LOCUS       KY042041                 340 bp    RNA     linear   VRL 12-APR-2017
DEFINITION  Zika virus strain Zika/Boracay/16427 envelope protein gene, partial
            cds.
ACCESSION   KY042041
VERSION     KY042041.1
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes;
            Amarillovirales; Flaviviridae; Orthoflavivirus; Orthoflavivirus
            zikaense.
REFERENCE   1  (bases 1 to 340)
  AUTHORS   Jeong,Y.E., Cha,G.W., Cho,J.E., Lee,E.J., Jee,Y. and Lee,W.J.
  TITLE     Viral and serological kinetics in Zika virus-infected patients in
            South Korea
  JOURNAL   Virol. J. 14 (1), 70 (2017)
   PUBMED   28388922
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 340)
  AUTHORS   Jeong,Y.E., Cha,G.-W., Cho,J.E. and Lee,E.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-OCT-2016) Division of Arboviruses, Korea National
            Institute of Health, 87 Osongsaengmyeong2-ro, Osong-eup,
            Cheongwon-gun, Chungbuk 363-951, Korea
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..340
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /strain="Zika/Boracay/16427"
                     /isolation_source="urine"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Philippines"
                     /collection_date="27-Apr-2016"
     CDS             <1..>340
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="APB91658.1"
                     /translation="GTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEA
                     EMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYA
                     GTDGPCKVPVQ"
BASE COUNT           99 a           78 c           97 g           66 t
ORIGIN      
        1 ggaactccac attggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa
       61 aggcaaactg tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga
      121 gctctggagg ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt
      181 cgcctgaaaa tggataaact cagattgaag ggcgtgtcat actccttgtg tactgcagca
      241 ttcacattca ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag
      301 tacgcaggga cagatggacc ttgcaaggtt ccagtccaaa
//