LOCUS KY042041 340 bp RNA linear VRL 12-APR-2017 DEFINITION Zika virus strain Zika/Boracay/16427 envelope protein gene, partial cds. ACCESSION KY042041 VERSION KY042041.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes; Amarillovirales; Flaviviridae; Orthoflavivirus; Orthoflavivirus zikaense. REFERENCE 1 (bases 1 to 340) AUTHORS Jeong,Y.E., Cha,G.W., Cho,J.E., Lee,E.J., Jee,Y. and Lee,W.J. TITLE Viral and serological kinetics in Zika virus-infected patients in South Korea JOURNAL Virol. J. 14 (1), 70 (2017) PUBMED 28388922 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 340) AUTHORS Jeong,Y.E., Cha,G.-W., Cho,J.E. and Lee,E.J. TITLE Direct Submission JOURNAL Submitted (26-OCT-2016) Division of Arboviruses, Korea National Institute of Health, 87 Osongsaengmyeong2-ro, Osong-eup, Cheongwon-gun, Chungbuk 363-951, Korea COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..340 /organism="Zika virus" /mol_type="genomic RNA" /strain="Zika/Boracay/16427" /isolation_source="urine" /host="Homo sapiens" /db_xref="taxon:64320" /country="Philippines" /collection_date="27-Apr-2016" CDS <1..>340 /codon_start=1 /product="envelope protein" /protein_id="APB91658.1" /translation="GTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEA EMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYA GTDGPCKVPVQ" BASE COUNT 99 a 78 c 97 g 66 t ORIGIN 1 ggaactccac attggaacaa caaagaagca ctggtagagt tcaaggacgc acatgccaaa 61 aggcaaactg tcgtggttct agggagtcaa gaaggagcag ttcacacggc ccttgctgga 121 gctctggagg ctgagatgga tggtgcaaag ggaaggctgt cctctggcca cttgaaatgt 181 cgcctgaaaa tggataaact cagattgaag ggcgtgtcat actccttgtg tactgcagca 241 ttcacattca ccaagatccc ggctgaaaca ctgcacggga cagtcacagt ggaggtacag 301 tacgcaggga cagatggacc ttgcaaggtt ccagtccaaa //