Emissivity Measurements of Painted Metals for Improved Temperature Estimation During Laser Damage Testing

    Science.gov (United States)

    2014-03-27

    authors.) . . . . . . . . . . . . . . . . . . 19 4.1 Temperature-dependent spectral emissivity for black painted Al2024 -T3 alloy as temperature is...increased from room temperature to 500◦ C. . . . . . . . . . 23 4.2 Detail of the spectral emissivity profiles for black painted Al2024 -T3 alloy in the...profiles for light gray camouflage painted Al2024 -T3 alloy as temperature is increased from room temperature to 500◦ C. . . . . . . . . . 25 4.6

  12. Multifunctional epitaxial systems on silicon substrates

    Energy Technology Data Exchange (ETDEWEB)

    Singamaneni, Srinivasa Rao, E-mail: ssingam@ncsu.edu [Department of Materials Science and Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Materials Science Division, Army Research Office, Research Triangle Park, North Carolina 27709 (United States); Department of Physics, The University of Texas at El Paso, El Paso, Texas 79968 (United States); Prater, John Thomas [Department of Materials Science and Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Materials Science Division, Army Research Office, Research Triangle Park, North Carolina 27709 (United States); Narayan, Jagdish [Department of Materials Science and Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States)

    2016-09-15

    Multifunctional heterostructures can exhibit a wide range of functional properties, including colossal magneto-resistance, magnetocaloric, and multiferroic behavior, and can display interesting physical phenomena including spin and charge ordering and strong spin-orbit coupling. However, putting this functionality to work remains a challenge. To date, most of the work reported in the literature has dealt with heterostructures deposited onto closely lattice matched insulating substrates such as DyScO{sub 3}, SrTiO{sub 3} (STO), or STO buffered Si(100) using concepts of lattice matching epitaxy (LME). However, strain in heterostructures grown by LME is typically not fully relaxed and the layers contain detrimental defects such as threading dislocations that can significantly degrade the physical properties of the films and adversely affect the device characteristics. In addition, most of the substrates are incompatible with existing CMOS-based technology, where Si (100) substrates dominate. This review discusses recent advances in the integration of multifunctional oxide and non-oxide materials onto silicon substrates. An alternative thin film growth approach, called “domain matching epitaxy,” is presented which identifies approaches for minimizing lattice strain and unwanted defects in large misfit systems (7%–25% and higher). This approach broadly allows for the integration of multifunctional materials onto silicon substrates, such that sensing, computation, and response functions can be combined to produce next generation “smart” devices. In general, pulsed laser deposition has been used to epitaxially grow these materials, although the concepts developed here can be extended to other deposition techniques, as well. It will be shown that TiN and yttria-stabilized zirconia template layers provide promising platforms for the integration of new functionality into silicon-based computer chips. This review paper reports on a number of thin

  13. Self-Assembled Local Artificial Substrates of GaAs on Si Substrate

    Directory of Open Access Journals (Sweden)

    Frigeri C

    2010-01-01

    Full Text Available Abstract We propose a self-assembling procedure for the fabrication of GaAs islands by Droplet Epitaxy on silicon substrate. Controlling substrate temperature and amount of supplied gallium is possible to tune the base size of the islands from 70 up to 250 nm and the density from 107 to 109 cm−2. The islands show a standard deviation of base size distribution below 10% and their shape evolves changing the aspect ratio from 0.3 to 0.5 as size increases. Due to their characteristics, these islands are suitable to be used as local artificial substrates for the integration of III–V quantum nanostructures directly on silicon substrate.

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0775 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0775 ref|ZP_01789776.1| multidrug resistance protein [Haemophilus influenza...e PittAA] gb|EDK08502.1| multidrug resistance protein [Haemophilus influenzae PittAA] ZP_01789776.1 0.22 27% ...

  15. Bacterial cellulose based hydrogel (BC-g-AA) and preliminary result of swelling behavior

    Energy Technology Data Exchange (ETDEWEB)

    Hakam, Adil; Lazim, Azwan Mat [UKM-MIMOS Laboratory, School of Chemical Sciences and Food Technology, National University of Malaysia (UKM) (Malaysia); Abdul Rahman, I. Irman [Laboratory of Gamma Radiation Instrument, Science Nuclear Program, School of Applied Physics, National University of Malaysia (UKM) (Malaysia)

    2013-11-27

    In this study, hydrogel based on Bacterial cellulose (BC) or local known as Nata de Coco, which grafted with monomer: Acrylic acid (AA) is synthesis by using gamma radiation technique. These hydrogel (BC-g-AA) has unique characteristic whereby responsive to pH buffer solution.

  16. Intrauterine, postpartum and adult relationships between arachidonic acid (AA) and docosahexaenoic acid (DHA)

    NARCIS (Netherlands)

    Kuipers, Remko S.; Luxwolda, Martine F.; Dijck-Brouwer, D. A. Janneke; Muskiet, Frits A. J.

    2011-01-01

    Erythrocyte (RBC) fatty acid compositions from populations with stable dietary habits but large variations in RBC-arachidonic (AA) and RBC-docosahexaenoic acid (DHA) provided us with insight into relationships between DHA and AA. It also enabled us to estimate the maternal RBC-DHA (mRBC-DHA) status

  17. NCBI nr-aa BLAST: CBRC-XTRO-01-0674 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0674 ref|YP_001022362.1| putative heme O oxygenase (cytochrome aa3-controlling...) transmembrane protein [Methylibium petroleiphilum PM1] gb|ABM96127.1| putative heme O oxygenase (cytochrome aa3-controlling

  18. Chang'aa Drinking in Kibera Slum: The Harmful Effects of ...

    African Journals Online (AJOL)

    Chang'aa Drinking in Kibera Slum: The Harmful Effects of Contemporary Changes in the Production and Consumption of Traditional Spirits. ... African Journal of Drug and Alcohol Studies ... This article examines the harmful effects of drinking chang'aa, an illegal spirit produced locally, in Kibera slum in Nairobi, Kenya.

  19. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available -binding protein that promotes hyphal development; This 731 amino acid protein is far longer than the 290 aa protein originally repor...ted. | There is little reason to accept the validity of a putative intron at aa 631

  20. NCBI nr-aa BLAST: CBRC-MMUR-01-0065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0065 ref|ZP_03493196.1| hypothetical protein AaLAA1DRAFT_0782 [Alicyclobacillus... acidocaldarius LAA1] gb|EED08211.1| hypothetical protein AaLAA1DRAFT_0782 [Alicyclobacillus acidocaldarius LAA1] ZP_03493196.1 2.4 30% ...

  1. Inside Hall 193 for the Antiproton Accumulator (AA) ring

    CERN Multimedia

    1979-01-01

    Installation work is in full swing. A model quadrupole on the left shows where the magnet ring will be. The cables wound on drums are part of the pulse-forming network for the injection kicker. See Annual Report 1979 p. 103, Fig. 9 and photo 7911303. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  2. Microstructural chacarteristics of an AA6061 spinning alloy

    OpenAIRE

    Oldani, C.; Aguirre, L.; Manzini,R.

    2008-01-01

    El proceso de repujado para la fabricación de tubos de aluminio ha sido muy poco estudiado, quizá debido al bajo tonelaje procesado por este método, lo que lo hace poco relevante frente a otros procesos de deformación plástica. Sin embargo, es un método económicamente competitivo para la fabricación de recipientes de presión livianos, consistentes en un liner de aleación de aluminio reforzado con fibra de vidrio. Los efectos producidos sobre la microestructura de una aleación de aluminio AA 6...

  3. Slot-type kicker for the AA stochastic cooling

    CERN Multimedia

    Photographic Service

    1979-01-01

    A "slotted transmission line" structure was used for both pickups and the kicker of one of the stochastic cooling systems of the Antiproton Accumulator (AA). They served for the cooling of the high-density stack, in momentum and in both transverse planes. In the beginning in a single band, 1-2 GHz, later in 3 bands, 1-2, 2-4 and 4-8 GHz. The kicker of the first generation, shown here, was located where the dispersion was zero and the beam size small, and thus had a quadratic cross-section. The pickups were rectangular and wider in the horizontal plane. See also 7906193

  4. Application of a europium complex, Eu(AA){sub 3}phen (AA = acrylic acid, phen = 1,10-phenanthroline) as a spectroscopic probe and cleaving reagent of DNA

    Energy Technology Data Exchange (ETDEWEB)

    Li, Ling; Pan, Quan; Song, Gong Wu, E-mail: songgw@hubu.edu.cn

    2013-05-01

    A complex Eu(AA){sub 3}phen was synthesized and characterized by elemental analysis, IR spectroscopy and {sup 1}H NMR. Interaction between Eu(AA){sub 3}phen and DNA was studied by UV/visible absorption spectroscopy, fluorescence spectrophotometer, circular-dichroism (CD) spectra and gel-electrophoresis measurements. Absorption spectral indicated that Eu(AA){sub 3}phen binding to DNA was an electrostatic mode, which was authenticated by the effect of ionic strength, thermal denaturation and fluorescence quenching experiments. The intrinsic binding constant K{sub b} of Eu(AA){sub 3}phen was calculated to be 1.6 × 10{sup 4} L mol{sup −1}. - Highlights: ► A novel complex was synthesized. ► The interaction between the complex and DNA was discussed. ► The complex was hoped to sense for DNA.

  5. Carbon nanotube substrates and catalyzed hot stamp for polishing and patterning the substrates

    Science.gov (United States)

    Wang, Yuhuang [Evanston, IL; Hauge, Robert H [Houston, TX; Schmidt, Howard K [Houston, TX; Kim, Myung Jong [Houston, TX; Kittrell, W Carter [Houston, TX

    2009-09-08

    The present invention is generally directed to catalyzed hot stamp methods for polishing and/or patterning carbon nanotube-containing substrates. In some embodiments, the substrate, as a carbon nanotube fiber end, is brought into contact with a hot stamp (typically at 200-800.degree. C.), and is kept in contact with the hot stamp until the morphology/patterns on the hot stamp have been transferred to the substrate. In some embodiments, the hot stamp is made of material comprising one or more transition metals (Fe, Ni, Co, Pt, Ag, Au, etc.), which can catalyze the etching reaction of carbon with H.sub.2, CO.sub.2, H.sub.2O, and/or O.sub.2. Such methods can (1) polish the carbon nanotube-containing substrate with a microscopically smooth finish, and/or (2) transfer pre-defined patterns from the hot stamp to the substrate. Such polished or patterned carbon nanotube substrates can find application as carbon nanotube electrodes, field emitters, and field emitter arrays for displays and electron sources.

  6. 76 FR 6794 - 30-Day Submission Period for Requests for ONC-Approved Accreditor (ONC-AA) Status

    Science.gov (United States)

    2011-02-08

    ... HUMAN SERVICES 30-Day Submission Period for Requests for ONC-Approved Accreditor (ONC-AA) Status AGENCY... ONC-Approved Accreditor (ONC-AA) status. Authority: 42 U.S.C. 300jj-11. DATES: The 30-day submission... a notice in the Federal Register to announce the 30-day period during which requests for ONC-AA...

  7. Optical substrate materials for synchrotron radiation beamlines

    Energy Technology Data Exchange (ETDEWEB)

    Howells, M.R. [Lawrence Berkeley National Lab., CA (United States). Advanced Light Source; Paquin, R.A. [Univ. of Arizona, Tucson, AZ (United States). Optical Sciences Center

    1997-06-01

    The authors consider the materials choices available for making optical substrates for synchrotron radiation beam lines. They find that currently the optical surfaces can only be polished to the required finish in fused silica and other glasses, silicon, CVD silicon carbide, electroless nickel and 17-4 PH stainless steel. Substrates must therefore be made of one of these materials or of a metal that can be coated with electroless nickel. In the context of material choices for mirrors they explore the issues of dimensional stability, polishing, bending, cooling, and manufacturing strategy. They conclude that metals are best from an engineering and cost standpoint while the ceramics are best from a polishing standpoint. They then give discussions of specific materials as follows: silicon carbide, silicon, electroless nickel, Glidcop{trademark}, aluminum, precipitation-hardening stainless steel, mild steel, invar and superinvar. Finally they summarize conclusions and propose ideas for further research.

  8. SERS substrate for detection of explosives.

    Science.gov (United States)

    Chou, Alison; Jaatinen, Esa; Buividas, Ricardas; Seniutinas, Gediminas; Juodkazis, Saulius; Izake, Emad L; Fredericks, Peter M

    2012-12-07

    A novel gold coated femtosecond laser nanostructured sapphire surface - an "optical nose" - based on surface-enhanced Raman spectroscopy (SERS) for detecting vapours of explosive substances was investigated. Four different nitroaromatic vapours at room temperature were tested. Sensor responses were unambiguous and showed response in the range of 0.05-15 μM at 25 °C. The laser fabricated substrate nanostructures produced up to an eight-fold increase in Raman signal over that observed on the unstructured portions of the substrate. This work demonstrates a simple sensing system that is compatible with commercial manufacturing practices to detect taggants in explosives which can undertake as part of an integrated security or investigative mission.

  9. A cellular glass substrate solar concentrator

    Science.gov (United States)

    Bedard, R.; Bell, D.

    1980-01-01

    The design of a second generation point focusing solar concentration is discussed. The design is based on reflective gores fabricated of thin glass mirror bonded continuously to a contoured substrate of cellular glass. The concentrator aperture and structural stiffness was optimized for minimum concentrator cost given the performance requirement of delivering 56 kWth to a 22 cm diameter receiver aperture with a direct normal insolation of 845 watts sq m and an operating wind of 50 kmph. The reflective panel, support structure, drives, foundation and instrumentation and control subsystem designs, optimized for minimum cost, are summarized. The use of cellular glass as a reflective panel substrate material is shown to offer significant weight and cost advantages compared to existing technology materials.

  10. Evaluation of substrates for butanol production

    Energy Technology Data Exchange (ETDEWEB)

    Compere, A.L.; Griffith, W.L.

    1979-01-01

    The production was evaluated of ethanol, acetone, and butanol from several different carbohydrate materials by five strains of Clostridia and two mixed cultures. The substrates, which were tested at concn ranging between 2.5 and 10% w/v, included pentoses, hexoses, disaccharides, and polysaccharides. The organisms used were Clostridium acetobutylicum strains NRRL B527 and NRRL B3179; Clostridium butylicum strains NRRL B592 and NRRL B593; and Clostridium pasteurianum strain NRRL B598. The mixed cultures contained all of these organisms. Mixed culture 1 contained in addition to the Clostridia, Klebsiella pneumoniae strain NRRL B427. Mixed culture 2 contained mixed culture 1 plus a yeast isolated from kefir culture. Where possible, maxima were found for the conversion of different substrates. 7 tables.

  11. Lithographically patterned silicon nanostructures on silicon substrates

    Energy Technology Data Exchange (ETDEWEB)

    Megouda, Nacera [Institut de Recherche Interdisciplinaire (IRI, USR 3078), Universite Lille1, Parc de la Haute Borne, 50 Avenue de Halley-BP 70478, 59658 Villeneuve d' Ascq and Institut d' Electronique, de Microelectronique et de Nanotechnologie (IEMN, CNRS-8520), Cite Scientifique, Avenue Poincare-B.P. 60069, 59652 Villeneuve d' Ascq (France); Faculte des Sciences, Universite Mouloud Mammeri, Tizi-Ouzou (Algeria); Unite de Developpement de la Technologie du Silicium (UDTS), 2 Bd. Frantz Fanon, B.P. 140 Alger-7 merveilles, Alger (Algeria); Piret, Gaeelle; Galopin, Elisabeth; Coffinier, Yannick [Institut de Recherche Interdisciplinaire (IRI, USR 3078), Universite Lille1, Parc de la Haute Borne, 50 Avenue de Halley-BP 70478, 59658 Villeneuve d' Ascq and Institut d' Electronique, de Microelectronique et de Nanotechnologie (IEMN, CNRS-8520), Cite Scientifique, Avenue Poincare-B.P. 60069, 59652 Villeneuve d' Ascq (France); Hadjersi, Toufik, E-mail: hadjersi@yahoo.com [Unite de Developpement de la Technologie du Silicium (UDTS), 2 Bd. Frantz Fanon, B.P. 140 Alger-7 merveilles, Alger (Algeria); Elkechai, Omar [Faculte des Sciences, Universite Mouloud Mammeri, Tizi-Ouzou (Algeria); and others

    2012-06-01

    The paper reports on controlled formation of silicon nanostructures patterns by the combination of optical lithography and metal-assisted chemical dissolution of crystalline silicon. First, a 20 nm-thick gold film was deposited onto hydrogen-terminated silicon substrate by thermal evaporation. Gold patterns (50 {mu}m Multiplication-Sign 50 {mu}m spaced by 20 {mu}m) were transferred onto the silicon wafer by means of photolithography. The etching process of crystalline silicon in HF/AgNO{sub 3} aqueous solution was studied as a function of the silicon resistivity, etching time and temperature. Controlled formation of silicon nanowire arrays in the unprotected areas was demonstrated for highly resistive silicon substrate, while silicon etching was observed on both gold protected and unprotected areas for moderately doped silicon. The resulting layers were characterized using scanning electron microscopy (SEM).

  12. Enhanced photoacoustic detection using photonic crystal substrate

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Yunfei; Liu, Kaiyang [Department of Electrical and Computer Engineering, Iowa State University, Ames, Iowa 50011 (United States); McClelland, John [Ames Laboratory-USDOE, Ames, Iowa 50011 (United States); Department of Mechanical Engineering, Iowa State University, Ames, Iowa 50011 (United States); Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, Ames, Iowa 50011 (United States); Lu, Meng, E-mail: menglu@iastate.edu [Department of Electrical and Computer Engineering, Iowa State University, Ames, Iowa 50011 (United States); Department of Mechanical Engineering, Iowa State University, Ames, Iowa 50011 (United States)

    2014-04-21

    This paper demonstrates the enhanced photoacoustic sensing of surface-bound light absorbing molecules and metal nanoparticles using a one-dimensional photonic crystal (PC) substrate. The PC structure functions as an optical resonator at the wavelength where the analyte absorption is strong. The optical resonance of the PC sensor provides an intensified evanescent field with respect to the excitation light source and results in enhanced optical absorption by surface-immobilized samples. For the analysis of a light absorbing dye deposited on the PC surface, the intensity of photoacoustic signal was enhanced by more than 10-fold in comparison to an un-patterned acrylic substrate. The technique was also applied to detect gold nanorods and exhibited more than 40 times stronger photoacoustic signals. The demonstrated approach represents a potential path towards single molecule absorption spectroscopy with greater performance and inexpensive instrumentation.

  13. Changing epidemiology of AA amyloidosis: clinical observations over 25 years at a single national referral centre.

    Science.gov (United States)

    Lane, Thirusha; Pinney, Jennifer H; Gilbertson, Janet A; Hutt, David F; Rowczenio, Dorota M; Mahmood, Shameem; Sachchithanantham, Sajitha; Fontana, Marianna; Youngstein, Taryn; Quarta, Candida C; Wechalekar, Ashutosh D; Gillmore, Julian D; Hawkins, Philip N; Lachmann, Helen J

    2017-09-01

    Systemic AA amyloidosis is a serious complication of chronic inflammation; however, there are relatively few published data on its incidence. We investigated the changing epidemiology of AA amyloidosis over a 25-year period at a single national referral centre. We conducted a retrospective study of all patients diagnosed with AA amyloidosis who had attended the centre between 1990 and 2014 inclusive. Six hundred and twenty-five patients were studied in three cohorts: C1: 1990-1997; C2: 1998-2006; C3: 2007-2014. Mean age at presentation increased from 46 in C1 to 56 in C3 (p AA amyloidosis over a quarter of a century, reflecting advances in therapeutics and overall management of complex chronic disease in an ageing population. AA amyloidosis of uncertain aetiology presents an emerging major problem. Newer techniques such as next-generation sequencing may aid diagnosis and effective treatment, thereby improving overall survival.

  14. Lu AA21004, a novel multimodal antidepressantwith activity exerted through serotonergic targets

    DEFF Research Database (Denmark)

    Mork, A.; Pehrson, A.; Montezinho, L. C. P.

    2012-01-01

    Background: Lu AA21004 is a multimodal antidepressant that functions as a 5-HT3 and 5-HT7 receptor antagonist, 5-HT1B receptor partial agonist, 5-HT1A receptor agonist and inhibitor of the 5-HT transporter in vitro. Here we investigated preclinical effects of Lu AA21004 1) on target occupancies, 2......) on neurotransmitter levels in the brain, 3) in an animal model of depression and 4) on cognitive processing. Methods: Lu AA21004 occupancy at the 5-HT transporter, and 5-HT1A, 5-HT1B and 5-HT3 receptors was measured ex vivo in rat brain slices. Effects of Lu AA21004 on extracellular neurotransmitter levels [serotonin...... (5-HT), noradrenaline (NA), dopamine (DA), acetylcholine (ACh), histamine (Hist)] were measured by microdialysis. Antidepressant potential was assessed in the forced swim test using Flinders Sensitive Line (FSL) rats. Moreover, effects of Lu AA21004 on acquisition, consolidation and recall...

  15. Dicty_cDB: FC-AA23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AA23 (Link to dictyBase) - - - Contig-U16090-1 FC-AA23E (Link to Original site)...- - - - - FC-AA23E 387 Show FC-AA23 Library FC (Link to library) Clone ID FC-AA23 (Link to dictyBase)...AL114484 |AL114484.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 72 3e-15...AL113432 |AL113432.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 72 3e-15...AL112836 |AL112836.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 72 3e-15

  16. Advanced organics for electronic substrates and packages

    CERN Document Server

    Fletcher, Andrew E

    1992-01-01

    Advanced Organics for Electronic Substrates and Packages provides information on packaging, which is one of the most technologically intensive activities in the electronics industry. The electronics packaging community has realized that while semiconductor devices continue to be improved upon for performance, cost, and reliability, it is the interconnection or packaging of these devices that will limit the performance of the systems. Technology must develop packaging for transistor chips, with high levels of performance and integration providing cooling, power, and interconnection, and yet pre

  17. Hydrogenation of biomass-derived substrates

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, John C.; Waidmann, Christopher R.

    2016-06-07

    The .alpha.,.beta.-unsaturated ketone moiety of a substrate representative of non-food based biomass was hydrogenated to the corresponding saturated alcohol moiety using a composition including (1) a copper salt; (2) a phosphine; (3) a polar aprotic solvent such as acetonitrile, and (4) a compound suitable for providing hydrogen for the hydrogenation, such as a suitable silane material or a suitable siloxane material.

  18. Thread as a substrate for microfluidic diagnostics

    OpenAIRE

    Ballerini, David Robert

    2017-01-01

    Strong need exists in the developing world for affordable diagnostics for health care and environmental monitoring. Diagnostic devices must meet a number of criteria to be suitable for these roles, including being cheap, easily used and transported, but also rapid and accurate, without the need for external equipment. The literature is crowded with studies which employed paper as a substrate for meeting this end, but a recently blossoming field of study has turned to the common ...

  19. Biomimetic substrate control of cellular mechanotransduction.

    Science.gov (United States)

    Andalib, Mohammad Nahid; Dzenis, Yuris; Donahue, Henry J; Lim, Jung Yul

    2016-01-01

    Extracellular mechanophysical signals from both static substrate cue and dynamic mechanical loading have strong potential to regulate cell functions. Most of the studies have adopted either static or dynamic cue and shown that each cue can regulate cell adhesion, spreading, migration, proliferation, lineage commitment, and differentiation. However, there is limited information on the integrative control of cell functions by the static and dynamic mechanophysical signals. For example, a majority of dynamic loading studies have tested mechanical stimulation of cells utilizing cultures on flat surfaces without any surface modification. While these approaches have provided significant information on cell mechanotransduction, obtained outcomes may not correctly recapitulate complex cellular mechanosensing milieus in vivo. Several pioneering studies documented cellular response to mechanical stimulations upon cultures with biomimetic substrate modifications. In this min-review, we will highlight key findings on the integrative role of substrate cue (topographic, geometric, etc.) and mechanical stimulation (stretch, fluid shear) in modulating cell function and fate. The integrative approaches, though not fully established yet, will help properly understand cell mechanotransduction under biomimetic mechanophysical environments. This may further lead to advanced functional tissue engineering and regenerative medicine protocols.

  20. Long-term prognosis of AL and AA renal amyloidosis: a Japanese single-center experience.

    Science.gov (United States)

    Ozawa, Masatoyo; Komatsuda, Atsushi; Ohtani, Hiroshi; Nara, Mizuho; Sato, Ryuta; Togashi, Masaru; Takahashi, Naoto; Wakui, Hideki

    2017-04-01

    Few studies have been conducted on the long-term prognosis of patients with amyloid light chain (AL) and amyloid A (AA) renal amyloidosis in the same cohort. We retrospectively examined 68 patients with biopsy-proven renal amyloidosis (38 AL and 30 AA). Clinicopathological findings at the diagnosis and follow-up data were evaluated in each patient. We analyzed the relationship between clinicopathological parameters and survival data. Significant differences were observed in several clinicopathological features, such as proteinuria levels, between the AL and AA groups. Among all patients, 84.2 % of the AL group and 93.3 % of the AA group received treatments for the underlying diseases of amyloidosis. During the follow-up period (median 18 months in AL and 61 months in AA), 36.8 % of the AL group and 36.7 % of the AA group developed end-stage renal failure requiring dialysis, while 71.1 % of the AL group and 56.7 % of the AA group died. Patient and renal survivals were significantly longer in the AA group than in the AL group. eGFR of >60 mL/min/1.73 m 2 at biopsy and an early histological stage of glomerular amyloid deposition were identified as low-risk factors. A multivariate analysis showed that cardiac amyloidosis and steroid therapy significantly influenced patient and renal survivals. Our results showed that heart involvement was the major predictor of poor outcomes in renal amyloidosis, and that the prognosis of AA renal amyloidosis was markedly better than that in previously reported cohorts. Therapeutic advances in inflammatory diseases are expected to improve the prognosis of AA amyloidosis.

  1. AAS, growth hormone, and insulin abuse: psychological and neuroendocrine effects

    Directory of Open Access Journals (Sweden)

    Michael R Graham

    2008-06-01

    Full Text Available Michael R Graham1, Peter Evans2, Bruce Davies1, Julien S Baker11Health and Exercise Science Research Unit, Faculty of Health Sport and Science, University of Glamorgan, Pontypridd, Wales, United Kingdom; 2Royal Gwent Hospital, Newport, Gwent, United KingdomAbstract: The nontherapeutic use of prescription medicines by individuals involved in sport is increasing. Anabolic-androgenic steroids (AAS are the most widely abused drug. Much of our knowledge of the psychological and physiological effects of human growth hormone (hGH and insulin has been learned from deficiency states. As a consequence of the Internet revolution, previously unobtainable and expensive designer drugs, particularly recombinant human growth hormone (rhGH and insulin, have become freely available at ridiculously discounted prices from countries such as China and are being abused. These drugs have various physiological and psychological effects and medical personnel must become aware that such prescription medicine abuse appears to be used not only for performance and cosmetic reasons, but as a consequence of psychological pre-morbidity.Keywords: AAS, cosmesis, growth hormone, insulin, performance, strength

  2. AAS Publishing News: Preparing Your Manuscript Just Got Easier

    Science.gov (United States)

    Kohler, Susanna

    2016-03-01

    Watermarking using the command watermark{DRAFT, v2}.Are you an astronomer considering submitting a paper to an AAS journal (i.e., AJ, ApJ, ApJ Letters, or ApJ Supplements)? If so, this post is for you! Read on to find out about the exciting new things you can do with the AASs newest LaTeX class file, available for download now.Why the Update?AAS publishing has maintained a consistent class file for LaTeX manuscript preparation for the past decade. But academic publishing is changing rapidly in todays era of electronic journals! Since its journals went fully electronic, the AAS has been continuously adding new publishing capabilities based on the recommendations of the Journals Task Force and the needs and requests of AAS authors. The AASs manuscript preparation tools are now being updated accordingly.Whats New in AASTex 6.0?There are many exciting new features and capabilities in AASTex 6.0. Here are just a few:Tracking options for author revisions include added{text}, deleted{text}, replaced{old}{new}, and explain{text}.Based on emulateapjDo you use the popular class file emulateapj to prepare your manuscripts? AASTex 6.0 is based on emulateapj, rather than on the older AASTex 5.2 (though 5.2 is still supported). This means that it is easy to produce a double-columned, single-spaced, and astro-ph-ready manuscript. Since two thirds of the AAS journals authors use emulateapj, this transition was designed to make manuscript preparation and sharing an easier and more seamless process.Tools for collaborationsDo you work in a large collaboration? AASTex now includes new tools to make preparing a manuscript within a collaboration easier. Drafts can now be watermarked to differentiate between versions. New markup for large author lists streamlines the display so that readers can access article information immediately, yet they can still access the full author list and affiliations at the end of the paper. And author revision markup allows members of a collaboration to

  3. Modeling substrate-bacteria-grazer interactions coupled to substrate transport in groundwater

    Science.gov (United States)

    Bajracharya, Bijendra M.; Lu, Chuanhe; Cirpka, Olaf A.

    2014-05-01

    Models of microbial dynamics coupled to solute transport in aquifers typically require the introduction of a bacterial capacity term to prevent excessive microbial growth close to substrate-injection boundaries. The factors controlling this carrying capacity, however, are not fully understood. In this study, we propose that grazers or bacteriophages may control the density of bacterial biomass in continuously fed porous media. We conceptualize the flow-through porous medium as a series of retentostats, in which the dissolved substrate is advected with water flow whereas the biomasses of bacteria and grazers are considered essentially immobile. We first model a single retentostat with Monod kinetics of bacterial growth and a second-order grazing law, which shows that the system oscillates but approaches a stable steady state with nonzero concentrations of substrate, bacteria, and grazers. The steady state concentration of the bacteria biomass is independent of the substrate concentration in the inflow. When coupling several retentostats in a series to mimic a groundwater column, the steady state bacteria concentrations thus remain at a constant level over a significant travel distance. The one-dimensional reactive transport model also accounts for substrate dispersion and a random walk of grazers influenced by the bacteria concentration. These dispersive-diffusive terms affect the oscillations until steady state is reached, but hardly the steady state value itself. We conclude that grazing, or infection by bacteriophages, is a possible explanation of the maximum biomass concentration frequently needed in bioreactive transport models. Its value depends on parameters related to the grazers or bacteriophages and is independent of bacterial growth parameters or substrate concentration, provided that there is enough substrate to sustain bacteria and grazers.

  4. Substrate Integrated Waveguide (SIW Coupler on Green Material Substrate for Internet of Things (IoT Applications

    Directory of Open Access Journals (Sweden)

    Khalid Nurehansafwanah

    2017-01-01

    Full Text Available This paper shows designed coupler on paper-substrate with Substrate Integrated Waveguide (SIW techniques. Types of paper-substrate that used are photographic paper. The rectangular coupler is presented with Substrate Integrated Waveguide (SIW which metallic via on paper-substrate. The structures of the coupler are designed and analysed using Computer Simulation Tools (CST Studio Suite 2014 Software. This designed coupler operating within frequency of 3.8-5 GHz. The paper-based substrates are permits the implementation of green materials (Eco-friendly technology. The design of the coupler and its simulated results are reported in this paper.

  5. Analysis of the flow property of aluminum alloy AA6016 based on the fracture morphology using the hydroforming technology

    OpenAIRE

    Lihui Lang; Quanda Zhang; Zhiying Sun; Yao Wang

    2017-01-01

    In this paper, the hydraulic bulging experiments were respectively carried out using AA6016-T4 aluminum alloy and AA6016-O aluminum alloy, and the deformation properties and fracture mechanism of aluminum alloy under the conditions of thermal and hydraulic were analyzed. Firstly, the aluminum alloy AA6016 was dealt with two kinds of heat treatment systems such as solid solution heat treatment adding natural ageing and full annealing, then the aluminum alloy such as AA6016-T4 and AA6016-O were...

  6. Stress Ratio Effects on Crack Opening Loads and Crack Growth Rates in Aluminum Alloy 2024

    Science.gov (United States)

    Riddell, William T.; Piascik, Robert S.

    1998-01-01

    The effects of stress ratio (R) and crack opening behavior on fatigue crack growth rates (da/dN) for aluminum alloy (AA) 2024-T3 were investigated using constant-delta K testing, closure measurements, and fractography. Fatigue crack growth rates were obtained for a range of delta K and stress ratios. Results show that constant delta K fatigue crack growth for R ranging from near 0 to 1 is divided into three regions. In Region 1, at low R, da/dN increases with increasing R. In Region 2, at intermediate R, fatigue crack growth rates are relatively independent of R. In Region 3, at high R, further increases in da/dN are observed with increasing R.

  7. A FEM based methodology to simulate multiple crack propagation in friction stir welds

    DEFF Research Database (Denmark)

    Lepore, Marcello; Carlone, Pierpaolo; Berto, Filippo

    2017-01-01

    In this work a numerical procedure, based on a finite element approach, is proposed to simulate multiple three-dimensional crack propagation in a welded structure. Cracks are introduced in a friction stir welded AA2024-T3 butt joint, affected by a process-induced residual stress scenario....... The residual stress field was inferred by a thermo-mechanical FEM simulation of the process, considering temperature dependent elastic-plastic material properties, material softening and isotropic hardening. Afterwards, cracks introduced in the selected location of FEM computational domain allow stress...... insertion, as well as with respect to crack sizes measured in three different points for each propagation step. This FEM-based approach simulates the fatigue crack propagation by considering accurately the residual stress field generated by plastic deformations imposed on a structural component and has...

  8. Controlled Release from Core-Shell Nanoporous Silica Particles for Corrosion Inhibition of Aluminum Alloys

    Directory of Open Access Journals (Sweden)

    Xingmao Jiang

    2011-01-01

    Full Text Available Cerium (Ce corrosion inhibitors were encapsulated into hexagonally ordered nanoporous silica particles via single-step aerosol-assisted self-assembly. The core/shell structured particles are effective for corrosion inhibition of aluminum alloy AA2024-T3. Numerical simulation proved that the core-shell nanostructure delays the release process. The effective diffusion coefficient elucidated from release data for monodisperse particles in water was 1.0×10−14 m2s for Ce3+ compared to 2.5×10−13 m2s for NaCl. The pore size, pore surface chemistry, and the inhibitor solubility are crucial factors for the application. Microporous hydrophobic particles encapsulating a less soluble corrosion inhibitor are desirable for long-term corrosion inhibition.

  9. Does the Dirac cone of germanene exist on metal substrates?

    Science.gov (United States)

    Wang, Yangyang; Li, Jingzhen; Xiong, Junhua; Pan, Yuanyuan; Ye, Meng; Guo, Ying; Zhang, Han; Quhe, Ruge; Lu, Jing

    2016-07-28

    Germanene, a germanium analogue of graphene and silicene, has been synthesized on metal substrates. It is predicted that the intrinsic germanene has a Dirac cone in its band structure, just like graphene and silicene. Using first-principles calculations, we investigate the geometrical structures and electronic properties of germanene on the Ag, Au, Cu, Al, Pt and Ir substrates. The Dirac cone of germanene is destroyed on the Al, Pt and Ir substrates but preserved on the Ag and Au substrates with a slight band hybridization. The upper part of the Dirac cone is destroyed for germanene on the Cu substrate while the lower part remains preserved. By contrast, the Dirac cone is always destroyed for silicene on these metal substrates because of a strong band hybridization. Our study suggests that it is possible to extract the intrinsic properties of germanene on the Ag and Au substrates although it appears impossible for silicene on these two substrates.

  10. Effect of substrate roughness on the contact damage of thin brittle films on brittle substrates

    Energy Technology Data Exchange (ETDEWEB)

    Weidner, Mirko [School of Materials Science and Engineering, University of New South Wales NSW 2052, Sydney (Australia); Institute for Materials Science, Technische Universitaet Darmstadt, Petersenstrasse 23, 64287 Darmstadt (Germany); Borrero-Lopez, Oscar [School of Materials Science and Engineering, University of New South Wales NSW 2052, Sydney (Australia); Departamento de Ingenieria Mecanica, Energetica y de los Materiales, Universidad de Extremadura, 06071, Badajoz (Spain); Hoffman, Mark, E-mail: mark.hoffman@unsw.edu.a [School of Materials Science and Engineering, University of New South Wales NSW 2052, Sydney (Australia); Bendavid, Avi; Martin, Phil J. [CSIRO Materials Science and Engineering, P.O. Box 218, Lindfield NSW 2070 (Australia)

    2010-07-01

    The effect of substrate and surface roughness on the contact fracture of diamond-like carbon coatings on brittle soda-lime glass substrates has been investigated. The average surface roughness (R{sub a}) of the examined samples ranged from 15 nm to 571 nm. Contact damage was simulated by means of spherical nanoindentation, and fracture was subsequently assessed by focused ion beam microscopy. It was found that, in the absence of sub-surface damage in the substrate, fracture occurs in the coating in the form of radial, and ring/cone cracks during loading, and lateral cracks during unloading. Increasing the surface roughness results in a decrease in the critical load for crack initiation during loading, and in the suppression of fracture modes during unloading from high loads. When sub-surface damage (lateral cracks) is present in the substrate, severe spalling takes place during loading, causing a large discontinuity in the load-displacement curve. The results have implications concerning the design of damage-tolerant coated systems consisting of a brittle film on a brittle substrate.

  11. AA mismatched DNAs with a single base difference exhibit a large structural change and a propensity for the parallel-stranded conformation

    Directory of Open Access Journals (Sweden)

    Chulhyun Lee

    2010-03-01

    Full Text Available AA mismatches in DNA with different nearest-neighbor sequences were studied to understand the structural changes that accompany base-pair mismatches and the associated thermodynamics. Two synthesized duplexes, , 5' -d(CGACAATTGACG (called AA1 and 5' -d(CGAGAATTCACG (called AA2 as a palindrome sequences, had different nearest-neighbor sequences to the AA mismatches. This study focused on elucidating the structural and thermodynamic differences between these two molecules. A hydrogen bond between the mismatched adenines in AA1 was found, while no hydrogen bond in AA2. Both of the mismatched adenines in AA1 were stacked in the helix, while the mismatched adenine in AA2 surrounded by guanines was partially out of the helix and the other mismatched adenine surrounded by cytosines was stacked in the helix. Thermodynamically, AA1 was more stable than AA2. The melting temperature of the internal bases of AA1 was about 7 degree higher than that of AA2. The standard Gibbs free energy change for the duplex formation of AA1 was 1.30 Kcal/mol smaller than that of AA2. These thermal properties could be ascribed to the formation of the hydrogen bond. The conformational changes of these molecules at low pH were also investigated and compared. AA1 unambiguously assumed a parallel-stranded duplex at pH 4, while AA2 existed as a mixture of anti-parallel and parallel duplexes below pH 5.

  12. Effect of pin tool design on the material flow of dissimilar AA7075-AA6061 friction stir welds

    Science.gov (United States)

    Hasan, Mohammed M.; Ishak, M.; Rejab, M. R. M.

    2017-10-01

    Tool design is the most influential aspect in the friction stir welding (FSW) technology. Influence of pin tool geometry on material flow pattern are studied in this work during the FSW of dissimilar AA7075 and AA6061 aluminium alloys. Three truncated pin tool profiles (threaded, threaded with single flat, and unthreaded with single flat) were used to prepare the weldments. The workpieces were joined using a custom-made clamping system under 1100 rpm of spindle speed, 300 mm/min of traverse rate and 3° of tilt angle. The metallographic analysis showed that defect-free welds can be produced using the three pin tools with significant changes in the mixing stir zone structure. The results declared that the introducing of the flat on the cone of the probe deviates the pattern of the onion rings without changing the chemical composition of the created layers. This in turn improves the hardness distribution and tensile strength of the welded joint. It was also noted that both heat affected zone (HAZ) and thermal-mechanical affected zone (TMAZ) are similar in composition to their corresponding base materials (BM).

  13. Modelling of Amperometric Biosensors in the Case of Substrate Inhibition

    OpenAIRE

    Romas Baronas; Juozas Kulys

    2006-01-01

    The response of an amperometric biosensor at mixed enzyme kinetics and diffusion limitations was modelled digitally in the case of substrate inhibition. Digital simulations were carried out using a finite difference technique. Calculations showed complex kinetics of biosensor response. At low enzyme activity and substrate concentration (S0 ), the response of the sensor looks like it is limited by a simple substrate diffusion. At substrate concentration comparable to the Michaelis-Menten const...

  14. Bacillus thuringiensis Cry3Aa fused to a cellulase-binding peptide shows increased toxicity against the longhorned beetle.

    Science.gov (United States)

    Guo, Chang-Hua; Zhao, Shu-Tang; Ma, Yuan; Hu, Jian-Jun; Han, Xiao-Jiao; Chen, Jun; Lu, Meng-Zhu

    2012-02-01

    Cry3 class toxins are used extensively for biological control of coleopteran larvae. We previously identified a peptide (PCx) from a phage display library that specifically binds Cx-cellulase from the midgut of Anoplophora glabripennis Motschulsky (Asian longhorn beetle) larvae. Here, we added a DNA fragment that encodes the peptide onto either end of the cry3Aa gene and tested the expressed PCx-Cry3Aa and Cry3Aa-PCx proteins for insecticidal activity in the longhorned beetle. An insect bioassay revealed that, compared with native Cry3Aa, the two modified Cry3Aa proteins had significantly higher lethality, with PCx-Cry3Aa exhibiting a mortality rate almost three times that of Cry3Aa. We also proposed that the increased lethality in larvae fed with PCx-Cry3Aa or Cry3Aa-PCx would be attributable to the binding of the toxin with Cx-cellulase, thereby increasing toxin retention in the midgut. The significantly enhanced insecticidal activity of Cry3Aa fused with the Cx-cellulase binding peptide provides a new strategy for increasing toxin efficacy against the longhorned beetle. These uniquely modified Cry3Aa proteins have potential use for pest control.

  15. A comparison of Aggregatibacter actinomycetemcomitans (Aa virulence traits in a rat model for periodontal disease.

    Directory of Open Access Journals (Sweden)

    Helen Schreiner

    Full Text Available Our aim was to explore the effects of Cytolethal Distending toxin (Cdt in a well established rat model of periodontal disease where leukotoxin (LtxA was thought to have no known effect. In vitro studies, were used to assess CdtB activity using Aa Leukotoxin as a negative control. These studies showed that both CdtB and LtxA (unexpectedly exerted significant effects on CD4(+ T cells. As a result we decided to compare the effects of these two prominent Aa virulence factors on bone loss using our rat model of Aa-induced periodontitis. In this model, Aa strains, mutant in cdtB and ltxA, were compared to their parent non-mutant strains and evaluated for colonization, antibody response to Aa, bone loss and disease. We found that bone loss/disease caused by the ltxA mutant strain, in which cdtB was expressed, was significantly less (p<0.05 than that due to the wild type strain. On the other hand, the disease caused by cdtB mutant strain, in which ltxA was expressed, was not significantly different from the wild type strain. This data indicates that Aa LtxA exerts a greater effect on bone loss than Cdt in this rat model of periodontal disease and supports the utility of this model to dissect specific virulence factors as they relate to immunopathology in studies of Aa-induced disease.

  16. Purification and Immunoprotection Evaluation of AaHIV from Complex Venom Metalloproteinases of Deinagkistrodon acutus.

    Science.gov (United States)

    Zhang, Lei; Chen, Cong; Cao, Yuliang; Xie, Baifa; Chen, Xiangyu; Zeng, Fanjie; Liu, Minghua

    2016-09-01

    The aim of this study was to investigate the immunoprotective effects of AaHIV in mice. After purification, a 12% sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) was performed. Bicinchoninic acid was used to determine the molecular weight and concentration of AaHIV. AaHIV, venom complex (VC), and phosphate buffered saline (PBS) were subsequently used to immunize the mice three times, and the blood was sampled 1 week after the third immunization to determine the serum immunoglobulin G (IgG) antibody titer. A skin-bleeding inhibition assay and toxin-eliminating assay were performed on the immunized mice. The purity and concentration of AaHIV were 86.6% and 1.20 mg/mL, respectively. The AaHIV group exhibited higher antibody titers than the VC group. The survival rate of the AaHIV group (7/10) was significantly higher than that of the PBS group (0/10) (P = 0.0031). The high titer of antibodies induced by AaHIV partially neutralized the bleeding activity of the Deinagkistrodon acutus venom complex. © 2016 Wiley Periodicals, Inc.

  17. Silicon—a new substrate for GaN growth

    Indian Academy of Sciences (India)

    Generally, GaN-based devices are grown on silicon carbide or sapphire substrates. But these substrates are costly and insulating in nature and also are not available in large diameter. Silicon can meet the requirements for a low cost and conducting substrate and will enable integration of optoelectronic or high power ...

  18. Effect of Substrate on Biogas Yield | Adamu | Global Journal of ...

    African Journals Online (AJOL)

    Biogas technology converts biological matter or biological waste (substrate) into energy and simultaneously helps to improve the quality of life and the environment. The effect of substrate on biogas yield was studied by using different substrate in laboratory scale experiment using water displacement method to monitor the ...

  19. Analysis of Rectangular Microstrip Antennas with Air Substrates ...

    African Journals Online (AJOL)

    This paper presents an analysis of rectangular microstrip antennas with air substrates. The effect of the substrate thickness on the bandwidth and the efficiency are examined. An additional thin layer supporting the dielectric material is added to the air substrate in order to make the antenna mechanically rigid and easy to ...

  20. Graphene-on-semiconductor substrates for analog electronics

    Science.gov (United States)

    Lagally, Max G.; Cavallo, Francesca; Rojas-Delgado, Richard

    2016-04-26

    Electrically conductive material structures, analog electronic devices incorporating the structures and methods for making the structures are provided. The structures include a layer of graphene on a semiconductor substrate. The graphene layer and the substrate are separated by an interfacial region that promotes transfer of charge carriers from the surface of the substrate to the graphene.

  1. Evaluation of Tea Wastes as an Alternative Substrate for Oyster ...

    African Journals Online (AJOL)

    Nafiisah

    Oyster mushroom (Pleurotus sajor caju) is locally cultivated on sugarcane bagasse substrate. Due to decreasing supply of bagasse, there was an urgent need to identify alternative substrates. The aim of this study was to evaluate tea wastes as an alternative substrate for oyster mushroom cultivation. The first step was to ...

  2. Stress of electroless copper deposits on insulating and metal substrates

    Energy Technology Data Exchange (ETDEWEB)

    Brüning, Ralf, E-mail: rbruening@mta.ca [Physics Department, Mount Allison University, Sackville, New Brunswick E4L 1E6 (Canada); Sibley, Allison; Sharma, Tanu; Brown, Delilah A.; Demay, Thibault [Physics Department, Mount Allison University, Sackville, New Brunswick E4L 1E6 (Canada); Brüning, Frank; Bernhard, Tobias [Atotech Deutschland GmbH, Erasmusstrasse 20, 10553 Berlin (Germany)

    2014-08-28

    In the fabrication of printed circuit boards, electroless copper is plated on insulating substrates. However, data for film stress by substrate bending are frequently obtained with metal substrates. We compare the stress evolution on an insulating substrate (acrylonitrile butadiene styrene) with results from commercial Ni–Fe and Cu–Fe alloy test strips, as well as X-ray diffraction based strain data. Tests were done with two plating bath formulations, one with and one without added nickel. Substrate type and condition determine the stress near the beginning of plating. Stress of the Ni-free films depends more strongly on the substrate material. Further, when the samples are cooled from the bath operating temperature to room temperature, the thermal contraction of the insulating substrate compresses the plated thin copper film. The measured stress change agrees with the change predicted by calculation. Data correction methods are discussed, and other substrate materials can be tested readily with the method employed here. - Highlights: • We report stress of electroless Cu deposits on insulating and metal substrates. • The final deposit stress is substrate-independent. • The final deposit stress and the X-ray diffraction based strain agree. • The stress change due to the thermal contraction of the substrate is observed. • Plating bath type, substrate and surface preparation alter the stress.

  3. Protective amorphous carbon coatings on glass substrates

    Directory of Open Access Journals (Sweden)

    Kaspars Silins

    2017-11-01

    Full Text Available Thick amorphous carbon films were deposited by the Magnets-in-Motion (M-M rf linear hollow cathode at varying acetylene contents in Ar in a hybrid PVD/PE-CVD process directly on glass substrates. The hollow cathode plates manufactured from graphite were used as the PVD target. The measurements show that the films can reach thickness of up to 50 μm at deposition rates of up to 2.5 μm/min. Scratch test measurements confirm that well adhering films several μm thick can be achieved at C2H2 contents of up to 0.5%.

  4. Palladium on plastic substrates for plasmonic devices.

    Science.gov (United States)

    Zuppella, Paola; Pasqualotto, Elisabetta; Zuccon, Sara; Gerlin, Francesca; Corso, Alain Jody; Scaramuzza, Matteo; De Toni, Alessandro; Paccagnella, Alessandro; Pelizzo, Maria Guglielmina

    2015-01-09

    Innovative chips based on palladium thin films deposited on plastic substrates have been tested in the Kretschmann surface plasmon resonance (SPR) configuration. The new chips combine the advantages of a plastic support that is interesting and commercially appealing and the physical properties of palladium, showing inverted surface plasmon resonance (ISPR). The detection of DNA chains has been selected as the target of the experiment, since it can be applied to several medical early diagnostic tools, such as different biomarkers of cancers or cystic fibrosis. The results are encouraging for the use of palladium in SPR-based sensors of interest for both the advancement of biodevices and the development of hydrogen sensors.

  5. Macro algae as substrate for biogas production

    DEFF Research Database (Denmark)

    Møller, Henrik; Sarker, Shiplu; Gautam, Dhan Prasad

    Algae as a substrate for biogas is superior to other crops since it has a much higher yield of biomass per unit area and since algae grows in the seawater there will be no competition with food production on agricultural lands. So far, the progress in treating different groups of algae as a source...... of energy is promising. In this study 5 different algae types were tested for biogas potential and two algae were subsequent used for co-digestion with manure. Green seaweed, Ulva lactuca and brown seaweed Laminaria digitata was co-digested with cattle manure at mesophilic and thermophilic condition...

  6. Simulating Substrate Recognition and Oxidation in Laccases

    DEFF Research Database (Denmark)

    Lucas, Maria Fátima; Monza, Emanuele; Jørgensen, Lise Juel

    2017-01-01

    To meet the very specific requirements demanded by industry, proteins must be appropriately tailored. Engineering laccases, to improve the oxidation of small molecules, with applications in multiple fields, is, however, a difficult task. Most efforts have concentrated on increasing the redox...... potential of the enzyme, but in recent work, we have pursued an alternate strategy to engineering these biocatalysts. In particular, we have found that redesigning substrate binding at the T1 pocket, guided by in silico methodologies, to be a more consistent option. In this work, we evaluate the robustness...

  7. EBG Size Reduction for Low Permittivity Substrates

    Directory of Open Access Journals (Sweden)

    Gonzalo Expósito-Domínguez

    2012-01-01

    Full Text Available Double layer and edge-location via techniques are combined for electromagnetic band gap (EBG size reduction. The study of the required number of elements and their dimensions is carried out in order to suppress the surface wave propagation modes and consequently to reduce the mutual coupling between radiating elements in low-permittivity substrates. By applying these techniques, the size of the EBG mushroom is reduced by 30%; however, the bandwidth operation maintains its value, and these structures can be integrated between radiating elements in broad bandwidth antennas.

  8. Thin film reactions on alloy semiconductor substrates

    Energy Technology Data Exchange (ETDEWEB)

    Olson, D.A.

    1990-11-01

    The interactions between Pt and In{sub .53}Ga{sub .47}As have been studied. In{sub .53}Ga{sub .47}As substrates with 70nm Pt films were encapsulated in SiO{sub 2}, and annealed up to 600{degree}C in flowing forming gas. The composition and morphology of the reaction product phases were studied using x-ray diffraction, Auger depth profiling, and transmission electron microscopy. The reaction kinetics were examined with Rutherford Backscattering. Results show that Pt/In{sub .53}Ga{sub .47}As reacts to form many of the reaction products encountered in the Pt/GaAs and Pt/InP reactions: PtGa, Pt{sub 3}Ga, and PtAs{sub 2}. In addition, a ternary phase, Pt(In:Ga){sub 2}, develops, which is a solid solution between PtIn{sub 2} and PtGa{sub 2}. The amount of Ga in the ternary phase increases with annealing temperature, which causes a decrease in the lattice parameter of the phase. The reaction products show a tendency to form layered structures, especially for higher temperatures and longer annealing times. Unlike the binary case, the PtAs{sub 2}, phase is randomly oriented on the substrate, and is intermingle with a significant amount of Pt(In:Ga){sub 2}. Following Pt/In{sub .53}Ga{sub .47}As reactions, two orientation relationships between the Pt(In:Ga){sub 2} product phase and the substrate were observed, despite the large mismatch with the substrate ({approximately}8%). For many metal/compound semiconductor interactions, the reaction rate is diffusion limited, i.e. exhibits a parabolic dependence on time. An additional result of this study was the development of an In-rich layer beneath the reacted layer. The Auger depth profile showed a substantial increase in the sample at this layer. This is a significant result for the production of ohmic contacts, as the Schottky barrier height in this system lower for higher In concentrations. 216 refs.

  9. Bioelectricity production by mediatorless microbial fuel cell under acidophilic condition using wastewater as substrate: Influence of substrate loading rate

    National Research Council Canada - National Science Library

    S. Venkata Mohan; S. Veer Raghavulu; S. Srikanth; P. N. Sarma

    2007-01-01

    ...). Experimental data showed the feasibility of power generation from wastewater treatment. However, the overall voltage generation, power yield and substrate degradation was found to depend on the substrate/organic loading rate (OLR...

  10. Method of forming through substrate vias (TSVs) and singulating and releasing die having the TSVs from a mechanical support substrate

    Science.gov (United States)

    Okandan, Murat; Nielson, Gregory N

    2014-12-09

    Accessing a workpiece object in semiconductor processing is disclosed. The workpiece object includes a mechanical support substrate, a release layer over the mechanical support substrate, and an integrated circuit substrate coupled over the release layer. The integrated circuit substrate includes a device layer having semiconductor devices. The method also includes etching through-substrate via (TSV) openings through the integrated circuit substrate that have buried ends at or within the release layer including using the release layer as an etch stop. TSVs are formed by introducing one or more conductive materials into the TSV openings. A die singulation trench is etched at least substantially through the integrated circuit substrate around a perimeter of an integrated circuit die. The integrated circuit die is at least substantially released from the mechanical support substrate.

  11. Changes in depression mediate the effects of AA attendance on alcohol use outcomes.

    Science.gov (United States)

    Wilcox, Claire E; Tonigan, J Scott

    2018-01-01

    Depression may contribute to increased drinking in individuals with alcohol use disorder. Although Alcoholics Anonymous (AA) attendance predicts drinking reductions, there is conflicting information regarding the intermediary role played by reductions in depression. We explored whether AA attendance reduces depressive symptoms, the degree to which improvement in depression results in reductions in drinking, and in which subgroups these effects occur. 253 early AA affiliates (63% male) were recruited and assessed at baseline 3, 6, 9, 12, 18, and 24 months. Depression was measured using the Beck Depression Inventory (BDI) and was administered at baseline 3, 6, 12, 18, and 24 months. AA attendance and alcohol use outcomes were obtained with the Form 90. Mediation analyses were performed at early (3, 6, and 9 months) and late (12, 18, and 24 months) follow-up to investigate the degree to which reductions in depression mediated the effect of AA attendance on drinking, controlling for concurrent drinking. In addition, a series of moderated mediation analyses were performed using baseline depression severity as a moderator. At early follow-up, reductions in depression (6 months) mediated the effects of AA attendance (3 months) on later drinking (drinks per drinking day) (9 months) (b = -0.02, boot CI [-0.055, -0.0004]), controlling for drinking at 6 months. Baseline depression severity did not moderate the degree to which BDI mediated the effects of AA attendance on alcohol use (ps > .05). These findings provide further evidence that depression reduction is a mechanism by which AA attendance leads to reductions in alcohol use. Improving depression may help reduce alcohol use in individuals with AUD, and AA attendance may be an effective way to achieve that goal.

  12. Safety of Percutaneous Ultrasound-Guided Kidney Biopsy in Patients with AA Amyloidosis.

    Science.gov (United States)

    Altindal, Mahmut; Yildirim, Tolga; Turkmen, Ercan; Unal, Mucahit; Boga, Ilker; Yilmaz, Rahmi; Arici, Mustafa; Altun, Bulent; Erdem, Yunus

    2015-01-01

    Bleeding is the most frequent complication of kidney biopsy. Although bleeding risk in patients with AA amyloidosis after kidney biopsy has not been studied in a large population, AA amyloidosis has long been perceived as a risk factor for bleeding. The aim of the present study was to evaluate post-biopsy bleeding risk in patients with AA amyloidosis. We retrospectively analyzed bleeding complications in 88 patients with AA amyloidosis and 202 controls after percutaneous kidney biopsy. All the kidney biopsies were performed under the guidance of real-time ultrasound with the use of an automated core biopsy system after a standard pre-biopsy screening protocol. Bleeding events were classified as major when transfusion of blood products or surgical or radiological intervention was required, or if the bleeding caused hypovolemic shock or death. Bleeding events that did not meet these criteria were accepted as minor. The incidence of post-biopsy bleeding was comparable between AA amyloidosis and control groups (5.7 vs. 5.0%, p = 0.796). Major bleeding events were observed in 3 patients from each group (p = 0.372). Selective renal angiography and embolization were applied to 2 patients from the AA amyloidosis group. One of these patients underwent colectomy and died because of infectious complications. Bleeding events were minor in 2.3% of the patients with AA amyloidosis and 3.5% of the controls (p = 0.728). AA amyloidosis was not associated with increased post-biopsy bleeding risk. Kidney biopsy is safe in AA amyloidosis when standard pre-biopsy screening is applied. Further data are needed to confirm these findings. © 2015 S. Karger AG, Basel.

  13. Substrate Channel Flexibility in Pseudomonas aeruginosa MurB Accommodates Two Distinct Substrates.

    Directory of Open Access Journals (Sweden)

    Ming Wei Chen

    Full Text Available Biosynthesis of UDP-N-acetylmuramic acid in bacteria is a committed step towards peptidoglycan production. In an NADPH- and FAD-dependent reaction, the UDP-N-acetylglucosamine-enolpyruvate reductase (MurB reduces UDP-N-acetylglucosamine-enolpyruvate to UDP-N-acetylmuramic acid. We determined the three-dimensional structures of the ternary complex of Pseudomonas aeruginosa MurB with FAD and NADP(+ in two crystal forms to resolutions of 2.2 and 2.1 Å, respectively, to investigate the structural basis of the first half-reaction, hydride transfer from NADPH to FAD. The nicotinamide ring of NADP(+ stacks against the si face of the isoalloxazine ring of FAD, suggesting an unusual mode of hydride transfer to flavin. Comparison with the structure of the Escherichia coli MurB complex with UDP-N-acetylglucosamine-enolpyruvate shows that both substrates share the binding site located between two lobes of the substrate-binding domain III, consistent with a ping pong mechanism with sequential substrate binding. The nicotinamide and the enolpyruvyl moieties are strikingly well-aligned upon superimposition, both positioned for hydride transfer to and from FAD. However, flexibility of the substrate channel allows the non-reactive parts of the two substrates to bind in different conformations. A potassium ion in the active site may assist in substrate orientation and binding. These structural models should help in structure-aided drug design against MurB, which is essential for cell wall biogenesis and hence bacterial survival.

  14. Controlled release of bioactive PDGF-AA from a hydrogel/nanoparticle composite.

    Science.gov (United States)

    Elliott Donaghue, Irja; Shoichet, Molly S

    2015-10-01

    Polymer excipients, such as low molar mass poly(ethylene glycol) (PEG), have shown contradictory effects on protein stability when co-encapsulated in polymeric nanoparticles. To gain further insight into these effects, platelet-derived growth factor (PDGF-AA) was encapsulated in polymeric nanoparticles with vs. without PEG. PDGF-AA is a particularly compelling protein, as it has been demonstrated to promote cell survival and induce the oligodendrocyte differentiation of neural stem/progenitor cells (NSPCs) both in vitro and in vivo. Here we show, for the first time, the controlled release of bioactive PDGF-AA from an injectable nanoparticle/hydrogel drug delivery system (DDS). PDGF-AA was encapsulated, with high efficiency, in poly(lactide-co-glycolide) nanoparticles, and its release from the drug delivery system was followed over 21 d. Interestingly, the co-encapsulation of low molecular weight poly(ethylene glycol) increased the PDGF-AA loading but, unexpectedly, accelerated the aggregation of PDGF-AA, resulting in reduced activity and detection by enzyme-linked immunosorbent assay (ELISA). In the absence of PEG, released PDGF-AA remained bioactive as demonstrated with NSPC oligodendrocyte differentiation, similar to positive controls, and significantly different from untreated controls. This work presents a novel delivery method for differentiation factors, such as PDGF-AA, and provides insights into the contradictory effects reported in the literature of excipients, such as PEG, on the loading and release of proteins from polymeric nanoparticles. Previously, the polymer poly(ethylene glycol) (PEG) has been used in many biomaterials applications, from surface coatings to the encapsulation of proteins. In this work, we demonstrate that, unexpectedly, low molecular weight PEG has a deleterious effect on the release of the encapsulated protein platelet-derived growth factor AA (PDGF-AA). We also demonstrate release of bioactive PDGF-AA (in the absence of PEG

  15. Renal AA amyloidosis in a patient with hereditary complete complement C4 deficiency

    Directory of Open Access Journals (Sweden)

    Imed Helal

    2011-01-01

    Full Text Available Hereditary complete C4 deficiency has until now been reported in 30 cases only. A disturbed clearance of immune- complexes probably predisposes these individuals to systemic lupus erythematosus, other immune- complex diseases and recurrent microbial infections. We present here a 20- year- old female with hereditary complete C4 deficiency. Renal biopsy demonstrated renal AA amyloidosis. This unique case further substantiates that deficiency of classical pathway components predisposes to the development of recurrent microbial infections and that the patients may develop AA amyloidosis. Furthermore, in clinical practice, the nephrotic syndrome occurring in a patient with hereditary complete complement C4 deficiency should lead to the suspicion of renal AA amyloidosis.

  16. Association between AA-NAT gene polymorphism and reproductive performance in sheep

    OpenAIRE

    Ding-ping,Bai; Cheng-jiang,Yu; Yu-lin,Chen

    2012-01-01

    Arylalkylamine N-acetyltransferase (AA-NAT) is critical enzyme in Melatonin (MLT) biosynthesis for MLT regulating the animal seasonal breeding. In this study, DNA sequencing methods were applied to detect the polymorphisms of the AA-NAT gene in 179 Chinese sheep belonging to two non-seasonal reproduction breeds and two seasonal reproduction breeds. One mutation at exon 3 (NM_001009461:c.486A > G) was firstly described at the sheep AA-NAT locus. Hence, we described the SmaI PCR-RFLP m...

  17. Neural substrates of sublexical processing for spelling.

    Science.gov (United States)

    DeMarco, Andrew T; Wilson, Stephen M; Rising, Kindle; Rapcsak, Steven Z; Beeson, Pélagie M

    2017-01-01

    We used fMRI to examine the neural substrates of sublexical phoneme-grapheme conversion during spelling in a group of healthy young adults. Participants performed a writing-to-dictation task involving irregular words (e.g., choir), plausible nonwords (e.g., kroid), and a control task of drawing familiar geometric shapes (e.g., squares). Written production of both irregular words and nonwords engaged a left-hemisphere perisylvian network associated with reading/spelling and phonological processing skills. Effects of lexicality, manifested by increased activation during nonword relative to irregular word spelling, were noted in anterior perisylvian regions (posterior inferior frontal gyrus/operculum/precentral gyrus/insula), and in left ventral occipito-temporal cortex. In addition to enhanced neural responses within domain-specific components of the language network, the increased cognitive demands associated with spelling nonwords engaged domain-general frontoparietal cortical networks involved in selective attention and executive control. These results elucidate the neural substrates of sublexical processing during written language production and complement lesion-deficit correlation studies of phonological agraphia. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Review of cellular mechanotransduction on micropost substrates.

    Science.gov (United States)

    Geng, Yuxu; Wang, Zhanjiang

    2016-03-01

    As physical entities, living cells can sense and respond to various stimulations within and outside the body through cellular mechanotransduction. Any deviation in cellular mechanotransduction will not only undermine the orchestrated regulation of mechanical responses, but also lead to the breakdown of their physiological function. Therefore, a quantitative study of cellular mechanotransduction needs to be conducted both in experiments and in computational simulations to investigate the underlying mechanisms of cellular mechanotransduction. In this review, we present an overview of the current knowledge and significant progress in cellular mechanotransduction via micropost substrates. In the aspect of experimental studies, we summarize significant experimental progress and place an emphasis on the coupled relationship among cellular spreading, focal adhesion and contractility as well as the influence of substrate properties on force-involved cellular behaviors. In the other aspect of computational investigations, we outline a coupled framework including the biochemically motivated stress fiber model and thermodynamically motivated adhesion model and present their predicted biomechanical responses and then compare predicted simulation results with experimental observations to further explore the mechanisms of cellular mechanotransduction. At last, we discuss the future perspectives both in experimental technologies and in computational models, as well as facing challenges in the area of cellular mechanotransduction.

  19. Substrate adaptation of Trichophyton rubrum secreted endoproteases.

    Science.gov (United States)

    Chen, Jian; Yi, Jinling; Liu, Li; Yin, Songchao; Chen, Rongzhang; Li, Meirong; Ye, Congxiu; Zhang, Yu-qing; Lai, Wei

    2010-02-01

    Trichophyton rubrum is the most common pathogen caused the dermatophytosis of nail and skin in human. The secreted proteases were considered to be the most important virulence factors. However, the substrates adaptation of T. rubrum secreted proteases is largely unknown. For the first time, we use the keratins from human nail and skin stratum corneum as the growth medium to investigate the different expression patterns of T. rubrum secreted endoproteases genes. During grow in both keratin-containing media SUB7 and MEP2 were the highest expressed gene in each family. These results indicated that SUB7 and MEP2 may be the dominant endoproteases secreted by T. rubrum during host infection and the other proteases may play a supplementary role. The direct comparison of T. rubrum grown on skin and nail medium showed different substrate favorite of secreted endoproteases. The genes MEP2, SUB5, SUB2 and SUB3 were more active during growth in skin medium, possibly these proteases have a higher affinity for skin original keratins. While the structures of SUB1, SUB4, and MEP4 maybe more suitable for the degradation of nail original keratins. This work presents useful molecular details for further understanding the pathogenesis of secreted proteases and the wide adaptation of T. rubrum.

  20. Alloyed surfaces: New substrates for graphene growth

    Science.gov (United States)

    Tresca, C.; Verbitskiy, N. I.; Fedorov, A.; Grüneis, A.; Profeta, G.

    2017-11-01

    We report a systematic ab-initio density functional theory investigation of Ni(111) surface alloyed with elements of group IV (Si, Ge and Sn), demonstrating the possibility to use it to grow high quality graphene. Ni(111) surface represents an ideal substrate for graphene, due to its catalytic properties and perfect matching with the graphene lattice constant. However, Dirac bands of graphene growth on Ni(111) are completely destroyed due to the strong hybridization between carbon pz and Ni d orbitals. Group IV atoms, namely Si, Ge and Sn, once deposited on Ni(111) surface, form an ordered alloyed surface with √{ 3} ×√{ 3} -R30° reconstruction. We demonstrate that, at variance with the pure Ni(111) surface, alloyed surfaces effectively decouple graphene from the substrate, resulting unstrained due to the nearly perfect lattice matching and preserves linear Dirac bands without the strong hybridization with Ni d states. The proposed surfaces can be prepared before graphene growth without resorting on post-growth processes which necessarily alter the electronic and structural properties of graphene.

  1. Agaricus blazei production on non-composted substrates based on sunflower seed hulls and spent oyster mushroom substrate.

    Science.gov (United States)

    González Matute, R; Figlas, D; Curvetto, N

    2011-06-01

    Agaricus blazei Murrill is usually cultivated using the same biphasic composting method employed for A. bisporus. Because cultivation of A. blazei on traditional A. bisporus composts poses some disadvantages, non-composted substrates were studied for A. blazei cultivation. Mycelial growth rate and productive performance of A. blazei were evaluated on substrates containing sunflower seed hulls, Pleurotus spp. spent mushroom substrate, or their combination, in the absence or in the presence of different supplements (vermicompost, peat or brewery residues). Substrates were prepared by initially soaking them and then they were sterilized (1 atm for 120 min). In addition, each substrate's degradation was measured after cultivation by obtaining the lignin, cellulose, hemicellulose, organic matter, total fiber, ash, carbon and nitrogen contents before spawn-run and at the end of two flushes of A. blazei. The cultivation of A. blazei on non-composted substrates is possible and with a low rate of contamination when using the spent mushroom substrate as the main component or combined 50:50 with sunflower seed hulls. In addition, the best yields were obtained on those substrates containing spent Pleurotus mushroom substrate with supplements and those mixtures with sunflower seed hulls and vermicompost. These yields were similar to those reported on composted substrates. Substrate changes in composition measured at the end of two flushes indicate that the lignin-hemicellulose fraction was preferentially used and that the substrates exhibiting the best yield showed greater biodegradation of lignin-hemicellulose fraction than the others did.

  2. Snap-Through Instability of Graphene on Substrates

    Directory of Open Access Journals (Sweden)

    Li Teng

    2009-01-01

    Full Text Available Abstract We determine the graphene morphology regulated by substrates with herringbone and checkerboard surface corrugations. As the graphene–substrate interfacial bonding energy and the substrate surface roughness vary, the graphene morphology snaps between two distinct states: (1 closely conforming to the substrate and (2 remaining nearly flat on the substrate. Since the graphene morphology is strongly tied to the electronic properties of graphene, such a snap-through instability of graphene morphology can lead to desirable graphene electronic properties that could potentially enable graphene-based functional electronic components (e.g. nano-switches.

  3. Effect of nanocrystalline surface of substrate on microstructure and ...

    Indian Academy of Sciences (India)

    In this research, effect of surface mechanical attrition treatment (SMAT) was studied on characteristics of the coatings formed using plasma electrolyte oxidation (PEO) on AA1230 aluminium. To do so, first, the samples were coated with and without SMAT pre-process. Coating by PEO method was carried out in two ...

  4. Ultrasonic inspection of AA6013 laser welded joints

    Directory of Open Access Journals (Sweden)

    Adriano Passini

    2011-09-01

    Full Text Available Interest in laser beam welding for aerospace applications is continuously growing, mainly for aluminum alloys. The joints quality is usually assessed by non-destructive inspection (NDI. In this work, bead on plate laser welds on 1.6 mm thick AA6013 alloy sheets, using a 2 kW Yb-fiber laser were obtained and inspected by pulse/echo ultrasonic phased-array technique. Good and poor quality welds were inspected in order to verify the limits of inspection, comparing also to X-ray radiography and metallographic inspections. The results showed that ultrasonic phased array technique was able to identify the presence of grouped porosity, through the attenuation of the amplitude of the echo signal. This attenuation is attributed to the scattering of the waves caused by micro pores, with individual size below the resolution limit of the equipment, but when grouped, can cause a perceptive effect on the reflection spectra.

  5. AA, radiation shielding curtain along the target area

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    At the far left is the beam tube for the high-intensity proton beam from the 26 GeV PS. The tube ends in a thin window and the proton beam continues in air through a hole in the shielding blocks (see also 8010308), behind which the target (see 7905091, 7905094)was located. After the target followed the magnetic horn, focusing the antiprotons, and the first part of the injection line with a proton dump. The antiprotons, deflected by a magnet, left the target area through another shielding wall, to make their way to the AA ring. Laterally, this sequence of components was shielded with movable, suspended, concrete blocks: the "curtain". Balasz Szeless, who had constructed it, is standing at its side.

  6. The roles of the AAS Journals' Data Editors

    Science.gov (United States)

    Muench, August; NASA/SAO ADS, CERN/Zenodo.org, Harvard/CfA Wolbach Library

    2018-01-01

    I will summarize the community services provided by the AAS Journals' Data Editors to support authors’ when citing and preserving the software and data used in the published literature. In addition I will describe the life of a piece of code as it passes through the current workflows for software citation in astronomy. Using this “lifecycle” I will detail the ongoing work funded by a grant from the Alfred P. Sloan Foundation to the American Astronomical Society to improve the citation of software in the literature. The funded development team and advisory boards, made up of non-profit publishers, literature indexers, and preservation archives, is implementing the Force11 Software citation principles for astronomy Journals. The outcome of this work will be new workflows for authors and developers that fit in their current practices while enabling versioned citation of software and granular credit for its creators.

  7. Precipitation in an AA6111 aluminium alloy and cosmetic corrosion

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Y. [Corrosion and Protection Centre, School of Materials, University of Manchester, Manchester M60 1QD (United Kingdom); Zhou, X. [Corrosion and Protection Centre, School of Materials, University of Manchester, Manchester M60 1QD (United Kingdom)]. E-mail: xiaorong.zhou@manchester.ac.uk; Thompson, G.E. [Corrosion and Protection Centre, School of Materials, University of Manchester, Manchester M60 1QD (United Kingdom); Hashimoto, T. [Corrosion and Protection Centre, School of Materials, University of Manchester, Manchester M60 1QD (United Kingdom); Scamans, G.M. [Innoval Technology, Beaumont Close, Banbury, Oxon OX16 1TQ (United Kingdom); Afseth, A. [Novelis Technology and Management, 8212 Neuhausen (Switzerland)

    2007-01-15

    The near-surface deformed layer on AA6111 automotive closure sheet alloy, generated by mechanical grinding during rectification, has an ultrafine grain microstructure, of 50-150 nm diameter, and a sharp transition with the underlying bulk alloy microstructure. Grinding and heat treatment to simulate rectification and paint baking processes result in the nucleation and growth of {approx}20 nm diameter precipitates at grain boundaries within the near-surface deformed layer. High-resolution transmission electron microscopy has shown Q phase precipitates in the deformed layer, giving dramatically increased corrosion susceptibility compared with the bulk microstructure, and this is responsible for the rapid-onset filiform corrosion. Transmission electron microscopy of the corrosion attack showed directly that the mode of corrosion was intergranular and that the Q phase precipitates were preserved after the passage of the corrosion front.

  8. AAS, growth hormone, and insulin abuse: psychological and neuroendocrine effects

    Science.gov (United States)

    Graham, Michael R; Evans, Peter; Davies, Bruce; Baker, Julien S

    2008-01-01

    The nontherapeutic use of prescription medicines by individuals involved in sport is increasing. Anabolic-androgenic steroids (AAS) are the most widely abused drug. Much of our knowledge of the psychological and physiological effects of human growth hormone (hGH) and insulin has been learned from deficiency states. As a consequence of the Internet revolution, previously unobtainable and expensive designer drugs, particularly recombinant human growth hormone (rhGH) and insulin, have become freely available at ridiculously discounted prices from countries such as China and are being abused. These drugs have various physiological and psychological effects and medical personnel must become aware that such prescription medicine abuse appears to be used not only for performance and cosmetic reasons, but as a consequence of psychological pre-morbidity. PMID:18827854

  9. An Update on the AAS Astronomy Ambassadors Program

    Science.gov (United States)

    Fienberg, Richard T.; Gurton, S.; Fraknoi, A.; Prather, E. E.; Hurst, A.; Schatz, D. L.

    2013-06-01

    The American Astronomical Society, partnering with organizations active in science education and public outreach (EPO), has launched a series of professional-development workshops and a community of practice designed to help improve early-career astronomers’ ability to effectively communicate with students and the public. Called Astronomy Ambassadors, the program provides mentoring and training experiences for young astronomers, from advanced undergraduates to beginning faculty; it also provides access to resources and a network of contacts within the astronomy EPO community. By learning how to implement effective education and outreach strategies, Astronomy Ambassadors become better teachers, better presenters at meetings, and better representatives of our science to the public and to government. And because young astronomers are a more diverse group than those who currently do the majority of outreach, they help the astronomical community present a more multicultural and gender-balanced face to the public, enabling members of underserved groups to see themselves as scientists. Ambassadors are provided with a large library of outreach activities and materials that are suitable for a range of venues and audiences and that will grow with time. For much of this library we are using resources developed by organizations such as the Astronomical Society of the Pacific, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. The first Astronomy Ambassadors workshop was held at the 221st meeting of the AAS in January 2013 and served 30 young astronomers chosen from more than 75 applicants. Incorporating feedback from workshop participants and lessons learned from the reports they’ve submitted after conducting their own outreach events, we are now planning the second annual workshop to be held 4-5 January 2014 at the 223rd AAS meeting in

  10. Chemometrics approach to substrate development, case: semisyntetic cheese

    DEFF Research Database (Denmark)

    Nielsen, Per Væggemose; Hansen, Birgitte Vedel

    1998-01-01

    from food production facilities.The Chemometrics approach to substrate development is illustrated by the development of a semisyntetic cheese substrate. Growth, colour formation and mycotoxin production of 6 cheese related fungi were studied on 9 types of natural cheeses and 24 synthetic cheese...... substrates and compared using principal component analysis (PCA). The synthetic cheese substrates contained various amounts of Ca, K, Mg, Na, P, Fe, Cu, Zn, lactate, lactose and casein. In this manner a robust, well-defined and easy prepared laboratory cheese substrate was developed for Penicillium commune......, the most frequently occurring contaminant on semi-hard cheese. Growth experiments on the substrate were repeatable and reproducible. The substrate was also suitable for the starter P. camemberti. Mineral elements in cheese were shown to have strong effect on growth, mycotoxin production and colour...

  11. Nemesia Root Hair Response to Paper Pulp Substrate for Micropropagation

    Directory of Open Access Journals (Sweden)

    Pascal Labrousse

    2012-01-01

    Full Text Available Agar substrates for in vitro culture are well adapted to plant micropropagation, but not to plant rooting and acclimatization. Conversely, paper-pulp-based substrates appear as potentially well adapted for in vitro culture and functional root production. To reinforce this hypothesis, this study compares in vitro development of nemesia on several substrates. Strong differences between nemesia roots growing in agar or in paper-pulp substrates were evidenced through scanning electron microscopy. Roots developed in agar have shorter hairs, larger rhizodermal cells, and less organized root caps than those growing on paper pulp. In conclusion, it should be noted that in this study, in vitro microporous substrates such as paper pulp lead to the production of similar root hairs to those found in greenhouse peat substrates. Consequently, if agar could be used for micropropagation, rooting, and plant acclimatization, enhancement could be achieved if rooting stage was performed on micro-porous substrates such as paper pulp.

  12. EcoRV catalysis with a pre-bent substrate

    Science.gov (United States)

    Sanchez, Daniel S.; Zocchi, Giovanni

    2015-05-01

    Enzymes are deformable molecules which often adapt their conformation to the substrate's geometry. In the case of restriction enzymes acting on DNA, the substrate (DNA) is deformable also. While it is well established that external mechanical stress exerted on an enzyme modulates the enzymatic activity, the effect of mechanically stressing the substrate is less explored. Here we present the restriction enzyme EcoRV with a series of pre-bent DNA substrates and observe modulation of the overall speed of the enzymatic reaction by up to a factor 50. While in all cases the reaction is slowed down compared to the unstressed substrate, we observe peaks in the reaction rate as we vary the state of stress of the DNA substrate. Both bending moments and torsional moments on the DNA substrate affect the reaction rate.

  13. Substrate wettability requirement for the direct transfer of graphene

    Science.gov (United States)

    Du, F.; Duan, H. L.; Xiong, C. Y.; Wang, J. X.

    2015-10-01

    The direct transfer method, wherein graphene is transferred from its growth metal to a soft substrate, is widely used to fabricate various devices, and the interfacial bonding condition between the substrate and the graphene is vital for transfer success. In this letter, we present a theoretical model to derive the wettability requirements of the soft substrate to sustain the direct transfer of graphene, and verify the theoretical analysis with experiments. We find that the surface energy components of the substrate have a crucial effect upon the graphene transfer, and that substrates possessing a strong polar surface energy are not suitable for transfer. The theoretical model predicts the critical water contact angle of the soft substrate for graphene transfer to be about 50°, and the experiments measure it to be about 60°. These results provide guidelines for choosing proper substrates to transfer graphene during the fabrication of graphene-based flexible devices.

  14. [Influence of substrate concentration on PHA production using fermented sugar cane as substrate].

    Science.gov (United States)

    Chen, Zhi-Qiang; Deng, Yi; Huang, Long; Wen, Qin-Xue; Guo, Zi-Rui

    2013-06-01

    PHA was a kind of biodegradable polymer produced by mixed microorganisms. In recent years, 3-stage PHA synthesis process (including substrate hydrolysis, culture selection, and PHA synthesis) was commonly used for PHA production. In this kind of process, culture selection is the key stage, which directly affects the PHA production efficiency. In order to deal with sludge bulking occurred in the culture selection system, this paper analyzes the influence of substrate concentration on culture selection efficiency as well as operation stability. Under different influent substrate concentrations of 560 mg x L(-1), 1 120 mg x L(-1) and 1 680 mg x L(-1), we confirmed that influent substrate concentration (COD) of 1 120 mg x L(-1) is the most suitable parameter for the bacteria enriching process after a long period of time under short SRT. After 94 days of cultivation, we achieved 50% of PHA content, 0.7145 COD/COD of PHA conversion rate and 0.191 2 mg x (mg x h)(-1) of specific PHA storage rate at the end of batch tests with nutrient starvation. The study also confirmed that glycogen level in cells has a close relationship with its PHA synthesis ability, which shows its potential to predict the enrichment efficiency.

  15. An Analytical Model for Spectral Peak Frequency Prediction of Substrate Noise in CMOS Substrates

    DEFF Research Database (Denmark)

    Shen, Ming; Mikkelsen, Jan H.

    2013-01-01

    This paper proposes an analytical model describing the generation of switching current noise in CMOS substrates. The model eliminates the need for SPICE simulations in existing methods by conducting a transient analysis on a generic CMOS inverter and approximating the switching current waveform us...

  16. Influence of process parameters on physical dimensions of AA6063 aluminium alloy coating on mild steel in friction surfacing

    Directory of Open Access Journals (Sweden)

    B. Vijaya Kumar

    2015-09-01

    Full Text Available An attempt is made in the present study to obtain the relationships among process parameters and physical dimensions of AA6063 aluminium alloy coating on IS2062 mild steel obtained through friction surfacing and their impact on strength and ductility of the coating. Factorial experimental design technique was used to investigate and select the parameter combination to achieve a coating with adequate strength and ductility. Spindle speed, axial force and table traverse speed were observed to be the most significant factors on physical dimensions. It was observed that the thickness of the coating decreased as the coating width increased. In addition, the width and thickness of the coatings are higher at low and high torques. At intermediate torque values, when the force is high, the width of the coating is high, and its thickness is thin; and when the force is low, the width and thickness are low. The interaction effect between axial force (F – table traverse speed (Vx and spindle speed (N – table traverse speed (Vx produced an increasing effect on coating width and thickness, but other interactions exhibited decreasing influence. It has also been observed that sound coatings could be obtained in a narrow set of parameter range as the substrate-coating materials are metallurgically incompatible and have a propensity to form brittle intermetallics.

  17. Automatic classification of blank substrate defects

    Science.gov (United States)

    Boettiger, Tom; Buck, Peter; Paninjath, Sankaranarayanan; Pereira, Mark; Ronald, Rob; Rost, Dan; Samir, Bhamidipati

    2014-10-01

    Mask preparation stages are crucial in mask manufacturing, since this mask is to later act as a template for considerable number of dies on wafer. Defects on the initial blank substrate, and subsequent cleaned and coated substrates, can have a profound impact on the usability of the finished mask. This emphasizes the need for early and accurate identification of blank substrate defects and the risk they pose to the patterned reticle. While Automatic Defect Classification (ADC) is a well-developed technology for inspection and analysis of defects on patterned wafers and masks in the semiconductors industry, ADC for mask blanks is still in the early stages of adoption and development. Calibre ADC is a powerful analysis tool for fast, accurate, consistent and automatic classification of defects on mask blanks. Accurate, automated classification of mask blanks leads to better usability of blanks by enabling defect avoidance technologies during mask writing. Detailed information on blank defects can help to select appropriate job-decks to be written on the mask by defect avoidance tools [1][4][5]. Smart algorithms separate critical defects from the potentially large number of non-critical defects or false defects detected at various stages during mask blank preparation. Mechanisms used by Calibre ADC to identify and characterize defects include defect location and size, signal polarity (dark, bright) in both transmitted and reflected review images, distinguishing defect signals from background noise in defect images. The Calibre ADC engine then uses a decision tree to translate this information into a defect classification code. Using this automated process improves classification accuracy, repeatability and speed, while avoiding the subjectivity of human judgment compared to the alternative of manual defect classification by trained personnel [2]. This paper focuses on the results from the evaluation of Automatic Defect Classification (ADC) product at MP Mask

  18. Characterization of AA7050 aluminium alloy processed by ECAP; Caracterizacao da liga de aluminio AA7050 processada por ECAP

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, K.R.; Guido, V. [Universidade do Vale do Paraiba (UNIVAP), Sao Jose dos Campos, SP (Brazil). Inst. de Pesquisa e Desenvolvimento; Travessa, D.N. [Empresa Brasileira de Aeronautica (EMBRAER), Sao Jose dos Campos, SP (Brazil); Jorge Junior, A.M. [Universidade Federal de Sao Carlos (DEMa/UFSCar), SP (Brazil). Dept. de Engenharia de Materiais

    2010-07-01

    The commercial AA7050 aluminium alloy in the solution heat treated condition (W) was processed by ECAP through route A. Two pressing temperatures (room and 150 deg C and velocities (5 and 30mm/min) were used, as well as different number of passes. The effect of such variables on the microstructure evolution was evaluated using optical and transmission electron microscopy with EDX microanalysis, and xray diffraction. It was found that the microstructure has been refined by ECAP, as a result of subgrains formed within deformation bands. ECAP at 150 deg C resulted in intense precipitation of plate like {eta} phase, which evolves to equiaxial morphology as the number of passes increases. (author)

  19. Co-deposition of basement membrane components during the induction of murine splenic AA amyloid

    DEFF Research Database (Denmark)

    Lyon, A W; Narindrasorasak, S; Young, I D

    1991-01-01

    Past studies have demonstrated that during murine AA amyloid induction there is co-deposition of the AA amyloid peptide and the basement membrane form of heparan sulfate proteoglycan. The synthesis and accumulation of heparan sulfate proteoglycan does not usually occur in the absence of other...... basement membrane components, such as type IV collagen, laminin, and fibronectin. Using immunohistochemical techniques, the present experiments have demonstrated that in addition to the heparan sulfate proteoglycan, there are other basement membrane components present in splenic AA amyloid deposits...... and these are present as soon as AA amyloid deposits are detectable. The results indicate that within the time constraints imposed by the experiments, the basement membrane components, fibronectin, laminin, type IV collagen, and heparan sulfate proteoglycan are co-deposited 36 to 48 hours after the AgNO3 and amyloid...

  20. Effect of cryogenic cooling on corrosion of friction stir welded AA7010-T7651

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Davenport, A. J.; Ambat, Rajan

    2010-01-01

    Purpose - The purpose of this paper is to study how cryogenic CO2 cooling during the welding process affects corrosion behaviour of friction stir welding (FSW) AA7010-T7651. Design/methodology/approach - Friction stir welded AA7010-17651 was produced with a rotation speed of 288 rpm and a travel...... a gel visualisation test and potentiodynamic polarisation measurements using a micro-electrochemical technique. Findings - The main corrosion region for both FSWs AA7010-T7651 produced with and without cryogenic CO2 cooling is in the HAZ region, which exhibited intergranular attack. Cryogenic cooling...... the nugget region of uncooled welds. Originality/value - There has been no previous work to investigate the effect of cryogenic CO2 cooling on the corrosion behaviour of FSW AA7010-T7651. The paper relates the microstructures of both uncooled and cooled welds to their anodic and cathodic reactivities using...

  1. Siim Kallas seab Lumani argumendid kahtluse alla / Kadri Paas ; kommenteerinud Norman Aas, Juhan Põldroos

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2009-01-01

    Seaduseelnõust, mille eesmärgiks on tõhustada võitlust kartellidega ja muude raskete konkurentsiõiguse rikkumistega nn leebusprogrammi abil. Kommenteerivad peaprokurör Norman Aas ja Juhan Põldroos

  2. Peaprokurör: kaevake kartellide peale! / Kadri Paas ; kommenteerinud Norman Aas ; Indrek, Kaju

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2009-01-01

    Seaduseelnõust, mille kohaselt salajasest kartellileppest esimesena võimudele teatanud ettevõte pääseb vastutasuks karistusest. Kommenteerivad peaprokurör Norman Aas ning Neste Eesti peadirektor Indrek Kaju

  3. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.5114 >orf19.5114; Contig19-10218; complement(13382...8..134301); GRD19; retrieval from vacuole to Golgi; MSKPFQPISDVINTSPKNKSQSFNEIYGEPENFLEIEVKNPLTHGYGSNLFTDYEI

  4. Evaluation of Alternative Aptitude Area (AA) Composites and Job Families for Army Classification

    National Research Council Canada - National Science Library

    Diaz, Tirso; Ingerick, Michael; Lightfoot, Mary Ann

    2004-01-01

    ... classification and assignment of Army personnel to entry-level jobs. The current study aimed to independently evaluate the efficacy of the proposed AA composites, and corresponding job families, to meet the Army's classification...

  5. ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ch_oct10_gene_aa_db Chro.70306 involved in sister chromatid cohesion >Chro.70306 i...nvolved in sister chromatid cohesion; Smc3p MIDIIQFDERVRPVIEQIFGNYVIVESLDNAKYLVDKYNVNCITLDGDEWDNKGCVRGGYRNIN

  6. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2070 >orf19.2070; Contig19-10139; complement(144199..145761); RSC58*; remod...els the structure of chromatin complex; MKIVSSLQSHTTTDVTSIKNKYKNGQYSTPYQLFHDIKAVASI

  7. Data of evolutionary structure change: 1D3AA-1SMKD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D3AA-1SMKD 1D3A 1SMK A D -TKVSVVGAAGTVGAAAGYNIALRDIADEVVFVDIPDKEDDTVGQAADTNHGIAYD...KLSDQYDKIS----- GFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDV----VNAPGVTADISHMD---TGAVVRGFLGQQQLE... 1SMK D 1SMKD 1SMK D 1SMKD 1SMK D 1SMKD

  8. AA-amyloidosis caused by visceral leishmaniasis in a human immunodeficiency virus-infected patient.

    Science.gov (United States)

    de Vallière, Serge; Mary, Charles; Joneberg, Jeanna E; Rotman, Samuel; Bullani, Roberto; Greub, Gilbert; Gillmore, Julian D; Buffet, Pierre A; Tarr, Philip E

    2009-08-01

    AA-amyloidosis in the setting of chronic visceral leishmaniasis (VL) has been reported in animal models but documentation in humans is unavailable. Here, we report on a Portuguese man who in 1996 was diagnosed with both human immunodeficiency virus (HIV)-infection and VL. Antiretroviral treatment led to sustained suppression of HIV viremia but CD4+ lymphocytes rose from 8 to only 160 cells/mL. Several courses of antimony treatment did not prevent VL relapses. Renal failure developed in 2006 and renal biopsy revealed AA-amyloidosis. The patient had cryoglobulinemia and serum immune complexes containing antibodies directed against seven leishmanial antigens. Antimony plus amphotericin B, followed by oral miltefosine resulted in a sustained VL treatment response with elimination of circulating Leishmania infantum DNA and CD4+ recovery. The concomitant reduction of serum AA levels and disappearance of circulating leishmanial immune complexes suggests that prolonged VL may lead to AA-amyloidosis in immunocompromised humans.

  9. Magnetism of an adatom on biased AA-stacked bilayer graphene

    Energy Technology Data Exchange (ETDEWEB)

    Mohammadi, Yawar, E-mail: yawar.mohammadi@gmail.com [Department of Physics, Islamic Azad University, Kermanshah Branch, Kermanshah (Iran, Islamic Republic of); Moradian, Rostam [Department of Physics, Razi University, Kermanshah (Iran, Islamic Republic of); Nano Science and Nano Technology Research Center, Razi University, Kermanshah (Iran, Islamic Republic of)

    2014-06-01

    We study the magnetism of an adatom adsorbed on AA-stacked bilayer graphene (BLG) in both unbiased and biased cases using the Anderson impurity model. We find different magnetic phase diagrams for the adatom, depending on its energy level. The magnetic phase of the adatom varies from that in normal metals to that in graphene. This is because of the individual energy dependence of the density of states (DOS) of AA-stacked BLG and anomalous broadening of the adatom energy level. We also investigate the effect of a bias voltage on the DOS of AA-stacked BLG and show that adatom magnetization can be controlled by applying a bias voltage. This allows the possibility of using AA-stacked BLG in spintronic devices.

  10. Gaseous Viscous Peeling of Linearly Elastic Substrates

    Science.gov (United States)

    Elbaz, Shai; Jacob, Hila; Gat, Amir

    2017-11-01

    We study pressure-driven propagation of gas into a micron-scale gap between two linearly elastic substrates. Applying the lubrication approximation, the governing nonlinear evolution equation describes the interaction between elasticity and viscosity, as well as weak rarefaction and low-Mach-number compressibility, characteristic to gaseous microflows. Several physical limits allow simplification of the evolution equation and enable solution by self-similarity. During the peeling process the flow-field transitions between the different limits and the respective approximate solutions. The sequence of limits occurring during the propagation dynamics can be related to the thickness of the prewetting layer of the configuration at rest, yielding an approximate description of the entire peeling dynamics. The results are validated by numerical solutions of the evolution equation. Israel Science Foundation 818/13.

  11. A universal mammalian vaccine cell line substrate.

    Directory of Open Access Journals (Sweden)

    Jackelyn Murray

    Full Text Available Using genome-wide small interfering RNA (siRNA screens for poliovirus, influenza A virus and rotavirus, we validated the top 6 gene hits PV, RV or IAV to search for host genes that when knocked-down (KD enhanced virus permissiveness and replication over wild type Vero cells or HEp-2 cells. The enhanced virus replication was tested for 12 viruses and ranged from 2-fold to >1000-fold. There were variations in virus-specific replication (strain differences across the cell lines examined. Some host genes (CNTD2, COQ9, GCGR, NDUFA9, NEU2, PYCR1, SEC16G, SVOPL, ZFYVE9, and ZNF205 showed that KD resulted in enhanced virus replication. These findings advance platform-enabling vaccine technology, the creation of diagnostic cells substrates, and are informative about the host mechanisms that affect virus replication in mammalian cells.

  12. The structural neural substrate of subjective happiness.

    Science.gov (United States)

    Sato, Wataru; Kochiyama, Takanori; Uono, Shota; Kubota, Yasutaka; Sawada, Reiko; Yoshimura, Sayaka; Toichi, Motomi

    2015-11-20

    Happiness is a subjective experience that is an ultimate goal for humans. Psychological studies have shown that subjective happiness can be measured reliably and consists of emotional and cognitive components. However, the neural substrates of subjective happiness remain unclear. To investigate this issue, we used structural magnetic resonance imaging and questionnaires that assessed subjective happiness, the intensity of positive and negative emotional experiences, and purpose in life. We found a positive relationship between the subjective happiness score and gray matter volume in the right precuneus. Moreover, the same region showed an association with the combined positive and negative emotional intensity and purpose in life scores. Our findings suggest that the precuneus mediates subjective happiness by integrating the emotional and cognitive components of happiness.

  13. Somatosensory Substrates of Flight Control in Bats

    Directory of Open Access Journals (Sweden)

    Kara L. Marshall

    2015-05-01

    Full Text Available Flight maneuvers require rapid sensory integration to generate adaptive motor output. Bats achieve remarkable agility with modified forelimbs that serve as airfoils while retaining capacity for object manipulation. Wing sensory inputs provide behaviorally relevant information to guide flight; however, components of wing sensory-motor circuits have not been analyzed. Here, we elucidate the organization of wing innervation in an insectivore, the big brown bat, Eptesicus fuscus. We demonstrate that wing sensory innervation differs from other vertebrate forelimbs, revealing a peripheral basis for the atypical topographic organization reported for bat somatosensory nuclei. Furthermore, the wing is innervated by an unusual complement of sensory neurons poised to report airflow and touch. Finally, we report that cortical neurons encode tactile and airflow inputs with sparse activity patterns. Together, our findings identify neural substrates of somatosensation in the bat wing and imply that evolutionary pressures giving rise to mammalian flight led to unusual sensorimotor projections.

  14. The structural neural substrate of subjective happiness

    Science.gov (United States)

    Sato, Wataru; Kochiyama, Takanori; Uono, Shota; Kubota, Yasutaka; Sawada, Reiko; Yoshimura, Sayaka; Toichi, Motomi

    2015-01-01

    Happiness is a subjective experience that is an ultimate goal for humans. Psychological studies have shown that subjective happiness can be measured reliably and consists of emotional and cognitive components. However, the neural substrates of subjective happiness remain unclear. To investigate this issue, we used structural magnetic resonance imaging and questionnaires that assessed subjective happiness, the intensity of positive and negative emotional experiences, and purpose in life. We found a positive relationship between the subjective happiness score and gray matter volume in the right precuneus. Moreover, the same region showed an association with the combined positive and negative emotional intensity and purpose in life scores. Our findings suggest that the precuneus mediates subjective happiness by integrating the emotional and cognitive components of happiness. PMID:26586449

  15. Substrate-emitting ring interband cascade lasers

    Science.gov (United States)

    Holzbauer, Martin; Szedlak, Rolf; Detz, Hermann; Weih, Robert; Höfling, Sven; Schrenk, Werner; Koeth, Johannes; Strasser, Gottfried

    2017-10-01

    We demonstrate interband cascade lasers fabricated into ring-shaped cavities with vertical light emission through the substrate at a wavelength of λ ≈ 3.7 μm. The out-coupling mechanism is based on a metallized second-order distributed feedback grating. At room-temperature, a pulsed threshold current-density of 0.75 kA/cm2 and a temperature-tuning rate of 0.3 nm/°C are measured. In contrast to the azimuthal polarization of ring quantum cascade lasers, we observe a radial polarization of the projected nearfield of ring interband cascade lasers. These findings underline the fundamental physical difference between light generation in interband and intersubband cascade lasers, offering new perspectives for device integration.

  16. Vector assembly of colloids on monolayer substrates

    Science.gov (United States)

    Jiang, Lingxiang; Yang, Shenyu; Tsang, Boyce; Tu, Mei; Granick, Steve

    2017-06-01

    The key to spontaneous and directed assembly is to encode the desired assembly information to building blocks in a programmable and efficient way. In computer graphics, raster graphics encodes images on a single-pixel level, conferring fine details at the expense of large file sizes, whereas vector graphics encrypts shape information into vectors that allow small file sizes and operational transformations. Here, we adapt this raster/vector concept to a 2D colloidal system and realize `vector assembly' by manipulating particles on a colloidal monolayer substrate with optical tweezers. In contrast to raster assembly that assigns optical tweezers to each particle, vector assembly requires a minimal number of optical tweezers that allow operations like chain elongation and shortening. This vector approach enables simple uniform particles to form a vast collection of colloidal arenes and colloidenes, the spontaneous dissociation of which is achieved with precision and stage-by-stage complexity by simply removing the optical tweezers.

  17. Substrate Integrated Evanescent Filters Employing Coaxial Stubs

    DEFF Research Database (Denmark)

    Zhurbenko, Vitaliy

    2015-01-01

    is designed, fabricated, and tested. The filter exhibits a transmission zero due to the implemented stubs. The problem of evanescent mode filter analysis is formulated in terms of conventional network concepts. This formulation is then used for modelling of the filters. Strategies to further miniaturization...... and small height of the waveguide. In this work, one of the realization methods of evanescent mode waveguides using a single layer substrate is considered. The method is based on the use of coaxial stubs as capacitive susceptances externally connected to a SIW. A microwave filter based on these principles...... of the microwave filter are discussed. The approach is useful in applications where a sharp roll-off at the upper stop-band is required....

  18. Dancing droplets: Chemical space, substrates, and control

    Science.gov (United States)

    Cira, Nate; Benusiglio, Adrien; Prakash, Manu

    2015-11-01

    Previously we showed that droplets of propylene glycol and water display remarkable properties when placed on clean glass due to an interplay between surface tension and evaporation. (Cira, Benusiglio, Prakash: Nature, 2015). We showed that these mechanisms apply to a range of two-component mixtures of miscible liquids where one component has both higher surface tension and higher vapor pressure on a variety of high energy surfaces. We now show how this rule can be cheated using a simple trick. We go on to demonstrate applications for cleaning, and show how this system works on substrates prepared only with sunlight. We finish by demonstrating active control of droplets, allowing access to a host of new possibilities.

  19. Palladium on Plastic Substrates for Plasmonic Devices

    Directory of Open Access Journals (Sweden)

    Paola Zuppella

    2015-01-01

    Full Text Available Innovative chips based on palladium thin films deposited on plastic substrates have been tested in the Kretschmann surface plasmon resonance (SPR configuration. The new chips combine the advantages of a plastic support that is interesting and commercially appealing and the physical properties of palladium, showing inverted surface plasmon resonance (ISPR. The detection of DNA chains has been selected as the target of the experiment, since it can be applied to several medical early diagnostic tools, such as different biomarkers of cancers or cystic fibrosis. The results are encouraging for the use of palladium in SPR-based sensors of interest for both the advancement of biodevices and the development of hydrogen sensors.

  20. Homocysteine induced cardiovascular events: a consequence of long term anabolic‐androgenic steroid (AAS) abuse

    Science.gov (United States)

    Graham, M R; Grace, F M; Boobier, W; Hullin, D; Kicman, A; Cowan, D; Davies, B; Baker, J S

    2006-01-01

    Objectives The long term effects (>20 years) of anabolic‐androgenic steroid (AAS) use on plasma concentrations of homocysteine (HCY), folate, testosterone, sex hormone binding globulin (SHBG), free androgen index, urea, creatinine, haematocrit (HCT), vitamin B12, and urinary testosterone/epitestosterone (T/E) ratio, were examined in a cohort of self‐prescribing bodybuilders. Methods Subjects (n = 40) were divided into four distinct groups: (1) AAS users still using AAS (SU; n = 10); (2) AAS users abstinent from AAS administration for 3 months (SA; n = 10); (3) non‐drug using bodybuilding controls (BC; n = 10); and (4) sedentary male controls (SC; n = 10). Results HCY levels were significantly higher in SU compared with BC and SC (p<0.01), and with SA (p<0.05). Fat free mass was significantly higher in both groups of AAS users (p<0.01). Daily energy intake (kJ) and daily protein intake (g/day) were significantly higher in SU and SA (p<0.05) compared with BC and SC, but were unlikely to be responsible for the observed HCY increases. HCT concentrations were significantly higher in the SU group (p<0.01). A significant linear inverse relationship was observed in the SU group between SHBG and HCY (r = −0.828, p<0.01), indicating a possible influence of the sex hormones in determining HCY levels. Conclusions With mounting evidence linking AAS to adverse effects on some clotting factors, the significantly higher levels of HCY and HCT observed in the SU group suggest long term AAS users have increased risk of future thromboembolic events. PMID:16488899

  1. PDGF-AA-induced filamentous mitochondria benefit dermal papilla cells in cellular migration.

    Science.gov (United States)

    Mifude, C; Kaseda, K

    2015-06-01

    Human dermal papilla cells (HDPCs) play essential roles in hair follicular morphogenesis and postnatal hair growth cycles. Previous reports demonstrated that platelet-derived growth factor-AA (PDGF-AA) enhanced the formation of dermal condensates in hair follicular development. Additionally, PDGF-AA induces/maintains the anagen phase of the hair cycle. It is likely that mitochondrial morphology and functions are tightly coupled with maintenance of these energy-demanding activities. However, little is known about the mitochondrial regulation in HDPCs. Thus, we investigated the PDGF-involved mitochondrial regulation in HDPCs. The mitochondrial morphologies of HDPCs were examined in the presence or absence of PDGF-AA under a fluorescent microscope. ATP production and cellular motility were investigated. The relationship between mitochondrial morphology and the cellular functions was discussed. We observed that primary HDPCs contained mitochondria with filamentous and/or rounded morphologies. Both types of mitochondria showed similar membrane potentials. Interestingly, in the presence of PDGF-AA, but not PDGF-BB, the balance between the two morphologies shifted towards the filamentous form. Concomitantly, both mitochondrial enzymatic activity and total cellular ATP level were augmented by PDGF-AA. These two parameters were closely correlated, suggesting the mitochondrial involvement in the PDGF-augmented ATP production. Moreover, PDGF-AA accelerated the migration of HDPCs in a gap-filling assay, but did not change the rate of cellular proliferation. Notably, filamentous mitochondria dominated migrating HDPCs. PDGF-AA benefits HDPCs in the process of migration, by increasing the number of filamentous mitochondria. © 2014 Society of Cosmetic Scientists and the Société Française de Cosmétologie.

  2. Overall view of the AA hall dominated by the 50 ton crane (Donges).

    CERN Multimedia

    1980-01-01

    A 50 ton, 32 metre span overhead travelling cranre was mounted in one of the bays of Hall 193 (AA). An identical crane was mounted on the other bay. See also photo 8004261. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  3. NCBI nr-aa BLAST: CBRC-TGUT-08-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available [Mus musculus] gb|AAR03540.1| cryopyrin [Mus musculus] gb|AAR03541.1| cryopyrin [Mus musculus] gb|AAR03542.1| cryo...pyrin [Mus musculus] gb|AAR03543.1| cryopyrin [Mus musculus] gb|AAR14737.1| NALP3 [Mus musculus] gb|AAS75794.1| cryo...pyrin [Mus musculus] gb|AAS75795.1| cryopyrin [Mus musculus] emb|C

  4. pH regulates pore formation of a protease activated Vip3Aa from Bacillus thuringiensis.

    Science.gov (United States)

    Kunthic, Thittaya; Watanabe, Hirokazu; Kawano, Ryuji; Tanaka, Yoshikazu; Promdonkoy, Boonhiang; Yao, Min; Boonserm, Panadda

    2017-11-01

    Vip3Aa insecticidal protein is produced from Bacillus thuringiensis and exerts a broad spectrum of toxicity against lepidopteran insect species. Although Vip3Aa has been effectively used as part of integrated pest management strategies, the mechanism of the toxin remains unclear. Here, we investigated the effect of pH in a range from 5.0 to 10.0 on the pore-forming activity of the trypsin activated Vip3Aa (actVip3Aa) by in vitro pore-forming assays. Based on calcein release assay, actVip3Aa could permeabilize the artificial neutral liposomes under all the pH tested, except pH10.0. The maximum membrane permeability of actVip3Aa was detected at pH8.0 and the permeability decreased and abolished when exposing to acidic and alkaline conditions, respectively. The planar lipid bilayer experiment revealed that actVip3Aa formed ion channels at pH5.0-8.0 but no current signals were detected at pH10.0, consistent with the observation from calcein release assay. The toxin formed ion channels with a diameter of 1.4nm at pH8.0 and pore size was gradually decreased when reducing the pH. This study provided a view of the molecular mechanism of Vip3Aa by which the pore-forming activity is regulated by pH. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Homocysteine induced cardiovascular events: a consequence of long term anabolic-androgenic steroid (AAS) abuse.

    Science.gov (United States)

    Graham, M R; Grace, F M; Boobier, W; Hullin, D; Kicman, A; Cowan, D; Davies, B; Baker, J S

    2006-07-01

    The long term effects (>20 years) of anabolic-androgenic steroid (AAS) use on plasma concentrations of homocysteine (HCY), folate, testosterone, sex hormone binding globulin (SHBG), free androgen index, urea, creatinine, haematocrit (HCT), vitamin B12, and urinary testosterone/epitestosterone (T/E) ratio, were examined in a cohort of self-prescribing bodybuilders. Subjects (n = 40) were divided into four distinct groups: (1) AAS users still using AAS (SU; n = 10); (2) AAS users abstinent from AAS administration for 3 months (SA; n = 10); (3) non-drug using bodybuilding controls (BC; n = 10); and (4) sedentary male controls (SC; n = 10). HCY levels were significantly higher in SU compared with BC and SC (p<0.01), and with SA (p<0.05). Fat free mass was significantly higher in both groups of AAS users (p<0.01). Daily energy intake (kJ) and daily protein intake (g/day) were significantly higher in SU and SA (p<0.05) compared with BC and SC, but were unlikely to be responsible for the observed HCY increases. HCT concentrations were significantly higher in the SU group (p<0.01). A significant linear inverse relationship was observed in the SU group between SHBG and HCY (r = -0.828, p<0.01), indicating a possible influence of the sex hormones in determining HCY levels. With mounting evidence linking AAS to adverse effects on some clotting factors, the significantly higher levels of HCY and HCT observed in the SU group suggest long term AAS users have increased risk of future thromboembolic events.

  6. Effect of Substrate and Process Parameters on the Gas-Substrate Convective Heat Transfer Coefficient During Cold Spraying

    Science.gov (United States)

    Mahdavi, Amirhossein; McDonald, André

    2017-11-01

    The final quality of cold-sprayed coatings can be significantly influenced by gas-substrate heat exchange, due to the dependence of the deposition efficiency of the particles on the substrate temperature distribution. In this study, the effect of the air temperature and pressure, as process parameters, and surface roughness and thickness, as substrate parameters, on the convective heat transfer coefficient of the impinging air jet was investigated. A low-pressure cold spraying unit was used to generate a compressed air jet that impinged on a flat substrate. A comprehensive mathematical model was developed and coupled with experimental data to estimate the heat transfer coefficient and the surface temperature of the substrate. The effect of the air total temperature and pressure on the heat transfer coefficient was studied. It was found that increasing the total pressure would increase the Nusselt number of the impinging air jet, while total temperature of the air jet had negligible effect on the Nusslet number. It was further found that increasing the roughness of the substrate enhanced the heat exchange between the impinging air jet and the substrate. As a result, higher surface temperatures on the rough substrate were measured. The study of the effect of the substrate thickness on the heat transfer coefficient showed that the Nusselt number that was predicted by the model was independent of the thickness of the substrate. The surface temperature profile, however, decreased in increasing radial distances from the stagnation point of the impinging jet as the thickness of the substrate increased. The results of the current study were aimed to inform on the influence and effect of substrate and process parameters on the gas-substrate heat exchange and the surface temperature of the substrate on the final quality of cold-sprayed coatings.

  7. Substrate Market. Compilation and analysis of substrate market; Substratmarknadsanalys. Sammanstaellning och analys av substratmarknaden

    Energy Technology Data Exchange (ETDEWEB)

    Holgersson, Pernilla (SP Sveriges Tekniska Forskningsinstitut (Sweden)); Newborg, Aase; Hellstroem, Chris (Kan Energi Sweden AB (Sweden)); Mc Cann, Michael; Oestervall, Sara Linnea (Vattenfall Power Consultant AB (Sweden)); Fagerstroem, Erik (Lund Univ., Faculty of Engineering, LTH (Sweden)); Thomten, Maria (Swedish Univ. of Agricultural Sciences (Sweden))

    2011-10-15

    A great potential exists to produce more biogas from anaerobic digestion in Sweden and local authorities are working to develop the required production, distribution and retail systems to aid the realisation of such potential. Vaestra Goetaland, which lies on the west coast of Sweden, has a goal to produce 1,2 TWh of biogas each year by 2020 and by 2013, intends to produce 0,3 TWh each year. Skaane in the south of Sweden, has a similar goal to produce 1,4 TWh of biogas each year by 2020. The goal of the project for which this study was initiated, is to define the regional market for biogas substrate in order to determine current supply and demand and predict supply and demand in 2020. The individual substrate types that are included in this study are organic domestic waste (household, restaurants and other food retail), industrial waste products, and animal manure from agriculture. Crops are not included in the study, nor is sewage sludge. Biogas produced via biomass gasification is also not covered. The geographical limit of the study is set to cover biogas plants in Skaane, Halland och Vaestra Goetaland as well as Vaermland, Oerebro, Joenkoeping, Kronoberg and Blekinge. A series of interviews carried out with personnel from the biogas plants reveal that 70 % of the plants experience competition for substrate material. Animal slaughter waste is much sought after for use in Co-digestion plants in Skaane and Halland whereas only one plant in Vaestra Goetaland uses such waste. Plant owners revealed that plants in Vaestra Goetaland use between 50% and 100% organic domestic waste. None of the contacted plants in Vaestra Goetaland use animal manure whereas for biogas plants in Skaane and Halland, use of manure varies between 8% and 80%. The interview results show that waste fired power plants are a considerable competitor for substrate originating from the food industry waste. Competition for substrate has increased over recent years especially for those substrates

  8. Trust Building Recruitment Strategies for Researchers Conducting Studies in African American (AA) Churches.

    Science.gov (United States)

    Bonner, Gloria; Williams, Sharon; Wilkie, Diana; Hart, Alysha; Burnett, Glenda; Peacock, Geraldine

    2016-01-01

    An initial and vital important step in recruiting participants for church-based hospice and palliative care research is the establishment of trust and credibility within the church community. Mistrust of medical research is an extremely important barrier hindering recruitment in African American (AA) communities. A church-based EOL dementia education project is currently being conducted at four large urban AA churches. Church leaders voiced mistrust concerns of previous researchers who conducted investigations in their faith-based institutions. We explored strategies to ameliorate the mistrust concerns. Specific aim: To identify trust-rebuilding elements for researchers following others who violated trust of AA church leaders. Face-to-face, in-depth interviews were conducted from a convenient sample of four established AA church leaders. Interviews were held in the informants' churches to promote candor and comfort in revealing sensitive information about trust /mistrust. Content analysis framework was used to analyze the data. Elements identified from the analysis were then used to create themes. Multidimensional overarching themes emerged from the analysis included: Experience with researchers (positive and extremely negative), violation of trust and trust building strategies. Findings suggest that researchers who wish to conduct successful studies in the AA religious institutions must implement trust rebuilding strategies that include mutual respect, collaboration and partnership building. If general moral practices continue to be violated, threat to future hospice and palliative care research within the institutions may prevail. Thus, potential benefits are thwarted for the church members, AA community, and advancement of EOL care scholarship.

  9. AA/12-lipoxygenase signaling contributes to inhibitory learning in Hermissenda Type B photoreceptors

    Directory of Open Access Journals (Sweden)

    Tony L Walker

    2010-08-01

    Full Text Available Conditioned inhibition (CI is a major category of associative learning that occurs when an organism learns that one stimulus predicts the absence of another. In addition to being important in its own right, CI is interesting because its occurrence implies that the organism has formed an association between stimuli that are non-coincident. In contrast to other categories of associative learning that are dependent upon temporal contiguity (pairings of stimuli, the neurobiology of CI is virtually unexplored. We have previously described a simple form of CI learning in Hermissenda, whereby animals’ phototactic behavior is increased by repeated exposures to explicitly unpaired (EU presentations of light and rotation. EU conditioning also produces characteristic reductions in the excitability and light response, and increases several somatic K+ currents in Type B photoreceptors. Type B photoreceptors are a major site of plasticity for classical conditioning in Hermissenda. Because arachidonic acid (AA and/or its metabolites open diverse K+ channels in many cell types, we examined the potential contribution of AA to CI. Our results indicate that AA contributes to one of the major effects of EU-conditioning on Type B photoreceptors: decreases in light-evoked spike activity. We find that AA increases the transient (IA somatic K+ current in Type B photoreceptors, further mimicking CI training. In addition, our results indicate that metabolism of AA by a 12-lipoxygenase enzyme is critical for these effects of AA, and further that 12-lipoxygenase metabolites are apparently generated during CI training.

  10. Multiple Dirac particles in AA-stacked graphite and multilayers of graphene

    Science.gov (United States)

    Lobato, I.; Partoens, B.

    2011-04-01

    Using the tight-binding formalism we show that in the recently experimentally realized AA-stacked graphite in essence two types of massless relativistic Dirac particles are present with a different effective speed of light. We also investigate how the electronic structure evolves from a single graphene sheet into AA-stacked graphite. It is shown that in contrast to AB-stacked graphene layers, the spectrum of AA-stacked graphene layers can be considered as a superposition of single-layer spectra and only particles with a linear spectrum at the Fermi energy around the K point are present. From the evolution of the band overlap we show that 6 multilayers of AA-stacked graphene already behave as AA-stacked graphite. The evolution of the effective speeds of light of the Dirac particles to their bulk values shows exactly the same behavior. The tight-binding parameters we use to describe AA-stacked graphite and multilayers of graphene are obtained by ab initio calculations.

  11. A Novel Tenebrio molitor Cadherin Is a Functional Receptor for Bacillus thuringiensis Cry3Aa Toxin*

    Science.gov (United States)

    Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D.; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis

    2009-01-01

    Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepidopteran cadherin B. thuringiensis receptors. A peptide containing the putative toxin binding region from TmCad1 bound specifically to Cry3Aa and promoted the formation of Cry3Aa toxin oligomers, proposed to be mediators of toxicity in lepidopterans. Injection of TmCad1-specific double-stranded RNA into T. molitor larvae resulted in knockdown of the TmCad1 transcript and conferred resistance to Cry3Aa toxicity. These data demonstrate the functional role of TmCad1 as a Cry3Aa receptor in T. molitor and reveal similarities between the mode of action of Cry toxins in Lepidoptera and Coleoptera. PMID:19416969

  12. A novel Tenebrio molitor cadherin is a functional receptor for Bacillus thuringiensis Cry3Aa toxin.

    Science.gov (United States)

    Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis

    2009-07-03

    Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepidopteran cadherin B. thuringiensis receptors. A peptide containing the putative toxin binding region from TmCad1 bound specifically to Cry3Aa and promoted the formation of Cry3Aa toxin oligomers, proposed to be mediators of toxicity in lepidopterans. Injection of TmCad1-specific double-stranded RNA into T. molitor larvae resulted in knockdown of the TmCad1 transcript and conferred resistance to Cry3Aa toxicity. These data demonstrate the functional role of TmCad1 as a Cry3Aa receptor in T. molitor and reveal similarities between the mode of action of Cry toxins in Lepidoptera and Coleoptera.

  13. Effect of Substrate Temperature and Ambient Pressure on Heat Transfer at Interface Between Molten Droplet and Substrate Surface

    Science.gov (United States)

    Fukumoto, M.; Yang, K.; Tanaka, K.; Usami, T.; Yasui, T.; Yamada, M.

    2011-01-01

    Millimeter-sized molten Cu droplets were deposited on AISI304 substrate surface by free falling experiment. The roles of substrate temperature and ambient pressure on heat transfer at interface between molten droplet and substrate surface were systematically investigated. The splat characteristics were evaluated in detail. Temperature history of molten droplet was measured at splat-substrate interface. Cooling rate of the flattening droplet was calculated as well. Furthermore, the spreading behavior of molten droplet on substrate surface was captured by high speed camera. The heat transfer from splat to substrate was enhanced both by substrate heating and by ambient pressure reduction, which can be attributed to the good contact at splat bottom surface. The splats in free falling experiment showed similar changing tendency as thermal-sprayed particles. Consequently, substrate temperature and ambient pressure have an equivalent effect to contact condition at interface between droplet and substrate surface. Substrate heating and pressure reduction may enhance the wetting during splat flattening, and then affect the flattening and solidification behavior of the molten droplet.

  14. Vitreous carbon mask substrate for X-ray lithography

    Science.gov (United States)

    Aigeldinger, Georg [Livermore, CA; Skala, Dawn M [Fremont, CA; Griffiths, Stewart K [Livermore, CA; Talin, Albert Alec [Livermore, CA; Losey, Matthew W [Livermore, CA; Yang, Chu-Yeu Peter [Dublin, CA

    2009-10-27

    The present invention is directed to the use of vitreous carbon as a substrate material for providing masks for X-ray lithography. The new substrate also enables a small thickness of the mask absorber used to pattern the resist, and this enables improved mask accuracy. An alternative embodiment comprised the use of vitreous carbon as a LIGA substrate wherein the VC wafer blank is etched in a reactive ion plasma after which an X-ray resist is bonded. This surface treatment provides a surface enabling good adhesion of the X-ray photoresist and subsequent nucleation and adhesion of the electrodeposited metal for LIGA mold-making while the VC substrate practically eliminates secondary radiation effects that lead to delamination of the X-ray resist form the substrate, the loss of isolated resist features, and the formation of a resist layer adjacent to the substrate that is insoluble in the developer.

  15. Metal plating removal from insulator substrate using pulsed arc discharge

    Science.gov (United States)

    Imasaka, K.; Gnapowski, S.; Akiyama, H.

    2014-06-01

    Removal technique of metal materials from a metal plating insulator substrate using a pulsed arc discharge was proposed and its fundamental characteristics were investigated. The metal plating substrate with three metal-layers structure (cupper, nickel and gold layers) is used as the sample substrate. Repetitive pulsed arc discharge plasma is generated using three types of electrode systems. Effects of the electrode systems on the metal plating removal from the insulator substrate were investigated. The metal plating was removed by the pulsed arc discharge between the electrode and substrate surface. A part of the gold layer, which is the topmost metal layer on the insulator substrate is vaporized and removed by the repetitive pulsed arc discharges.

  16. Polymer Substrates For Lightweight, Thin-Film Solar Cells

    Science.gov (United States)

    Lewis, Carol R.

    1993-01-01

    Substrates survive high deposition temperatures. High-temperature-resistant polymers candidate materials for use as substrates of lightweight, flexible, radiation-resistant solar photovoltaic cells. According to proposal, thin films of copper indium diselenide or cadmium telluride deposited on substrates to serve as active semiconductor layers of cells, parts of photovoltaic power arrays having exceptionally high power-to-weight ratios. Flexibility of cells exploited to make arrays rolled up for storage.

  17. THz metal mesh filters on electrically thick fused silica substrates

    OpenAIRE

    Otter, WJ; F. Hu; Hazell, JF; Lucyszyn, S

    2014-01-01

    ? 2014 IEEE.This paper shows simulated and measured results of ultra-low cost metal mesh filters on electrically thick substrates for millimeter-wave and THz bands. It provides a broad overview of metal mesh filters currently available and suggest why it is worth moving to an electrically thick substrate for ultra-low cost applications. We demonstrate scalable traditional metal mesh filters on 525 ?m thick fused silica substrates. In addition, trapped-mode excitation is exploited to improve o...

  18. Structural insights into substrate traffic and inhibition in acetylcholinesterase

    OpenAIRE

    Colletier, Jacques-Philippe,; Fournier, Didier; Greenblatt, Harry M.; Stojan, Jure; Sussman, Joel L.; Zaccai, Giuseppe; Silman, Israel; Weik, Martin

    2006-01-01

    Acetylcholinesterase (AChE) terminates nerve-impulse transmission at cholinergic synapses by rapid hydrolysis of the neurotransmitter, acetylcholine. Substrate traffic in AChE involves at least two binding sites, the catalytic and peripheral anionic sites, which have been suggested to be allosterically related and involved in substrate inhibition. Here, we present the crystal structures of Torpedo californica AChE complexed with the substrate acetylthiocholine, the product thiocholine and a n...

  19. Pd thin films on flexible substrate for hydrogen sensor

    Energy Technology Data Exchange (ETDEWEB)

    Öztürk, Sadullah [Fatih Sultan Mehmet Vakıf University, Engineering Faculty, Istanbul (Turkey); Kılınç, Necmettin, E-mail: nkilinc@nigde.edu.tr [Nigde University, Mechatronics Engineering Department, 51245 Nigde (Turkey); Nigde University, Nanotechnology Application and Research Center, 51245 Nigde (Turkey)

    2016-07-25

    In this work, palladium (Pd) thin films were prepared via RF sputtering method with various thicknesses (6 nm, 20 nm and 60 nm) on both a flexible substrate and a hard substrate. Hydrogen (H{sub 2}) sensing properties of Pd films on flexible substrate have been investigated depending on temperatures (25–100 °C) and H{sub 2} concentrations (600 ppm – 10%). The effect of H{sub 2} on structural properties of the films was also studied. The films were characterized by Scanning Electron Microscopy (SEM) and X-ray diffraction. It is found that whole Pd films on hard substrate show permanent structural deformation after exposed to 10% H{sub 2} for 30 min. But, this H{sub 2} exposure does not causes any structural deformation for 6 nm Pd film on flexible substrate and 6 nm Pd film on flexible substrate shows reversible sensor response up to 10% H{sub 2} concentration without any structural deformation. On the other hand, Pd film sensors that have the thicknesses 20 nm and 60 nm on flexible substrate are irreversible for higher H{sub 2} concentration (>2%) with film deformation. The sensor response of 6 nm Pd film on flexible substrate increased with increasing H{sub 2} concentration up 4% and then saturated. The sensitivity of the film decreased with increasing operation temperature. - Highlights: • Pd thin films fabricated by RF sputtering on both flexible and hard substrates. • Structural deformation observed for films on hard substrate after exposing 10% H{sub 2}. • 6 nm Pd film on flexible substrate shows reversible sensor response up to 10% H{sub 2}. • H{sub 2} sensing properties of film on flexible substrate investigated depending on temperature and concentration. • The sensitivity of the film decreased with increasing operation temperature.

  20. Inorganic Islands on a Highly Stretchable Polyimide Substrate

    OpenAIRE

    Vlassak, Joost J.; Sun, Jeong-Yun; Lu, Nanshu; Yoon, Juil; Oh, Kyu-Hwan; Suo, Zhigang

    2009-01-01

    For a flexible electronic device integrating inorganic materials on a polymer substrate, the polymer can deform substantially, but the inorganic materials usually fracture at small strains. This paper describes an approach to make such a device highly stretchable. A polyimide substrate is first coated with a thin layer of an elastomer, on top of which SiNx islands are fabricated. When the substrate is stretched to a large strain, the SiNx islands remain intact. Calculations confirm that th...