Sample records for zrn hfn vn

  1. Electrical and structural properties of group-4 transition-metal nitride (TiN, ZrN, and HfN) contacts on Ge

    Yamamoto, Keisuke; Nakashima, Hiroshi, E-mail: [Art, Science and Technology Center for Cooperative Research, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Noguchi, Ryutaro; Wang, Dong [Interdisciplinary Graduate School of Engineering Sciences, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Mitsuhara, Masatoshi; Nishida, Minoru [Department of Engineering Sciences for Electronics and Materials, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Hara, Toru [National Institute for Materials Science, 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan)


    Electrical and structural properties were investigated for group-4 transition-metal nitride contacts on Ge (TiN/Ge, ZrN/Ge, and HfN/Ge), which were prepared by direct sputter depositions using nitride targets. These contacts could alleviate the intrinsic Fermi-level pinning (FLP) position toward the conduction band edge. It was revealed that this phenomenon is induced by an amorphous interlayer (a-IL) containing nitrogen atoms at the nitride/Ge interfaces. The strength of FLP alleviation positively depended on the thickness of a-IL. TiN/Ge and ZrN/Ge contacts with ∼2 nm-thick a-ILs showed strong FLP alleviations with hole barrier heights (Φ{sub BP}) in the range of 0.52–56 eV, and a HfN/Ge contact with an ∼1 nm-thick a-IL showed a weaker one with a Φ{sub BP} of 0.39 eV. However, TaN/Ge contact without a-IL did not show such FLP alleviation. Based on the results of depth distributions for respective elements, we discussed the formation kinetics of a-ILs at TiN/Ge and ZrN/Ge interfaces. Finally, we proposed an interfacial dipole model to explain the FLP alleviation.

  2. Silicon Strengthened CrAlVN Coatings

    Qiang LI; Yue-xiu QIU; Bo LI; Dong-liang ZHAO; De-en SUN; De-hui LI


    CrAlVN coatings are of good intrinsic mechanical and tribological properties but lack of strength.Silicon can provide nitride coating high strength and excellent oxidation resistance.Logically,the combination of CrAlVN and Si should provide a good candidate for dry machining.The effect of silicon content on CrAlSiVN coating′s me-chanical,tribological properties and oxidation resistance was investigated.The coatings were deposited on cemented tungsten carbide and Si wafer (100)substrates in an in-line magnetron sputtering system.Grazing incidence X-ray diffractometer,scanning electron microscopy,atomic force microscopy,transmission electron microscopy,electron probe micro-analyzer,X-ray photoelectron spectroscopy and Auger electron spectroscopy were employed to charac-terize the microstructure and chemistry.Nanoindentation and ball-on-disc tribo-tester were used in characterization of the mechanical and tribological properties.Incorporating with silicon,the CrAlVN coating was strengthened (hard-ness:21.2 GPa up to 38.7 GPa);even after 2 h exposure to 700 ℃ in air,the hardness still maintains at 11.0 GPa.

  3. Anticooperativity of FHF hydrogen bonds in clusters of the type F- × (HF)n, RF × (HF)n and XF × (HF)n, R = alkyl and X = H, Br, Cl, F

    Kucherov, S. Yu.; Bureiko, S. F.; Denisov, G. S.


    Properties of twenty five hydrogen-bonded complexes, namely, F- × (HF)n (n = 1-6), RF × (HF)n (R = t-Bu, i-Pr, Et, Me; n = 1-3), XF × (HF)n (X = H, Br, Cl; n = 1-2), and FF…HF with the hydrogen bond energy varying in a wide range have been calculated using ab initio methods at the MP2/6-31++G** level. For the first time, the energies, geometrical parameters and vibrational frequencies are obtained for the series of clusters, where the bonding character changes from covalent to van der Waals on the variation of proton-acceptor ability of the base, and the energies are in the range of 45-1 kcal/mol. The mutual influence of multiple hydrogen bonds of F…HF type in clusters, in which a fluorine anion or an atom participates in hydrogen bond formation as the acceptor, is systematically investigated. The relative changes in the values of the considered parameters on the sequential addition of an HF molecule (anticooperativity) were determined. It was shown that non-additivity of the interaction is most strongly pronounced in the energy and vibrational frequency values, geometrical parameters of hydrogen bonds are less sensitive to the mutual influence. The anticooperative effect is more pronounced on the hydrogen bridge length R(F...F) than on the geometry of proton donor r(HF). The hydrogen bond formation and the increase of the number n of ligands lead to successive lengthening of the r(XF) bond adjacent to the hydrogen bridge. The length of an XF bond changes stronger on formation of each hydrogen bond than the HF bond length.

  4. Reactive DC magnetron sputtered zirconium nitride (ZrN) thin film and its characterization

    Subramanian, B.; Ashok, K.; Sanjeeviraja, C.; Kuppusami, P.; Jayachandran, M.


    Zirconium nitride (ZrN) thin films were prepared by using reactive direct current (DC) magnetron sputtering onto different substrates. A good polycrystalline nature with face centered cubic structure was observed from X-ray Diffraction for ZrN thin films. The observed 'd' values from the X-ray Diffraction pattern were found to be in good agreement with the standard 'd' values (JCPDS-89-5269). An emission peak is observed at 587nm from Photoluminescence studies for the excitation at 430nm. The resistivity value (ρ) of 2.1798 (μΩ cm) was observed. ZrN has high wear resistance and low coefficient of friction. A less negative value of Ecorr and lower value of Icorr observed for ZrN / Mild Steel (MS) clearly confirm the better corrosion resistance than the bare substrate. Also the higher Rct value and lower Cdl value was observed for ZrN / MS from Nyquist - plot.

  5. Microstructural evolution and grain morphology of ZrN pellets

    Park, Sungho; Han, Ilsu; Lee, Hyunjun; Huh, Sunchul; Park, Wonjo


    Improvements in the mechanical integrity of zirconium nitride (ZrN) inert matrixes in advanced nuclear fuels were addressed in this work. This was done by first better understanding and then controlling texture and microstructural evolution of the former. Several samples were examined via orientation imaging microscopy: several monolithic specimens were hot isostatically pressed (HIP), and two sintered specimens with 80 % and 85 % density Grain size and crystallographic orientation studies revealed sample microstructure and their evolution during sintering. A correlation between larger grains and orientations near to parallel to the compression axis during cold pressing was present for the 85 % density sample.

  6. E-commerce of

    Nguyen, Bao


    The main objective of the thesis is providing a guide on doing e-commerce business in Vietnam. By showing the example of, this thesis will present the development process of this company. Therefore, when a new entrepreneur wants to join the e-commerce market, he will know what to do and how to be successful in Vietnam. In order to distinguish the difference between e-commerce in Vietnam and Amazon, this thesis contains statistical information about internet in Vietnam as well a...

  7. Displacive radiation-induced structural contraction in nanocrystalline ZrN

    Lu Fengyuan; Sun Hongtao; Lian Jie [Department of Mechanical, Aerospace and Nuclear Engineering, Rensselaer Polytech Institute, Troy, New York 12180 (United States); Huang, Mengbing; Yaqoob, Faisal [Ion Beam Laboratory, University at Albany-SUNY, Albany, New York 12222 (United States); Lang, Maik; Ewing, Rodney C. [Departments of Earth and Environmental Sciences and Materials Sciences and Engineering, University of Michigan, Ann Arbor, Michigan 48109-1005 (United States); Namavar, Fereydoon [Department of Orthopaedic Surgery and Rehabilitation, University of Nebraska Medical Center, Omaha, Nebraska 68198 (United States); Trautmann, Christina [GSI Helmholtz Center for Heavy Ion Research, 64291 Darmstadt (Germany); Technische Universitaet Darmstadt, 64289 Darmstadt (Germany)


    Nanocrystalline ZrN thin films with 5 nm grain size, prepared by ion beam assisted deposition, maintained their isometric structure upon intensive displacive and ionizing irradiations, indicating an extremely high stability similar to bulk ZrN. However, a unique structural contraction up to 1.42% in lattice parameter occurred only in nano-sized ZrN upon displacive irradiations. A significant nitrogen loss occurred with reduced N:Zr atomic ratio to 0.88, probably due to the production of displaced nitrogen atoms and fast diffusion along grain boundaries in nanocrystalline ZrN matrix. The accumulation of nitrogen vacancies and related strain relaxation may be responsible for the structural contraction.

  8. Mechanical and electrochemical characterization of vanadium nitride (VN) thin films

    Caicedo, J.C., E-mail: [Grupo de Peliculas Delgadas, Departamento de Fisica, Universidad del Valle, Cali (Colombia); Zambrano, G. [Grupo de Peliculas Delgadas, Departamento de Fisica, Universidad del Valle, Cali (Colombia); Aperador, W. [Ingenieria Mecatronica, Universidad Militar Nueva Granada, Bogota (Colombia); Escobar-Alarcon, L.; Camps, E. [Departamento de Fisica, Instituto Nacional de Investigaciones Nucleares, Apdo. Postal 18-1027, Mexico, DF 11801 (Mexico)


    Vanadium nitride (V-N) thin films were grown using a reactive d.c. magnetron sputtering process, from a vanadium target (99.999%) in an Ar/N{sub 2} gas mixture at different deposition bias voltage. Films were deposited onto silicon (1 0 0) and RUS-3 steel substrates at 400 deg. C. Structural, compositional, mechanical and electrochemical characterizations were performed by X-ray diffraction (XRD), elastic forward analysis (EFA), nanoindentation, electrochemical impedance spectroscopy (EIS), and Tafel polarization curves, respectively. X-ray diffraction patterns show the presence of (1 1 1) and (2 0 0) crystallographic orientations associated to the V-N cubic phase. Nanoindentation measurements revealed that when the bias voltage increases from 0 V to -150 V the hardness and elastic modulus are increased from 11 GPa to 20 GPa and from 187 GPa to 221 GPa, respectively. EIS and Tafel curves showed that the corrosion rate of steel, coated with V-N single layer films deposited without bias voltage, diminishes 90% compared to the steel without this coating. On the other hand, when the V-N coating was deposited at the highest d.c. bias voltage (-150 V), the corrosion rate was greater than in the steel coated with zero-voltage (0 V) V-N films. This last result could be attributed to the formation of porosities produced by the ion bombardment during the deposition process.

  9. Effect of thickness on structural, corrosion and mechanical properties of a thin ZrN film deposited by medium frequency (MF) reactive sputtering

    Kavitha, Ayyalu; Kannan, Raman [Anna Univ., Dindigul (India). Dept. of Physics; Loganathan, Subramani [Titan Industries, Hosur, Tamilnadu (India). Ion Plating Dept.


    Zirconium nitride (ZrN) thin films were prepared on stainless steel (SS) substrates by medium frequency (MF) reactive sputtering with gas ion source (GIS) by varying the deposition time and obtained thickness (t{sub ZrN}) in the range of 1.25 to 3.24 μm. The effect of thickness on the structural and microstructural properties was studied using XRD and AFM. XRD characterization revealed that the texture of the ZrN thin films changes as a function of thickness. Both, the (111) and (200) peak, appear initially and (111) becomes more intense with increasing t{sub ZrN}. AFM imaging revealed that the ZrN thin film coated with t{sub ZrN} ∼ 3.24 μm shows larger grains that are uniformly distributed over the surface. An average hardness value of 19.79 GPa was observed for ZrN thin films having t{sub ZrN} ∼ 3.24 μm. The ZrN thin films having t{sub ZrN} ∼ 3.24 μm exhibits better adhesion strength up to 20 N. The electrochemical polarization studies indicated that the ZrN thin film having larger thickness shows improved corrosion resistance compared to SS in 3.5 % NaCl solution.

  10. Influence of aluminium incorporation on the structure of ZrN films deposited at low temperatures

    Araiza, J J [Unidad Academica de Fisica, Universidad Autonoma de Zacatecas, Paseo a la Bufa esq, Calzada Solidaridad s/n 98060, Zacatecas (Mexico); Sanchez, O [Departamento de Fisica e Ingenieria de Superficies, Instituto de Ciencia de Materiales de Madrid-CSIC, C/ Sor Juana Ines de la Cruz 3, 28049 Cantoblanco, Madrid (Spain)], E-mail:


    We have studied the influence of Al incorporation in the crystalline structure of ZrN thin films deposited by dc magnetron sputtering at low temperature. The amount of aluminium in the films depends directly on the power applied to the aluminium cathode during the deposition. Energy dispersive x-ray analysis and x-ray diffraction (XRD) were used to obtain the chemical composition and crystalline structure of the films, respectively. When Al atoms are incorporated into the ZrN coatings, the strong ZrN (2 0 0) orientation is modified by a combination of other ones such as ZrN (1 1 1), Zr{sub 3}N{sub 4} (2 1 1) and hexagonal AlN (1 0 0) as detected from the XRD spectra for high aluminium concentrations. Fourier-transform infrared spectroscopy allowed us to identify oxides and nitrides, ZrO, AlO and AlN, incorporated into the deposited films. The effect of a bias voltage applied to the substrate has also been investigated and related to the changes in the microstructure and in the nanohardness values of the ZrAlN films.

  11. Corrosion behaviour of TiN and ZrN in the environment containing fluoride ions.

    Joska, Ludek; Fojt, Jaroslav; Hradilova, Monika; Hnilica, Frantisek; Cvrcek, Ladislav


    Nowadays, a wide range of materials for human implants is used. To reach the required properties of implants, coatings are applied in some cases. This contribution is focused on the corrosion properties of TiN and ZrN layers on cp-titanium (commercially pure titanium) under environment modelling conditions in an oral cavity. Measurements were done in artificial saliva and a physiological solution unbuffered and buffered to a pH value of 4.2 with the addition of fluoride ions up to 4000 ppm. Standard corrosion electrochemical techniques were applied. Both types of layers were stable in both model saliva and physiological solution with non-adjusted pH. The decrease in pH to 4.2 resulted in a minor decrease of corrosion resistance in all cases, but polarization resistance was still in the order of 10(5) Ω cm². An important change in a specimens' behaviour was noticed in the presence of fluoride ions. TiN was stable in the highest concentration of fluorides used. The ZrN layers were destabilized in an environment containing a few hundred ppm of fluoride ions. As for TiN, the decisive factor is the influence of porosity; the corrosion resistance of ZrN is limited. From the corrosion point of view, the application of the TiN-based barrier layers in dental implantology is more advisable than the use of ZrN, provided that the application of a barrier is inevitable.

  12. Hot deformation behavior of medium carbon V-N microalloyed steel

    XU Lei; WANG Cheng-yang; LIU Guo-quan; BAI Bing-zhe


    Processing maps for a medium carbon V-N microalloyed steel(designated as VN steel) and a medium carbon V-N bared steel(designated as Non-VN steel) were developed to study the hot deformation behavior and the influence of vanadium and nitrogen,in the temperature range of 750-1 100 ℃ and strain rate range of 0.005-30 s~(-1).Experimental results show that the processing map for the VN steel exhibits two dynamic recrystallization and three instability domains,while that for the Non-VN steel has one dynamic recrystallization and three instability domains.The instability domains of VN steel are larger than those of the Non-VN steel,and the VN steel is easier to be unstable when being hot deformed at high temperature and high stain rate.The addition and precipitation of vanadium and nitrogen can hinder the dynamic recrystallization.Compared with the Non-VN steel,the VN steel has higher dynamic recrystallization critical strain and the corresponding stress.

  13. Effect of VN precipitates on formation of grain boundary and intragranular ferrite in a high N-V bearing steel; V-N tenkako no ryukai oyobi ryunai ferrite hentai ni oyobosu austenite chu no VN sekishutsu no eikyo

    Omori, A.; Oi, K.; Kawabata, F.; Amano, K. [Kawasaki Steel Corp., Tokyo (Japan)


    The enhancement of ferrite nucleation owing to vanadium nitride (VN) precipitated in the austenite phase was studied for a 0.14%C- 1.45%Mn-0.06%V-0.009%N steel and the isothermal ferrite transformation behavior associated with VN precipitation was also quantitatively discussed. Vanadium nitrides precipitate on the austenite grain boundary in preference to the grain interior and increase the density of grain boundary ferrites. On the other hand, VN precipitates in austenite grain interior are less effective to intragranular ferrite nucleation. The calculation based on the classical nucleation theory shows that the activation energy of VN precipitates for a critical ferrite nucleus formation is one-fifth lower than that in case of no precipitate. The ferrite nucleation potency of VN precipitates is kept high even in higher temperature range above 700degreeC. (author)

  14. Contact characterizations of ZrN thin films obtained by reactive sputtering

    Pelleg, J. [Department of Materials Engineering, Ben Gurion University of the Negev, 84105 Beer Sheva (Israel)]. E-mail:; Bibi, A. [Department of Materials Engineering, Ben Gurion University of the Negev, 84105 Beer Sheva (Israel); Sinder, M. [Department of Materials Engineering, Ben Gurion University of the Negev, 84105 Beer Sheva (Israel)


    The contact properties of ZrN {sub x} on p-type Si obtained by magnetron reactive sputtering were investigated. Schottky diode characteristics were observed as determined by forward current-voltage (I-V) and capacitance-voltage (C-V) measurements. The zero-bias barrier heights evaluated by I-V were in the range of 0.55-0.63 V, which is higher than the value of 0.53 V of as-deposited amorphous TiN.

  15. Tribology of zrn, crn and tialn thin films deposited by reactive magnetron sputtering

    Alexander Ruden; Juam M González; RESTREPO, JOHANS S.; Michell F Cano; Federico Sequeda


    El coeficiente de fricción y el coeficiente de desgaste, representan dos variables importantes para la elección de recubrimientos duros en aplicaciones críticas de ingeniería tales como corte y conformado de materiales. Para explicar de manera profunda estas variables, es necesario conocer los diferentes tipos de desgaste que ocurren en estas superficies recubiertas. Se han evaluado recubrimientos de nitruro de circonio (ZrN), nitruro de cromo (CrN) y nitruro de titanio aluminio (TiAlN), prod...

  16. Effects of HfB2 and HfN Additions on the Microstructures and Mechanical Properties of TiB2-Based Ceramic Tool Materials

    Jing An


    Full Text Available The effects of HfB2 and HfN additions on the microstructures and mechanical properties of TiB2-based ceramic tool materials were investigated. The results showed that the HfB2 additive not only can inhibit the TiB2 grain growth but can also change the morphology of some TiB2 grains from bigger polygons to smaller polygons or longer ovals that are advantageous for forming a relatively fine microstructure, and that the HfN additive had a tendency toward agglomeration. The improvement of flexural strength and Vickers hardness of the TiB2-HfB2 ceramics was due to the relatively fine microstructure; the decrease of fracture toughness was ascribed to the formation of a weaker grain boundary strength due to the brittle rim phase and the poor wettability between HfB2 and Ni. The decrease of the flexural strength and Vickers hardness of the TiB2-HfN ceramics was due to the increase of defects such as TiB2 coarse grains and HfN agglomeration; the enhancement of fracture toughness was mainly attributed to the decrease of the pore number and the increase of the rim phase and TiB2 coarse grains. The toughening mechanisms of TiB2-HfB2 ceramics mainly included crack bridging and transgranular fracture, while the toughening mechanisms of TiB2-HfN ceramics mainly included crack deflection, crack bridging, transgranular fracture, and the core-rim structure.

  17. Post Irradiation TEM Investigation of ZrN Coated U(Mo) Particles Prepared with FIB

    Van Renterghem, W.; Leenaers, A.; Van den Berghe, S.; Miller, B. D.; Gan, J.; Madden, J. W.; Keiser, D. D.; Palancher, H.; Hofman, G. L.; Breitkreuz, H.


    In the framework of the Selenium project, two dispersion fuel plates were fabricated with Si and ZrN coated fuel particles and irradiated in the Br2 reactor of SCK•CEN to high burn-up. The first analysis of the irradiated plate proved the reduced swelling of the fuel plate and interaction layer growth up to 70% burn-up. The question was raised how the structure of the interaction layer had been affected by the irradiation and how the structure of the fuel particles had evolved. Hereto, samples from the ZrN coated UMo particles were prepared for transmission electron microscopy (TEM) using focused ion beam milling (FIB) at INL. The FIB technique allowed to precisely select the area of the interaction layer and/or fuel to produce a sample that is TEM transparent over an area of 20 by 20 µm. In this contribution, the first TEM results will be presented from the 66% burn-up sample.

  18. Optical Properties of Ar Ions Irradiated Nanocrystalline ZrC and ZrN Thin Films

    Martin, C.; Miller, K. H.; Makino, H.; Craciun, D.; Simeone, D.; Craciun, V.


    Thin nanocrystalline ZrC and ZrN films (less than 400 nanometers), grown on (100) Si substrates at a substrate temperature of 500 degrees Centigrade by the pulsed laser deposition (PLD) technique, were irradiated by 800 kiloelectronvolts Ar ion irradiation with fluences from 1 times 10(sup 14) atoms per square centimeter up to 2 times 10(sup 15) atoms per square centimeter. Optical reflectance data, acquired from as-deposited and irradiated films, in the range of 500-50000 per centimeter (0.06–6 electronvolts), was used to assess the effect of irradiation on the optical and electronic properties. Both in ZrC and ZrN films we observed that irradiation affects the optical properties of the films mostly at low frequencies, which is dominated by the free carriers response. In both materials, we found a significant reduction in the free carriers scattering rate, i.e. possible increase in mobility, at higher irradiation flux. This is consistent with our previous findings that irradiation affects the crystallite size and the micro-strain, but it does not induce major structural changes.

  19. Influence of substrate bias on the structure and properties of ZrN films deposited by cathodic vacuum arc

    Niu, E.W. [Beijing National Laboratory for Condensed Matter, Institute of Physics, Chinese Academy of Science, 100080 Beijing (China)], E-mail:; Li, L. [Beijing National Laboratory for Condensed Matter, Institute of Physics, Chinese Academy of Science, 100080 Beijing (China); Lv, G.H. [Beijing National Laboratory for Condensed Matter, Institute of Physics, Chinese Academy of Science, 100080 Beijing (China); Chen, H. [Beijing National Laboratory for Condensed Matter, Institute of Physics, Chinese Academy of Science, 100080 Beijing (China); Feng, W.R. [Beijing National Laboratory for Condensed Matter, Institute of Physics, Chinese Academy of Science, 100080 Beijing (China); Fan, S.H. [Beijing National Laboratory for Condensed Matter, Institute of Physics, Chinese Academy of Science, 100080 Beijing (China); Yang, S.Z. [Beijing National Laboratory for Condensed Matter, Institute of Physics, Chinese Academy of Science, 100080 Beijing (China); Yang, X.Z. [Beijing National Laboratory for Condensed Matter, Institute of Physics, Chinese Academy of Science, 100080 Beijing (China)


    ZrN films were deposited by cathodic vacuum arc (CVA) technique in N{sub 2} atmosphere at low temperature with different substrate bias. The ZrN films deposited are atomically smooth. The influence of substrate bias at the wide range (0 to -500 V) on the deposition rate, surface morphology, crystal structure, internal stress, and mechanical properties of the ZrN films were systematically investigated. Increasing substrate bias results in the decrease of deposition rate and the increase of surface roughness. It was found that there is a strong correlation between the substrate bias, film structure and properties. At the bias of 0 V, ZrN films characterize with random orientation, low surface roughness, small grain size. With the increase of bias, the structure changes from random orientation to (1 1 1) preferred orientation and then to (2 2 0) orientation. As substrate bias increases to about -150 V, the internal stress, hardness and Young's modulus increase to maximum. A further increase of bias results in the gradual decrease to lower level.

  20. Precipitation Behavior of V-N Microalloyed Steels during Normalizing

    Tao PAN; Xi-yang CHAI; Jin-guang WANG; Hang SU; Cai-fu YANG


    The precipitation behavior of V-N microalloyed steel during normalizing process was studied by physicochemical phase analysis and transmission electron microscopy (TEM). The effect of precipitation behavior on mechanical properties was inves-tigated by theoretical calculations. The results showed that 32.9% of V(C,N) precipitates remained undissolved in the austenite during the soaking step of the normalizing process. These precipitates prevented the growth of the austenite grains. During the subsequent cooling process, the dissolved V(C,N) re-precipitated and played a role in precipitation strengthening. The undissolved V(C,N) induced intragranular ferrite nucleation and reifned the ferrite grains. Consequently, compared with hot-rolled steel, the normalized steel exhibited increased grain-reifning strengthening but diminished precipitation strengthening, leading to an im-provement of the impact energy at the expense of about 40 MPa yield strength.

  1. Deposition and characterization of zirconium nitride (ZrN) thin films by reactive magnetron sputtering with linear gas ion source and bias voltage

    Kavitha, A.; Kannan, R. [Department of Physics, University College of Engineering, Anna University, Dindugal-624622 (India); Subramanian, N. Sankara [Department of Physics, Thiagarajar College of Engineering, Madurai -625015, Tamilnadu (India); Loganathan, S. [Ion Plating, Titan Industries Ltd., Hosur - 635126, Tamilnadu (India)


    Zirconium nitride thin films have been prepared on stainless steel substrate (304L grade) by reactive cylindrical magnetron sputtering method with Gas Ion Source (GIS) and bias voltage using optimized coating parameters. The structure and surface morphologies of the ZrN films were characterized using X-ray diffraction, atomic microscopy and scanning electron microscopy. The adhesion property of ZrN thin film has been increased due to the GIS. The coating exhibits better adhesion strength up to 10 N whereas the ZrN thin film with bias voltage exhibits adhesion up to 500 mN.

  2. Tribology of ZRN, CRN and TIALN thin films deposited by reactive magnetron sputtering

    Alexander Ruden


    Full Text Available El coeficiente de fricción y el coeficiente de desgaste, representan dos variables importantes para la elección de recubrimientos duros en aplicaciones críticas de ingeniería tales como corte y conformado de materiales. Para explicar de manera profunda estas variables, es necesario conocer los diferentes tipos de desgaste que ocurren en estas superficies recubiertas. Se han evaluado recubrimientos de nitruro de circonio (ZrN, nitruro de cromo (CrN y nitruro de titanio aluminio (TiAlN, producidos por la técnica magnetrón sputtering reactivo, determinando las propiedades tribológicas, midiendo coeficientes de fricción (COF y desgaste, y mostrando un análisis de los mecanismos de desgaste presentes para cada recubrimiento durante el contacto tribológico en sistemas cerámicos. Se observó que el voltaje de polarización incrementa las fallas por deformación plástica y la generación de un tercer cuerpo en la superficie del ZrN. El aumento del flujo de nitrógeno en la deposición de CrN, mejora el comportamiento tribológico al segregar la fase cúbica del material, optimizando sus propiedades superficiales. Al incrementar la temperatura de deposición del TiAlN se mejora su calidad superficial (reducción de rugosidad y densidad de poros, reduciendo la abrasión y aumentando la capacidad de carga del compuesto.

  3. Research, Development, and Production of V-N Microalloyed High Strength Rebars for Building in China

    YANG Cai-fu; WANG Quan-li


    The research, production, and application of V-N microalloyed high strength rebars in China were reviewed. Enhanced nitrogen in vanadium-containing rebars promotes the precipitation of fine V(C, N) particles, and markedly improves the precipitation strengthening effectiveness of vanadium. Therefore, vanadium added to V-N microalloyed rebars can be reduced by 40% compared to the same strength level of vanadium-containing rebars.

  4. ZrN coatings deposited by high power impulse magnetron sputtering and cathodic arc techniques

    Purandare, Yashodhan, E-mail:; Ehiasarian, Arutiun; Hovsepian, Papken [Nanotechnology Centre for PVD Research, Materials and Engineering Research Institute, Sheffield Hallam University, Sheffield S1 1WB (United Kingdom); Santana, Antonio [Ionbond AG Olten, Industriestrasse 211, CH-4600 Olten (Switzerland)


    Zirconium nitride (ZrN) coatings were deposited on 1 μm finish high speed steel and 316L stainless steel test coupons. Cathodic Arc (CA) and High Power Impulse Magnetron Sputtering (HIPIMS) + Unbalanced Magnetron Sputtering (UBM) techniques were utilized to deposit coatings. CA plasmas are known to be rich in metal and gas ions of the depositing species as well as macroparticles (droplets) emitted from the arc sports. Combining HIPIMS technique with UBM in the same deposition process facilitated increased ion bombardment on the depositing species during coating growth maintaining high deposition rate. Prior to coating deposition, substrates were pretreated with Zr{sup +} rich plasma, for both arc deposited and HIPIMS deposited coatings, which led to a very high scratch adhesion value (L{sub C2}) of 100 N. Characterization results revealed the overall thickness of the coatings in the range of 2.5 μm with hardness in the range of 30–40 GPa depending on the deposition technique. Cross-sectional transmission electron microscopy and tribological experiments such as dry sliding wear tests and corrosion studies have been utilized to study the effects of ion bombardment on the structure and properties of these coatings. In all the cases, HIPIMS assisted UBM deposited coating fared equal or better than the arc deposited coatings, the reasons being discussed in this paper. Thus H+U coatings provide a good alternative to arc deposited where smooth, dense coatings are required and macrodroplets cannot be tolerated.

  5. Effect of deposition temperature on microstructure and corrosion resistance of ZrN thin films deposited by DC reactive magnetron sputtering

    Roman, Daiane; Bernardi, Juliane; Amorim, Cintia L.G. de [Centro de Ciencias Exatas e Tecnologia, Universidade de Caxias do Sul, Caxias do Sul, RS 95070-560 (Brazil); Souza, Fernando S. de; Spinelli, Almir [Departamento de Quimica, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Giacomelli, Cristiano [Departamento de Quimica, Universidade Federal de Santa Maria, Santa Maria, RS 97105-900 (Brazil); Figueroa, Carlos A. [Centro de Ciencias Exatas e Tecnologia, Universidade de Caxias do Sul, Caxias do Sul, RS 95070-560 (Brazil); Baumvol, Israel J.R. [Centro de Ciencias Exatas e Tecnologia, Universidade de Caxias do Sul, Caxias do Sul, RS 95070-560 (Brazil); Instituto de Fisica, Universidade Federal do Rio Grande do Sul, Porto Alegre, RS 91509-970 (Brazil); Basso, Rodrigo L.O., E-mail: [Centro de Ciencias Exatas e Tecnologia, Universidade de Caxias do Sul, Caxias do Sul, RS 95070-560 (Brazil)


    Highlights: {center_dot} Deposition conditions determine the thickness and microstructure of the ZrN films. {center_dot} For ZrN films relatively thin, the microstructure shows no preferred orientation. {center_dot} For ZrN film relatively thick, preferred orientation is in the (1 1 1) direction. {center_dot} Composition and microstructure controls the corrosion resistance of the ZrN films. {center_dot} The air exposure forms oxide and oxynitride layer promoting the corrosion resistance. - Abstract: Thin films of zirconium nitride were deposited on different substrates by direct current reactive magnetron sputtering, varying the deposition time, Ar/N{sub 2} partial pressure ratio and substrate temperature. The physicochemical, crystalline structure and corrosion resistance of the thin films were studied by glancing angle X-ray diffraction, Rutherford backscattering spectrometry, scanning electron microscopy, X-ray photoelectron spectroscopy and potentiodynamic polarization tests in artificial saliva solution. The results show that the thin films presents high texture in [1 1 1] direction verified by X-ray diffraction measurements which indicated the lack of a Bragg peak for (2 0 0) crystallographic planes for a lower deposition temperatures. The XPS analysis showed the presence of ZrN and also the oxide species (ZrN{sub x}O{sub y} and ZrO{sub 2}) at the surface, with chemical states changing with deposition temperatures. In addition, the thin ZrN films were found to be stable in an electrochemical cell over a large potential range and the pitting potential increases with increasing the deposition temperature. For deposition at 500 deg. C, the pitting potential was found to be E{sub p} = 1.5 V/SCE. The corrosion behavior is attributed to the formation of thin ZrN{sub x}O{sub y} and ZrO{sub 2} layer on the top surface of the films, with increasing of the deposition temperature.

  6. Investigation of the physical properties of ion assisted ZrN thin films deposited by RF magnetron sputtering

    Signore, M A; Valerini, D; Rizzo, A; Tapfer, L; Capodieci, L; Cappello, A [ENEA, Department of Physical Technologies and New Materials, SS7, Appia, km 706, 72100 Brindisi (Italy)


    Ion bombardment during thin film growth is known to cause structural and morphological changes in the deposited films, thus affecting their physical properties. In this work zirconium nitride films have been deposited by the ion assisted magnetron sputtering technique. The ion energy is controlled by varying the voltage applied to the substrate in the range 0-25 V. The deposited ZrN films are characterized for their structure, surface roughness, oxygen contamination, optical reflectance and electrical resistivity. With increasing substrate voltage crystallinity of the films is enhanced with a preferential orientation of the ZrN grains having the (1 1 1) axis perpendicular to the substrate surface. At the same time, a decrease in electrical resistivity and oxygen contamination content is observed up to 20 V. A higher substrate voltage (25 V) causes an inversion in the observed experimental trends. The role of oxygen contamination decrease and generation of nitrogen vacancies due to ionic assistance have been considered as a possible explanation for the experimental results.

  7. Plasmonic efficiencies of nanoparticles made of metal nitrides (TiN, ZrN) compared with gold

    Lalisse, Adrien; Tessier, Gilles; Plain, Jérome; Baffou, Guillaume


    Metal nitrides have been proposed to replace noble metals in plasmonics for some specific applications. In particular, while titanium nitride (TiN) and zirconium nitride (ZrN) possess localized plasmon resonances very similar to gold in magnitude and wavelength, they benefit from a much higher sustainability to temperature. For this reason, they are foreseen as ideal candidates for applications in nanoplasmonics that require high material temperature under operation, such as heat assisted magnetic recording (HAMR) or thermophotovoltaics. This article presents a detailed investigation of the plasmonic properties of TiN and ZrN nanoparticles in comparison with gold nanoparticles, as a function of the nanoparticle morphology. As a main result, metal nitrides are shown to be poor near-field enhancers compared to gold, no matter the nanoparticle morphology and wavelength. The best efficiencies of metal nitrides as compared to gold in term of near-field enhancement are obtained for small and spherical nanoparticles, and they do not exceed 60%. Nanoparticle enlargements or asymmetries are detrimental. These results mitigate the utility of metal nitrides for high-temperature applications such as HAMR, despite their high temperature sustainability. Nevertheless, at resonance, metal nitrides behave as efficient nanosources of heat and could be relevant for applications in thermoplasmonics, where heat generation is not detrimental but desired.

  8. Association study of human VN1R1 pheromone receptor gene alleles and gender.

    Mitropoulos, Constantinos; Papachatzopoulou, Adamantia; Menounos, Panagiotis G; Kolonelou, Christina; Pappa, Magda; Bertolis, George; Gerou, Spiros; Patrinos, George P


    Pheromones are water-soluble chemicals that elicit neuroendocrine and physiological changes, while they also provide information about gender within individuals of the same species. VN1R1 is the only functional pheromone receptor in humans. We have undertaken a large mutation screening approach in 425 adult individuals from the Hellenic population to investigate whether the allelic differences, namely alleles 1a and 1b present in the human VN1R1 gene, are gender specific. Here we show that both VN1R1 1a and 1b alleles are found in chromosomes of both male and female subjects at frequency of 26.35% and 73.65%, respectively. Given the fact that those allelic differences potentially cause minor changes in the protein conformation and its transmembrane domains, as simulated by the TMHMM software, our data suggest that the allelic differences in the human VN1R1 gene are unlikely to be associated with gender and hence to contribute to distinct gender-specific behavior.

  9. Electric and Adsorption Characteristics of Nanocrystalline V-(N, He Coatings

    Alexey G. Guglya


    Full Text Available This paper studies the structure, temperature dependences of electric resistance, and adsorption properties of nanoporous three-component V-(N, He coatings. The coatings were produced using the technique of ion beam assisted deposition, in particular, deposition of vanadium onto a titanium substrate simultaneously bombarding it with N2+He ions of 30 keV. It is shown, in contrast to V-N composites that have negative TCR (temperature coefficient of resistance, that the V-(N, He coatings have negative TCR only in the temperature range of 250 to 350∘C. A specific surface of pores and adsorption characteristics of V-(N, He composites depend on preliminary treatment of a titanium surface. A coating deposited onto an untreated substrate has specific surface of 25.5 m2/g. The preliminary irradiation of titanium with N2+He beam up to a dose of 6 × 1017 ion/cm2 provides the increase in surface area up to 57.6 m2/g. The preliminary ion bombardment provides a considerable increase in hydrogen adsorption capacity of coatings. Especially, such impact is noticeable at the room temperature, when the amount of hydrogen absorbed by a coating that was applied onto a treated surface is more than three times of that absorbed by a coating that was deposited onto nonexposed titanium.

  10. Tribological and wear behavior of HfN/VN nanomultilayer coated cutting tools

    Willian Aperador Chaparro


    Full Text Available Wear and tribological behavior of [HfN/VN]n multinanolayers deposited via magnetron sputtering has been exhaustively studied in this work. Enhancement of both hardness and elastic modulus up to 37 GPa and 351 GPa, respectively, was observed as bilayer periods in the coatings were decreased. The sample with a bilayer period (Λ of 15 nm and bilayer number n = 80, showed the lowest friction coefficient (∼0.15 and the highest critical load (72 N, corresponding to 2.2 and 1.38 times better than those values for the coating deposited with n = 1, respectively. Taking into account the latest results of tungsten carbide (WC inserts were used as substrates to improve the mechanical and tribological properties of [HfN/VN]n coatings as a function of increased interface number and to manage higher efficiency of these coatings in different industrial applications, like machining and extrusion. Their physical, mechanical, and tribological characteristics were investigated, including cutting tests with AISI 1020 steel (workpiece to assess wear as a function of the bilayer number and bilayer period. A comparison of the tribological properties revealed a decrease of flank wear (approximately 24% for WC inserts coated with [HfN/VN]80 (Λ =15 nm, when compared to uncoated tungsten carbide inserts. These results demonstrate the possibility of using [HfN/VN] multilayers as new coatings for tool machining with excellent industrial performance.

  11. Data of evolutionary structure change: 1AOHA-2VN5A [Confc[Archive

    Full Text Available ID> A 1AOHA DLVEQ-KTQFF ...> -EEEEE> ATOM 926 CA ASP A 131 7.897 26.261 30.967 1.00...entryIDChain> TMSKIASVTKT > EEEEE> 2VN5A SSSAS--NGTIS re>EEEEE--EEEEE...KMIV >EEEEE EEEE>

  12. VnD: a structure-centric database of disease-related SNPs and drugs.

    Yang, Jin Ok; Oh, Sangho; Ko, Gunhwan; Park, Seong-Jin; Kim, Woo-Yeon; Lee, Byungwook; Lee, Sanghyuk


    Numerous genetic variations have been found to be related to human diseases. Significant portion of those affect the drug response as well by changing the protein structure and function. Therefore, it is crucial to understand the trilateral relationship among genomic variations, diseases and drugs. We present the variations and drugs (VnD), a consolidated database containing information on diseases, related genes and genetic variations, protein structures and drug information. VnD was built in three steps. First, we integrated various resources systematically to deduce catalogs of disease-related genes, single nucleotide polymorphisms (SNPs), protein mutations and relevant drugs. VnD contains 137,195 disease-related gene records (13,940 distinct genes) and 16,586 genetic variation records (1790 distinct variations). Next, we carried out structure modeling and docking simulation for wild-type and mutant proteins to examine the structural and functional consequences of non-synonymous SNPs in the drug-related genes. Conformational changes in 590 wild-type and 4437 mutant proteins from drug-related genes were included in our database. Finally, we investigated the structural and biochemical properties relevant to drug binding such as the distribution of SNPs in proximal protein pockets, thermo-chemical stability, interactions with drugs and physico-chemical properties. The VnD database, available at or, would be a useful platform for researchers studying the underlying mechanism for association among genetic variations, diseases and drugs.

  13. Effects of Plasma ZrN Metallurgy and Shot Peening Duplex Treatment on Fretting Wear and Fretting Fatigue Behavior of Ti6Al4V Alloy

    Jingang Tang


    Full Text Available A metallurgical zirconium nitride (ZrN layer was fabricated using glow metallurgy using nitriding with zirconiuming prior treatment of the Ti6Al4V alloy. The microstructure, composition and microhardness of the corresponding layer were studied. The influence of this treatment on fretting wear (FW and fretting fatigue (FF behavior of the Ti6Al4V alloy was studied. The composite layer consisted of an 8-μm-thick ZrN compound layer and a 50-μm-thick nitrogen-rich Zr–Ti solid solution layer. The surface microhardness of the composite layer is 1775 HK0.1. A gradient in cross-sectional microhardness distribution exists in the layer. The plasma ZrN metallurgical layer improves the FW resistance of the Ti6Al4V alloy, but reduces the base FF resistance. This occurs because the improvement in surface hardness results in lowering of the toughness and increasing in the notch sensitivity. Compared with shot peening treatment, plasma ZrN metallurgy and shot peening composite treatment improves the FW resistance and enhances the FF resistance of the Ti6Al4V alloy. This is attributed to the introduction of a compressive stress field. The combination of toughness, strength, FW resistance and fatigue resistance enhance the FF resistance for titanium alloy.

  14. Effect of ZrN coating by magnetron sputtering and sol-gel processed silica coating on titanium/porcelain interface bond strength.

    Xia, Yang; Zhou, Shu; Zhang, Feimin; Gu, Ning


    In this study, a coating technique was applied to improve the bond strength of titanium (Ti) porcelain. ZrN coating was prepared by magnetron sputtering, and silica coating was processed by a sol-gel method. The treated surfaces of the specimens were analyzed by X-ray diffraction, and the Ti/porcelain interface was investigated by scanning electron microscopy (SEM) and energy dispersive spectroscopy. The coated specimens appeared fully coherent to the Ti substrate. The fractured bonding surface was also investigated by SEM. The residual porcelain on the metal surface could be observed in the ZrN group and silica group, but there was no obvious porcelain remaining in the control group. A three-point-bending test showed that the bonding strength of the ZrN group (45.99 ± 0.65 MPa) was higher than the silica group (37.77 ± 0.78 MPa) (P coatings resulted in a stronger Ti/porcelain bond. ZrN coating by magnetron sputtering was a more effective way to improve the bond strength between Ti and porcelain compared with sol-gel processed silica coating in this study.

  15. Effects of Plasma ZrN Metallurgy and Shot Peening Duplex Treatment on Fretting Wear and Fretting Fatigue Behavior of Ti6Al4V Alloy.

    Tang, Jingang; Liu, Daoxin; Zhang, Xiaohua; Du, Dongxing; Yu, Shouming


    A metallurgical zirconium nitride (ZrN) layer was fabricated using glow metallurgy using nitriding with zirconiuming prior treatment of the Ti6Al4V alloy. The microstructure, composition and microhardness of the corresponding layer were studied. The influence of this treatment on fretting wear (FW) and fretting fatigue (FF) behavior of the Ti6Al4V alloy was studied. The composite layer consisted of an 8-μm-thick ZrN compound layer and a 50-μm-thick nitrogen-rich Zr-Ti solid solution layer. The surface microhardness of the composite layer is 1775 HK0.1. A gradient in cross-sectional microhardness distribution exists in the layer. The plasma ZrN metallurgical layer improves the FW resistance of the Ti6Al4V alloy, but reduces the base FF resistance. This occurs because the improvement in surface hardness results in lowering of the toughness and increasing in the notch sensitivity. Compared with shot peening treatment, plasma ZrN metallurgy and shot peening composite treatment improves the FW resistance and enhances the FF resistance of the Ti6Al4V alloy. This is attributed to the introduction of a compressive stress field. The combination of toughness, strength, FW resistance and fatigue resistance enhance the FF resistance for titanium alloy.

  16. VN-Sim: A Way to Keep Core Concepts in a Crowded Computing Curriculum

    R. Raymond Lang


    Full Text Available Contemporary computer science curricula must accommodate a broad array of developments important to the field. Tough choices have to be made between introducing newer topics and retaining fundamentals that ground the discipline as a whole. All too frequently, understanding of low level coding and its relation to basic hardware is sacrificed to make room for newer material. VN-Sim, a von Neumann machine simulator, provides a mechanism for streamlined coverage of low level coding and hardware topics.

  17. Research Update: Reactively sputtered nanometer-thin ZrN film as a diffusion barrier between Al and boron layers for radiation detector applications

    Golshani, Negin; Mohammadi, V.; Schellevis, H.; Beenakker, C. I. M.; Ishihara, R.


    In this paper, optimization of the process flow for PureB detectors is investigated. Diffusion barrier layers between a boron layer and the aluminum interconnect can be used to enhance the performance and visual appearance of radiation detectors. Few nanometers-thin Zirconium Nitride (ZrN) layer deposited by reactive sputtering in a mixture of Ar/N2, is identified as a reliable diffusion barrier with better fabrication process compatibility than others. The barrier properties of this layer have been tested for different boron layers deposited at low and high temperatures with extensive optical microscopy analyses, electron beam induced current, SEM, and electrical measurements. This study demonstrated that spiking behavior of pure Al on Si can be prevented by the thin ZrN layer thus improving the performance of the radiation detectors fabricated using boron layer.

  18. Research Update: Reactively sputtered nanometer-thin ZrN film as a diffusion barrier between Al and boron layers for radiation detector applications

    Golshani, Negin, E-mail:; Mohammadi, V.; Schellevis, H.; Beenakker, C. I. M.; Ishihara, R. [ECTM, DIMES, Faculty of Electrical Engineering (EWI), Delft University of Technology (TU Delft), Feldmannweg 17, P.O. Box 5053, 2628 CT Delft (Netherlands)


    In this paper, optimization of the process flow for PureB detectors is investigated. Diffusion barrier layers between a boron layer and the aluminum interconnect can be used to enhance the performance and visual appearance of radiation detectors. Few nanometers-thin Zirconium Nitride (ZrN) layer deposited by reactive sputtering in a mixture of Ar/N{sub 2}, is identified as a reliable diffusion barrier with better fabrication process compatibility than others. The barrier properties of this layer have been tested for different boron layers deposited at low and high temperatures with extensive optical microscopy analyses, electron beam induced current, SEM, and electrical measurements. This study demonstrated that spiking behavior of pure Al on Si can be prevented by the thin ZrN layer thus improving the performance of the radiation detectors fabricated using boron layer.

  19. Research Update: Reactively sputtered nanometer-thin ZrN film as a diffusion barrier between Al and boron layers for radiation detector applications

    Negin Golshani


    Full Text Available In this paper, optimization of the process flow for PureB detectors is investigated. Diffusion barrier layers between a boron layer and the aluminum interconnect can be used to enhance the performance and visual appearance of radiation detectors. Few nanometers-thin Zirconium Nitride (ZrN layer deposited by reactive sputtering in a mixture of Ar/N2, is identified as a reliable diffusion barrier with better fabrication process compatibility than others. The barrier properties of this layer have been tested for different boron layers deposited at low and high temperatures with extensive optical microscopy analyses, electron beam induced current, SEM, and electrical measurements. This study demonstrated that spiking behavior of pure Al on Si can be prevented by the thin ZrN layer thus improving the performance of the radiation detectors fabricated using boron layer.

  20. Producción y caracterización de recubrimientos de multicapas de TiN / ZrN por PAPVD por arco pulsado


    En este trabajo se estudia el crecimiento y caracterización de las pel ículas delgadas de TiN y ZrN crecidas en forma de monocapas, bicapas y multicapas, utilizando la técnica de Deposición Física en Fase de Vapor asistida por Plasma (PAPVD) por arco pulsado. El crecimiento de los recubrimientos se realizó a diferente número de descargas. Por medio de la difracción de rayos X (XRD) se pudo identificar que tanto para el TiN como para el ZrN, el plano de mayor intensidad se da en la orientación...

  1. Effect of sintering conditions on the microstructure and mechanical properties of ZrN as a surrogate for actinide nitride fuels

    Wheeler, K.; Peralta, P.; Parra, M.; McClellan, K.; Dunwoody, J.; Egeland, G.


    Pellets of sintered ZrN were studied to optimize the mechanical properties and microstructures needed in nitride fuel pellets, using ZrN as a surrogate for actinide nitrides and as potential component in low fertile and inert matrix fuels. Samples were prepared via sintering in either Ar or N2 (with and without 6% H2) and at 1300 °C or 1600 °C. A significant difference in the hardness was measured ranging from 1000 (Kg/mm2) in samples sintered at 1600 °C in argon to 100 (Kg/mm2) in samples sintered at 1300 °C in nitrogen. Samples with 6% hydrogen added to the sintering environment experienced a decrease in hardness, as well as an increase in intergranular cracking as compared to samples sintered without hydrogen, suggesting hydrogen embrittlement. Grain size was more uniform in samples sintered in pure Ar as compared to Ar-H2, while the latter had a larger fraction of high angle grain boundaries than the former. Cracking around indents had a clear tendency to follow high angle boundaries, which were found to be intrinsically weak in ZrN.

  2. Potential of HfN, ZrN, and TiH as hot carrier absorber and Al2O3/Ge quantum well/Al2O3 and Al2O3/PbS quantum dots/Al2O3 as energy selective contacts

    Shrestha, Santosh; Chung, Simon; Liao, Yuanxun; Wang, Pei; Cao, Wenkai; Wen, Xiaoming; Gupta, Neeti; Conibeer, Gavin


    The hot carrier (HC) solar cell is one of the most promising advanced photovoltaic concepts. It aims to minimise two major losses in single junction solar cells due to sub-band gap loss and thermalisation of above band gap photons by using a small bandgap absorber, and, importantly, collecting the photo-generated carriers before they thermalise. In this paper we will present recent development of the two critical components of the HC solar cell, i.e., the absorber and energy selective contacts (ESCs). For absorber, fabrication and carrier cooling rates in potential bulk materials — hafnium nitride, zirconium nitride, and titanium hydride are presented. Results of ESCs employing double barrier resonant tunneling structures Al2O3/Ge quantum well (QW)/Al2O3 and Al2O3/PbS quantum dots (QDs)/Al2O3 are also presented. These results are expected to guide further development of practical HC solar cell devices.

  3. Flow Harmonics vn in pPb and PbPb Collisions

    Wang, Quan


    Previous CMS measurements have demonstrated the collective nature of multiparticle correlations in high-multiplicity pPb collisions at the LHC. This collectivity is consistent with a hydrodynamic flow origin. However, it can also be interpreted in terms of initial state effects arising from gluon saturation. The pseudorapidity dependence of the azimuthal Fourier coefficients (vn) is expected to be sensitive to the underlying mechanism with, in the hydrodynamic picture, the longer lifetime of the fireball on the Pb-going side expected to lead to a larger flow signal than found on the p-going side. To investigate the detailed properties of the observed collectivity, differential vn values in transverse momentum (pT) and pseudorapidity (η) are presented over the full range of the CMS tracker detector (- 2.4 < η < 2.4) for pPb collisions at a nucleon-nucleon center-of-mass energy of 5.02 TeV. Results based on multiparticle analyses involving four or more particles are shown. An event plane analysis is presented where the influence of recently demonstrated event-plane decorrelation is considered. Comparisons are made with peripheral PbPb collisions measured at similar mid-rapidity particle multiplicities. The results will be discussed in the context of current models of the longitudinal dependence of the multiparticle correlations.

  4. Differential flow harmonic vn in pPb and PbPb collisions

    CMS Collaboration


    Previous CMS measurements have demonstrated the collective nature of multiparticle correlations in high-multiplicity pPb collisions at the LHC. This collectivity is consistent with a hydrodynamic flow origin. However, it can also be interpreted in terms of initial state effects arising from gluon saturation. The pseudorapidity dependence of the azimuthal Fourier coefficients ($v_n$) is expected to be sensitive to the underlying mechanism with, in the hydrodynamic picture, the longer lifetime of the fireball on the Pb-going side expected to lead to a larger flow signal than found on the p-going side. To investigate the detailed properties of the observed collectivity, differential $v_n$ values in transverse momentum ($p_T$) and pseudorapidity ($\\eta$) are presented over the full range of the CMS tracker detector ($-2.4 < \\eta < 2.4$) for pPb collisions at a nucleon-nucleon center-of mass energy of 5.02 TeV. Results based on multiparticle analyses involving four or more particles are shown. An event plane...

  5. Flow Harmonics $v_{n}$ in pPb and PbPb Collisions



    Previous CMS measurements have demonstrated the collective nature of multiparticle correlations in high-multiplicity pPb collisions at the LHC. This collectivity is consistent with a hydrodynamic flow origin. However, it can also be interpreted in terms of initial state effects arising from gluon saturation. The pseudorapidity dependence of the azimuthal Fourier coefficients ($v_n$) is expected to be sensitive to the underlying mechanism with, in the hydrodynamic picture, the longer lifetime of the fireball on the Pb-going side expected to lead to a larger flow signal than found on the p-going side. To investigate the detailed properties of the observed collectivity, differential $v_n$ values in transverse momentum ($p_T$) and pseudorapidity ($\\eta$) are presented over the full range of the CMS tracker detector ($-2.4 < \\eta < 2.4$) for pPb collisions at a nucleon-nucleon center-of-mass energy of 5.02 TeV. Results based on multiparticle analyses involving four or more particles are shown. An event plane...

  6. Flow Harmonics $v_{n}$ in pPb and PbPb Collisions

    Wang, Quan


    Previous CMS measurements have demonstrated the collective nature of multiparticle correlations in high-multiplicity pPb collisions at the LHC. This collectivity is consistent with a hydrodynamic flow origin. However, it can also be interpreted in terms of initial state effects arising from gluon saturation. The pseudorapidity dependence of the azimuthal Fourier coefficients ($v_n$) is expected to be sensitive to the underlying mechanism with, in the hydrodynamic picture, the longer lifetime of the fireball on the Pb-going side expected to lead to a larger flow signal than found on the p-going side. To investigate the detailed properties of the observed collectivity, differential $v_n$ values in transverse momentum ($p_T$) and pseudorapidity ($\\eta$) are presented over the full range of the CMS tracker detector ($-2.4 < \\eta < 2.4$) for pPb collisions at a nucleon-nucleon center-of-mass energy of 5.02 TeV. Results based on multiparticle analyses involving four or more particles are shown. An event plane...

  7. Lattice dynamics and electron/phonon interactions in epitaxial transition-metal nitrides

    Mei, Antonio Rodolph Bighetti

    Transition metal (TM) nitrides, due to their unique combination of remarkable physical properties and simple NaCl structure, are presently utilized in a broad range of applications and as model systems in the investigation of complex phenomena. Group-IVB nitrides TiN, ZrN, and HfN have transport properties which include superconductivity and high electrical conductivity; consequentially, they have become technologically important as electrodes and contacts in the semiconducting and superconducting industries. The Group-VB nitride VN, which exhibits enhanced ductility, is a fundamental component in superhard and tough nanostructured hard coatings. In this thesis, I investigate the lattice dynamics responsible for controlling superconductivity and electrical conductivities in Group-IVB nitrides and elasticity and structural stability of the NaCl-structure Group-VB nitride VN. Our group has already synthesized high-quality epitaxial TiN, HfN, and CeN layers on MgO(001) substrates. By irradiating the growth surface with high ion fluxes at energies below the bulk lattice-atom displacement threshold, dense epitaxial single crystal TM nitride films with extremely smooth surfaces have been grown using ultra-high vacuum magnetically-unbalanced magnetron sputter deposition. Using this approach, I completed the Group-IVB nitride series by growing epitaxial ZrN/MgO(001) films and then grew Group-VB nitride VN films epitaxially on MgO(001), MgO(011), and MgO(111). The combination of high-resolution x-ray diffraction (XRD) reciprocal lattice maps (RLMs), high-resolution cross-sectional transmission electron microscopy (HR-XTEM), and selected-area electron diffraction (SAED) show that single-crystal stoichiometric ZrN films grown at 450 °C are epitaxially oriented cube-on-cube with respect to their MgO(001) substrates, (001) ZrN||(001)MgO and [100]ZrN||[100]MgO. The layers are essentially fully relaxed with a lattice parameter of 0.4575 nm. X-ray reflectivity results reveal that

  8. Surface modification of 316L stainless steel with magnetron sputtered TiN/VN nanoscale multilayers for bio implant applications.

    Subramanian, B; Ananthakumar, R; Kobayashi, Akira; Jayachandran, M


    Nanoscale multilayered TiN/VN coatings were developed by reactive dc magnetron sputtering on 316L stainless steel substrates. The coatings showed a polycrystalline cubic structure with (111) preferential growth. XPS analysis indicated the presence of peaks corresponding to Ti2p, V2p, N1s, O1s, and C1s. Raman spectra exhibited the characteristic peaks in the acoustic range of 160-320 cm(-1) and in the optic range between 480 and 695 cm(-1). Columnar structure of the coatings was observed from TEM analysis. The number of adherent platelets on the surface of the TiN/VN multilayer, VN, TiN single layer coating exhibit fewer aggregation and pseudopodium than on substrates. The wear resistance of the multilayer coatings increases obviously as a result of their high hardness. Tafel plots in simulated bodily fluid showed lower corrosion rate for the TiN/VN nanoscale multilayer coatings compared to single layer and bare 316L SS substrate.

  9. Evaluation of antibacterial activity and osteoblast-like cell viability of TiN, ZrN and (Ti1-xZrx)N coating on titanium.

    Ji, Min-Kyung; Park, Sang-Won; Lee, Kwangmin; Kang, In-Chol; Yun, Kwi-Dug; Kim, Hyun-Seung; Lim, Hyun-Pil


    The aim of this study was to evaluate antibacterial activity and osteoblast-like cell viability according to the ratio of titanium nitride and zirconium nitride coating on commercially pure titanium using an arc ion plating system. Polished titanium surfaces were used as controls. Surface topography was observed by scanning electron microscopy, and surface roughness was measured using a two-dimensional contact stylus profilometer. Antibacterial activity was evaluated against Streptococcus mutans and Porphyromonas gingivalis with the colony-forming unit assay. Cell compatibility, mRNA expression, and morphology related to human osteoblast-like cells (MG-63) on the coated specimens were determined by the XTT assay and reverse transcriptase-polymerase chain reaction. The number of S. mutans colonies on the TiN, ZrN and (Ti1-xZrx)N coated surface decreased significantly compared to those on the non-coated titanium surface (PTiN, ZrN and (Ti1-xZrx)N coated titanium showed antibacterial activity against S. mutans related to initial biofilm formation but not P. gingivalis associated with advanced periimplantitis, and did not influence osteoblast-like cell viability.

  10. Using a spherical crystallite model with vacancies to relate local atomic structure to irradiation defects in ZrC and ZrN

    Olive, Daniel T.; Ganegoda, Hasitha; Allen, Todd; Yang, Yong; Dickerson, Clayton; Terry, Jeff


    Zirconium carbide and zirconium nitride are candidate materials for new fuel applications due to several favorable physicochemical properties. ZrC and ZrN samples were irradiated at the Advanced Test Reactor National Scientific User Facility with neutrons at 800 °C to a dose of 1 dpa. Structural examinations have been made of the ZrC samples using high resolution transmission electron microscopy, and the findings compared with a previous study of ZrC irradiated with protons at 800 °C. The use of X-ray absorption fine structure spectroscopy (XAFS) to characterize the radiation damage was also explored including a model based on spherical crystallites that can be used to relate EXAFS measurements to microscopy observations. A loss of coordination at more distant coordination shells was observed for both ZrC and ZrN, and a model using small spherical crystallites suggested this technique can be used to study dislocation densities in future studies of irradiated materials.

  11. Anti-tumor effects of VnA in in vitro cultured Colon26-L5 cells and in vivo Colon26-L5 cells planted mice

    LV Li; UENO Yu-ko; HAN Guo-zhu; ZHAO Wei-jie; LIU Ke-xin; SAKURAI Hiroaki; SAIKI Ikuo


    Objective To investigate the antitumor effects of VnA, the total alkaloids isolated from Veratrum Nigrum L. var. ussuriense Nakai ("Wusuli Lilu" in Chinese), and the underlying mechanisms with emphasis on its anti-metastatic effects. Methods The effects of VnA on in vitro proliferation, invasion, migration and adhesion in Colon26-L5 cells were investigated. The effect of VnA on experimental lung metastasis of Colon26-L5 cells in mice was also be studied by means of measuring the numbers of tumor colonies in lungs after single i. v. administration of Colon26-L5 ceils to mice followed by q. d. i. p VnA for consecutive 14 days. The effect of VnA on the production of matrix metalloproteinases (MMPs) from Colon26-L5 cell in vitro was determined by means of gelatin zymography. Results In in vitro experiments, VnA was found to significantly reduce the number of tumor colonies at dosage of 20.0-40.0 μg·kg-1. In in vitro experiments, VnA inhibited the adhesion (at 1.6-12.5 μg·mL-1) and migration (at 3.1-50.0 μg·mL-1) of Colon26-L5 cell to extracellular matrix components and suppressed invasion into reconstituted basement membrane matrigel (at 3.1-50.0 μg·mL-1), meanwile cell proliferation (at 25.0-50.0 μg·mL-1) was attenuated. VnA also showed a concentration-dependent inhibition of MMP2 and MMP9 production (at 3.1-50.0 μg·mL-1). Conclusions VnA has anti-metastatic protential by decreasing invasiveness of cancer cells as one of its anti-tumor pharmacological effects.

  12. The role of ZrN capping layer deposited on ultra-thin high-k Zr-doped yttrium oxide for metal-gate metal–insulator–semiconductor applications

    Juan, Pi-Chun; Mong, Fan-Chen; Huang, Jen-Hung [Department of Materials Engineering and Center for Thin Film Technologies and Applications, Ming Chi University of Technology, New Taipei City 243, Taiwan (China)


    Metal-gate MIS structures with and without ZrN capping layer on high-k Y{sub 2}O{sub 3}:Zr/Y{sub 2}O{sub 3} stack were fabricated. The binding energies and depth profiles were investigated by x-ray photoelectron spectroscopy (XPS). The x-ray diffraction (XRD) patterns were compared. It is found that Ti out-diffusion into Zr-based high-k dielectric becomes lesser with the insertion of ZrN capping layer. The electrical properties of current-voltage (I-V) and capacitance-voltage (C-V) characteristics were measured in the postannealing temperature range of 550–850 °C. According to the defect reaction model, Zr cation vacancies are associated with the concentration of Ti ion by a transition from +3 to +2 states. The amount of Zr cation vacancies is quantified and equal to a half of Ti substitution amount at Zr site. The reduction in cation vacancies at high temperatures can well explain the decrease in ΔV{sub FB} for samples with ZrN layer. In contrast, an excess of Ti outdiffusion will produce the interstitial defects in high-k films without ZrN capping.

  13. VN 2080 Ground Clearance Grape Harvesting Machine of New Holland Company%NEW HOLLAND公司VN2080型高地隙葡萄收获机



    简要介绍了New Holland公司的VN 2080型高地隙葡萄收获机各主要部件的结构特点和技术性能,为我国农机行业在研究和开发葡萄收获机新产品时提供参考和借鉴.

  14. Hot Deformation Behavior of 1Cr12Ni3Mo2VN Martensitic Stainless Steel

    He, Xiaomao; Jiang, Peng; Zhou, Leyu; Chen, Chao; Deng, Xiaochun


    1Cr12Ni3Mo2VN is a new type of martensitic stainless steel for the last-stage blades of large-capacity nuclear and thermal power turbines. The deformation behavior of this steel was studied by thermal compression experiments that performed on a Gleeble-3500 thermal simulator at a temperature range of 850°C to 1200°C and a strain rate of 0.01s-1 to 20s-1. When the deformation was performed at high temperature and low strain rate, a necklace type of microstructures was observed, the plastic deformation mechanism is grain boundary slip and migration, when at low temperature and lower strain rate, the slip bands were observed, the mechanism is intracrystalline slips, and when at strain rate of 20s-1, twins were observed, the mechanism are slips and twins. The Arrhenius equation was applied to describe the constitutive equation of the flow stress. The accuracy of the equation was verified by using the experimental data and the correlation coefficient R2 = 0.9786, and the equation can provide reasonable data for the design and numerical simulation of the forging process.

  15. Word Generative Grammar -- an Extensible 6-element System: {VT, VN, θ, L, S, P}


    On the basis of formal grammar, this paper introduces operation set θ (e.g., vector point multiply *, vector couple multiply*, vector set multiply ×, substitution H, function F, set plus ∪, et al.) and set of set's types L (e.g., ordered set, continuous (descending) ordered set, unordered set, coupled set, coordinate, et al.), and generalizes them to other word types of natural language, thus presenting the generative grammar for words--an extensible 6-element formal system {VT, VN, θ, L, S, P}, and takeing time words in natural language as example for detailed discussion. With the colorfulness of time words of natural language, time words for different natural languages assume different meaning. Generative grammar for time words can generate not only different time words, but also their semantics (Generative grammar of Chomsky can only produce all right sentences instead of semantics), and then, generalizes them to other word types, e.g., accurate measure words, adjectives, etc.

  16. Effect of V and V-N Microalloying on Deformation-Induced Ferrite Transformation in Low Carbon Steels


    Deformation-induced ferrite transformation (DIFT) has been proved to be an effective approach to refine ferrite grains. This paper shows that the ferrite grains can further be refined through combination of DIFT and V or VN microalloying. Vanadium dissolved in γ matrix restrains DIFT. During deformation, vanadium carbonitrides rapidly precipitate due to strain-induced precipitation, which causes decrease in vanadium dissolved in matrix and indirectly accelerates DIFT. Under heavy deformation, deformation induced ferrite (DIF) grains in V microalloyed steel were finer than those in V free steel. The more V added to steel, the finer DIF grains obtained. Moreover, the addition of N to V microalloyed steels can remarkably accelerate precipitation of V,and then promote DIFT. However, DIF grains in V-N microalloyed steel easily coarsen.

  17. Die Umsetzung der VN-Agenda 2030 für nachhaltige Entwicklung: welche Signale Deutschland jetzt international setzen sollte

    Beisheim, Marianne


    Beim Nachhaltigkeitsgipfel der Vereinten Nationen (VN) im September 2015 haben die Staats- und Regierungschefs und -chefinnen aller Mitgliedstaaten die 2030-Agenda für nachhaltige Entwicklung verabschiedet. Auch die Bundesregierung hat zugesichert, die Umsetzung rasch angehen zu wollen, sowohl in Deutschland als auch weltweit mit Partnern und deutscher Unterstützung. Kanzlerin Merkel kündigte an, ehrgeizige Umsetzungsanstrengungen bereits im Juli in New York vorstellen zu wollen. Welche Impul...

  18. D meson $v_n$ harmonics in PbPb collisions at 5.02 TeV with CMS

    Sun, Jian


    Because of their large mass, heavy quarks are produced primarily at early stages of heavy-ion collisions, and therefore experience the full evolution of the system and carry information about the extent of thermalization of the QGP. Azimuthal anisotropy parameters ($v_n$) of charm and bottom hadrons provide unique information about the path length dependent interactions between heavy quarks and the medium. To what extent heavy quarks at low $p_T$ flow with the medium is a good measure of the interaction strength. At high $p_T$, $v_2$ and $v_3$ from path length dependent energy loss provide a powerful tool to study heavy quark energy loss mechanisms. With the large PbPb data sample at 5.02 TeV collected by the CMS detector during the 2015 LHC run, azimuthal anisotropy $v_2$ and $v_3$ of D0 meson is measured over a wide $p_T$ range and at different centralities. In this talk, new results of D0 meson $v_n$ parameters are presented, and compared to the charged hadron $v_n$ at the same energy and the latest theore...

  19. $D^{0}$ meson $v_{n}$ harmonics in PbPb collisions at $5.02~\\mathrm{TeV}$

    CMS Collaboration


    The Fourier coefficients $v_{2}$ and $v_{3}$, which reflect the azimuthal anisotropy of $D^0$ meson, is measured with scalar-product method in PbPb collisions at $\\sqrt{s_\\mathrm{NN}} = 5.02~\\mathrm{TeV}$ with CMS. The measurement is done in a wide $p_T$ range up to $40~\\mathrm{GeV}/c$, for centrality classes 0-10$\\%$, 10-30$\\%$ and 30-50$\\%$. It is the first measurement on $D^0$ $v_{3}$ and the uncertainties on $D^0$ $v_{2}$ are significantly improved compared with previous measurements. The measured $D^0$ $v_{n}$ (n = 2, 3) is consistent with charged particle $v_{n}$ in central collisions, and begins to be lower than charged particles $v_{n}$ in $p_T$ range 1 to $6~\\mathrm{GeV}/c$ for more peripheral collisions. In high $p_T$ range, non-zero $D^0$ $v_{2}$ is also observed, which indicates the path length dependent energy loss of charm quark.

  20. Dureza e resistência ao desgaste da camada de ZrN formada por nitretação a plasma sobre zircônia parcialmente estabilizada com ítria Hardness and wear resistance of the ZrN layer made by plasma nitriding of yttria partially-stabilized zirconia

    R. Milani


    Full Text Available Corpos-de-prova de zircônia parcialmente estabilizada com ítria foram moldados por prensagem uniaxial, sinterizados e nitretados em plasma de micro-ondas à pressão atmosférica. A camada de ZrN sobre zircônia formou-se a uma taxa de 4 µm.min-1, podendo atingir uma espessura de 500 µm. As amostras foram caracterizadas por meio de medidas de dureza e resistência ao desgaste. A superfície nitretada apresentou dureza superior e resistência ao desgaste similar ao substrato de zircônia.Samples of yttria partially-stabilized zirconia were molded by uniaxial pressing, sintered and nitrided in an atmospheric pressure microwave plasma. This procedure leads to the formation of a ZrN layer whose growth rate and thickness reached 4 µm.min-1 and 500 µm, respectively. The samples were characterized by means of hardness and wear resistance tests. The nitrided surface exhibits superior hardness and wear resistance similar to that of the zirconia substrate.

  1. Intrinsic stress in ZrN thin films: Evaluation of grain boundary contribution from in situ wafer curvature and ex situ x-ray diffraction techniques

    Koutsokeras, L. E. [Departement Physique et Mecanique des Materiaux, Institut Pprime, CNRS-Universite de Poitiers-ENSMA, UPR 3346, SP2MI, Teleport 2, Bd M et P Curie, F 86962 Chasseneuil-Futuroscope (France); Department of Materials Science and Engineering, University of Ioannina, Ioannina 45110 (Greece); Abadias, G. [Departement Physique et Mecanique des Materiaux, Institut Pprime, CNRS-Universite de Poitiers-ENSMA, UPR 3346, SP2MI, Teleport 2, Bd M et P Curie, F 86962 Chasseneuil-Futuroscope (France)


    Low-mobility materials, like transition metal nitrides, usually undergo large residual stress when sputter-deposited as thin films. While the origin of stress development has been an active area of research for high-mobility materials, atomistic processes are less understood for low-mobility systems. In the present work, the contribution of grain boundary to intrinsic stress in reactively magnetron-sputtered ZrN films is evaluated by combining in situ wafer curvature measurements, providing information on the overall biaxial stress, and ex situ x-ray diffraction, giving information on elastic strain (and related stress) inside crystallites. The thermal stress contribution was also determined from the in situ stress evolution during cooling down, after deposition was stopped. The stress data are correlated with variations in film microstructure and growth energetics, in the 0.13-0.42 Pa working pressure range investigated, and discussed based on existing stress models. At low pressure (high energetic bombardment conditions), a large compressive stress is observed due to atomic peening, which induces defects inside crystallites but also promotes incorporation of excess atoms in the grain boundary. Above 0.3-0.4 Pa, the adatom surface mobility is reduced, leading to the build-up of tensile stress resulting from attractive forces between under-dense neighbouring column boundary and possible void formation, while crystallites can still remain under compressive stress.

  2. Performance of VN as Negative Electrode Materials in Electrochemical Capacitors%电化学电容器氮化钒负极材料性能研究

    高兆辉; 张浩; 曹高萍; 韩敏芳; 杨裕生


    Nanocrystalline vanadium nitride (VN) materials were synthesized by high temperature ammonia (NH3) reduction of vanadium oxide (V2O5). The structure and morphology of VN materials were characterized by XRD,SEM and TEM, while the specific surface area, pore size distribution and supercapacitive behavior by N2 absorption, cyclic voltammetry (CV) and constant current charge-discharge measurements in 1 mol·L-1 KOH electrolyte. The results showed that the VN sample belonged to the cubic crystal system (Fm3m [225]),and had homogeneous surface and appeared nearly spherical with uniform size. As the reaction time was extended to 12 h, small particles were interconnected with each other to form some mesopores. The specific capacitance of VN-c was 192 F ·g-1 at current density of 50 mA ·g-1,and retained 150 F ·g-1 after 1000 cycles. The VN sample possessed both capacitive properties of electrical double-layer and pseudocapacitive properties of redox reactions.%利用高温氨解还原氧化钒(V2O5)制备了氮化钒(VN)纳米材料.采用XRD、SEM与TEM观察分析样品的结构和形貌,采用氮气吸附、循环伏安曲线以及恒流充放电曲线测试样品的比表面积、孔径分布和电极电化学性能.结果表明,VN样品属于立方晶系(Fm3m [225]),其大小均一,近似球形,氨解时间的加长(12h),小颗粒间相互交联可形成一定的介孔.50 mA·g-1电流密度下VN-c电极的比电容能达到192 F·g-1,1000周期循环其比电容仍有150 F·g-1,同时具有双电层电容性能和氧化还原反应的准电容性能.

  3. Decolorization and biodegradation of reactive sulfonated azo dyes by a newly isolated Brevibacterium sp. strain VN-15.

    Franciscon, Elisangela; Grossman, Matthew James; Paschoal, Jonas Augusto Rizzato; Reyes, Felix Guillermo Reyes; Durrant, Lucia Regina


    Azo dyes constitute the largest and most versatile class of synthetic dyes used in the textile, pharmaceutical, food and cosmetics industries and represent major components in wastewater from these industrial dying processes. Biological decolorization of azo dyes occurs efficiently under low oxygen to anaerobic conditions. However, this process results in the formation of toxic and carcinogenic amines that are resistant to further detoxification under low oxygen conditions. Moreover, the ability to detoxify these amines under aerobic conditions is not a wide spread metabolic activity. In this study we describe the use of Brevibacterium sp. strain VN-15, isolated from an activated sludge process of a textile company, for the sequential decolorization and detoxification of the azo dyes Reactive Yellow 107 (RY107), Reactive Black 5 (RB5), Reactive Red 198 (RR198) and Direct Blue 71 (DB71). Tyrosinase activity was observed during the biotreatment process suggesting the role of this enzyme in the decolorization and degradation process, but no-activity was observed for laccase and peroxidase. Toxicity, measured using Daphnia magna, was completely eliminated.

  4. Gene expression profiles of the thermotolerant yeast Saccharomyces cerevisiae strain KKU-VN8 during high-temperature ethanol fermentation using sweet sorghum juice.

    Techaparin, Atiya; Thanonkeo, Pornthap; Klanrit, Preekamol


    To investigate gene expression profiles of the thermotolerant yeast Saccharomyces cerevisiae strain KKU-VN8, a potential high-ethanol producer, in response to various stresses during high-temperature ethanol fermentation using sweet sorghum juice (SSJ) under optimal conditions. The maximal ethanol concentration obtained by S. cerevisiae KKU-VN8 using SSJ at 40 °C was 66.6 g/l, with a productivity of 1.39 g/l/h and a theoretical ethanol yield of 81%. Quantitative RT-PCR assays were performed to investigate the gene expression profiles of S. cerevisiae KKU-VN8. Differential expression of genes encoding heat-shock proteins (HSP82, HSP104, SSA4), genes involved in trehalose metabolism (TPS1, TPS2, NTH1) and genes involved the glycolytic pathway (ADH1, ADH2, CDC19) at various time points during fermentation was observed. The expression levels of HSP82, HSP104, SSA4, ADH1 and CDC19 were significantly higher than those of the controls (10.2-, 4-, 8-, 8.9- and 5.9-fold higher, respectively). In contrast, the expression levels of TPS1, TPS2, NTH1 and ADH2 were approx. 2-fold less than those of the controls. The highly expressed genes encoding heat-shock proteins, HSP82 and SSA4, potentially play an important role in helping S. cerevisiae KKU-VN8 cope with various stresses that occur during high-temperature fermentation, leading to higher ethanol production efficiency.

  5. CGC/saturation approach for high energy soft interactions: `soft' Pomeron structure and $v_{n}$ in hadron and nucleus collisions from Bose-Einstein correlation

    Gotsman, E; Maor, U


    In the framework of our model of soft interactions at high energy based on CGC/saturation approach,we show that Bose-Einstein correlations of identical gluons lead to large values of $v_n$. We demonstrate how three dimensional scales of high energy interactions: hadron radius, typical size of the wave function in diffractive production of small masses (size of the constituent quark), and the saturation momentum, influence the values of BE correlations, and in particular, the values of $v_n$. Our calculation shows that the structure of the `dressed' Pomeron leads to values of $v_n$ which are close to experimental values for proton-proton scattering, 20\\% smaller than the observed values for proton-lead collisions, and close to lead-lead collisions for 0-10\\% centrality. Bearing this result in mind, we conclude that it is premature to consider, that the appearance of long range rapidity azimuthal correlations are due only to the hydrodynamical behaviour of the quark-gluon plasma.

  6. A survey for antibodies to equine arteritis virus in donkeys, mules and zebra using virus neutralisation (VN) and enzyme linked immunosorbent assay (ELISA).

    Paweska, J T; Binns, M M; Woods, P S; Chirnside, E D


    A seroepidemiological survey of donkeys in South Africa (n = 4300) indicated a wide distribution and increasing prevalence of antibodies to equine arteritis virus (EAV). Donkey sera inhibited equine arteritis virus infection in virus neutralisation (VN) tests and in ELISA specifically bound to a recombinant antigen derived from the Bucyrus isolate of EAV. These results suggest that donkeys have been exposed to the same serotype of this virus as circulates among horses. A good correlation existed between EAV neutralising antibody titres and ELISA absorbance values (0.8631); the ELISA was sensitive and specific (99.2% and 80.3% respectively) for donkey sera when compared to the VN test and the recombinant ELISA antigen did not cross-react with sera positive for common African equine pathogens. VN+ ELISA+ donkeys were also found in Morocco and Zimbabwe and seropositive mules in both South Africa and Morocco. No seropositive zebra (n = 266) were detected from game reserves or zoos in 9 countries. The results confirm that in addition to horses and donkeys, mules are naturally infected with EAV.

  7. First-principles study of transition-metal nitrides as diffusion barriers against Al

    Mei, Zhi-Gang, E-mail:; Yacout, Abdellatif M.; Kim, Yeon Soo; Hofman, Gerard; Stan, Marius


    Using density-functional theory based first-principles calculations we provided a comparative study of the diffusion barrier properties of TiN, ZrN, and HfN against Al for U–Mo dispersion fuel applications. We firstly examined the thermodynamic stability of these transition-metal nitrides with Al. The calculated heats of reaction show that both TiN and ZrN are thermodynamically unstable diffusion barrier materials, which might be decomposed by Al at relatively high temperatures. As a comparison, HfN is a stable diffusion barrier material for Al. To evaluate the kinetic stability of these nitride systems against Al diffusion, we investigated the diffusion mechanisms of Al in TiN, ZrN and HfN using atomic scale simulations. The effect of non-stoichiometry on the defect formation and Al migration was systematically studied.

  8. Main group tellurium heterocycles anchored by a P(2)(V)N(2) scaffold and their sulfur/selenium analogues.

    Nordheider, Andreas; Hüll, Katharina; Prentis, Joanna K D; Athukorala Arachchige, Kasun S; Slawin, Alexandra M Z; Woollins, J Derek; Chivers, Tristram


    A comprehensive investigation of reactions of alkali-metal derivatives of the ditelluro dianion [TePV(NtBu)(μ-NtBu)]22– (L2–, E = Te) with p-block element halides produced a series of novel heterocycles incorporating P2VN2 rings, tellurium, and group 13–16 elements. The dianion engages in Te,Te′-chelation to the metal center in Ph2Ge and R2Sn (R = tBu, nBu, Ph) derivatives; similar behavior was noted for group 14 derivatives of L2– (E = S, Se). In the case of group 13 trihalides MCl3 (M = Ga, In), neutral spirocyclic complexes (L)M[NtBu(Te)PV(μ-NtBu)2PIIIN(H)tBu)] (M = Ga, In) comprised of a Te,Te′-chelated ligand L2– and a N,Te-bonded ligand resulting from loss of Te and monoprotonation were obtained. In reactions with RPCl2 (R = tBu, Ad, iPr2N) a significant difference was observed between Se- and S-containing systems. In the former case, Se,Se′-chelated derivatives were formed in high yields, whereas the N,S-chelated isomers predominated for sulfur. All complexes were characterized by multinuclear (1H, 31P, 77Se, 119Sn, and 125Te) NMR spectroscopy; this technique was especially useful in the analysis of the mixture of (L)(Se) and (L)(SeSe) obtained from the reaction of Se2Cl2 with L2– (E = Te). Single-crystal X-ray structures were obtained for the spirocyclic In complex (9), (L)GePh2 (E = Te, 10), (L)SntBu2 (E = Te, 12a); E = Se, 12aSe, E = S, 12aS) and (L)(μ-SeSe) (E = Te, 16).

  9. Physical and electrical properties of induced high-k ZrHfO crystallization with ZrN cap by high power impulse magnetron sputtering for metal-gate metal-insulator-semiconductor structures

    Tsai, Jung-Ruey; Juan, Pi-Chun; Lin, Cheng-Li; Lin, Guo-Cheng


    Metal-gate TiN/ZrN/ZrHfO/p-Si metal-insulator-semiconductor (MIS) structures have been fabricated in this work. The physical and electrical properties were characterized. The crystallization of high-k ZrHfO thin-film is induced by high power impulse magnetron sputtering (HIPIMS) during the deposition of ZrN capping layer. The binding energies and depth profiles were investigated by X-ray photoelectron spectroscopy (XPS). It is found that Zr and Hf out-diffusion from high-k dielectric in samples with HIPIMS is lesser than those in samples with the conventional DC magnetron sputtering (DCMS). The dielectric constant which strongly relates to the tetragonal phase becomes higher and the flatband voltage shift shows smaller by using the HIPIMS method than by the conventional DCMS. The cation and anion vacancies have been investigated by the defect reaction model.

  10. 模板法制备介孔VN纳米电极材料及其电容性能%Template Synthesis of Mesoporous Nanocrystalline VN Electrode Materials and Its Supercapacitive Behavior

    高兆辉; 张浩; 曹高萍; 韩敏芳; 杨裕生


    Using hexadecyl trimethyl ammonium bromide (CTAB) as the template, mesoporous VN nanocrystalline was synthesized by NH3 reduction of precursor V2O5. The structure and surface morphology of mesoporous VN were characterized by XRD and TEM. Specific area and pore size distribution were studied by N2 absorption. The XRD result indicated that VN nanocrystalline belonged to the cubic crystal system. VN nanoparticles were in dimension of about 10 nm. N2 absorption result indicated that the surface area of VN sample was 88 m2/g, and most pores were distributed in the range of 2-6 nm. The supercapacitive behavior of VN electrode in 1 mol/L KOH electrolyte was studied by cyclic voltammetry (CV) and constant current charge-discharge measurements. The results showed that mesoporous VN electrode had both electrical double-layer capacitive properties and redox pseudoca-pacitive properties. The specific capacitance was of VN electrode 517 F/g at 1 mV/s scan rate, when the scan rate was up to 10 mV/s, its specific capacitance maintained 275 F/g.%以十六烷基三甲基溴化铵(CTAB)为模板剂,通过高温氨解还原V2O5前驱体制得了具有丰富介孔的VN纳米材料,采用XRD与TEM分析观察样品的结构和形貌,用N2吸附测试样品的比表面积和孔径分布.XRD分析表明,介孔VN纳米材料属于立方晶系的晶体结构.TEM和N2吸附测试结果表明,VN纳米材料的颗粒粒径大约为10 nm,比表面积为88 m2/g,有比较丰富的2~6 nm的介孔.在1 mol/L KOH电解液中进行循环伏安和恒流充放电测试研究其电容性能,结果显示,VN电极同时具有双电层电容性能和氧化-还原反应的准电容性能,1 mV/s的扫描速率下能获得517 F/g的比电容;当扫描速率增大到10 mV/s时,其比电容仍有275F/g.

  11. Discovery and development of Galeterone (TOK-001 or VN/124-1) for the treatment of all stages of prostate cancer.

    Njar, Vincent C O; Brodie, Angela M H


    In our effort to discover potent and specific inhibitors of 17α-hydroxylase/17,20-lyase (CYP17), the key enzyme which catalyzes the biosynthesis of androgens from progestins, 3β-(hydroxy)-17-(1H-benzimidazole-1-yl)androsta-5,16-diene (Galeterone or TOK-001, formerly called VN/124-1) was identified as a selective development candidate which modulates multiple targets in the androgen receptor (AR) signaling pathway. This drug annotation summarizes the mechanisms of action, scientific rationale, medicinal chemistry, pharmacokinetic properties, and human efficacy data for galeterone, which has successfully completed phase II clinical development in men with castration resistant (advanced) prostate cancer (CRPC). Phase III clinical studies in CRPC patients are scheduled to begin in early 2015.

  12. Technology for Smelting V-N Micro-alloyed Steel by Blowing Nitrogen%气体增氮法冶炼钒氮微合金钢

    康伟; 康磊; 赵坦; 廖相巍


    从理论上分析了钢液增氮的热力学、动力学影响因素,进行了BOF+RH双联吹氮冶炼钒氮钢试验。结果表明,转炉底吹、RH喷吹均能有效增加钢液氮含量。 RH真空度两段式控制既能满足控氢要求又能实现钢液搬出时较高的氮含量。 BOF+RH双联吹氮气工艺可以不加含氮合金冶炼钒氮微合金钢。%The thermodynamic and dynamic influence factors for increasing the content of ni-trogen in molten steel are theoretically analyzed and the experiment for the smelting V-N contain-ing steel by blowing nitrogen into both BOF and RH is carried out. The results show that the con-tent of nitrogen in molten steel can be effectively increased by converter bottom blowing and RH blowing. With its characteristics of the RH blowing the two-stage control technology for RH vacu-um degree can meet the requirement for controlling the content of hydrogen and also the molten steel with relative high content of nitrogen can be available when tapping. V-N micro-alloyed steel can be smelted without adding the nitrogen-containing alloy by using BOF and RH duplex nitro-gen-blowing process.

  13. The Influence of the Bias Potential on the Phase Composition, Structure, Substructure and Mechanical Properties of Multilayer TiN / ZrN System Obtained by Vacuum Arc Evaporation

    O.V. Sobol’


    Full Text Available Influence of constant and pulsed negative bias potential applied to the substrate during the deposition on the phase composition, structure, substructure and mechanical properties of multilayer ZrN / TiN coatings with a bilayer thickness of 50-200 nm was studied. Two-phase coating obtained from ZrN and TiN phases of the fcc structure of NaCl type without a significant loss of planarity and mixing layers is established. The use of high-voltage pulses would greatly change the structure and properties at Ub < 100 V. At larger value of Ub, constant potential becomes crucial for the structural engineering of the coating. It is shown that the greatest hardness is inherent to the coatings obtained by Ub = – 140...– 150 V, and H/E reaches a large value of 0.14, which is difficult to obtain in the single-layer coatings.

  14. D meson nuclear modification factor and $v_{n}$ harmonics in PbPb collisions at 5.02 TeV with CMS

    Sun, Jian


    The measurement of heavy flavour production is a powerful tool to study the properties of the high-density QCD medium created in heavy-ion collisions as heavy quarks are sensitive to the transport properties of the medium and may interact with the QCD matter differently from light quarks. In particular, the comparison between the nuclear modification factors ($R_{AA}$) of light- and heavy-flavour particles provides insights into the expected flavour dependence of in-medium parton energy loss. Furthermore, azimuthal anisotropy coefficient ($v_{n}$) of heavy-flavor particles provide insights into the degree of the thermalization of the bulk medium at low $p_{T}$, and unique information about the path length dependence of heavy quark energy loss at high $p_{T}$. Using the large statistics proton-proton and PbPb samples collected at 5.02 TeV during the 2015 LHC run, high precision open charm measurements are performed with the CMS detector in a wide transverse momentum range. This allows us to set an important mi...

  15. Construction of pBIFC-VN173-CXCR4 and pBIFC-VC155-NT21MP eukaryotic expression plasmids and their interaction in living cells%pBIFC-VN173-CXCR4和pBIFC-VC155-NT21MP真核表达质粒的构建及其在活细胞内的作用

    高艳军; 杨清玲; 陈昌杰; 丁勇兴


    目的:构建pBIFC-VN173-CXCR4和pBIFC-VC 155-NT21MP真核表达质粒,利用双分子荧光互补( BiFC)技术,在活细胞内直接观察趋化因子受体4(chemokine receptor 4、CXCR4和CD184)与CXCR4抑制性多肽的相互作用.方法:应用化学合成法获得巨噬细胞炎症蛋白Ⅱ(viral macrophage inflammatory protein-Ⅱ,vMIP-Ⅱ)N端21肽(N-terminal 21-mer peptide,NT21MP)编码的基因序列,克隆至经Kpn Ⅰ和EcoR Ⅰ酶切的pBiFC-VC155中,筛选含有目标基因的正确克隆.利用RT-PCR扩增人乳腺癌细胞株SKBR3的CXCR4全长基因后,T-A亚克隆至经Kpn Ⅰ和EcoR Ⅰ酶切的pBiFC-VN173载体中.然后,经酶切鉴定及DNA测序分析2个基因是否正确连接至真核表达载体中.应用脂质体转染的方法共转染pBiFC-VC155-NT21 MP和pBiFC-VC155-CXCR4至细胞株COS-7中,在荧光显微镜下观察NT21MP与CXCR4在胞内的相互作用.结果:经DNA测序及同源性对比,证实pBiFC-VC155-NT21MP和pBiFC-VN173-CXCR4重组栽体构建成功;基因片段与NCBI基因库vMIP-Ⅱ和CXCR4基因CDS序列同源性达99.9%.BiFC法观察NT21MP与CXCR4在细胞内结合出现的荧光信号,该信号分布细胞内.结论:本实验成功构建了应用BiFC技术的真核表达载体,并且在活细胞内检测到NT21MP与CXCR4的互相结合.%Objective: To construct pBIFC-VN173-CXCR4 and pBIFC-VC155-NT21MP eukaryotic expression plasmids and to investigate the interaction of chemokine receptor 4 ( CXCR4) and viral macrophage inflammatory protein-Ⅱ ( vMIP-Ⅱ ) N terminal 21 peptides (NT21MP) in living cells. Methods; DNA fragment encoding NT21MP was chemically synthesized and inserted into BiFC eukaryotic expression vector pBIFC-VC155. The full length of CXCR4 DNA fragment was amplified by RT-PCR from SKBR3 cells and inserted into BiFC eukaryotic expression plasmid pBIFC-VN173. Two recombinant vectors were identified by restriction enzyme digestion and DNA sequencing. The recombinant vectors were cotransfected into

  16. Segmentace cévního řečiště na snímcích sítnice s využitím matematické morfologie

    Stonawski, Stanislav


    Důležitým krokem analýzy sítnicových snímků je segmentace cévního řečiště. Výsledek této analýzy může být využit při diagnostice očních či kardiovaskulárních onemocnění. Tato práce se zabývá možnostmi segmentace cévního řečiště ve snímcích s vysokým rozlišením za využití metod matematické morfologie. Cílem práce je vytvoření algoritmu, který bude schopen segmentace cévního řečiště ze sítnicových snímků. Dalším cílem je provedení hodnocení jeho účinnosti. Práce se stručně zabývá problematikou ...

  17. Treatment of Common Effluent Treatment Plant Wastewater in a Sequential Anoxic-Oxic Batch Reactor by Developed Bacterial Consortium VN11.

    Chattaraj, Sananda; Purohit, Hemant J; Sharma, Abhinav; Jadeja, Niti B; Madamwar, Datta


    A laboratory-scale anoxic-oxic sequential reactor system was seeded with acclimatized mixed microbial consortium for the treatment of common effluent treatment plant (CETP) wastewater having 7000-7400 mg L(-1) of COD and 3000-3400 mg L(-1) of BOD. Initially, CETP wastewater was treated under anoxic reactor at 5000 mg L(-1) of MLSS concentrations, 5.26 ± 0.27 kg COD m(-3) day(-1) of organic loading rate (OLR) and 36 h of hydraulic retention time (HRT). Further, the effluent of anoxic reactor was treated in oxic reactor with an OLR of 6.6 ± 0.31 kg COD m(-3) day(-1) and 18 h HRT. Maximum color and COD removal were found to be 72 and 85 % at total HRT of 2.25 days under anoxic-oxic sequential reactor at 37 °C and pH 7.0. The UV-VIS, FTIR, NMR and GCMS studies showed that majority of peaks observed in untreated wastewater were either shifted or disappeared after sequential treatment. Phytotoxicity study with the seeds of Vigna radiata and Triticum aestivum showed more sensitivity toward the CETP wastewater, while the products obtained after sequential treatment does not have any inhibitory effects. The results demonstrated that the anoxic-oxic reactor fed with bacterial consortium VN11 could bring about efficient bioremediation of industrial wastewaters.

  18. Tribology Behavior of Zr-N Alloying Layer on Ti6Al4V Alloy Surface at Elevated Temperature%Ti6Al4V钛合金表面Zr-N合金化层的抗高温摩擦磨损性能

    汤金钢; 刘道新; 唐长斌; 于首明; 张晓化


    The dense Zr-N alloying layers were prepared on the surface of Ti6A14V alloy by two kinds of surface alloying processes to improve the wear resistance of Ti alloy at elevated temperature. One process is Zr-diffusing with nitriding simultaneously (synchronous surface alloying), and the other is nitriding after Zr-diffusing (asynchronous surface alloying). The microstructure and tribological property at elevated temperature of the modified surface layers were investigated. Results show that both the Zr-N diffusion layers consist of ZrN phase, and the asynchronous surface alloying with thick Zr-Ti solid solution layer is beneath the surface. The surface microhardness of the Ti6A14V alloy was significantly increased by both Zr-N alloying layers. With the same time and temperature, the thickness of the asynchronous surface alloying layer was about 6 times of the synchronous surface alloying layer, because the asynchronous surface alloying has excellent solution and low diffusion inhibition. The results of the ball-on-disc wear tests indicate that the wear resistance at 300 ℃ of the synchronous surface alloying layer was not significantly improved because of the shallow diffusion depth. The asynchronous surface alloying reduced the wear rate obviously by two orders and the friction coefficient by 50% due to the high surface hardness, thick depth, good thermal oxidization resistance and big surface load-bearing ability.%为了改善钛合金的高温耐磨性能,采用锆-氮离子共渗与异步渗(渗锆后再氮化处理)两种工艺技术分别在Ti6A14V钛合金表面制备致密的锆-氮合金化改性层,对比研究了合金化层的组织结构特征和高温摩擦磨损性能.结果表明,两种工艺制各的Zr-N合金层表面均由ZrN相组成,异步渗改性层的内层则包含较厚的Zr-Ti固溶体,两种等离子表面合金化层均使钛合金表面硬度显著提高.同样温度和处理时间条件下,异步渗合金化层的厚度约为锆-

  19. An Integrated Architecture to Support Hastily Formed Network (HFN)


    Figure 8. EU 1000I, EU 2000I and EU 3000IS...............................................................52 Figure 9. Inmarsat BGAN Satellite Coverage...Hughes 9201 Broadband Satellite IP Terminal with Wireless LAN Access Point, which interfaces over the Inmarsat BGAN satellite network, has many...advantages that make it an attractive solution. (1) Global Coverage BGAN delivers seamless network coverage across most of the world’s land mass

  20. Affairs and selective shopping in a spiral of exaggeration. What is the matter with the UN Climate Panel?; Affaires en selectief winkelen in een spiraal van overdrijving. Wat is er toch aan de hand mt het VN-Klimaatpanel?

    Labohm, H.


    In two articles the state-of-the-art in the discussion on climate change will be analyzed. In this first article the author pays attention to scientific skirmishes that have taken place in and around the climate panel of the UN (IPCC or Intergovernmental Panel on Climate Change) and how the conclusions and recommendations are translated and interpreted in political terms. In the second article the author will analyse a few shortcomings of the scientific basis of the human greenhouse hypothesis as formulated by the IPCC. [Dutch] In twee artikelen wordt de actuele stand van zaken in de klimaatdiscussie ganalyseerd. In dit eerste artikel besteedt de auteur aandacht aan de wetenschappelijke schermutselingen die in en rond het klimaatpanel van de VN (het IPCC of Intergovernmental Panel on Climate Change) hebben plaatsgevonden en de wijze waarop de bevindingen van het panel in de politiek zijn vertaald. In het tweede artikel zal de auteur enkele tekortkomingen analyseren van de wetenschappelijke onderbouwing van de menselijke broeikashypothese door het IPCC.

  1. V.N. y Mr. Chip

    Sáez Vacas, Fernando


    EL matemático Bronowski ha dejado escrito que John Von Neumann era, en su opinión, el más inteligente de todos los hombres y mujeres que ha conocido. Esta opinión es muy significativa porque Bronowski ha tratado a casi todos los matemáticos y físicos importantes entre los años treintas y setentas, y sitúa en segundo lugar nada menos que a Enrico Germi, Premio Nobel y genio de la Física.

  2. Vnímání barev žákem s mentálním postižením Perception of colours by mentally-handicapped pupils

    Olga Krejčířová


    Full Text Available Předložená stať se pokouší o využití obecných poznatků o barvách v oblasti tělesné kultury a aplikuje je na tělesnou výchovu v podmínkách speciálních škol. Vychází z předpokladu, že vzdělávání žáků s mentálním postižením by mělo probíhat za podmínek, které v nich evokují libé pocity. A k těmto podmínkám patří i barevnost. Jsou prezentovány výsledky šetření preference barev probandy s lehkým a středně těžkým mentálním postižením. Výsledky naznačují, že probandi s lehkým mentálním postižením mají tendenci citlivě vnímat barvy, a to i v abstraktní podobě. Preferují modrou, případně zelenou a červenou barvu a hůře přijímají černou a fialovou. Preference oblíbené barvy je u probandů s těžším mentálním postižením více variabilní než u probandů s lehkým mentálním postižením. The following article attempts to utilize general knowledge of colours in the sphere of physical culture and applies it to physical education in special schools. It is based on the precondition that education of mentally-handicapped pupils should proceed under conditions evoking pleasurable feelings in them. And such conditions also include colours. The article presents the results of an examination of colour preference in probands with slight to moderate mental handicaps. The results show that probands with a slight mental handicap tend to be sensitive in relation to colours, even in their abstract form. They prefer blue, respectively green and red, and they have difficulties with perception of black and violet. The favourite colour preference in probands with a more serious mental handicap is more variable than in probands with a slight mental handicap.

  3. Examining the performance of refractory conductive ceramics as plasmonic materials: a theoretical approach

    Kumar, Mukesh; Umezawa, Naoto; Ishii, Satoshi; Nagao, Tadaaki


    The main aim of this study is to scrutinize promising plasmonic materials by understanding their electronic structure and correlating them to the optical properties of selected refractory materials. For this purpose, the electronic and optical properties of the conductive ceramics TiC, ZrC, HfC, TaC, WC, TiN, ZrN, HfN, TaN, and WN are studied systematically by means of first-principles density functional theory. A full ab initio procedure to calculate plasma frequency from the electronic band...

  4. The influence of physical activity on body image in people with and without acquired mobility disability [Vliv pohybové aktivity na subjektivní vnímání těla u osob se získaným tělesným postižením a bez něj

    Ziya Koruç


    Full Text Available BACKGROUND: Body image in people with physical disability is important, but it has received little attention in the research literature. OBJECTIVE: The aim of the study was to determine whether differences exist between adolescents with acquired mobility disability (AMD and those without AMD regarding body image, and whether physical activity influences these differences. METHODS: Fifty-eight adolescents, aged 16 to 18 years, participated in this study. Half the participants had some form of AMD while the other half were healthy. Body image was evaluated with the Multidimensional Body-Self Relations Questionnaire (MBSRQ before and after 6 weeks of playing darts. A two-way ANOVA was used to analyse the results. RESULTS: At the end of the study, the healthy adolescents scored significantly higher than the AMD group on the subscales of fitness perception, orientation and overall health perception. No interaction was found between disability and exercise on any subscales of the MBSRQ. CONCLUSIONS: The results of this study demonstrate that people with AMD evaluate their health and fitness levels as being lower than healthy adolescents and that they are less concerned with fitness as compared with healthy adolescents. Six weeks of playing darts as a physical activity had no effect on improving the self-perceptions of the AMD group.[VÝCHODISKA: Subjektivní vnímání těla u lidí s tělesným postižením je důležitý aspekt, v odborné literatuře mu však nebylo věnováno příliš pozornosti. CÍLE: Cílem studie bylo stanovit, zda se vyskytují rozdíly mezi adolescenty se získaným tělesným postižením (AMD a adolescenty bez AMD, co se týče subjektivního vnímání těla, a zda tyto rozdíly ovlivňuje pohybová aktivita. METODIKA: Této studie se zúčastnilo padesát osm adolescentů ve věku mezi 16 a 18 lety. Polovina účastníků měla některou z forem AMD, zatímco druhá polovina byla zdravá. Subjektivní vnímání t

  5. Examining the performance of refractive conductive ceramics as plasmonic materials: a theoretical approach

    Kumar, Mukesh; Ishii, Satoshi; Nagao, Tadaaki


    The main aim of the study is to scrutinize promising plasmonic materials by understanding and correlating the electronic structure to optical properties of selected refractory materials. For this purpose, the electronic and optical properties of conductive ceramics TiC, ZrC, HfC, TaC, WN, TiN, ZrN, HfN, TaN and WN are studied systematically by means of the first-principles density functional theory. A full ab-initio procedure to calculate plasma frequency from electronic band structure is discussed. The dielectric functions are calculated including both interband and intraband transitions. Our calculations confirmed that transition metal nitrides such as TiN, ZrN and HfN are the strongest candidates close to the performance of conventional noble metals in the visible to the near-infrared regions. On the other hand, carbides are not suitable for plasmonic applications due to very large losses in the same regions. By adopting the dielectric functions calculated from the calculations, the scattering and absorpti...

  6. Morphological Studies of Local Influence of Implants with Coatings Based on Superhard Compounds on Bone Tissue under Conditions of Induced Trauma

    Galimzyan KABIROV


    Full Text Available In this paper we analyze the response of bone tissue to a transosseous introduction of implants made of copper (Cu, medical steel 12X18H9T, steel with nitrides of titanium and hafnium coatings (TiN + HfN, as well as steel coated with titanium and zirconium nitrides (TiN + ZrN into the diaphysis of the tibia of experimental rats. The obtained results showed that the restoration of the injured bone and bone marrow in groups with implants made of steel 12X18H9T occurred without the participation of the granulation and cartilaginous tissues, but with implants made of steel coated with titanium and hafnium nitrides (TiN + HfN, this bone recovery also took place in the early term. At the same time, in groups, where the implants were made of copper (Cu, implants were made of steel coated with titanium and zirconium nitrides (TiN + ZrN were used, such phenomena as necrosis, lysis and destruction of the bone were registered and the bone tissue repair went through formation of the cartilaginous tissue.

  7. Hastily Formed Networks (HFN) As an Enabler for the Emergency Response Community


    to communicate provides the means to "correct its mistakes, regulate itself, and organize itself" ( Capra , 1996). Considering prior research in the...Laboratory, Massachusetts Institute of Technology website: Capra , F. (1996). The web

  8. Multimodální hodnocení fyzioterapeutického účinku u pacientů s postižením horní končetiny po cévní mozkové příhodě Multimodal evaluation of the effects of physiotherapy on stroke patients with upperlimb involvement

    Jaroslav Opavský


    Full Text Available Úkolem této práce bylo sestavení jednoduché testové baterie, která by citlivě registrovala změny motoriky paretické ruky a postižené horní končetiny u pacientů po cévní mozkové příhodě v chronickém stádiu. Vycházeli jsme z běžně dostupných testů (Nine hole peg test, dynamometrie apod., které jsou pro tyto účely v praxi nejvíce využívány, a sledovali jsme charakter a dynamiku jejich změn po 10 rehabilitačních procedurách. Většina výsledků u vybraných testů měla obdobnou tendenci k mírnému zlepšení, ale vzhledem k rozsahu souboru nedosáhly tyto změny hladiny statistické významnosti. Prezentované nálezy předkládáme pouze jako výsledky pilotní studie. Studie bude pokračovat a soubor bude dále rozšiřován. The aim of this paper was to compile an easy testing battery, sensitive enough to register changes in the motor task performance of the paretic hand and disabled upper limb of patients who have had a brain stroke and are in the chronic stage. We selected tests commonly used in rehabilitation to scan the characteristics and dynamics of test value changes after 10 kinesiotherapy lessons. Most of our outcome had the same trend of slight improvement, but did not reach statistical signifi cance because of the size of the group. Only our pilot outcome is presented in this paper. We are going to continue this study.

  9. Core-level spectra and binding energies of transition metal nitrides by non-destructive x-ray photoelectron spectroscopy through capping layers

    Greczynski, G.; Primetzhofer, D.; Lu, J.; Hultman, L.


    We present the first measurements of x-ray photoelectron spectroscopy (XPS) core level binding energies (BE:s) for the widely-applicable group IVb-VIb polycrystalline transition metal nitrides (TMN's) TiN, VN, CrN, ZrN, NbN, MoN, HfN, TaN, and WN as well as AlN and SiN, which are common components in the TMN-based alloy systems. Nitride thin film samples were grown at 400 °C by reactive dc magnetron sputtering from elemental targets in Ar/N2 atmosphere. For XPS measurements, layers are either (i) Ar+ ion-etched to remove surface oxides resulting from the air exposure during sample transfer from the growth chamber into the XPS system, or (ii) in situ capped with a few nm thick Cr or W overlayers in the deposition system prior to air-exposure and loading into the XPS instrument. Film elemental composition and phase content is thoroughly characterized with time-of-flight elastic recoil detection analysis (ToF-E ERDA), Rutherford backscattering spectrometry (RBS), and x-ray diffraction. High energy resolution core level XPS spectra acquired with monochromatic Al Kα radiation on the ISO-calibrated instrument reveal that even mild etching conditions result in the formation of a nitrogen-deficient surface layer that substantially affects the extracted binding energy values. These spectra-modifying effects of Ar+ ion bombardment increase with increasing the metal atom mass due to an increasing nitrogen-to-metal sputter yield ratio. The superior quality of the XPS spectra obtained in a non-destructive way from capped TMN films is evident from that numerous metal peaks, including Ti 2p, V 2p, Zr 3d, and Hf 4f, exhibit pronounced satellite features, in agreement with previously published spectra from layers grown and analyzed in situ. In addition, the N/metal concentration ratios are found to be 25-90% higher than those obtained from the corresponding ion-etched surfaces, and in most cases agree very well with the RBS and ToF-E ERDA values. The N 1 s BE:s extracted from

  10. Canine distemper virus DNA vaccination of mink can overcome interference by maternal antibodies.

    Jensen, Trine Hammer; Nielsen, Line; Aasted, Bent; Pertoldi, Cino; Blixenkrone-Møller, Merete


    Canine distemper virus (CDV) is highly contagious and can cause severe disease against which conventional live vaccines are ineffective in the presence of maternal antibodies. Vaccination in the presences of maternal antibodies was challenged by vaccination of 5 days old and 3 weeks old mink kits with CDV DNA vaccines. Virus neutralising (VN) antibody responses were induced in mink kits vaccinated with a plasmid encoding the haemaglutinin protein (H) of CDV (n=5, pCDV-H) or a combination of the H, fusion (F) and nucleoprotein (N) of CDV (n=5, pCDV-HFN). These DNA vaccinated kits were protected against virulent experimental infection with field strains of CDV. The pCDV-H was more efficient in inducing protective immunity in the presence of maternal antibodies compared to the pCDV-HFN. The results show that DNA vaccination with the pCDV-H or pCDV-HFN (n=4) only given once at 5 days of age induces virus specific immune response in neonatal mink and protection against virulent CDV exposure later in life.

  11. Modelling and analysis of sputter deposited ZrN coating by CFD

    Kapopara, Jaydeep M.; Mengar, Akshaykumar R.; Chauhan, Kamlesh V.; Patel, Nicky P.; Rawal, Sushant K.


    The objective of the present work is to investigate the effect of various sputtering parameters such as velocity, mass flow rate on velocity profiles, pressure profiles, density profiles and concentration distribution of the process gases (argon and nitrogen) of zirconium nitride films deposited on glass and silica substrate by RF magnetron sputtering. A three dimensional Computational Fluid Dynamics (CFD) study has been carried out using Fluent-ANSYS commercial code to visualize the mixing behavior of process gases inside the deposition chamber. The results show that the location of gas inlet port has a greater influence on gas distribution inside the chamber where reactive gas will form coating. By having this information, one can able to modify the reactor geometry and gas flow openings along with its positions for better gas flow over the substrate which in turns gives an indirect indication of coating from the composition point of view.

  12. Effect of alloying on elastic properties of ZrN based transition metal nitride alloys

    Kanoun, Mohammed


    We report the effect of composition and metal sublattice substitutional element on the structural, elastic and electronic properties of ternary transition metal nitrides Zr1-xMxN with M=Al, Ti, Hf, V, Nb, W and Mo. The analysis of the elastic constants, bulk modulus, shear modulus, Young\\'s modulus, and Poisson\\'s ratio provides insights regarding the mechanical behavior of Zr1-xMxN. We predict that ternary alloys are more ductile compared to their parent binary compounds. The revealed trend in the mechanical behavior might help for experimentalists on the ability of tuning the mechanical properties during the alloying process by varying the concentration of the transition metal. © 2014 Elsevier B.V.

  13. The Syntheses and Structure of the First Vanadium(IV) and Vanadium(V) Binary Azides, V(N3)4, [V(N3)6]2- and [V(N3)6]- (Preprint)


    the Cambridge Crystallographic Data 14 This page is Distribution A: approved for public release; distribution unlimited. Centre ( CCDC , 12 Union...Road, Cambridge CB21EZ, UK (Fax: (+44) 1223-336- 033; e-mail: on quoting the deposition no. CCDC 288159. [25] T. M. Klapötke, H

  14. Dårlig søvn er en trussel mod helbredet

    Clark, Alice Jessie; Jørgensen, Thea Suldrup; Bonke, Jens


    sleep. A quiet, dark and well-tempered bedroom and physical activity during the day may have a positive impact on sleep. Impaired sleep may be related to stress and conditions at home or at work. Psychological sleep treatment is free of adverse side effects with effects comparable to effects of medical......Long-term sleep impairment is related to an increased risk of somatic health problems, e.g. overweight, Type 2 diabetes, cardiovascular disease and premature death. Avoidance of caffeine, alcohol, energy-rich or fatty foods and light from computer screens close to bedtime may counteract impaired...

  15. Moeders in de Mainstream: een genderanalyse van het werk van het VN-Kinderrechtencomite

    Brink, Marjoleine van den


    The relationship between women's rights and children's rights is strong and complex. Their rights and interests are often assumed to coincide, but in practice that is not necessarily the case. Granting rights to children may be to the benefit of women. However, appeals to the rights and best interes

  16. Lidský kapitál a vnímaná kvalita produkce podniku

    Petra Štamfestová


    Full Text Available Purpose of the article: One aim of this paper is to define the concept of human capital and quality and based on the research of foreign literature to examine the findings of empirical research on the impact of human capital on production quality. The second aim is to verify the impact of human capital on the quality of production in industrial companies in the Czech Republic. Methodology/methods: In order to determine wheather human capital influence product quality correlation analysis was used. To create indexes of human capital and quality factor analysis was used and to analyse more complex links between constructs path analysis was used. Scientific aim: This paper is aimed at revealing whether human capital can effect product quality. Findings: Analysis show that there are a positive links between human capital and product quality. The research was carried out between the four dimensions of human capital measurement and quality found a positive correlation. The closest relationship is between employee satisfaction and quality. Employee satisfaction is followed by their motivation, innovation, and at least a close relationship with quality is education of employees. Conclusions: The so-called new economy puts new demands on businesses in terms of achieving long-term performance. More and more important is management of non-financial determinants of business performance which include quality management, information technology, human capital and customer, etc. and also analysing links between each other and thereby to contribute to the development of knowledge regarding the management of non-financial determinants of business performance because these determinants are crucial in achieving long term prosperity and success.

  17. Moeders in de Mainstream: een genderanalyse van het werk van het VN-Kinderrechtencomite

    Brink, Marjoleine van den


    The relationship between women's rights and children's rights is strong and complex. Their rights and interests are often assumed to coincide, but in practice that is not necessarily the case. Granting rights to children may be to the benefit of women. However, appeals to the rights and best interes

  18. Strategische samenwerking van de grote mogendheden in de VN-Veiligheidsraad 1946-2000

    Noldus, J.C.F.


    The subject of this study is the strategic cooperation of the permanent members in the Security Council in the period 1946 2000. Because of their right of veto the cooperation of the permanent members has a significant influence on the functioning of the Council. The most important aspects of the co

  19. A dialogue between Marxism and Psychoanalysis: The Legacy of V.N. Voloshinov

    F. Manuel Montalbán Peregrín


    Full Text Available Psychoanalysis appears early in Russia, even before that in many western countries. The development of a scientific theory of the psyche was understood as a priority by the social Marxist scientists and the Freudian hypotheses were received by interest for this task before repression dissolved the psychoanalytic movement at the 1920s. In our case we are going to centre on the contributions of Valentin N. Voloshinov, representative of the fruitful circle bajtiniano in the post-revolutionary Leningrad, which work carries a real anticipating character in the comprehension of the dialectics between the person and the social being from his rediscovery for the social sciences in West. Likewise we will comment how Voloshinov’s influence flows especially in some recent attempts for reconceptualizing the unconscious from a psycosocial perspective.

  20. Vnímanie identity a image-u vybranej spoločnosti

    Orosz, Noémi


    This bachelor thesis analyses the corporate identity and corporate image of the company Renault Česká Republika, a.s. The aim of the thesis is to examine the current state of the corporate identity and image from the perception point of the employees and to make recommodations to better the current situation of the corporate identity and with that, the corporate image if needed. The first, theoretical part of the thesis further introduces the corporate identity, its components and their contr...

  1. Dårlig søvn er en trussel mod helbredet

    Clark, Alice Jessie; Jørgensen, Thea Suldrup; Bonke, Jens


    Long-term sleep impairment is related to an increased risk of somatic health problems, e.g. overweight, Type 2 diabe­tes, cardiovascular disease and premature death. Avoidance of caffeine, alcohol, energy-rich or fatty foods and light from computer screens close to bedtime may counteract impai...

  2. Strategische samenwerking van de grote mogendheden in de VN-Veiligheidsraad 1946-2000

    Noldus, J.C.F.


    The subject of this study is the strategic cooperation of the permanent members in the Security Council in the period 1946 2000. Because of their right of veto the cooperation of the permanent members has a significant influence on the functioning of the Council. The most important aspects of the co

  3. Moeders in de Mainstream: een genderanalyse van het werk van het VN-Kinderrechtencomite

    Brink, Marjoleine van den


    The relationship between women's rights and children's rights is strong and complex. Their rights and interests are often assumed to coincide, but in practice that is not necessarily the case. Granting rights to children may be to the benefit of women. However, appeals to the rights and best

  4. Freestanding mesoporous VN/CNT hybrid electrodes for flexible all-solid-state supercapacitors.

    Xiao, Xu; Peng, Xiang; Jin, Huanyu; Li, Tianqi; Zhang, Chengcheng; Gao, Biao; Hu, Bin; Huo, Kaifu; Zhou, Jun


    High-performance all-solid-state supercapacitors (SCs) are fabricated based on thin, lightweight, and flexible freestanding MVNN/CNT hybrid electrodes. The device shows a high volume capacitance of 7.9 F/cm(3) , volume energy and power density of 0.54 mWh/cm(3) and 0.4 W/cm(3) at a current density of 0.025 A/cm(3) . By being highly flexible, environmentally friendly, and easily connectable in series and parallel, the all-solid-state SCs promise potential applications in portable/wearable electronics.

  5. Právní úprava pokusů na zvířatech

    Zábojníková, Daniela


    Legal regulation of animal testing The diploma thesis is analyzing current legislation in the field of animal experiments. It is formed by five chapters and each chapter is concerned with different aspects of animal protection, when focusing on experimental animals in particular. The first chapter is divided into three subchapters and it is successively describing development of animal experiments, progress of legislation dealing with animal protection and experimental animal protection on th...

  6. Dårlig søvn er en trussel mod helbredet

    Clark, Alice Jessie; Jørgensen, Thea Suldrup; Bonke, Jens


    Long-term sleep impairment is related to an increased risk of somatic health problems, e.g. overweight, Type 2 diabetes, cardiovascular disease and premature death. Avoidance of caffeine, alcohol, energy-rich or fatty foods and light from computer screens close to bedtime may counteract impaired...... sleep. A quiet, dark and well-tempered bedroom and physical activity during the day may have a positive impact on sleep. Impaired sleep may be related to stress and conditions at home or at work. Psychological sleep treatment is free of adverse side effects with effects comparable to effects of medical...

  7. Dårlig søvn er en trussel mod helbredet

    Clark, Alice Jessie; Jørgensen, Thea Suldrup; Bonke, Jens;


    Long-term sleep impairment is related to an increased risk of somatic health problems, e.g. overweight, Type 2 diabetes, cardiovascular disease and premature death. Avoidance of caffeine, alcohol, energy-rich or fatty foods and light from computer screens close to bedtime may counteract impaired...

  8. Mezinárodně právní ochrana Antarktidy

    ŠULCOVÁ, Jana


    This thesis treats the subject of international status of Antarctic, environmental protection and Antarctic treaty system. It contains an overview of juridical documents about this area. History of Antarctic is mentioned in the attachments.

  9. Vztah lékař- pacient; trestněprávní aspekty

    Vrajíková, Melinda


    The purpose of my thesis is to analyse criminal aspects of the relationship between a doctor and an patient. The reason for my research is that I think this topic does not recive enough attention in Czech republic as it deserves. The thesis is composed of five chapters, each of them dealing with different aspects of doctors criminal lability. I dedicated m attention only to doctors criminal lability, not to the criminal liability of patient. Chapter One is introductory and defines basic termi...

  10. Corporate governace a její právní rámec

    Březina, Václav


    The master's thesis analyses the contemporary corporate governance standards and their legal framework. The paper describes the development of different corporate governance principles and the key legal pieces that regulate the corporate governance area (eg. Sarbanes-Oxley, Basel II, EC regulation). The core of the paper focuses on corporate governance failures that led to the current financial crisis, analyses their link to the corporate governance principles and describes the trends for dev...

  11. Discovery of a strong magnetic field in the rapidly rotating B2Vn star HR 7355

    Oksala, M E; Marcolino, W L F; Grunhut, J; Bohlender, D A; Manset, N; Townsend, R H D


    We report on the detection of a strong, organized magnetic field in the helium-variable early B-type star HR 7355 using spectropolarimetric data obtained with ESPaDOnS on CFHT by the MiMeS large program. We also present results from new V-band differential photometry obtained with the CTIO 0.9m telescope. We investigate the longitudinal field, using a technique called Least-Squares Deconvolution (LSD), and the rotational period of HR 7355. These new observations strongly support the proposal that HR 7355 harbors a structured magnetosphere similar to that in the prototypical helium-strong star, sigma Ori E.

  12. An Analysis of the Use of Medical Applications Required for Complex Humanitarian Disasters and Emergencies via Hastily Formed Networks (HFN) in the Field


    reference software for nurses in all settings. $119.9 5 2005-03-31 NCLEX -RN®, 8th Ed. The top-selling NCLEX -RN® review reflects the current... NCLEX ® test plan and contains more than 5,000 total test questions-including alternate- format questions-to help students practice taking the exam


    Pablo Andrés Guzmán Durán


    Full Text Available Los recubrimientos duros son una alternativa para el mejoramiento superficial de herramientasindustriales, ya que son desarrollados con el fin de aumentar la vida de servicio del materialmediante un mejoramiento de sus características frente a mecanismos de desgaste yfenómenos corrosivos. En el presente estudio se depositaron monocapas de nitruro de hafniosobre sustratos de acero AISI 4140 mediante la técnica del magnetrón sputtering multi-blancoen r.f. (13.56 MHz. Esto se hizo con el objetivo de determinar valores estimados de la pérdidade material, el desgaste mecánico y la sinergia en los fenómenos corrosivos y erosivos con baseen la norma ASTM G119–03, que interrelaciona la corrosión con el desgaste. Las monocapasfueron evaluadas frente a fenómenos de corrosión-erosión, erosión y corrosión a dos ángulos deimpacto de 30º y 90º, en una solución compuesta por NaCl 0.5 M usando un equipo de incidenciade chorro de partícula. Se analizó el efecto del ángulo de impacto en la resistencia a la corrosiónerosión de estos recubrimientos. Mediante curvas de polarización Tafel y microscopia electrónicade barrido se realizó la evaluación electroquímica y la caracterización micro-estructural de losrecubrimientos respectivamente. Se observó un aumento en la velocidad de corrosión para lossistemas sometidos a 90° y una disminución para los sistemas a 30º.

  14. Developing a Fly-Away-Kit (FLAK) to Support Hastily Formed Networks (HFN) for Humanitarian Assistance and Disaster Relief (HA/DR)


    most people will agree that the global response to this disaster was unprecedented. It is the author’s belief that the greatest lesson learned is that...interface connecting to the satellite connection first before any remote configuring could be accomplished. The following list of lessons learned is...James L.; Perry, Michael W. Comunication During ComplexHmanitarian Emergencies: Using Technology to Bridge the Gap. Master Thesis. Naval

  15. Virtual Cloud Computing: Effects and Application of Hastily Formed Networks (HFN) for Humanitarian Assistance/Disaster Relief (HA/DR) Missions


    TERMINAL MEASUREMENTS...............53  C.  CHEETAH MEASUREMENTS ..................................................................57  D.  AN-TSC 168...connection.................................................................55  Figure 31.  Cheetah Earth Terminal...Tachyon or Cheetah earth terminal. The IP addresses are input into the terminal and the team establishes connectivity with the World Wide Web (WWW

  16. Electroreduction of N2 to ammonia at ambient conditions on mononitrides of Zr, Nb, Cr, and V – A DFT guide for experiments

    Abghoui, Younes; Garden, Anna L.; Howalt, Jakob Geelmuyden


    with only a -0.5 V overpotential, thereby avoiding decomposition. We suggest that this is a promising step towards the development of a method for synthesizing ammonia cheaply, to prepare high-value-added nitrogenous compounds directly from air, water and electricity at ambient conditions. An additional......A rapid and facile reduction of nitrogen to achieve a sustainable and energy efficient production of ammonia is critical to its use as a hydrogen storage medium, chemical feedstock and especially for manufacturing inorganic fertilizers. For a decentralization of catalytic ammonia production, small...... of molecular nitrogen to ammonia in aqueous media at ambient conditions with only a low applied bias. The most promising catalysts are VN, ZrN, NbN and CrN, which are identified among a range of transition metal nitride surfaces through a comprehensive density functional theory based analysis. All four...

  17. Electronic bonding analyses and mechanical strengths of incompressible tetragonal transition metal dinitrides TMN2 (TM = Ti, Zr, and Hf)

    Zhang, Meiguang; Cheng, Ke; Yan, Haiyan; Wei, Qun; Zheng, Baobing


    Motivated by recent successful synthesis of transition metal dinitride TiN2, the electronic structure and mechanical properties of the discovered TiN2 and other two family members (ZrN2 and HfN2) have been thus fully investigated by using first-principles calculations to explore the possibilities and provide guidance for future experimental efforts. The incompressible nature of these tetragonal TMN2 (TM = Ti, Zr, and Hf) compounds has been demonstrated by the calculated elastic moduli, originating from the strong N-N covalent bonds that connect the TMN8 units. However, as compared with traditional fcc transition metal mononitride (TMN), the TMN2 possess a larger elastic anisotropy may impose certain limitations on possible applications. Further mechanical strength calculations show that tetragonal TMN2 exhibits a strong resistance against (100)[010] shear deformation prevents the indenter from making a deep imprint, whereas the peak stress values (below 12 GPa) of TMN2 along shear directions are much lower than those of TMN, showing their lower shear resistances than these known hard wear-resistant materials. The shear deformation of TMN2 at the atomic level during shear deformation can be attributed to the collapse of TMN8 units with breaking of TM-N bonds through the bonding evolution and electronic localization analyses.

  18. Unintentional carbide formation evidenced during high-vacuum magnetron sputtering of transition metal nitride thin films

    Greczynski, G.; Mráz, S.; Hultman, L.; Schneider, J. M.


    Carbide signatures are ubiquitous in the surface analyses of industrially sputter-deposited transition metal nitride thin films grown with carbon-less source materials in typical high-vacuum systems. We use high-energy-resolution photoelectron spectroscopy to reveal details of carbon temporal chemical state evolution, from carbide formed during film growth to adventitious carbon adsorbed upon contact with air. Using in-situ grown Al capping layers that protect the as-deposited transition metal nitride surfaces from oxidation, it is shown that the carbide forms during film growth rather than as a result of post deposition atmosphere exposure. The XPS signature of carbides is masked by the presence of adventitious carbon contamination, appearing as soon as samples are exposed to atmosphere, and eventually disappears after one week-long storage in lab atmosphere. The concentration of carbon assigned to carbide species varies from 0.28 at% for ZrN sample, to 0.25 and 0.11 at% for TiN and HfN, respectively. These findings are relevant for numerous applications, as unintentionally formed impurity phases may dramatically alter catalytic activity, charge transport and mechanical properties by offsetting the onset of thermally-induced phase transitions. Therefore, the chemical state of C impurities in PVD-grown films should be carefully investigated.

  19. Vnímání společnosti AutoCont jako zaměstnavatele

    Hrabík, Václav


    This diploma thesis deals with the perception of AutoCont company in the Czech labor market. The aim is to identify strengths and weaknesses from the perspective of job applicants and current employees and help attract more potential workers, ensuring greater satisfaction of existing ones and thereby achieve greater efficiency in the process of filling vacancies in the company. Reaching this goal will bring the necessary knowledge and information for HR department and top management of the co...

  20. EMERGING ILO(lNOSl£S: ii-n: Pnnnic HEALTH horror vn'rnniNAniA ...


    Apr 10, 2006 ... In the face ofinereased emerging human zoonotic diseases in the ... surveillance of these emerging zoonotic diseases. improving the cooperation between human health and .... agriculture and human medicine (Hoblet et al.

  1. Vnímání reklamy na sociální síti Facebook

    Brejcha, Jan


    This thesis is focused on advertising on social network Facebook. The aim of this thesis is to explore how Facebook users perceive different types of ads that appear on Facebook and to make comparisons in relation to advertising elsewhere on the Internet. In the first part of this thesis, different types of Internet advertising and social networks are characterized. Further there are described possible kinds of advertising on Facebook which appear on this social network and equivalents of the...

  2. Analýza vnímání genderových rolí

    Šuhajová, Irena


    Masters thesis "Analysis of perception of gender roles" describes opinions of current society on status of men and women. The objective of the diploma thesis is to gain information about how people perceive gender roles and gender stereotypes. It is very important to discover whether today society still follow gender stereotypes. The theoretical part focuses on description of gender history from period of industry revolution to the present. Furthermore, it defines and deeply describes gender ...

  3. Trestněprávní ochrana životního prostředí

    Bejčková, Pavla


    The main goal of the thesis is to answer the question, whether the current Czech criminal legislation enables effective punishment of serious environmental offences and ensures the enforcement of rules on environmental protection in a more efficient way than administrative sanctions. Protection of the environment through the criminal law can be traced in the Czech Republic back to 1980s. However, criminal law has until now played only marginal role in the sanctioning of offences against the e...

  4. Apophatic way: darkness or light? (interpretation of the apophatic way in the theology of V.N. Lossky

    V. V. Limonchenko


    Full Text Available Consideration of apophatics by V. Lossky realized through the establishment of two measurements that may explicate by reference to the texts of Dionysius the Areopagite. The significance of Dionysius the Areopagite in pointing out some not having gnostic­intellectual character mode of apophatic theology. Non­intellectualistic understanding of apophaticism may disclose through the understanding of the image of the Divine Darkness. Ignorance alleged mystical theology is not a state of negative character or a simple lack of knowledge, it is obvious affinity act of aesthetic contemplation, not allowing yourself to express the statement, but supposing the real presence, indicating stepping over the edge, extasys. But the ecstatic character of apophaticism makes sense of not the ecstatic visions, images, and the need to cleanse and going beyond the usual state: apophaticism is a disposition of mind, refuses drafting concepts of God that is not possible by turning off the thought, but deepening it to the primacy of reason, pre­predicative and pre­logical, turning the idea into an existential position. In the image of the Divine Darkness, correlated to the Divine Light, easy to see antinomy, but cannot see agnosticism closeness of God. In the light of existential understanding apophaticism it can be understood as the ultimate existential exposure, when the experience of others does not guarantee the encounter with God, this is the way that can only pass on their own. There is no unauthorized individualism but there is enduring on himself, that is, both intellectually and apophaticism­dialectical procedure, and how vital existential entering into communion with God is experienced in its nature.

  5. Analýza vnějšího prostředí pro vybranou firmu

    ONDOKOVÁ, Lucie


    The aim of my bachelor thesis was to appreciate the current situation and market position of the building company Milan Hodboď through analysis of external environment.For analyse of external environment I used STEP analyse and Porter´s model of five powers. STEP analyse detects effects from macroenvironment (social and cultural, technical and technological, economic, political and legislative). Porter´s model five forces studies microenvironment (new competition, customers, suppliers, substi...

  6. Právní aspekty korupce policie a soudů v ČR

    Štěrba, Ondřej


    This bachelor thesis focuses on the law aspects of corruption of police and courts in the Czech Republic. Theoretical part describes historical development of corruption and how its perception has changed during the development of our society, definition of corruption and crimes which it comes from. Next part presents structure and function of governmental anti-corruption organisations - police, courts and prosecution and non-governmental organisations represented by Anti-Corruption Endowment...

  7. Hate speech v české právní teorii a mediální praxi

    Moravová, Veronika


    This bachelor thesis deals with the topic of "hate speech" in relation to the freedom of expression. In the first part, I went into the legislation on freedom of expression and hate speech in our legal system. I devoted a considerable part to international treaties concerning this issue that, according to the Constitution, are a part of our laws and base of the national legislation to a great extent. There are two different approaches to the freedom of expression - the American and European o...

  8. Formy právní ochrany počítačových programů

    Šurina, Štefan


    ❘❡s✉♠é ✈ ❛♥❣❧✐❝❦é♠ ❥❛③②❝❡✴❆❜str❛❝t ❋♦r♠s ♦❢ ▲❡❣❛❧ Pr♦t❡❝t✐♦♥ ♦❢ ❈♦♠♣✉t❡r Pr♦❣r❛♠s ❚❤❡ ♣✉r♣♦s❡ ♦❢ t❤❡ t❤❡s✐s ✇❛s t♦ ♣r❡s❡♥t ❛ ❝♦♠♣r❡❤❡♥s✐✈❡ ♦✈❡r✈✐❡✇ ♦❢ ✈❛r✐♦✉s ♠❡t❤♦❞s ♦❢ ❝♦♠♣✉t❡r ♣r♦❣r❛♠s✬ ❧❡❣❛❧ ♣r♦t❡❝t✐♦♥✳ ❚❤♦s❡ ♠❡t❤♦❞s ✇❡r❡ r❛♥❣✐♥❣ ❢r♦♠ ❛❝❝❡♣t❡❞ t♦ ♣✉r❡❧② ❤②♣♦t❤❡t✐❝❛❧ ♦♥❡s✳ ❆❝❝♦r❞✐♥❣❧②✱ t❤❡ ♦✉t❧✐♥❡❞ ♠❡t❤♦❞♦❧✲ ♦❣② ✇❛s ❝♦♥str✉❡❞ t♦ ❝♦♠♣❧② ✇✐t❤ t❤✐s s❝❤❡♠❡✳ ❋✐rst ❢♦r♠✱ t❤❡ ❝♦♣②r✐❣❤t ♣r♦✲ t❡❝t✐♦♥ ❛s t❤❡ ♠♦st ❛❝❝❡♣t❡❞ ♦♥❡ ✇❛s t❤❡r❡❢♦r❡ ❞❡❛❧t ✇✐t❤ ♠♦st❧② ❢r♦♠ t❤❡ ♣❡rs♣❡❝t✐✈❡ ♦❢ ✐ts ♣r❛❝t✐❝❛❧ ❛♣♣❧...

  9. Measurement of the suppression and vn of heavy flavor muons in lead-lead collisions with the ATLAS detector

    Hu, Qipeng; The ATLAS collaboration


    ATLAS has measured the production of heavy flavor muons in 2.76 TeV pp and Pb+Pb collisions at the LHC. The measurements are performed over the transverse momentum range 4 < pT < 14 GeV and for five Pb+Pb centrality intervals. Backgrounds arising from in-flight pion and kaon decays, hadronic showers, and mis-reconstructed muons are statistically removed using a template fitting procedure. The heavy flavor muon differential cross-sections and per-event yields are measured in pp and Pb+Pb collisions, respectively. The nuclear modification factor, RAA , is observed to be independent of pT within uncertainties and to be less than unity, which indicates suppressed production of heavy flavor muons in Pb+Pb collisions. The heavy flavor muon yield is measured as a function of the azimuthal angle difference, phi-Psi_{2}, where the experimental event plane angle, Psi_{2} is measured in forward calorimeters that cover 3.2 < |y| < 4.9. Fourier coefficients associated with the cos(2(phi-Psi_{2})) modulation, v...

  10. Heavy flavor $R_\\text{AA}$ and $v_n$ in event-by-event viscous relativistic hydrodynamics

    Prado, Caio A G; Cosentino, Mauro R; Munhoz, Marcelo G; Noronha, Jorge; Suaide, Alexandre A P


    Recently it has been shown that a realistic description of the medium via event-by-event viscous hydrodynamics plays an important role in the long-standing $R_\\text{AA}$ vs. $v_2$ puzzle at high $p_T$. In this proceedings we begin to extend this approach to the heavy flavor sector by investigating the effects of full event-by-event fluctuating hydrodynamic backgrounds on the nuclear suppression factor and $v_2\\{2\\}$ of heavy flavor mesons and non-photonic electrons at intermediate to high $p_T$. We also show results for $v_3\\{2\\}$ of $B^0$ and D$^0$ for PbPb collisions at $\\sqrt{s}=2.76$ TeV.

  11. Analýza vnějšího prostředí pro vybranou firmu

    ONDOKOVÁ, Lucie


    The aim of my bachelor thesis was to appreciate the current situation and market position of the building company Milan Hodboď through analysis of external environment.For analyse of external environment I used STEP analyse and Porter´s model of five powers. STEP analyse detects effects from macroenvironment (social and cultural, technical and technological, economic, political and legislative). Porter´s model five forces studies microenvironment (new competition, customers, suppliers, substi...

  12. Vnější vztahy Katalánska: cesta k nezávislosti?

    Körtingová, Gabriela


    This bachelor thesis deals with Catalan's external action and its role in seeking independence. The research focuses on the strategy and institutions formed by the autonomous government of Catalonia since 1978, through which this autonomous community is seeking to get the idea of independence at international level and gain support for it. The aim of the thesis is to prove that foreign relations of a non-state entity could play an important role its efforts to promote independence, and to con...

  13. Energetická politika Japonska: vnitřní a vnější dopady

    Roštínský, Jakub


    Main purpose of this thesis is to give complex overview of energy policy development in Japan and to identify the impact of Fukushima accident on actual energy policy in Japan. Thesis is divided into five chapters. In the first chapter the emphasis is put on development in second half of 20th century in which were created foundations of Japanese energy policy. Second chapter is focused on analysis of energy policy during first decade of 21st century, when complex definition and structure of J...

  14. Evaluation of antibacterial activity and osteoblast-like cell viability of TiN, ZrN and (Ti1-xZrx)N coating on titanium


    PURPOSE The aim of this study was to evaluate antibacterial activity and osteoblast-like cell viability according to the ratio of titanium nitride and zirconium nitride coating on commercially pure titanium using an arc ion plating system. MATERIALS AND METHODS Polished titanium surfaces were used as controls. Surface topography was observed by scanning electron microscopy, and surface roughness was measured using a two-dimensional contact stylus profilometer. Antibacterial activity was evalu...

  15. Erosion-resistant coatings for gas turbine compressor blades

    Muboyadzhyan, S. A.


    The effect of ion-plasma coatings made from high-hardness metal compounds on the erosion and corrosion resistance and the mechanical properties of alloy (substrate) + coating compositions is comprehensively studied. The effects of the thickness, composition, deposition conditions, and design of coatings based on metal nitrides and carbides on the relative gas-abrasive wear of alloy + coating compositions in a gas-abrasive flux are analyzed. The flux contains quartz sand with an average fraction of 300-350 μm; the abrasive feed rate is 200 g/min; and the angles of flux incidence are 20° (tangential flow) and 70° (near-head-on attack flow). Alloy + coating compositions based on VN, VC, Cr3C2, ZrN, and TiN coatings 15-30 μ m thick or more are shown to have high erosion resistance. A detailed examination of the coatings with high erosion resistance demonstrates that a zirconium nitride coating is most appropriate for protecting gas turbine compressor blades made of titanium alloys; this coating does not decrease the fatigue strength of these alloys. A chromium carbide coating is the best coating for protecting compressor steel blades.

  16. Hardness analysis of cubic metal mononitrides from first principles

    Fulcher, B. D.; Cui, X. Y.; Delley, B.; Stampfl, C.


    Density functional theory calculations are performed to evaluate the hardness of various cubic metal nitrides: rocksalt TiN, VN, ZrN, NbN, AlN, and SiN; zincblende AlN and BN; and diamond C for comparison. The isotropic elastic stiffness constants cij, bulk modulus K, shear modulus G, Young's modulus E, and isotropic Poisson's ratio ν¯ are calculated. From simulated uniaxial stress-strain curves, ideal strength values σmax in the [100], [110], and [111] directions are also evaluated for all systems. In particular, rocksalt AlN is found to possess both high elastic moduli and ideal strength. These quantities are then compared for correlations with existing experimental Vicker's hardness data. The bulk modulus is found to be a poor indicator of hardness, while E, G, 1/ν¯, and σmax all exhibit stronger correlations. With a view to circumvent the need to run computationally expensive relaxation steps, different methodologies for approximating uniaxial stress-strain curves are introduced. Utilizing the anisotropic Poisson's ratio to approximate the relaxed transverse lattice parameters at a given axial strain is a good approximation to stress-strain curves, and the ideal strengths obtained in this way exhibit strong correlations to experimental Vicker's hardness values.

  17. Headway statistics of public transport in Mexican cities 05.65.+b Self-organized systems; 45.70.Vn Granular models of complex systems; traffic flow;

    Krbalek, M


    We present a cellular automaton simulating the behaviour of public bus transport in several Mexican cities. The headway statistics obtained from the model is compared to the measured time intervals between subsequent bus arrivals to a given bus stop and to a spacing distribution resulting from a random matrix theory. (letter to the editor)

  18. Automatizace rozvodny VN s využitím řídicího systému COM600 a standardu IEC61850

    Havelka, Tomáš


    Předkládaná práce se zabývá problematikou standardu IEC 61850 zvláště jeho kapitolou IEC 61850- 9-2 LE. Kapitola IEC 61850-9-2 LE je spíše známá jako komunikace Process bus. V práci jsou popsány rozšiřující nástroje použité v řídicím systému COM 600 a jejich detailní konfigurace. Dále se práce zabývá konfigurací standardu IEC 61850- 9-2 LE v ochranných terminálech rodiny Relion a její následné implementaci do řídicího systému COM 600. Hlavním cílem předkládané práce je konfigurování standardu...

  19. Vnímání zdravotních pojišťoven v Jihočeském kraji

    HYKOVÁ, Michaela


    In my thesis, I deal with the issue of perception of health insurance companies in the South Bohemian Region. That is, how South Bohemian citizens perceive health insurance companies and whether they are satisfied with the services that health insurance companies provide. In the theoretical part, I present basic information about public health insurance system in the Czech Republic. I mention the history of health insurance evolution, its systems, and principles of its operation. I also deal ...

  20. Mezinárodněprávní ochrana dětí v ozbrojených konfliktech

    Čechlovská, Soňa


    Children are particularly vulnerable individuals and therefore, they have particular rights under international law that recognize their special need for protection. Armed conflicts constitute the biggest threat to them. I have chosen this topic for admiring the strength of children affected by armed conflicts to face all the problems brought by armed conflicts. On the other hand, children are indispensable in reconciliation and reconstruction of society. The aim of the thesis is to describe ...

  1. Vnímání značek Coca Cola a Kofola na českém trhu

    Svobodová, Julie


    The bachelor thesis explores perception of the brands Coca-Cola and Kofola on the Czech market. The objective of this thesis is to analyse and compare perception of these brands by the Czech consumers and consequently propose proceedings to improve marketing strategies of these comapnies. In the theoretical part I attend to brand issue and methods of marketing research. In the practical part I present companies Coca-Cola and Kofola, proceed quantitative research by the method of semantic diff...

  2. Právní politika v oblasti geneticky modifikovaných organismů a ochrana spotřebitele

    Skálová, Petra


    This Bachelor thesis is focused on genetic engineering and its results. The aim is to familiarize the reader with the issue of biotechnology and its products, which are genetically modified organisms. The introduction of the work explains the basic concepts and describes the history of the biotechnology and genetic modifications in general. In this part are also listed examples of genetic modifications including information about testing and practical application in the Czech Republic. This s...

  3. Úroveň právní ochrany zdravotnického záchranáře v praxi

    CUPER, Tomáš


    Members of the ambulance teams of Emergency Medical Services are increasingly becoming victims of assaults by patients, their close relatives or passers-by. Many of them does not end with only verbal threat or insult, but also with direct physical confrontations that affect not only the quality of pre-hospital care provided, but also the physical and psychological state of the crew members. On the contemporary risk of reprisal attacks aren't members of the Emergency Medical Service adequately...

  4. Diskriminace v pracovně právních vztazích - mobbing, bossing a stalking

    Liebichová, Eva


    The thesis defines forms of discriminative behaviors with focus on relationships in the workplace. It lists and evaluates legal tools that can be used for handling dangerous forms of workplace harassment (in Czech as well as in other legal systems). The thesis may serve to employers as well as employees in order to help them prevent identify and fight against discriminative behaviors in the workplace.

  5. Event-plane-dependent dihadron correlations with harmonic vn subtraction in Au + Au collisions at s NN =200 GeV

    Agakishiev, H.; Aggarwal, M. M.; Ahammed, Z.; Alakhverdyants, A. V.; Alekseev, I.; Alford, J.; Anderson, B. D.; Anson, C. D.; Arkhipkin, D.; Averichev, G. S.; Balewski, J.; Beavis, D. R.; Behera, N. K.; Bellwied, R.; Betancourt, M. J.; Betts, R. R.; Bhasin, A.; Bhati, A. K.; Bichsel, H.; Bielcik, J.; Bielcikova, J.; Biritz, B.; Bland, L. C.; Borowski, W.; Bouchet, J.; Braidot, E.; Brandin, A. V.; Bridgeman, A.; Brovko, S. G.; Bruna, E.; Bueltmann, S.; Bunzarov, I.; Burton, T. P.; Cai, X. Z.; Caines, H.; De La Barca Sánchez, M. Calderón; Cebra, D.; Cendejas, R.; Cervantes, M. C.; Chajecki, Z.; Chaloupka, P.; Chattopadhyay, S.; Chen, H. F.; Chen, J. H.; Chen, J. Y.; Chen, L.; Cheng, J.; Cherney, M.; Chikanian, A.; Choi, K. E.; Christie, W.; Chung, P.; Codrington, M. J M; Corliss, R.; Cramer, J. G.; Crawford, H. J.; Dash, S.; Leyva, A. Davila; De Silva, L. C.; Debbe, R. R.; Dedovich, T. G.; Derevschikov, A. A.; De Souza, R. Derradi; Didenko, L.; Djawotho, P.; Dogra, S. M.; Dong, X.; Drachenberg, J. L.; Draper, J. E.; Dunlop, J. C.; Efimov, L. G.; Elnimr, M.; Engelage, J.; Eppley, G.; Estienne, M.; Eun, L.; Evdokimov, O.; Fatemi, R.; Fedorisin, J.; Feng, A.; Fersch, R. G.; Filip, P.; Finch, E.; Fine, V.; Fisyak, Y.; Gagliardi, C. A.; Gangadharan, D. R.; Geromitsos, A.; Geurts, F.; Ghosh, P.; Gorbunov, Y. N.; Gordon, A.; Grebenyuk, O.; Grosnick, D.; Guertin, S. M.; Gupta, A.; Guryn, W.; Haag, B.; Hajkova, O.; Hamed, A.; Han, L. X.; Harris, J. W.; Hays-Wehle, J. P.; Heinz, M.; Heppelmann, S.; Hirsch, A.; Hjort, E.; Hoffmann, G. W.; Hofman, D. J.; Huang, B.; Huang, H. Z.; Humanic, T. J.; Huo, L.; Igo, G.; Jacobs, P.; Jacobs, W. W.; Jena, C.; Jin, F.; Joseph, J.; Judd, E. G.; Kabana, S.; Kang, K.; Kapitan, J.; Kauder, K.; Ke, H.; Keane, D.; Kechechyan, A.; Kettler, D.; Kikola, D. P.; Kiryluk, J.; Kisiel, A.; Kizka, V.; Knospe, A. G.; Koetke, D. D.; Kollegger, T.; Konzer, J.; Koralt, I.; Koroleva, L.; Korsch, W.; Kotchenda, L.; Kouchpil, V.; Kravtsov, P.; Krueger, K.; Krus, M.; Kumar, L.; Kurnadi, P.; Lamont, M. A C; Landgraf, J. M.; Lapointe, S.; Lauret, J.; Lebedev, A.; Lednicky, R.; Lee, J. H.; Leight, W.; Levine, M. J.; Li, C.; Li, L.; Li, N.; Li, W.; Li, X.; Li, X.; Li, Y.; Li, Z. M.; Lisa, M. A.; Liu, F.; Liu, H.; Liu, J.; Ljubicic, T.; Llope, W. J.; Longacre, R. S.; Love, W. A.; Lu, Y.; Lukashov, E. V.; Luo, X.; Ma, G. L.; Ma, Y. G.; Mahapatra, D. P.; Majka, R.; Mall, O. I.; Mangotra, L. K.; Manweiler, R.; Margetis, S.; Markert, C.; Masui, H.; Matis, H. S.; Matulenko, Yu A.; McDonald, D.; McShane, T. S.; Meschanin, A.; Milner, R.; Minaev, N. G.; Mioduszewski, S.; Mischke, A.; Mitrovski, M. K.; Mohanty, B.; Mondal, M. M.; Morozov, B.; Morozov, D. A.; Munhoz, M. G.; Naglis, M.; Nandi, B. K.; Nayak, T. K.; Netrakanti, P. K.; Nogach, L. V.; Nurushev, S. B.; Odyniec, G.; Ogawa, A.; Oh, K.; Ohlson, A.; Okorokov, V.; Oldag, E. W.; Olson, D.; Pachr, M.; Page, B. S.; Pal, S. K.; Pandit, Y.; Panebratsev, Y.; Pawlak, T.; Pei, H.; Peitzmann, T.; Perkins, C.; Peryt, W.; Phatak, S. C.; Pile, P.; Planinic, M.; Ploskon, M. A.; Pluta, J.; Plyku, D.; Poljak, N.; Poskanzer, A. M.; Potukuchi, B. V K S; Powell, C. B.; Prindle, D.; Pruthi, N. K.; Pujahari, P. R.; Putschke, J.; Qiu, H.; Raniwala, R.; Raniwala, S.; Redwine, R.; Reed, R.; Ritter, H. G.; Roberts, J. B.; Rogachevskiy, O. V.; Romero, J. L.; Rose, A.; Ruan, L.; Rusnak, J.; Sahoo, N. R.; Sakai, S.; Sakrejda, I.; Sakuma, T.; Salur, S.; Sandweiss, J.; Sangaline, E.; Sarkar, A.; Schambach, J.; Scharenberg, R. P.; Schmah, A. M.; Schmitz, N.; Schuster, T. R.; Seele, J.; Seger, J.; Selyuzhenkov, I.; Seyboth, P.; Shahaliev, E.; Shao, M.; Sharma, M.; Shi, S. S.; Shou, Q. Y.; Sichtermann, E. P.; Simon, F.; Singaraju, R. N.; Skoby, M. J.; Smirnov, N.; Spinka, H. M.; Srivastava, B.; Stanislaus, T. D S; Staszak, D.; Steadman, S. G.; Stevens, J. R.; Stock, R.; Strikhanov, M.; Stringfellow, B.; Suaide, A. A P; Suarez, M. C.; Subba, N. L.; Sumbera, M.; Sun, X. M.; Sun, Y.; Sun, Z.; Surrow, B.; Svirida, D. N.; Symons, T. J M; De Toledo, A. Szanto; Takahashi, J.; Tang, A. H.; Tang, Z.; Tarini, L. H.; Tarnowsky, T.; Thein, D.; Thomas, J. H.; Tian, J.; Timmins, A. R.; Tlusty, D.; Tokarev, M.; Tram, V. N.; Trentalange, S.; Tribble, R. E.; Tribedy, P.; Tsai, O. D.; Ullrich, T.; Underwood, D. G.; Van Buren, G.; Van Nieuwenhuizen, G.; Vanfossen, J. A.; Varma, R.; Vasconcelos, G. M S; Vasiliev, A. N.; Videbæk, F.; Viyogi, Y. P.; Vokal, S.; Wada, M.; Walker, M.; Wang, F.; Wang, G.; Wang, H.; Wang, J. S.; Wang, Q.; Wang, X. L.; Wang, Y.; Webb, G.; Webb, J. C.; Westfall, G. D.; Whitten, C.; Wieman, H.; Wissink, S. W.; Witt, R.; Witzke, W.; Wu, Y. F.; Xiao, Z.; Xie, W.; Xu, H.; Xu, N.; Xu, Q. H.; Xu, W.; Xu, Y.; Xu, Z.; Xue, L.; Yang, Y.; Yepes, P.; Yip, K.; Yoo, I. K.; Zawisza, M.; Zbroszczyk, H.; Zhan, W.; Zhang, J. B.; Zhang, S.; Zhang, W. M.; Zhang, X. P.; Zhang, Y.; Zhang, Z. P.; Zhao, J.; Zhong, C.; Zhou, W.; Zhu, X.; Zhu, Y. H.; Zoulkarneev, R.; Zoulkarneeva, Y.


    STAR measurements of dihadron azimuthal correlations (Δφ) are reported in midcentral (20-60%) Au+Au collisions at sNN=200 GeV as a function of the trigger particle's azimuthal angle relative to the event plane, φs=|φt-ψEP|. The elliptic (v2), triangular (v3), and quadratic (v4) flow harmonic backgro

  6. Vnímání značky SAM 73 u cílových skupin

    Talácková, Jitka


    This thesis deals with SAM 73 brand perception of brand's target groups. The thesis consists of two parts. The theoretical part deals with marketing essentials, brand, marketing research and types of commercial communication. The practical part is dedicated to the introduction of SAM 73 brand, which is a sportswear and leisurewear manufacturer, and evaluation of the research based on questioning. In the last part the thesis proposes ideas for improvement of the brand communication.

  7. Vybrané právní formy podnikání zahraničního subjektu v ČR

    Pacovský, Martin


    The work deals with the topic of entry of foreign entrepreneurs to the Czech market on the background of two different forms of business - franchising and a limited liability company. The main topic concentrates on the comparison of legislation and contractual framework of these two business forms, primarily focusing on intellectual property and the protection of intangible assets. The work presents general legal provisions related to contracts in the field of intellectual property rights, in...

  8. Analýza vnějšího prostředí vybraného podnikatelského subjektu

    PLACHÁ, Veronika


    The bachelor thesis has got two parts. The first is theoretical frame work. There are the terms of the area explained, for example enterprise, business, strategy and external analysis. The practical part focuses on the analysis of a medium-sized company. Based on observations and interviews with company management, the thesis processes SWOT analysis, PESTE analysis and method of Porter´s five forces model.

  9. Vnímání reklamy a in-store komunikace českým spotřebitelem

    Kozel, Adam


    The main aim of this bachelor thesis is to analyse the contemporary position of advertisement in mass media and in-store communication on the Czech market and simultaneously, based on carried out marketing research, evaluate the way how Czech consumers perceive these two forms of communication mix. The thesis is divided into two parts. The theoretical part focuses on basic terms, division, practical examples, characteristic feature and function of advertisement and in-store communication on t...

  10. Dětská oděvní kultura v historických a sociálních kontextech

    Pitrová, Pavlína


    The theme of my thesis is "Children's Clothing Culture in Historical and Social Contexts". I was interested in how children's clothing culture developed and was formed throughout the centuries, particularly from the middle ages towards the end of the 19th century and how the approaches to children and their clothing were influenced by societal, cultural and economic values. Furthermore I also questioned whether it is possible to outline the changes of children's standing in society through ch...

  11. Vnímání homosexuality učiteli mateřských škol

    PREXLOVÁ, Julie


    This baccalaureate work deals with homosexuality in context of parenthood and child upbringing. It also deals with kindergarten teachers attitudes of this theme. Work is divided into those parts: theoretical and practical part. Theoretical part collected facts about homosexual phenomen for comprehension of the life of homosexuals. Here I also deals with gender and profession education of kindergarten teachers. At this theoretical base I want to show a social institucionaly ? preschool platfor...

  12. Ochrana spotřebitele v dopravě v právní úpravě EU

    Kaľavská, Tereza


    Thesis "Consumer Protection in transport in EU legislation" deals with consumer protection in specific areas. This thesis defined the rights and obligations of air passengers, rail transport, bus and coach transport and consumer protection when traveling by sea and inland waterways. The thesis is also exploring the awareness of EU citizens of their rights by the European Commission - Eurobarometer. Thesis is processed by analysis and comparison of selected judgments of the Court of Justice of...

  13. Vnímání homosexuality učiteli mateřských škol

    PREXLOVÁ, Julie


    This baccalaureate work deals with homosexuality in context of parenthood and child upbringing. It also deals with kindergarten teachers attitudes of this theme. Work is divided into those parts: theoretical and practical part. Theoretical part collected facts about homosexual phenomen for comprehension of the life of homosexuals. Here I also deals with gender and profession education of kindergarten teachers. At this theoretical base I want to show a social institucionaly ? preschool platfor...

  14. Vliv digitalizace na české mediální právo a právní prostředí

    Zápotocký, Jan


    The diploma thesis The influence of digitization on the Czech media law and legal environment deals with the transformation of media law and legal environment during the transition from analogue to digital broadcasting in the Czech Republic. The text describes and evaluates change of the broadcasting legislation, and emphasizes not only the actual changes in legal regulations, but also the legislative process and influences that have affected the final text of the laws. In the introduction th...

  15. Porovnání etických a právních pravidel upravujících reklamu

    Hübnerová, Daniela


    This diploma thesis deals with commercials aimed at children, and compares the ethical regulation and the legislation by which the commercial is regulated. First of all, the regulation dealing with commercials is briefly described, then the focus of the thesis shifts towards the effects that commercials have on children and also towards the specific legislation that pertains to the child-oriented commercials. Furthermore, the thesis discusses the importance of legal rules and the Code of Cond...

  16. Exekuce na dávky sociálního zabezpečení - právní zhodnocení

    Šimůnková, Marie


    This thesis deals with the execution of social security benefits. The thesis is divided into six chapters, which are broken down into subsections. It also includes an introduction and a conclusion. The first chapter describes the batch system in the Czech Republic. After defining the concept of social security benefit, the principles are described in the provision of social security benefits and the breakdown of social security benefits. Furthermore, according to the systems of social securit...

  17. Analýza vnějšího prostředí vybraného podnikatelského subjektu

    Plachá, Veronika


    The bachelor thesis has got two parts. The first is theoretical frame work. There are the terms of the area explained, for example enterprise, business, strategy and external analysis. The practical part focuses on the analysis of a medium-sized company. Based on observations and interviews with company management, the thesis processes SWOT analysis, PESTE analysis and method of Porter´s five forces model.

  18. Concomitant caries and calculus formation from in situ dentin caries model [v1; ref status: indexed,

    Frederico B de Sousa


    Full Text Available The aim of this study was to test the possibility of the concomitant formation of calculus deposits and caries from in situ dentin caries model for short time periods. Six volunteers wore palatal removal appliances with four polished dentin specimens protected from intra-oral mechanical forces for up to 14 days. Each volunteer applied a 50% sucrose solution (four times a day on the specimens and performed a daily mouthwash with 0.05% NaF. Samples were removed after 2, 5, 9 and 14 days in situ. Demineralization was analyzed by stereomicroscopy and SEM (secondary electrons and backscattered electrons modes and calculus was analyzed by energy dispersive spectroscopy and fluorescence spectroscopy. Seventeen samples, at least one sample from each volunteer, presented dental calculus on both carious and non-carious ones, detected in all time intervals. Ca/P ratios of dental calculus ranged from 1.1 to 1.7. Some large calculus deposits on carious surfaces were confirmed by fluorescence. In conclusion, concomitant caries and calculus formation can be found in dentin caries formed in situ. This has important repercussions on the study of surface phenomena on the interface between hard dental tissues and dental plaque.

  19. Effects of PEGylation on biomimetic synthesis of magnetoferritin nanoparticles

    Yang, Caiyun; Cao, Changqian; Cai, Yao; Xu, Huangtao; Zhang, Tongwei; Pan, Yongxin


    Recent studies have demonstrated that ferrimagnetic magnetoferritin nanoparticles are a promising novel magnetic nanomaterial in biomedical applications, including biocatalysis, imaging, diagnostics, and tumor therapy. Here we investigated the PEGylation of human H-ferritin (HFn) proteins and the possible influence on biomimetic synthesis of magnetoferritin nanoparticles. The outer surface of HFn proteins was chemically modified with different PEG molecular weights (PEG10K and PEG20K) and different modification ratios (HFn subunit:PEG20K = 1:1, 1:2, 1:4). The PEGylated HFn proteins were used for biomimetic synthesis of ferrimagnetic magnetoferritin nanoparticles. We found that, compared with magnetoferritin using non-PEGylated HFn protein templates, the synthesized magnetoferritin using the PEGylated HFn protein templates possessed larger magnetite cores, higher magnetization and relaxivity values, and improved thermal stability. These results suggest that the PEGylation of H-ferritin may improve the biomineralization of magnetoferritin nanoparticles and enhance their biomedical applications.

  20. Pressure-stabilized hafnium nitrides and their properties

    Zhang, Jin; Oganov, Artem R.; Li, Xinfeng; Niu, Haiyang


    We report hafnium nitrides under pressure using first-principles evolutionary calculations. Metallic P 63/m m c -HfN (calculated Vickers hardness 23.8 GPa) is found to be more energetically favorable than NaCl-type HfN at zero and high pressure. Moreover, NaCl-type HfN actually undergoes a phase transition to P 63/m m c -HfN below 670 K at ambient pressure. HfN10, which simultaneously has infinite armchairlike polymeric N chains and N2 molecules in its crystal structure, is discovered to be stable at moderate pressure above 23 GPa and can be preserved as a metastable phase at ambient pressure. At ambient conditions (298 K, 0 GPa), the gravimetric energy densities and the volumetric energy densities of HfN10 are 2.8 kJ/g and 14.1 kJ/cm3, respectively.

  1. Hair Follicle Nevus: A Case Report

    İnci Mevlitoğlu


    Full Text Available Hair follicle nevus (HFN is a rare hamartoma showing follicular differentiation. Hamartomas are benign tumoral formations caused by overproduction of normal tissues and cells. HFN was first introduced by Gans et al in 1928. There are a few reports in literature on HFN appearing as multiple lesions, which is often observed as a single papule or nodule. We are hereby present our patient having complaints beginning in early childhood as his lesions might be confused with other dermatoses located on face area. As far as we know, our patient is the first HFN case with bilateral, multiple, perioral, perinasal, periorbital and genital involvements.

  2. Komparace právní úpravy veřejné obchodní společnosti v českém a německém právním řádu

    Szabóová, Katarína


    COMPARISON OF THE LEGAL ADJUSTMENT OF THE GENERAL PARTNERSHIP IN THE CZECH AND GERMAN LEGAL SYSTEMS Abstract: The purpose of my thesis is to analyse the differences and similarities between the general partnership in the Czech and German legal system. The reason for my research is to identify the differences and the similarities between the two companies mentioned above to demonstrate how the laws and legal adjustments in different countries of the European Union are. The thesis is composed o...

  3. Surface and sub-surface oxidation of thin films using Low Energy Ion Scattering

    Coloma Ribera, R.; van de Kruijs, Robbert Wilhelmus Elisabeth; Sturm, Jacobus Marinus; Yakshin, Andrey; Bijkerk, Frederik


    Ru and ZrN are candidate capping layers for applications such as catalysis, electronics and optical coatings: Ru exhibits a low resistivity, high thermal stability, excellent oxidation resistance and good diffusion capabilities. ZrN is thermally stable, and is known for its good mechanical


    there has been established the conformity to law of the growth of the hardest layers-the - solid solution and nitride of zirconium ZrN. An equation...has been found which connects the summary thickness of the films of ZrN and the alpha- solid solution with the temperature and time of the nitration

  5. Analýza vývoje vnímání národní identity německou CDU v letech 1990–2009

    Michal Vít


    Full Text Available The paper aims to explain the development of the perception of national identity of the Christian Democratic Party (CDU, the strongest German political party in the past few decades. The paper focuses on election manifestos for the 1990, 1994, 1998, 2002, 2005, and 2009 elections. For this purpose, each manifesto is examined according to up to five analytical categories – such as values, nation, Europe, threats, and society. These categories explore the party’s perception in a wider context instead of focusing only on direct  references to national identity. The analysed period was divided into three phases with an emphasis on the internal crisis between the years 1998 and 2002. The crisis influenced policy priorities; therefore the perceptions of elements belonging to national identity were changed in order i to gain victory in the general elections in 2002 and 2005, and ii to reflect properly the state of German society. Therefore, significant policy shifts were made. These policy changes show how the party successfully integrated societal demands and preferences over the past decade. Thank to this, the CDU incorporated both conservative and liberal elements. This is evident in the case of incorporating liberal elements such as homosexual partnerships while, at the same time, actively stressing the importance of defending national interests.

  6. Potřeba jednotného vnímání výstupů manažerského účetnictví v podniku

    Sipták, Roman


    In this thesis I'm devoted to united perception of outputs of management accounting in company. With different perception the company has problems with communication and evaluation of set targets. Furthermore there are problems in communication between departments and in the end even generation of large quantity of duplicate outputs. The example of insurance company and bank showed that the solution isn't just implementation of place of one truth in company (data warehouse) but there is a nee...

  7. Alternativní zdroje energie a jejich právní úprava v kontextu českého a komunitárního práva

    Walas, Patrik


    Alternative sources of energy and their legal regulation in the context of the Czech and the Community law The purpose of my thesis is to analyze alternative or renewable sources of energy. The aim of the thesis is to examine the legal background of renewable sources in the law of European Union and the Czech law. Renewable sources of energy are fundamental instrument to deal with such challenges as environmental protection, climate change and energy security. Author outlines importance of th...

  8. Možnosti fyzioterapeutické léčby u osob po cévní mozkové příhodě

    KUBÁTOVÁ, Radka


    The topic of this thesis is Options of physiotherapy treatment in patients after stroke. The objective of the thesis is to survey physiotherapy-nursing care for patients after stroke and to describe current possibilities and quality of physiotherapy care for patients after stroke The thesis deals with possibilities of physiotherapy treatment and cooperation between nursing and physiotherapy staff. One of the targets is description of physiotherapy care for patients after stroke which is docum...

  9. Nekalá soutěž se zaměřením na klamavou reklamu a její vnímání spotřebiteli

    Bukvová, Tereza


    The bachelor thesis is dealing with unfair competition focusing primarily on false advertising and it's perception of consumers. Theoretical part is focusing on expla-nation of terms related to unfair competition, advertising and false advertising and further legal as well as extralegal protection of consumer against false advertising. In practical part, I have dealt with questionnaire survey whose purpose was to determine how consumers perceive false advertising and if they are aware how to ...

  10. Ochrana osobnosti v bulvárních médiích v českém a anglickém právním prostředí

    Smolková, Kateřina


    Protection of personality in the tabloid media in Czech and English legal environment Abstract in English The purpose of this work is to analyze the approach to the protection of personal rights in the media with regard to the nature of the tabloid media. The main goal of this work is to describe the approach to the protection of personal rights in the Czech Republic and in England in relation to the media, especially the tabloid character, interfaces and vice versa differences in it. The wor...

  11. CSP流程钒氮微合金化X60钢的强化机理%Strengthening Mechanism of V-N Microalloyed X60 Pipeline Steel Produced by Compact Strip Production Line

    苏世怀; 何宜柱; 胡学文; 刘学伟; 翁宇庆


    通过钒氮微合金化,在转炉CSP生产线上开发了超细晶、高韧性API-X60管线钢,通过实验研究了X60的组织、性能,探讨了X60的强化机制.结果表明,X60的金相组织由多边形铁素体和微量珠光体组成,铁素体晶粒尺寸细化到了5μm以下.CSP流程存在V(C,N)析出不充分的现象.X60的主要强化机制为细晶强化,另外,V(C,N)沉淀强化产生的强度增量约为60 MPa,纳米夹杂析出物产生的强度增量约为40 MPa.

  12. Sociální sítě jako marketingový nástroj (se zaměřením na oděvní průmysl)

    Nikolaeva, Anastasia


    The bachelor thesis concerns social networks as a marketing tool with focus on fashion industry. After a brief introduction to marketing theory social networks as a mean of modern communication are introduced. The following practical part demonstrates use of social networks for commercial communications on examples of three international fashion corporations. The conclusion should assess different approaches of the companies to marketing in social networks and an attempt to identify possible ...

  13. Marketingový výzkum spokojenosti návštěvníků sportovně-hudební akce Bm(X)treme fest 2013

    Čermák, Roman


    Title: Marketing research of visitors'satisfaction at sport and music event Bm(X)treme fest 2013 Objectives: The goal is to analyze results of visitors'satisfaction research. Furthermore, on the basis of the results obtained to develop proposals which should be directed to increase of visitors' satisfaction. Methods: Visitors satisfaction research has been done by electronic questioning. Research sample was randomly selected from the visitors of that event. Results: The obtained data are arra...

  14. Most cases of cryptococcal meningitis in HIV-uninfected patients in Vietnam are due to a distinct amplified fragment length polymorphism-defined cluster of Cryptococcus neoformans var. grubii VN1.

    Day, Jeremy N; Hoang, Thu N; Duong, Anh V; Hong, Chau T T; Diep, Pham T; Campbell, James I; Sieu, Tran P M; Hien, Tran T; Bui, Tien; Boni, Maciej F; Lalloo, David G; Carter, Dee; Baker, Stephen; Farrar, Jeremy J


    Cryptococcal disease most commonly occurs in patients with an underlying immune deficit, most commonly HIV infection, and is due to Cryptococcus neoformans var. grubii. Occasionally disease due to this variety occurs in apparently immunocompetent patients. The relationship between strains infecting immunosuppressed and immunocompetent patients is not clear. Amplified fragment length polymorphism (AFLP) analysis was used to characterize the relationship between strains infecting HIV-infected and uninfected patients. Isolates from 51 HIV-uninfected patients and 100 HIV-infected patients with cryptococcal meningitis were compared. C. neoformans var. grubii VNI was responsible for infections in 73% of HIV-uninfected and 100% of HIV-infected patients. AFLP analysis defined two distinct clusters, VNIγ and VNIδ. The majority (84%) of isolates from HIV-uninfected patients were VNIγ, compared with only 38% of isolates from HIV-infected patients (odds ratio, 8.30; 95% confidence interval [CI], 3.04 to 26.6; P cryptococcal meningitis in Vietnam. The distribution of these clusters differs according to the immune status of the host.

  15. Research on the Mathematical Modeling for Dynamic Recrystallization of V-N Microalloyed Steel%钒氮微合金钢的动态再结晶数学模型研究

    赵宝纯; 赵坦; 李桂艳


    利用Gleeble-3800热模拟试验机对含钒微合金钢进行了温度范围为900~1 050℃,应变速率范围为0.1~10s-1的单道次压缩试验,得到了试验钢的应力-应变曲线.采用回归分析法确定了双曲线本构方程中的材料常数,动态再结晶激活能和临界应变量与Z参数的关系.根据该试验钢发生动态再结晶的条件,建立了其动态再结晶图.%Single — pass compressing tests were performed with the Gleeble — 3800 thermo-mechanical simulator at the temperature of 900℃ to 1 050℃ and strain rate of 0.1 s-1 to 10 s-1 to investigate the dynamic recrystallization behavior of a kind of vanadium-bearing microalloyed steel and the stress-strain curve was obtained as a result. By the regression analysis of the stress-strain data obtained from the test, the material parameters in the hyperbolic sine constitutive equation and the dynamic recrystallization activation energy, including the relationship between the critical strain and parameter Zener-Hollomon, were determined. Based on the conditions for the deformation, the dynamic recrystallization diagram of the tested steel was drawn.

  16. Thermodynamics of GaN(s)-NH3(v)+N2(v)+H2(v) system - Electronic aspects of the processes at GaN(0001) surface

    Kempisty, Pawel; Strak, Pawel; Sakowski, Konrad; Krukowski, Stanislaw


    Comprehensive analysis of GaN(0001) surface in equilibrium with ammonia/hydrogen mixture was undertaken using results of ab initio calculations. Adsorption energies of the species derived from ammonia and molecular hydrogen and their stable sites were obtained. It was shown that the adsorption process type and energy depend on the position of Fermi level at the surface. Hydrogen decomposes into two separate H atoms, always adsorbed in the positions on top of the surface Ga atoms (On-top). Ammonia adsorption at GaN(0001) surface proceeds molecularly to ammonia in the On-top position or dissociatively into NH2 radicals in bridge (NH2-bridge) or On-top positions or into NH radicals in H3 (NH-H3) site. Presence of these species affects Fermi level pinning at the surface due to creation of new surface states. The Fermi level pinning in function of the surface attached species concentration was determined using extended electron counting rule (EECR). Results of ab initio calculations fully proved validity of the EECR predictions. Thermodynamic analysis of the surface in equilibrium with molecular hydrogen and ammonia vapor mixture is made giving the range of ammonia and hydrogen pressures, corresponding to Fermi level pinned at Ga-broken bond state for NH-H3&H and NH3&H and NH2-bridge&H coverage and at VBM for NH3 & H coverage. As the region of Fermi level pinned at Ga broken bond state corresponds to very low pressures, at pressures close to normal, GaN(0001) surface is almost totally covered by H, NH3 and NH2 located in On-top positions. It is also shown however that dominant portion of the hydrogen and ammonia pressures corresponds to Fermi level not pinned. Among them are these corresponding to MOVPE and HVPE growth conditions in which the surface is almost fully covered by NH3, NH2 and H species in On-top positions.

  17. Kvalitativní výzkum: "Jak děti vnímají tělesně modifikované rodiče a dospělé."

    LUXÍKOVÁ, Lenka


    The presented study aims to determine how preschool children perceive people with body modifications. Foremost, I have decided to focus on modifications which children can encounter in their every day lives, such as tattoos and piercings. In the theoretical part I outline terms connected with physical modifications and relevant related questions, specific characteristics of preschool children behavior and the influence of their social environment on their perceptions. For the practical part, ...

  18. Marketingová komunikace módních značek a jejich vliv na vnímání body image spotřebitele

    Macková, Monika


    The Master's Thesis deals with the marketing communication of fashion industry with the focus on two particular global fast fashion brands. The main goal is to identify the specifics of marketing communication strategies of fashion industry, to analyze the approach difference of the two chosen fashion brands H&M and Zara and to define their influence on consumer's body image through qualitative and quantitative research. The thesis is divided into several parts. The first chapter follows up t...

  19. Česká debata o vnější dimenzi energetické bezpečnosti a národní zájem

    Petr Binhack


    Full Text Available The Czech debate on the external dimension of energy security and national interest. Energy security is one of the most topical and important issues, both at the EU and member states level. This is a fact, not only in the context of climate change policy and common energy market design, but also in the light of the dynamics of EU external energy relations, with the latter recently gaining in importance. The Czech discourse on energy security is no exception and mirrors the development in the EU-wide debate. This claim is based not only on the analysis of events and the subsequent debate on energy security in the Czech Republic regarding the period from 2006 to 2010 (e.g. the natural gas crisis, Presidency of the Council of the EU, the question of energy import dependence, i.e. the period between the last two parliamentary elections with minor overlaps, but also on the three applied criteria of national interest – relevance, consensus, and external acceptability. The discourse on external energy relations of the Czech Republic is relevant, shows signs of consensus, and, from an EU perspective, could be considered as acceptable. Therefore, the external energy relations meet the criteria of the Czech national interest.

  20. Vliv nesprávné životosprávy na výskyt obezity u dětí školního věku

    LUPÍŠKOVÁ, Šárka


    Child obesity is becoming a huge problem not just in the Czech Republic, but also among other developed countries. The World Health Organization (WHO) claimed that obesity is a plague of the 21st century. There was a noticeable prevalence of obesity and overweight in industrialized countries and also in the Southern Hemisphere. Although adult obesity has been increasing, the number of obese children has gone up even more rapidly. Currently, in the Czech Republic, nine percent of children are ...

  1. Nové trendy finančního účetnictví podnikatelů v kontextu právních předpisů České republiky

    Jana Hinke


    Full Text Available The issue of financial accounting, there is gradual harmonization across states, which stems primarily from international operations of entrepreneurs and European integration. In 2015, it was implemented through an amendment to the Accounting Act to the Czech legislation, financial accounting new European Union legislation, which will take effect from 2016 on accounting in Czech companies. The amendment of the decrees was the further modification of Czech legislation. The paper is focused on entrepreneurs, so the attention is paid primarily by the Decree no. 500/2002 Coll. This paper deals with current issues and aims to identify major changes in the financial accounting in the Czech Republic, which will be applied since 2016. In the paper are identified significant changes as the distribution of entities into four levels, the improvement of the term the fair value, the categorization of consolidation groups, the return of the single-entry bookkeeping, making the final accounts more accurate and others. Partial aim of this paper is to analyze the impact of selected changes of financial accounting to the results of selected ratios of financial analysis because these indicators are based on the accounting data. Given the tendencies of the harmonization of the accounting standards at the international level was made the further analysis of the compatibility of selected changes to the international accounting standards. The analysis was made on the evaluation of the own inventory, the billing of the changes of the inventory and activation, the cancellation of extraordinary profit and loss account, the abolition of formation expenses in the balance and on the adjustment of the definition of reserves. In all cases of the researched changes was not detected the inconsistency between the czech legislative amendments and the international accounting standards.

  2. Vnímanie a obrazotvornosť v piatej Prechádzke snívajúceho samotára (La perception et l’imagination dans Les rêveries du promeneur solitaire

    Róbert Karul


    Full Text Available Dans sa 5ème promenade, Rousseau relate ses expériences de la rêverie qui vont à contre-courant de la théorie de l’imagination poétique chez Bachelard. Celle-ci sépare rigoureusement l’imagination de la perception du monde, alors que Rousseau se dit incapable à distinguer, par moments, ses rêveries de la perception de la nature.

  3. Problematika řízení automobilu u pacientů po cévní mozkové příhodě - možnosti ergoterapeutické intervence

    Málková, Kristýna


    The issue of driving a car after stroke is getting increasingly common, especially because of the high stroke incidence concerning productive age patients. Nowadays, driving is considered a matter of course which intervenes our leisure time activities and work performance. Self-sufficiency and independency of a patient is one of the domains of occupational therapy, which is why the occupational therapist is a part of an interdisciplinary team. The theoretical part of the thesis defines terms ...

  4. On the mechanism of zirconium nitride formation by zirconium, zirconia and yttria burning in air

    Malikova, Ekaterina; Pautova, Julia [Tomsk Polytechnic University, 30, Lenin Prospekt, Tomsk 634050 (Russian Federation); Gromov, Alexander, E-mail: [Tomsk Polytechnic University, 30, Lenin Prospekt, Tomsk 634050 (Russian Federation); Fraunhofer Institute of Chemical Technology, Joseph-von-Fraunhofer Str. 7, 76327 Pfinztal (Germany); Nürnberg University of Technology Georg Simon Ohm, 12, Keßlerplatz, 90489 Nürnberg (Germany); Semenov Institute of Chemical Physics, 4, Kosygina str., 119991 Moscow (Russian Federation); Monogarov, Konstantin [Tomsk Polytechnic University, 30, Lenin Prospekt, Tomsk 634050 (Russian Federation); Semenov Institute of Chemical Physics, 4, Kosygina str., 119991 Moscow (Russian Federation); Larionov, Kirill [Tomsk Polytechnic University, 30, Lenin Prospekt, Tomsk 634050 (Russian Federation); Teipel, Ulrich [Fraunhofer Institute of Chemical Technology, Joseph-von-Fraunhofer Str. 7, 76327 Pfinztal (Germany); Nürnberg University of Technology Georg Simon Ohm, 12, Keßlerplatz, 90489 Nürnberg (Germany)


    The combustion of Zr and (Zr+ZrO{sub 2}) powdery mixtures in air was accompanied by major ZrN stabilization. The synthesis of cheap ZrN with the high yield in air was facile and utile. The influence of Y{sub 2}O{sub 3} additive on the content of ZrN the solid combustion products (SCP) was investigated. The reagents and SCP were analyzed by BET, DTA–TGA, XRD, SEM and EDS. Burning temperature was measured by thermal imager. The yield of ZrN in the SCP has been varied by the time regulation of the combustion process. The burning samples were quenched at a certain time to avoid the re-oxidation of the obtained ZrN by oxygen. The quenching of the burned (Zr+ZrO{sub 2}) samples with the Y{sub 2}O{sub 3} additive was allowed increasing the ZrN yield in SCP up to 66 wt%. The chemical mechanism of ZrN formation in air was discussed and the probable source of ZrN massive formation is suggested. - Highlights: • Combustion of Zr, (Zr+ZrO{sub 2}) and (Zr+ZrO{sub 2}+Y{sub 2}O{sub 3}) powdery mixtures in air was studied. • The new combustion phenomenon has been found: metal (Zr) chemically reacts with its oxide (ZrO{sub 2}) in the burning wave. • The effective influence of Y{sub 2}O{sub 3} additive (2–3 wt%) on ZrN yield in combustion products is shown. • The yield of ZrN in the combustion products can be varied by the burning time regulation (quenching)

  5. GPS User Equipment Performance Evaluation.


    simulation of range dynamics of the satellite/user paths. The JGA provides four CW signals aid a I’N modulated RF signal so as to simulate up to 5 jummers...VN e (PN) 4 VE e (PE) ViH e (PCT) VN e (PE) - VE e (PN) e (VAT)= VN e (VN) 4 VE e (VE) VH e (VCT)= V e (V) - VE e (VN) V H For the true North (TN

  6. : Pěstounská péče, dávky pěstounské péče, orgán sociálně-právní ochrany dětí ( OSPOD) ývoj právní úpravy dávek pěstounské péče od roku 1995 do současnosti.

    KALINOVÁ, Alexandra


    My work is focused on a topic: The trend of foster care benefits since 1995 to the present. Foster care is one of the forms of alternate family care in the Czech Republic, in case of parents´ disability or unwillingness to care about their child. Government provides creature comforts for a child resigned to foster care by foster care benefits. The foster care benefits have changed a lot since 1995 up to now. By the year 2012 foster care benefits were governed by law n. 117/1995, code about st...

  7. Enhanced magnetic resonance imaging and staining of cancer cells using ferrimagnetic H-ferritin nanoparticles with increasing core size

    Cai Y


    Full Text Available Yao Cai,1–3 Changqian Cao,1,2 Xiaoqing He,1 Caiyun Yang,1–3 Lanxiang Tian,1,2 Rixiang Zhu,2 Yongxin Pan1,21France–China Bio-Mineralization and Nano-Structures Laboratory, 2Paleomagnetism and Geochronology Laboratory, Key Laboratory of the Earth and Planetary Physics, Institute of Geology and Geophysics, Chinese Academy of Sciences, 3University of Chinese Academy of Sciences, Beijing, People’s Republic of ChinaPurpose: This study is to demonstrate the nanoscale size effect of ferrimagnetic H-ferritin (M-HFn nanoparticles on magnetic properties, relaxivity, enzyme mimetic activities, and application in magnetic resonance imaging (MRI and immunohistochemical staining of cancer cells.Materials and methods: M-HFn nanoparticles with different sizes of magnetite cores in the range of 2.7–5.3 nm were synthesized through loading different amounts of iron into recombinant human H chain ferritin (HFn shells. Core size, crystallinity, and magnetic properties of those M-HFn nanoparticles were analyzed by transmission electron microscope and low-temperature magnetic measurements. The MDA-MB-231 cancer cells were incubated with synthesized M-HFn nanoparticles for 24 hours in Dulbecco’s Modified Eagle’s Medium. In vitro MRI of cell pellets after M-HFn labeling was performed at 7 T. Iron uptake of cells was analyzed by Prussian blue staining and inductively coupled plasma mass spectrometry. Immunohistochemical staining by using the peroxidase-like activity of M-HFn nanoparticles was carried out on MDA-MB-231 tumor tissue paraffin sections.Results: The saturation magnetization (Ms, relaxivity, and peroxidase-like activity of synthesized M-HFn nanoparticles were monotonously increased with the size of ferrimagnetic cores. The M-HFn nanoparticles with the largest core size of 5.3 nm exhibit the strongest saturation magnetization, the highest peroxidase activity in immunohistochemical staining, and the highest r2 of 321 mM-1 s-1, allowing to

  8. High sensitive troponin T and heart fatty acid binding protein: Novel biomarker in heart failure with normal ejection fraction?: A cross-sectional study

    Barroso Michael


    Full Text Available Abstract Background High sensitive troponin T (hsTnT and heart fatty acid binding protein (hFABP are both markers of myocardial injury and predict adverse outcome in patients with systolic heart failure (SHF. We tested whether hsTnT and hFABP plasma levels are elevated in patients with heart failure with normal ejection fraction (HFnEF. Methods We analyzed hsTnT, hFABP and N-terminal brain natriuretic peptide in 130 patients comprising 49 HFnEF patients, 51 patients with asymptomatic left ventricular diastolic dysfunction (LVDD, and 30 controls with normal diastolic function. Patients were classified to have HFnEF when the diagnostic criteria as recommended by the European Society of Cardiology were met. Results Levels of hs TnT and hFABP were significantly higher in patients with asymptomatic LVDD and HFnEF (both p Conclusion In HFnEF patients, hsTnT and hFABP are elevated independent of coronary artery disease, suggesting that ongoing myocardial damage plays a critical role in the pathophysiology. A combination of biomarkers and echocardiographic parameters might improve diagnostic accuracy and risk stratification of patients with HFnEF.

  9. Biogenesis, characterization, and the effect of vicenin-gold nanoparticles on glucose utilization in 3T3-L1 adipocytes: a bioinformatic approach to illuminate its interaction with PTP 1B and AMPK.

    Chockalingam, Shivashri; Thada, Rajarajeshwari; Dhandapani, Ramesh Kumar; Panchamoorthy, Rajasekar


    This study reported the synthesis of Vicenin-2 gold nanoparticles (VN-AuNPs) and evaluated their effect on the glucose utilization efficiency of 3T3-L1 adipocytes. The VN-AuNPs were characterized by microscopic, DLS and spectral analysis. The bio-reducing efficiency of Vicenin-2 (VN) was computed and confirmed by HPLC analysis. The stability of VN-AuNPs in various physiological media was explored. The cytotoxicity and glucose uptake assays were performed in 3T3-L1 adipocytes. The docking of VN with PTP1B and AMPK was also performed. The color change and UV absorption at 537 nm preliminarily confirmed the VN reduced gold nanoparticles. The VN-AuNPs appeared as spherical particles (57 nm) and face centered cubic crystals under TEM and XRD analysis, respectively. Its zeta potential was found to be -6.53 mV. The FT-IR spectra of VN and its AuNPs confirmed its stability. The computed reducing potential of VN was similar to the extent of VN utilized during the synthesis of VN-AuNPs. The VN-AuNPs showed a remarkable stability in different physiological media. At 100 µM concentration, VN-AuNPs displayed 78.21% cell viability. A concentration dependent increase in glucose uptake was noted in 3T3-L1 adipocytes when incubated with VN-AuNPs. The docking data revealed a strong interaction of VN with the binding pockets of PTP1B and AMPK. This demonstrates that the fabricated VN-AuNPs might enhance the intracellular VN availability mediated cellular glucose utilization and this would serve as a novel nanodrug for the management of diabetes.

  10. Vitronectin is not essential for normal mammalian development and fertility.

    Zheng, X; Saunders, T L; Camper, S A; Samuelson, L C; Ginsburg, D


    Vitronectin (VN) is an abundant glycoprotein present in plasma and the extracellular matrix of most tissues. Though the precise function of VN in vivo is unknown, it has been implicated as a participant in diverse biological processes, including cell attachment and spreading, complement activation, and regulation of hemostasis. The major site of synthesis appears to be the liver, though VN is also found in the brain at an early stage of mouse organogenesis, suggesting that it may play an important role in mouse development. Genetic deficiency of VN has not been reported in humans or in other higher organisms. To examine the biologic function of VN within the context of the intact animal, we have established a murine model for VN deficiency through targeted disruption of the murine VN gene. Southern blot analysis of DNA obtained from homozygous null mice demonstrates deletion of all VN coding sequences, and immunological analysis confirms the complete absence of VN protein expression in plasma. However, heterozygous mice carrying one normal and one null VN allele and homozygous null mice completely deficient in VN demonstrate normal development, fertility, and survival. Sera obtained from VN-deficient mice are completely deficient in "serum spreading factor" and plasminogen activator inhibitor 1 binding activities. These observations demonstrate that VN is not essential for cell adhesion and migration during normal mouse development and suggest that its role in these processes may partially overlap with other adhesive matrix components. Images Fig. 1 Fig. 2 Fig. 3 PMID:8618914

  11. Zirconium nitride hard coatings; Revestimentos protetores de nitreto de zirconio

    Roman, Daiane; Amorim, Cintia Lugnani Gomes de; Soares, Gabriel Vieira; Figueroa, Carlos Alejandro; Baumvol, Israel Jacob Rabin; Basso, Rodrigo Leonardo de Oliveira [Universidade de Caxias do Sul (UCS), Caxias do Sul, RS (Brazil)


    Zirconium nitride (ZrN) nanometric films were deposited onto different substrates, in order to study the surface crystalline microstructure and also to investigate the electrochemical behavior to obtain a better composition that minimizes corrosion reactions. The coatings were produced by physical vapor deposition (PVD). The influence of the nitrogen partial pressure, deposition time and temperature over the surface properties was studied. Rutherford backscattering spectrometry (RBS), X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD), scanning electron microscopy (SEM) and corrosion experiments were performed to characterize the ZrN hard coatings. The ZrN films properties and microstructure changes according to the deposition parameters. The corrosion resistance increases with temperature used in the films deposition. Corrosion tests show that ZrN coating deposited by PVD onto titanium substrate can improve the corrosion resistance. (author)

  12. Estimating Incision Depth in Martian Valleys: Comparing Two Methods

    Luo, W.; Howard, A. D.; Trischan, J.


    Regional variation of valley network (VN) depths may be informative of past climatic variation across Mars. Both black top hat transformation and search radius approach provide reasonable estimates of VN depths, but require careful interpretation.

  13. Gene : CBRC-PTRO-17-0015 [SEVENS


  14. The Presence of Visual Neglect after Thrombolytic Treatment in Patients with Right Hemisphere Stroke

    J. E. Kettunen


    Full Text Available Visual neglect (VN is a common consequence of right hemisphere (RH stroke. The aims of this study were to explore the presence of VN after RH stroke in the patients with (T+ or without (T− thrombolytic treatment, and to determine whether thrombolysis is a predictor of VN. The study group consisted of 77 RH infarct patients. VN was evaluated with six conventional subtests of the Behavioural Inattention Test (BIT. Stroke severity was assessed using the National Institute of Health Stroke Scale (NIHSS. In the neuropsychological examination, 22% of all RH stroke patients had VN. VN was present in 15% of the patients in the T+ group and in 28% of the patients in the T− group, but the difference was not statistically significant. Despite that, patients in the T− group had a higher risk of VN than patients in the T+ group. Our results suggest that thrombolysis independently predicted absence of VN.

  15. Comparative Phylogeography of Neotropical Birds


    Marten, spadiceus vn 117176; 6) PERU: San Marten, spadiceus vn 117177; 7) PERU: Loreto, spadiceus vn 110648; 8) SURINAME , spadiceus vn 178366; and 9...C., and J. M. Bates. 2007. Amphibian DNA shows marked genetic structure and tracks Pleistocene climate change in northeastern Brazil. Evolution 61...58.666667 62 ANSP 7407 cis Guiana Guyana Potaro-Siparuni 4.333333 -58.850000 63 LSUMZ 45809 cis Guiana Suriname 3.731623 -55.983179 64 USNM 12223 cis

  16. Columnar structured FePt films epitaxially grown on large lattice mismatched intermediate layer

    Dong, K. F.; Deng, J. Y.; Peng, Y. G.; Ju, G.; Chow, G. M.; Chen, J. S.


    The microstructure and magnetic properties of the FePt films grown on large mismatched ZrN (15.7%) intermediate layer were investigated. With using ZrN intermediate layer, FePt 10 nm films exhibited (001) texture except for some weaker FePt (110) texture. Good epitaxial relationships of FePt (001) //ZrN (001) //TiN (001) among FePt and ZrN/TiN were revealed from the transmission electron microscopy (TEM) results. As compared with TiN intermediate layer, although FePt-SiO2-C films grown on ZrN/TiN intermediate layer showed isotropic magnetic properties, the large interfacial energy and lattice mismatch between FePt and ZrN would lead to form columnar structural FePt films with smaller grain size and improved isolation. By doping ZrN into the TiN layer, solid solution of ZrTiN was formed and the lattice constant is increased comparing with TiN and decreased comparing with ZrN. Moreover, FePt-SiO2-C films grown on TiN 2 nm-20 vol.% ZrN/TiN 3 nm intermediate layer showed an improved perpendicular magnetic anisotropy. Simultaneously, columnar structure with smaller grain size retained.

  17. Identification of second arginine-glycine-aspartic acid motif of ovine vitronectin as the complement C9 binding site and its implication in bacterial infection.

    T, Prasada Rao; T, Lakshmi Prasanth; R, Parvathy; S, Murugavel; Devi, Karuna; Joshi, Paritosh


    Vitronectin (Vn), a multifunctional protein of blood and extracellular matrix interacts with complement C9. This interaction may modulate innate immunity. Details of Vn-C9 interaction are limited. An assessment of Vn-C9 interaction was made employing goat homologous system. Vn binding to C9 was observed in three different assays. Using recombinant fragments, the C9 binding was mapped to the N-terminus of Vn. Site directed mutagenesis was performed to alter the second RGD sequence (RGD-2) of Vn. Change of R to G or D to A in RGD-2 caused significant decrease in Vn binding to C9 whereas change of R to G in the first RGD motif (RGD-1) had no effect on Vn binding to C9. These results imply that the RGD-2 of goat Vn is involved in C9 binding. In competitive binding assay, the presence of soluble RGD peptide inhibited Vn binding to C9 whereas heparin had no effect. Vn binding to C9 in terms of bacterial pathogenesis was also evaluated. Serum dependent inhibition of E. coli growth was significantly reverted when Vn or its N-fragment were included in the assay. The C-fragment, which did not support C9 binding, also partly nullified serum dependent inhibition of bacterial growth probably through other serum component(s).

  18. Enhanced peroxidase activity and tumour tissue visualization by cobalt-doped magnetoferritin nanoparticles

    Zhang, Tongwei; Cao, Changqian; Tang, Xu; Cai, Yao; Yang, Caiyun; Pan, Yongxin


    Magnetoferritin (M-HFn) is a biomimetic magnetic nanoparticle with a human heavy-chain ferritin (HFn) shell, trapping a magnetite (Fe3O4) core that has inherited peroxidase-like activity. In this study, cobalt-doped M-HFn nanoparticles (M-HFn-Co x Fe3-x O4) with different amounts of cobalt were successfully synthesized. Experimental results indicate that the controlled doping of a certain amount of cobalt into the magnetite cores of M-HFn nanoparticles enhances its peroxidase-like catalytic activity and efficacy for visualizing tumour tissues. For example, compared with sample Co0 (without cobalt doping), the peroxidase-like activity of the cobalt-doped nanoparticle sample Co60 (with a cobalt doping molar percentage of ˜34.2%) increases 1.7 times, and has the maximal reaction velocity (V max) values. Moreover, after a one-step incubation with Co60 nanoparticles, and using the peroxidase substrate 3,3‧-diaminobenzidine tetrahydrochloride (DAB) for colour development, the tumour tissues of breast, colorectal, stomach and pancreas tumours showed a deeper brown colour with clear boundaries between the healthy and tumourous cells. Therefore, this suggests that the cobalt-doped magnetoferritin nanoparticles enhance peroxidase activity and tumour tissue visualization.

  19. Combat body armor and injuries to the head, face, and neck region: a systematic review.

    Tong, Darryl; Beirne, Ross


    There has been a reported increase in combat-related head, face, and neck (HFN) injuries among service personnel wearing combat body armor (CBA) that have deployed to Iraq and Afghanistan. Modern ceramic plate CBA has decreased the incidence of fatal-penetrating injuries to the torso but offers no protection to the limbs and face which remain exposed to gunshot wounds and fragments from explosive devices. The aim of this review was to systematically summarize the literature reporting on HFN injuries sustained by combat personnel wearing CBA and to highlight recommendations for increased protection to the facial region. Three major contributing factors were identified with this proportional increase in HFN injuries, namely the increased survivability of soldiers because of CBA, fragments injuries from explosive devices, and the lack of protection to the face and limbs. There appears to be no evidence to suggest that by virtue of wearing CBA the likelihood of sustaining an HFN injury increases as such, but a higher incidence of fragment injuries to the HFN region may be due to the more common use of improvised explosive devicess and other explosive devices. Further development of lightweight protection for the face is needed.

  20. Veratri Nigri Rhizoma et Radix (Veratrum nigrum L. and Its Constituent Jervine Prevent Adipogenesis via Activation of the LKB1-AMPKα-ACC Axis In Vivo and In Vitro

    Jinbong Park


    Full Text Available This study was performed in order to investigate the antiobese effects of the ethanolic extract of Veratri Nigri Rhizoma et Radix (VN, a herb with limited usage, due to its toxicology. An HPLC analysis identified jervine as a constituent of VN. By an Oil Red O assay and a Real-Time RT-PCR assay, VN showed higher antiadipogenic effects than jervine. In high-fat diet- (HFD- induced obese C57BL/6J mice, VN administration suppressed body weight gain. The levels of peroxisome proliferator-activated receptor gamma (PPARγ, CCAAT-enhancer-binding protein alpha (C/EBPα, adipocyte fatty-acid-binding protein (aP2, adiponectin, resistin, and LIPIN1 were suppressed by VN, while SIRT1 was upregulated. Furthermore, VN activated phosphorylation of the liver kinase B1- (LKB1- AMP-activated protein kinase alpha- (AMPKα- acetyl CoA carboxylase (ACC axis. Further investigation of cotreatment of VN with the AMPK agonist AICAR or AMPK inhibitor Compound C showed that VN can activate the phosphorylation of AMPKα in compensation to the inhibition of Compound C. In conclusion, VN shows antiobesity effects in HFD-induced obese C57BL/6J mice. In 3T3-L1 adipocytes, VN has antiadipogenic features, which is due to activating the LKB1-AMPKα-ACC axis. These results suggest that VN has a potential benefit in preventing obesity.

  1. Numerical Investigation into the Effect of Natural Fracture Density on Hydraulic Fracture Network Propagation

    Zhaohui Chong


    Full Text Available Hydraulic fracturing is an important method to enhance permeability in oil and gas exploitation projects and weaken hard roofs of coal seams to reduce dynamic disasters, for example, rock burst. It is necessary to fully understand the mechanism of the initiation, propagation, and coalescence of hydraulic fracture network (HFN caused by fluid flow in rock formations. In this study, a coupled hydro-mechanical model was built based on synthetic rock mass (SRM method to investigate the effects of natural fracture (NF density on HFN propagation. Firstly, the geometrical structures of NF obtained from borehole images at the field scale were applied to the model. Secondly, the micro-parameters of the proposed model were validated against the interaction between NF and hydraulic fracture (HF in physical experiments. Finally, a series of numerical simulations were performed to study the mechanism of HFN propagation. In addition, confining pressure ratio (CPR and injection rate were also taken into consideration. The results suggested that the increase of NF density drives the growth of stimulated reservoir volume (SRV, concentration area of injection pressure (CAIP, and the number of cracks caused by NF. The number of tensile cracks caused by rock matrix decrease gradually with the increase of NF density, and the number of shear cracks caused by rock matrix are almost immune to the change of NF density. The propagation orientation of HFN and the breakdown pressure in rock formations are mainly controlled by CPR. Different injection rates would result in a relatively big difference in the gradient of injection pressure, but this difference would be gradually narrowed with the increase of NF density. Natural fracture density is the key factor that influences the percentages of different crack types in HFN, regardless of the value of CPR and injection rate. The proposed model may help predict HFN propagation and optimize fracturing treatment designs in

  2. Development of a Modified Embedded Atom Force Field for Zirconium Nitride Using Multi-Objective Evolutionary Optimization

    Narayanan, Badri; Sasikumar, Kiran; Mei, Zhi-Gang; Kinaci, Alper; Sen, Fatih G.; Davis, Michael J.; Gray, Stephen K.; Chan, Maria K. Y.; Sankaranarayanan, Subramanian K. R. S.


    Zirconium nitride (ZrN) exhibits exceptional mechanical, chemical, and electrical properties, which make it attractive for a wide range of technological applications, including wear-resistant coatings, protection from corrosion, cutting/shaping tools, and nuclear breeder reactors. Despite its broad usability, an atomic scale understanding of the superior performance of ZrN, and its response to external stimuli, for example, temperature, applied strain, and so on, is not well understood. This is mainly due to the lack of interatomic potential models that accurately describe the interactions between Zr and N atoms. To address this challenge, we develop a modified embedded atom method (MEAM) interatomic potential for the Zr–N binary system by training against formation enthalpies, lattice parameters, elastic properties, and surface energies of ZrN (and, in some cases, also Zr3N4) obtained from density functional theory (DFT) calculations. The best set of MEAM parameters are determined by employing a multiobjective global optimization scheme driven by genetic algorithms. Our newly developed MEAM potential accurately reproduces structure, thermodynamics, energetic ordering of polymorphs, as well as elastic and surface properties of Zr–N compounds, in excellent agreement with DFT calculations and experiments. As a representative application, we employed molecular dynamics simulations based on this MEAM potential to investigate the atomic scale mechanisms underlying fracture of bulk and nanopillar ZrN under applied uniaxial strains, as well as the impact of strain rate on their mechanical behavior. These simulations indicate that bulk ZrN undergoes brittle fracture irrespective of the strain rate, while ZrN nanopillars show quasi-plasticity owing to amorphization at the crack front. The MEAM potential for Zr–N developed in this work is an invaluable tool to investigate atomic-scale mechanisms underlying the response of ZrN to external stimuli (e.g, temperature

  3. Probing initial-stages of ALD growth with dynamic in situ spectroscopic ellipsometry

    Muneshwar, Triratna, E-mail:; Cadien, Ken


    Graphical abstract: - Highlights: • Dynamic in situ spectroscopic ellipsometry to study ALD growth initiation. • Sub-monolayer ALD growth is modeled as diffusive film growth mode. • Bruggeman's EMA model used to analyze d-iSE data. • Plasma enhanced ALD of ZrN is presented as example. • Surface coverage of ZrN film is calculated after every ALD cycle. - Abstract: The initial stages of ALD surface reactions are probed using dynamic in situ spectroscopic ellipsometry (d-iSE) technique during plasma-enhanced ALD of zirconium nitride (ZrN) thin films in spectral range of 0.73–6.4 eV. The measured change in the ellipsometry parameter Δ, with every precursor (TDMAZr) and reactant (forming gas plasma) exposure is interpreted as the combined effect of film growth and change in surface chemistry during ALD. We present application of Bruggeman's effective-medium approximation (B-EMA) in the analysis of d-iSE data to determine fractional surface coverage (θ) of ALD grown film at the end of every deposition cycle. During the deposition of first few ZrN monolayers, d-iSE datasets are analyzed on the basis of surface diffusion enhanced ALD growth, where the surface adsorbed precursor molecules can diffuse over substrate surface to occupy energetically favorable surface sites. The determined surface coverage of ZrN films highlights the effects of substrate enhanced ALD growth.

  4. Legal Rules on the Purchase Contract under the Czech new Civil Code – – Selected Problems / Právní Úprava Kupní Smlouvy Ve Světle Nového Občanského Zákoníku Čr – – Vybrané Problémy

    Janků Martin


    Full Text Available The goal of the present paper is to draw attention to some key rules and principles of the purchase contract. After the specification of this contract type we will deal in more details with the defective performance and the procedure of its complaint. As suggest the first assessment and reviews of the application of new legislation in its practical use and by the case law, in the achievement of the objective desired by the NCC - to increase the transparency of the procedure of complaints - the new legislation stacked in the middle of the way. The paper compares the impact of the new the previous and the current regulations, We will use the method of functional analysis as well as the method of legal formalistic comparison. It is obvious that the new rules respect the former régime of commercial contracts. The business sphere has undoubtedly welcomed this feature of the legal regime as the merchandisers are familiar with these rules. The second issue is, however, how this modification in the general regulation meets the expectations of the to provide sufficient legal certainty in the interpretation of contractual provisions and in the access to the protection of their interests by courts in the event of disputes.

  5. Porovnání vykazování dlouhodobého hmotného a nehmotného majetku dle IFRS a českých právních předpisů

    Adamec, Jakub


    Bachelor thesis Comparison of Fixed Tangible and Intangible Assets in accordance with IFRS and Czech Legal Regulation is focuses on classification and valuation of tangible and intangible assets according to both methodologies. Bachelor thesis consists of theoretical and analytical part. The theoretical part defines basic principles of valuation, classification, and amortization of the tangible and intangible assets under IFRS and Czech accounting legislation. The analytical part of the thesi...

  6. Vliv správného protahování na výkonnost, kloubní rozsah a prevenci svalového přetížení hráče amerického fotbalu

    Zeman, Jaroslav


    The bachelor thesis deals with stretching and its influence on Budweis Hellboys, American football players. As a part of this work is a development of ideal stretching plan and verification of its effectiveness. Therefore, this work maps how the stretching plan operates in terms of prevention of the low back pain and how it affects the total performance and joint range of the American football players. This is a qualitative research work and it is divided into two parts: theoretical and pract...

  7. Vliv skupinového cvičení na subjektivní vnímání bolesti a pohyblivost páteře u jedinců s ankylozující spondylitidou.

    Levitová, Andrea


    Title of thesis: The effect of group exercise on the perception of pain and spinal mobility of Individuals with ankylosing spondylitis Aims: To evaluate the impact of a targeted group exercise on pain perception, posture and mobility of the spine in patients with ankylosing spondylitis (AS). Method: The study selected 30 subjects with AS in I. - III. stage (mean age = 27.17 ± 4.57). This group was divided into experimental set (motion program participants (n = 15) and control group [n = 15])....

  8. Vnější ekonomická rovnováha zemí jižního křídla eurozóny v kontextu světové ekonomické krize.

    Rakouský, Tomáš


    This diploma thesis focuses on changes in the external balance of Portugal, Italy, Greece and Spain in the period of financial and economic crisis after 2008. The theoretical framework is based on an exact definition of external balance, ultimately as neither surplus nor deficit of a relevant balance in terms of balance of payments. Potential impacts of monetary and fiscal policies on the external balance are described there as well, using the IS-LM-BP model. The second part of the thesis, wh...

  9. Plnění rozpočtu územních samosprávných celků v konkrétních podmínkách obce Mezihoří a obce Křenice v letech 2011 - 2012

    Němečková, Stanislava


    This bachelor thesis is examining the functionality of the local government in the Czech Republic. The main aim of the thesis are basic local government units called municipalities, the municipal budget and all issues related to it. Also it focuses on the recent accounting reform, its basic goals and the consequences resulting from it. Theoretical knowledge gained in the first part of the thesis is applied into the practice in the second part of thesis, which focuses on the execution of the b...

  10. Vztah mezi učitelem a žákem na 2. st. ZŠ a nižším stupni víceletého gymnázia z pohledu vnímání sebe samého a jejich vzájemné interakce

    SRBOVÁ, Kamila


    The thesis concerns about the relationship between teacher and student at lower-secondary school. To be more precise, it focuses on student's self-perception and perception of a teacher; also it focuses on teacher's self-perception and perception of his/her students, all of it in the context of teacher/student interaction. The theoretical part covers student's and teacher's personality, their relationship and selected dimensions of their communication verbal correctness, sense of humour, pers...

  11. Branding leteckých společností: vnímání značek leteckých společností na českém trhu generací Y

    Sýkora, Ondřej


    The bachelor thesis "Airline Branding: Perception of Airline Brands on the Czech Market by Generation Y" discusses branding in the airline industry. The theoretical part firstly uses basic marketing concepts to define individual attributes of the industry. The work then describes the theory and essential principles of branding, focusing mainly on specific characteristics of the airline segment. Thereafter, single aspects such as branding, positioning, segmentation, brand equity building, and ...

  12. Assembly of fibronectin into the extracellular matrix of early and late passage human skin fibroblasts

    Mann, D.M.


    The specific binding of soluble /sup 125/I-human plasma fibronectin (/sup 125/I-HFN-P) to confluent cultures of early and late passage human skin fibroblasts was investigated. Previous studies HFN-P bound to fibroblast cell layers indicated that HNF-P was present in the cultures in two separate pools, distinguishable on the basis of their solubility in 1% deoxycholate. Examination of the kinetics of /sup 125/I-HFN-P binding to Pool I of early and late passage cultures revealed that both cultures required 2-4 h to approach steady-state conditions. Other kinetic studies showed that the rates of low of /sup 125/I-HFN-P from either Pool I or Pool II were similar for both cultures. Further, Scatchard analysis revealed a single class of Pool I binding sites with apparent dissociation constants (K/sub d/) of 5.3 x 10/sup -8/M (early passage) and 4.2 x 10/sup -8/M (late passage). These results indicate that early and late passage cultures of human fibroblasts exhibit differences in the number of cell surface biding sites for soluble fibronectin, and in the extent to which they incorporate soluble fibronectin into the extracellular matrix. Parameters which affect the fibronectin matrix assembly system of human skin fibroblasts were also examined. In addition, several monoclonal anti-fibronectin antibodies were characterized and developed as experimental probes for fibronectin structure and function.

  13. Vagus Nerve and Vagus Nerve Stimulation, a Comprehensive Review: Part I.

    Yuan, Hsiangkuo; Silberstein, Stephen D


    The vagus nerve (VN), the "great wondering protector" of the body, comprises an intricate neuro-endocrine-immune network that maintains homeostasis. With reciprocal neural connections to multiple brain regions, the VN serves as a control center that integrates interoceptive information and responds with appropriate adaptive modulatory feedbacks. While most VN fibers are unmyelinated C-fibers from the visceral organs, myelinated A- and B-fiber play an important role in somatic sensory, motor, and parasympathetic innervation. VN fibers are primarily cholinergic but other noncholinergic nonadrenergic neurotransmitters are also involved. VN has four vagal nuclei that provide critical controls to the cardiovascular, respiratory, and alimentary systems. Latest studies revealed that VN is also involved in inflammation, mood, and pain regulation, all of which can be potentially modulated by vagus nerve stimulation (VNS). With a broad vagal neural network, VNS may exert a neuromodulatory effect to activate certain innate "protective" pathways for restoring health.

  14. Effect of Vitronectin Bound to Insulin-Like Growth Factor-I and Insulin-Like Growth Factor Binding Protein-3 on Porcine Enamel Organ-Derived Epithelial Cells

    Yoshinori Shinohara; Shuhei Tsuchiya; Kazuo Hatae; Honda, Masaki J


    The aim of this paper was to determine whether the interaction between IGF, IGFBP, and VN modulates the functions of porcine EOE cells. Enamel organs from 6-month-old porcine third molars were dissociated into single epithelial cells and subcultured on culture dishes pretreated with VN, IGF-I, and IGFBP-3 (IGF-IGFBP-VN complex). The subcultured EOE cells retained their capacity for ameloblast-related gene expression, as shown by semiquantitative reverse transcription-polymerase chain reaction...

  15. Biodegradation of differently cross-linked collagen membranes: an experimental study in the rat.

    Rothamel, Daniel; Schwarz, Frank; Sager, Martin; Herten, Monika; Sculean, Anton; Becker, Jürgen


    The aim of the present study was to compare the biodegradation of differently cross-linked collagen membranes in rats. Five commercially available and three experimental membranes (VN) were included: (1) BioGide (BG) (non-cross-linked porcine type I and III collagens), (2) BioMend (BM), (3) BioMendExtend (BME) (glutaraldehyde cross-linked bovine type I collagen), (4) Ossix (OS) (enzymatic-cross-linked bovine type I collagen), (5) TutoDent (TD) (non-cross-linked bovine type I collagen, and (6-8) VN(1-3) (chemical cross-linked porcine type I and III collagens). Specimens were randomly allocated in unconnected subcutaneous pouches separated surgically on the back of 40 wistar rats, which were divided into five groups (2, 4, 8, 16, and 24 weeks), including eight animals each. After 2, 4, 8, 16, and 24 weeks of healing, the rats were sacrificed and explanted specimens were prepared for histologic and histometric analysis. The following parameters were evaluated: biodegradation over time, vascularization, tissue integration, and foreign body reaction. Highest vascularization and tissue integration was noted for BG followed by BM, BME, and VN(1); TD, VN(2), and VN(3) showed prolongated, while OS exhibited no vascularization. Subsequently, biodegradation of BG, BM, BME and VN(1) was faster than TD, VN(2), and VN(3). OS showed only a minute amount of superficial biodegradation 24 weeks following implantation. Biodegradation of TD, BM, BME, VN(2), and VN(3) was associated with the presence of inflammatory cells. Within the limits of the present study, it was concluded that cross-linking of bovine and porcine-derived collagen types I and III was associated with (i) prolonged biodegradation, (ii) decreased tissue integration and vascularization, and (iii) in case of TD, BM, BME, VN(2), and VN(3) foreign body reactions.

  16. Lipolytic and antiadipogenic effects of (3,3-dimethylallyl) halfordinol on 3T3-L1 adipocytes and high fat and fructose diet induced obese C57/BL6J mice.

    Saravanan, Munisankar; Pandikumar, Perumal; Saravanan, Subramaniam; Toppo, Erenius; Pazhanivel, Natesan; Ignacimuthu, Savarimuthu


    Aegle marmelos Correa., (Rutaceae) is a medium sized tree distributed in South East Asia and used traditionally for the management of obestiy and diabetes. In this study the lipolytic and antiadipogenic effects of (3,3-dimethylallyl) halfordinol (Hfn) isolated from leaves of A. marmelos have been investigated. Intracellular lipid accumulation was measured by oil red O staining and glycerol secretion. The expression of genes related to adipocyte differentiation was analyzed by reverse transcriptase-polymerase chain reaction (RT-PCR). Hfn decreased intracellular triglyceride accumulation and increased glycerol release in a dose dependent manner (5-20 μg/ml) in differentiated 3T3-L1 adipocytes. In high fat diet fed C57/BL 6J mice, treatment with Hfn for four weeks reduced plasma glucose, insulin and triglyceride levels and showed a significant reduction in total adipose tissue mass by 37.85% and visceral adipose tissue mass by 62.99% at 50mg/kg b.w. concentration. RT-PCR analyses indicated that Hfn decreased the expression of peroxisome proliferator-activated receptor γ (PPARγ) and CCAAT enhancer binding protein α (CEBPα) and increased the expression of sterol regulatory enzyme binding protein (SREBP-1c), peroxisome proliferator-activated receptor α (PPARα), Adiponectin and Glucose transporter protein 4 (GLUT4) compared to the high fat diet group. These results suggested that Hfn decreased adipocyte differentiation and stimulated lipolysis of adipocytes. This study justifies the folklore medicinal uses and claims about the therapeutic values of this plant for the management of insulin resistance and obesity. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. Formation of inorganic nanofibers by heat-treatment of poly(vinyl alcohol-zirconium compound hybrid nanofibers

    Nakane K.


    Full Text Available Poly(vinyl alcohol-zirconium compound hybrid nanofibers (precursors were formed by electrospinning employing water as a solvent for the spinning solution. The precursors were converted into oxide (ZrO2, carbide (ZrC or nitride (ZrN nanofibers by heating them in air, Ar or N2 atmospheres. Monoclinic ZrO2 nanofibers with high-specific surface area were obtained by heat-treatment of the precursors in air. ZrC and ZrN nanofibers could be obtained below theoretical temperatures calculated from thermodynamics data.

  18. Dicty_cDB: CFH305 [Dicty_cDB

    Full Text Available - ---MLCKGFXMIDVH*dvqhaheckvdhngkeccvrsp*ttttqkfvh*dahqnmkckfd dhgkkccvkihcdevcdldcgrgfeckirhdgskccvrs...vll*iihhvvvnkngla lkvhlilvhmkivvieihpitkllkyqinasilmdllklqlqpsilvlmprlknvpy*vn hvvskr--- ---MLCKGFXMIDVH*dvqhaheckvdhngkeccvrs...p*ttttqkfvh*dahqnmkckfd dhgkkccvkihcdevcdldcgrgfeckirhdgskccvrserphppqhekcnkrcppghec kvdqh

  19. Dicty_cDB: SFD228 [Dicty_cDB

    Full Text Available invnfgsimrkvi*lskvicvt*rmkvcqlkvplekvn* slllilnihrilqmmilknslksyqklppllfqnlivnrlv...ny*tqslvvnsl*thwinvnfgsimrkvi*lskvicvt*rmkvcqlkvplekvn* slllilnihrilqmmilknslksyqklppllfqnlivnrlvsqr*TLIPTNK...rmkvcqlkvplek vn*slllilnihrilqmmilknslksyqklppllfqnlivnrlvsqr*tliptnkvlmvv lvvlinnmvvlmviknnnnkvlillilvlnlvv

  20. Dicty_cDB: AFA594 [Dicty_cDB

    Full Text Available MCGP VN--- ---XINGRDFGKXXLQFPRSXTFLK*nh*qstkl*lxsrrlqqiqkcplrqcrssihsrf qsprixs**ilriyyl*rscchhersl*xlfslilm...plnqlkidqinnf*lpsppilvcvv qli--- ---XINGRDFGKXXLQFPRSXTFLK*nh*qstkl*lxsrrlqqiqkcplrqcrssihsrf qsprixs**ilriy

  1. Optimizing human semen cryopreservation by reducing test vial volume and repetitive test vial sampling

    Jensen, Christian F S; Ohl, Dana A; Parker, Walter R


    OBJECTIVE: To investigate optimal test vial (TV) volume, utility and reliability of TVs, intermediate temperature exposure (-88°C to -93°C) before cryostorage, cryostorage in nitrogen vapor (VN2) and liquid nitrogen (LN2), and long-term stability of VN2 cryostorage of human semen. DESIGN: Prospec......OBJECTIVE: To investigate optimal test vial (TV) volume, utility and reliability of TVs, intermediate temperature exposure (-88°C to -93°C) before cryostorage, cryostorage in nitrogen vapor (VN2) and liquid nitrogen (LN2), and long-term stability of VN2 cryostorage of human semen. DESIGN...

  2. Vitronectin significantly influences prognosis in osteosarcoma.

    Shi, Kai; Lan, Rui-Long; Tao, Xuan; Wu, Chao-Yang; Hong, Hai-Feng; Lin, Jian-Hua


    Vitronectin (Vn), a multifunctional adhesive protein, is found in association with tumor progression, angiogenesis and metastasis in a variety of (human) tumors. But no studies concerning its correlation to osteosarcoma prognosis were found. Hence, we aimed to investigate the prognostic value of Vitronectin (Vn) in osteosarcoma. Here, we studied the expression of VN in the tumor tissues from 67 patients with osteosarcoma and 20 patients with osteochondroma using immunohistochemistry and estimated the effects of VN expression in osteosarcoma on progression-free survival (PFS) and overall survival (OS) using the Kaplan-Meier curve and COX proportional hazards regression model. Increased expression of VN in osteosarcoma tissue compared to no VN expression in osteochondroma tissue was shown in immunohistochemical assay. No associations were observed between VN expression and osteosarcoma patients' gender (P = 0.675), age (P = 0.813), tumor size (P = 0.436), histologic subtype (P = 0.0.543) or tumor location (P = 0.456). Univariate survival analysis demonstrated significant correlations of high VN expression with shorter PFS (P = 0.002) and OS (P = 0.001); multivariate survival analysis revealed high VN expression as a significant independent prognostic indicator for shorter PFS (HR 2.788, P = 0.003) and OS (HR2.817, P = 0.003). In conclusion, the high expression of VN in tumor cells independently indicated poor clinical prognosis in patients with osteosarcoma, other than large tumor size and non-neoadjuvant chemoradiotherapy, suggesting that VN may serve as a potential therapeutic target in osteosarcoma.

  3. ZrN/Cu nanocomposite film - a novel superhard material

    Musil, J.; Zeman, P. [Univ. of West Bohemia, Plzen (Czech Republic). Dept. of Phys.; Hruby, H.; Mayrhofer, P.H. [Montanuniversitaet Leoben (Austria). Inst. fuer Metallkunde und Werkstoffpruefung


    This article reports on the structure and hardness of ZrCu-N films prepared by dc reactive magnetron sputtering of a ZrCu alloyed target in a mixture of Ar+N{sub 2} using a round planar unbalanced magnetron of diameter 100 mm. It was found that there is a strong correlation between the structure of the film and its hardness. The hard (<40 GPa) ZrCu-N films are characterized by many weak reflections from poly-oriented ZrN and Cu grains. In contrast, the superhard ({>=}40 GPa) ZrCu-N films are characterized by a strong reflection from ZrN grains with a dominate ZrN(111) orientation and no reflections from Cu. The superhard ZrCu-N films with a hardness of 54 GPa are nc-ZrN/Cu nanocomposite films composed of strongly oriented ZrN grains surrounded by a thin layer of Cu. These films exhibit a high elastic recovery of about 80% (determined by a microhardness tester) and contain approximately 1-2 wt.% Cu. The superhard nc-ZrN/Cu nanocomposite films represent a new class of superhard materials of the type nc-MeN/metal. (orig.)

  4. A Focused Fundamental Study of Predicting Materials Degradation & Fatigue. Volume 1


    Philadelphia, (1986), pp. 27-48. (6) Bakunin , V.N., and Parenago, O.P., "A Mechanism of Thermo-Oxidative Degradation of Polyol Ester Lubricants," Journal of...Materials, Philadelphia, (1986), pp. 27-48. (21) Bakunin , V.N., and Parenago, O.P., "A Mechanism of Thermo-Oxidative Degradation of Polyol Ester

  5. Characterization of the paclitaxel loaded chitosan graft Pluronic F127 copolymer micelles conjugate with a DNA aptamer targeting HER-2 overexpressing breast cancer cells

    Thach Nguyen, Kim; Nguyen, Thu Ha; Do, Dinh Ho; Huan Le, Quang


    In this work we report the isolation of DNA aptamer that is specifically bound to a HER-2 overexpressing SK-BR-3 human breast cancer cell line, using SELEX strategy. Paclitaxel (PTX) loaded chitosan graft Pluronic F127 copolymer micelles conjugate with a DNA aptamer was synthesized and its structure was confirmed by TEM image. This binary mixed system consisting of DNA aptamer modified Pluronic F127 and chitosan could enhance PTX loading capacity and increase micelle stability. Morphology images confirmed the existence of PTX micelles, with an average size of approximately 86.22 ± 1.45 nm diameters. Drug release profile showed that the PTX conjugate maintained a sustained PTX release. From in vitro cell experiment it was shown that 89%–93%, 50%–58%, 55%–62%, 24%–28% and 2%–7% of the SK-BR-3, NS-VN-67, LH-VN-48, HT-VN-26 and NV-VN-31, respectively, were dead after 6–48 h. These results demonstrated a novel DNA aptamer-micelle assembly for efficient detection and a system for the delivery of PTX targeting specific HER-2 overexpressing. We have also successfully cultivated cancer tissues of explants from Vietnamese patients on a type I collagen substrate. The NS-VN-67, LH-VN-48, HT-VN-26 and NV-VN-31cell lines were used as cellular model sources for the study of chemotherapy drug in cancer.

  6. Genome-wide assessment for genetic variants associated with ventricular dysfunction after primary coronary artery bypass graft surgery.

    Amanda A Fox

    Full Text Available BACKGROUND: Postoperative ventricular dysfunction (VnD occurs in 9-20% of coronary artery bypass graft (CABG surgical patients and is associated with increased postoperative morbidity and mortality. Understanding genetic causes of postoperative VnD should enhance patient risk stratification and improve treatment and prevention strategies. We aimed to determine if genetic variants associate with occurrence of in-hospital VnD after CABG surgery. METHODS: A genome-wide association study identified single nucleotide polymorphisms (SNPs associated with postoperative VnD in male subjects of European ancestry undergoing isolated primary CABG surgery with cardiopulmonary bypass. VnD was defined as the need for ≥2 inotropes or mechanical ventricular support after CABG surgery. Validated SNPs were assessed further in two replication CABG cohorts and meta-analysis was performed. RESULTS: Over 100 SNPs were associated with VnD (P2.1 of developing in-hospital VnD after CABG surgery. However, three genetic loci identified by meta-analysis were more modestly associated with development of postoperative VnD. Studies of larger cohorts to assess these loci as well as to define other genetic mechanisms and related biology that link genetic variants to postoperative ventricular dysfunction are warranted.

  7. Usage Frequency and Articulatory Reduction in Vietnamese Tonogenesis

    Stebbins, Jeff Roesler


    Vietnamese (Vietic, Mon-Khmer, Austroasiatic) is monosyllabic and tonal. Most Mon-Khmer (MK) languages are multisyllabic and atonal. Evidence suggests that Vietnamese (VN) has had its tones less than one millennium, and that other languages (both MK and non-MK) are also acquiring tones, a process called "tonogenesis". Comparing VN's…

  8. AcEST: DK961439 [AcEST

    Full Text Available [Protein-PII] uridylyltransferase OS=Brucel... 51 6e-06 sp|A5VN81|GLND_BRUO2 [Protein-PII] uridylyltransfer...TLSNKFTVIEVEGLDRPGLLSELTGLISDLSLDIASAHITTFGEKVIDSFYVTDL 895 Query: 534 LGNKVKD 554 +G+K+ + Sbjct: 896 VGHKIS...N 902 >sp|A5VN81|GLND_BRUO2 [Protein-PII] uridylyltransferase OS=Brucella ovis (s

  9. AcEST: DK960532 [AcEST

    Full Text Available Brucel... 55 3e-07 sp|A5VN81|GLND_BRUO2 [Protein-PII] uridylyltransferase OS=Bruc... IE+ G DRPGLLSE++ +++ L ++ +A + T Sbjct: 847 TVIEVEGLDRPGLLSELTGLISDLSLDIASAHITT 881 >sp|A5VN81|GLND_BRUO2 [

  10. AcEST: BP921601 [AcEST

    Full Text Available ase OS=Brucel... 41 0.002 sp|A5VN81|GLND_BRUO2 [Protein-PII] uridylyltransferase OS=Brucel... 41 0.002 sp|Q8...TTFGEKVIDSFYVTD-LVGHKIS 901 Query: 34 DSDRLASIK 8 ++ R +IK Sbjct: 902 NATRQGNIK 910 >sp|A5VN81|GLND_BRUO2 [P

  11. AcEST: DK963331 [AcEST

    Full Text Available uridylyltransferase OS=Brucel... 37 0.084 sp|A5VN81|GLND_BRUO2 [Protein-PII] uridylyltransferase OS=Brucel....TRQGNIKRKLLALLG 918 >sp|A5VN81|GLND_BRUO2 [Protein-PII] uridylyltransferase OS=Br

  12. Mesoporous vanadium nitride as a high performance catalyst support for formic acid electrooxidation.

    Yang, Minghui; Cui, Zhiming; DiSalvo, Francis J


    Mesoporous vanadium nitride (VN) with high surface area and good electrical conductivity was prepared by a solid-solid phase separation method from a Zn containing vanadium oxide, Zn(3)V(2)O(8). The VN supported Pd catalyst exhibited significant catalytic activity for formic acid oxidation.

  13. JPRS Report, Soviet Union, Military History Journal, No. 2, February 1988.


    the Party [Editorial; pp 3-11] 1 Military Activities of Labor, Defense Council Headed by V.l. Lenin [V.N. Maltsev ; pp 13-18] 4 Genesis...00010032b Moscow VOYENNO-ISTORICHESKIY ZHURNAL in Russian No 2, Feb 88 (signed to press 21Jan88)pp 13-18 [Article by Lt Col V.N. Maltsev : "The Military

  14. Dyslexia and Hyperlexia in Bilinguals

    Malatesha Joshi, R.; Padakannaya, Prakash; Nishanimath, S.


    This study explores the nature of reading difficulties of two bilinguals in Kannada and English, which vary in their orthographic depth and script layout. VN and MS manifest two different types of reading disabilities, dyslexia and hyperlexia, respectively. The performance of VN was below average on Kannada and English tests of phonemic awareness,…

  15. Correlation of Serum Levels of Vitronectin, Malondialdehyde and Hs-CRP With Disease Severity in Coronary Artery Disease

    Alireza Yaghoubi


    Conclusion: The association and correlation between VN, MDA and hs-CRP indicate their involvement in the atherosclerosis process that may lead to progression of CAD. Also, these findings suggested that serum levels of VN, MDA and hs-CRP can help as diagnostic and monitoring markers in CAD patients and as markers of disease severity.

  16. Mobility Monitor

    Schæbel, Anne-Lise; Dybbro, Karina Løvendahl; Andersen, Lisbeth Støvring;


    Undersøgelse af digital monitorering af plejehjemsbeboeres vendinger under søvn på Fremtidens Plejehjem, Nørresundby......Undersøgelse af digital monitorering af plejehjemsbeboeres vendinger under søvn på Fremtidens Plejehjem, Nørresundby...

  17. Gene : CBRC-PABE-19-0001 [SEVENS

    Full Text Available CBRC-PABE-19-0001 pseudo Novel 18 A Pheromone receptors VN1R3_HUMAN 1e-106 66% sp|Q...9BXE9|VN1R3_HUMAN Vomeronasal type-1 receptor 3 (V1r-like receptor 3) gb|AAK21299.1|AF336873_1 FKSG46 [Homo sapiens] 1e-

  18. Corpora and Collocations in Chinese-English Dictionaries for Chinese Users

    Xia, Lixin


    The paper identifies the major problems of the Chinese-English dictionary in representing collocational information after an extensive survey of nine dictionaries popular among Chinese users. It is found that the Chinese-English dictionary only provides the collocation types of "v+n" and "v+n," but completely ignores those of…

  19. On the Behavior of a Variant of Hofstadter's Q-Sequence

    Balamohan, B.; Kuznetsov, A.; Tanny, Stephen


    We completely solve the meta-Fibonacci recursion V(n) = V(n - V(n - 1)) + V(n - V(n - 4)), a variant of Hofstadter's meta-Fibonacci Q-sequence. For the initial conditions V(1) = V(2) = V(3) = V(4) = 1 we prove that the sequence V(n) is monotone, with successive terms increasing by 0 or 1, so the sequence hits every positive integer. We demonstrate certain special structural properties and fascinating periodicities of the associated frequency sequence (the number of times V(n) hits each positive integer) that make possible an iterative computation of V(n) for any value of n. Further, we derive a natural partition of the V-sequence into blocks of consecutive terms ("generations") with the property that terms in one block determine the terms in the next. We conclude by examining all the other sets of four initial conditions for which this meta-Fibonacci recursion has a solution; we prove that in each case the resulting sequence is essentially the same as the one with initial conditions all ones.

  20. A Concentration Behavior for Semilinear Elliptic Systems with Indefinite Weight

    Xue Xiu ZHONG; Wen Ming ZOU


    Consider the Schr¨odinger system where Ω ⊂ RN , α,β > 1, α +β 0}shrink to a point x0∈Ω as n→+∞. We obtain the concentration phenomenon. Precisely, we first show that the system has a nontrivial solution (un, vn) corresponding to Qn, then we prove that the sequences (un) and (vn) concentrate at x0 with respect to the H1-norm. Moreover, if the sets {Qn >0} shrink to finite points and (un, vn) is a ground state solution, then we must have that both un and vn concentrate at exactly one of these points. Surprisingly, the concentration of un and vn occurs at the same point. Hence, we generalize the results due to Ackermann and Szulkin [Arch. Rational Mech. Anal., 207, 1075-1089 (2013)].

  1. Coated U(Mo) Fuel: As-Fabricated Microstructures

    Emmanuel Perez; Dennis D. Keiser, Jr.; Ann Leenaers; Sven Van den Berghe; Tom Wiencek


    As part of the development of low-enriched uranium fuels, fuel plates have recently been tested in the BR-2 reactor as part of the SELENIUM experiment. These fuel plates contained fuel particles with either Si or ZrN thin film coating (up to 1 µm thickness) around the U-7Mo fuel particles. In order to best understand irradiation performance, it is important to determine the starting microstructure that can be observed in as-fabricated fuel plates. To this end, detailed microstructural characterization was performed on ZrN and Si-coated U-7Mo powder in samples taken from AA6061-clad fuel plates fabricated at 500°C. Of interest was the condition of the thin film coatings after fabrication at a relatively high temperature. Both scanning electron microscopy and transmission electron microscopy were employed. The ZrN thin film coating was observed to consist of columns comprised of very fine ZrN grains. Relatively large amounts of porosity could be found in some areas of the thin film, along with an enrichment of oxygen around each of the the ZrN columns. In the case of the pure Si thin film coating sample, a (U,Mo,Al,Si) interaction layer was observed around the U-7Mo particles. Apparently, the Si reacted with the U-7Mo and Al matrix during fuel plate fabrication at 500°C to form this layer. The microstructure of the formed layer is very similar to those that form in U-7Mo versus Al-Si alloy diffusion couples annealed at higher temperatures and as-fabricated U-7Mo dispersion fuel plates with Al-Si alloy matrix fabricated at 500°C.

  2. Spolupráce orgánů sociálně-právní ochrany dětí Jihočeského kraje a Intervenčního centra České Budějovice při řešení případů domácího násilí

    JANŮ, Alena


    Domestic violence highlights as a significant social problem, it introduces frequent and least controlled form of violence included all manifestations of violence among close people. Domestic violence is a form of violence widespreaded throughout the world, in all cultures, appears among people of all social levels, regardless of education, economic situation or ethnicity. Victims of domestic violence are in up to 98% women. In families with domestic violence living minor children, so that th...

  3. Exercise Training for Heart Failure Patients with and without Systolic Dysfunction: An Evidence-Based Analysis of How Patients Benefit

    Neil Smart


    Full Text Available Significant benefits can be derived by heart failure patients from exercise training. This paper provides an evidence-based assessment of expected clinical benefits of exercise training for heart failure patients. Meta-analyses and randomized, controlled trials of exercise training in heart failure patients were reviewed from a search of PubMed, Cochrane Controlled Trial Registry (CCTR, CINAHL, and EMBASE. Exercise training improves functional capacity, quality of life, hospitalization, and systolic and diastolic function in heart failure patients. Heart failure patients with preserved systolic function (HFnEF participating in exercise training studies are more likely to be women and are 5–7 years older than their systolic heart failure (CHF counterparts. All patients exhibit low functional capacities, although in HFnEF patients this may be age related, therefore subtle differences in exercise prescriptions are required. Published works report that exercise training is beneficial for heart failure patients with and without systolic dysfunction.




    Full Text Available BACKGROUND AND OBJECTIVES : To study the socio demographic profile , risk factors , clinical presentation and comorbidies in patients with heart failure. To compare the socio demographic profile , risk factors , clinical presentation and comorbidities in patients with Heart failure with normal ejection fraction (HFnEF and Heart failure with reduced ejection fraction (HFrEF. METHODS: The primary study population consisted of 100 cases of adult men and women aged more than 18 years with symptoms of Hea rt failure diagnosed by Framingham’s criteria . The study population was selected from inpatients and outpatients attending Department of Medicine of KIMS hospital between January to December 2012. The study was a hospital based observatory and comparative study. RESULTS: Out of 100 cases included in our study 50% cases had HFrEF & 50% cases had HFnEF as confirmed by echocardiographic parameters. There was no statistically significant difference between the two groups with respect to age and sex. However the re were significant statistical significant differences between the groups with respect to clinical features , risk factors and co morbidities. Clinical features like oedema , hepatomegaly and rales were common in HFrEF group (P<0.05. Also LVESD & LVEDD wer e increased in patients with HFrEF. Risk factors like prior MI/IHD were more common in patients with HfrEF (P<0.05 . History of hypertension and left ventricular hypertrophy were common in patients with HFnEF (P< 0.05. Among the comorbidities: IHD Conduct ion abnormalities were common in HFrEF group. Pericardial effusion was more common in HFnEFgroup.

  5. Left atrial enlargement in the early stage of hypertensive heart disease: a common but ignored condition.

    Su, Guanhua; Cao, Heng; Xu, Sudan; Lu, Yongxin; Shuai, Xinxin; Sun, Yufei; Liao, Yuhua; Li, Jingdong


    How to identify the early signs of hypertensive heart disease is the key to block or reverse the process of heart failure. The aim of this study was to evaluate the predictive value of left atrial (LA) enlargement in the early stage of hypertensive heart disease and to explore the correlations between LA enlargement and heart failure with normal ejection fraction (HFnEF), as well as the metabolic syndrome (MetS). Baseline clinical characteristics, biochemical indices, electrocardiographic and echocardiographic data were collected from 341 consecutive patients with essential hypertension. Among those patients, LA enlargement was more frequently presented than LV enlargement (57.2% vs 17.9%). Compared with patients without HFnEF, the prevalence of LA enlargement was higher in patients with HFnEF (82.9% vs 49.0%, Page, body mass index, waist circumference, triglyceride level, and left ventricular diameter were independent predictors of LA enlargement. The simple measurement for identification of LA enlargement potentially allows early recognition of those patients at risk for heart failure, particularly among patients with MetS.

  6. Numerical Investigation into the Influence of Bedding Plane on Hydraulic Fracture Network Propagation in Shale Formations

    Yushi, Zou; Xinfang, Ma; Shicheng, Zhang; Tong, Zhou; Han, Li


    Shale formations are often characterized by low matrix permeability and contain numerous bedding planes (BPs) and natural fractures (NFs). Massive hydraulic fracturing is an important technology for the economic development of shale formations in which a large-scale hydraulic fracture network (HFN) is generated for hydrocarbon flow. In this study, HFN propagation is numerically investigated in a horizontally layered and naturally fractured shale formation by using a newly developed complex fracturing model based on the 3D discrete element method. In this model, a succession of continuous horizontal BP interfaces and vertical NFs is explicitly represented and a shale matrix block is considered impermeable, transversely isotropic, and linearly elastic. A series of simulations is performed to illustrate the influence of anisotropy, associated with the presence of BPs, on the HFN propagation geometry in shale formations. Modeling results reveal that the presence of BP interfaces increases the injection pressure during fracturing. HF deflection into a BP interface tends to occur under high strength and elastic anisotropy as well as in low vertical stress anisotropy conditions, which generate a T-shaped or horizontal fracture. Opened BP interfaces may limit the growth of the fracture upward and downward, resulting in a very low stimulated thickness. However, the opened BP interfaces favor fracture complexity because of the improved connection between HFs and NFs horizontally under moderate vertical stress anisotropy. This study may help predict the HF growth geometry and optimize the fracturing treatment designs in shale formations with complex depositional heterogeneity.

  7. Adsorption behavior of human plasma fibronectin on hydrophobic and hydrophilic Ti6Al4V substrata and its influence on bacterial adhesion and detachment.

    Vadillo-Rodríguez, Virginia; Pacha-Olivenza, Miguel A; Gónzalez-Martín, M Luisa; Bruque, José M; Gallardo-Moreno, Amparo M


    Biomaterial implant-associated infections, a common cause of medical devices' failure, are initiated by bacterial adhesion to an adsorbed protein layer on the implant material surface. In this study, the influence of protein surface orientation on bacterial adhesion has been examined using three clinically relevant bacterial strains known to express specific binding sites for human plasma fibronectin (HFN). HFN was allowed to adsorb on hydrophobic Ti6Al4V and physically modified hydrophilic Ti6Al4V substrata. Ellipsometric data reveal that the characteristics of the adsorbed protein layers primary depend on solid surface tension and the initial protein concentration in solution. In particular, HFN molecules adopt a more extended conformation on hydrophobic than hydrophilic surfaces, an effect that is more pronounced at low than at high initial protein concentrations. Moreover, the extended conformation of the protein molecules on these surfaces likely facilitates the exposure of specific sites for adhesion, resulting in the higher bacterial-cell attachment observed regardless of the strain considered. Contact angle measurements and the analysis of the number of remaining adhering cells after being subjected to external forces further suggest that both specific and nonspecific (hydrophobic) interactions play an important role on bacterial attachment. This study is the first one to evaluate the influence of surface hydrophobicity on protein adsorption and its subsequent effect on bacterial adhesion using a material whose hydrophobicity was not modified using chemical treatments that potentially led to surface properties changes other than hydrophobicity.

  8. Partial recovery of respiratory function and diaphragm reinnervation following unilateral vagus nerve to phrenic nerve anastomosis in rabbits.

    Junxiang Wen

    Full Text Available Respiratory dysfunction is the leading cause of mortality following upper cervical spinal cord injury (SCI. Reinnervation of the paralyzed diaphragm via an anastomosis between phrenic nerve and a donor nerve is a potential strategy to mitigate ventilatory deficits. In this study, anastomosis of vagus nerve (VN to phrenic nerve (PN in rabbits was performed to assess the potential capacity of the VN to compensate for lost PN inputs. At first, we compared spontaneous discharge pattern, nerve thickness and number of motor fibers between these nerves. The PN exhibited a highly rhythmic discharge while the VN exhibited a variable frequency discharge pattern. The rabbit VN had fewer motor axons (105.3±12.1 vs. 268.1±15.4. Nerve conduction and respiratory function were measured 20 weeks after left PN transection with or without left VN-PN anastomosis. Compared to rabbits subjected to unilateral phrenicotomy without VN-PN anastomosis, diaphragm muscle action potential (AP amplitude was improved by 292%, distal latency by 695%, peak inspiratory flow (PIF by 22.6%, peak expiratory flow (PRF by 36.4%, and tidal volume by 21.8% in the anastomosis group. However, PIF recovery was only 28.0%, PEF 28.2%, and tidal volume 31.2% of Control. Our results suggested that VN-PN anastomosis is a promising therapeutic strategy for partial restoration of diaphragm reinnervation, but further modification and improvements are necessary to realize the full potential of this technique.

  9. Grading ductal carcinoma in situ of the breast using an automated proliferation index.

    Stasik, Christopher J; Davis, Marilyn; Kimler, Bruce F; Fan, Fang; Damjanov, Ivan; Thomas, Patricia; Tawfik, Ossama W


    Tumor grade, size and margin status are the most significant factors in predicting the behavior of ductal carcinoma in-situ (DCIS). The inclusion of necrosis and nuclear grade in the grading of DCIS has demonstrated a fair but suboptimal agreement between pathologists. The grading of DCIS was studied and compared to the Van Nuys (VN) system, by using our newly proposed unifying "nuclear grade + proliferation index (N+P) grading system for invasive carcinomas. 162 DCIS tumors were studied including 49 VN I, 31 VN II, and 82 VN III cases. The VN and N+P systems were compared with each other and correlated with tumor size, ER, PR, p53, Her-2, EGFR, Bcl-2, p27 and p21 status. The two systems demonstrated similar frequencies for the different grades and an agreement with each other for all of the biomarkers studied. The greatest difference between the two systems was observed for those tumors initially classified as VN II (94% being down-graded to N+P I) and VN III (80% being down-graded to N+P II). These results suggest that the N+P system, combining nuclear grade with automated MIB-1 count, is a potentially valid and reproducible grading system for both non-invasive and invasive mammary carcinomas. It is automated, less subjective in assessing mitotic activity and necrosis and correlates with other prognostic biomarkers.

  10. Vascular Neurology Nurse Practitioner Provision of Telemedicine Consultations

    Bart M. Demaerschalk


    Full Text Available Objective. The objective was to define and evaluate a role for the Vascular Neurology-Nurse Practitioner (VN-NP in the delivery of telemedicine consultations in partnership with a vascular neurologist. Methods. Prospective stroke alert patients at participating hospitals underwent a two-way audio video telemedicine consultation with a VN-NP at a remotely located stroke center in partnership with a vascular neurologist. Demographic information, National Institutes of Health Stroke Scale (NIHSS scores, diagnoses, CT contraindications to thrombolysis, thrombolysis eligibility, and time interval data were collected. The inter-rater agreement between VN-NP and vascular neurologist assessments was calculated. Results. Ten patients were evaluated. Four were determined to have ischemic stroke, one had a transient ischemic attack, two had intracerebral hemorrhages, and three were stroke mimics. Overall, three patients received thrombolysis. The inter-rater agreement between VN-NP and vascular neurologist assessments were excellent, ranging from 0.9 to 1.0. The duration of VN-NP consultation was 53.2±9.0 minutes, which included the vascular neurologist supervisory evaluation time of 12.0±9.6 minutes. Conclusion. This study illustrated that a stroke center VN-NP, in partnership with a vascular neurologist, could deliver timely telemedicine consultations, accurate diagnoses, and correct treatments in acute stroke patients who presented to remotely located rural emergency departments within a hub and spoke network. VN-NPs may fulfill the role of a telestroke provider.

  11. Adsorption of fibronectin and vitronectin onto Primaria and tissue culture polystyrene and relationship to the mechanism of initial attachment of human vein endothelial cells and BHK-21 fibroblasts.

    Steele, J G; Dalton, B A; Johnson, G; Underwood, P A


    The two cell culture substrata, tissue culture polystyrene (TCPS) and Primaria, were compared in order to determine whether a nitrogen-containing surface such as Primaria attracts cells by a different mechanism to an oxygen-containing surface (TCPS). The amounts of vitronectin (Vn) and fibronectin (Fn) which adsorb from the fetal bovine serum (FBS) component of the culture medium onto Primaria and TCPS were determined. Primaria adsorbed two- to threefold more Fn than TCPS, but adsorbed similar amounts of Vn from medium containing FBS. The Fn and Vn binding sites on Primaria were distinct, as adsorption was non-competitive between these two proteins. The amounts of Fn and Vn that adsorbed onto the two surfaces were compared to the concentration dependence of the cell attachment activities of Fn and Vn. Whereas the amounts of Fn which adsorbed onto TCPS were suboptimal for cell attachment, Primaria adsorbed an Fn surface density that was supraoptimal for attachment of human vein endothelial cells and BHK-21 fibroblasts. We conclude that Primaria differs from TCPS in that both Fn and Vn mediate initial cell attachment to Primaria when the culture medium contains FBS, whereas cell attachment to TCPS is dependent upon Vn.

  12. Anxiolytic activity of Vitex negundo Linn. in experimental models of anxiety in mice

    Adnaik R


    Full Text Available The purpose of this study was to characterize the putative anxiolytic-like activity of an ethanolic extract prepared from the roots of Vitex negundo (VN using the elevated plus maze (EPM and light-dark exploration test in mice. Male mice were either treated orally with the VN extract or the positive control diazepam, respectively, 1 hour before behavioral evaluation. Oral administration of 100 and 200 mg/kg of VN extract significantly (P > 0.01 increased the percentage time spent on and the number of entries into the open arms of the EPM. The effect was comparable to that of the benzodiazepine diazepam (2 mg/kg p.o.. In light-dark exploration test, diazepam-treated rats significantly increased the time spent in light arena and decreased the duration of immobility, while VN treated rats also showed a significant (P >0.01 increase in the time spent (100 and 200 mg/kg in light arena. Diazepam and the VN extracts do not produced any overt motor dysfunction. These results indicate that VN is an effective anxiolytic agent. In conclusion, the action of extract upon the anxiety models tested are in accord with the traditional use of VN L. and could be useful in primary medical care.

  13. Identification and therapeutic potential of a vitronectin binding region of meningococcal msf.

    Hill, Darryl J; Griffiths, Natalie J; Borodina, Elena; Andreae, Clio A; Sessions, Richard B; Virji, Mumtaz


    The human pathogen Neisseria meningitides (Nm) attains serum resistance via a number of mechanisms, one of which involves binding to the host complement regulator protein vitronectin. We have shown previously that the Meningococcal surface fibril (Msf), a trimeric autotransporter, binds to the activated form of vitronectin (aVn) to increase Nm survival in human serum. In this study, we aimed to identify the aVn-binding region of Msf to assess its potential as an antigen which can elicit antibodies that block aVn binding and/or possess bactericidal properties. Using several recombinant Msf fragments spanning its surface-exposed region, the smallest aVn-binding recombinants were found to span residues 1-86 and 39-124. The use of further deletion constructs and overlapping recombinant Msf fragments suggested that a region of Msf comprising residues 39-82 may be primarily important for aVn binding and that other regions may also be involved but to a lesser extent. Molecular modelling implicated K66 and K68, conserved in all available Msf sequences, to be involved in the interaction. Recombinant fragments which bound to aVn were able to reduce the survival advantage conveyed by aVn-interaction in serum bactericidal assays. Antibodies raised against one such fragment inhibited aVn binding to Msf. In addition, the antibodies enhanced specific killing of Msf-expressing Nm in a dose-dependent manner. Overall, this study identifies an aVn-binding region of Msf, an adhesin known to impart serum resistance properties to the pathogen; and shows that this region of Msf can elicit antibodies with dual properties which reduce pathogen survival within the host and thus has potential as a vaccine antigen.

  14. Identification and therapeutic potential of a vitronectin binding region of meningococcal msf.

    Darryl J Hill

    Full Text Available The human pathogen Neisseria meningitides (Nm attains serum resistance via a number of mechanisms, one of which involves binding to the host complement regulator protein vitronectin. We have shown previously that the Meningococcal surface fibril (Msf, a trimeric autotransporter, binds to the activated form of vitronectin (aVn to increase Nm survival in human serum. In this study, we aimed to identify the aVn-binding region of Msf to assess its potential as an antigen which can elicit antibodies that block aVn binding and/or possess bactericidal properties. Using several recombinant Msf fragments spanning its surface-exposed region, the smallest aVn-binding recombinants were found to span residues 1-86 and 39-124. The use of further deletion constructs and overlapping recombinant Msf fragments suggested that a region of Msf comprising residues 39-82 may be primarily important for aVn binding and that other regions may also be involved but to a lesser extent. Molecular modelling implicated K66 and K68, conserved in all available Msf sequences, to be involved in the interaction. Recombinant fragments which bound to aVn were able to reduce the survival advantage conveyed by aVn-interaction in serum bactericidal assays. Antibodies raised against one such fragment inhibited aVn binding to Msf. In addition, the antibodies enhanced specific killing of Msf-expressing Nm in a dose-dependent manner. Overall, this study identifies an aVn-binding region of Msf, an adhesin known to impart serum resistance properties to the pathogen; and shows that this region of Msf can elicit antibodies with dual properties which reduce pathogen survival within the host and thus has potential as a vaccine antigen.

  15. Inverse stochastic resonance in electroconvection by multiplicative colored noise

    Huh, Jong-Hoon


    A kind of inverse stochastic resonance (ISR) observed in ac-driven electroconvection (EC) in a nematic liquid crystal is presented. In successive pattern evolutions by increasing noise intensity VN, a typical EC (with a normalized amplitude A0=1 at VN=0 ) disappears (A0→0 ) , and then the rest state (A0=0 ) reenters into the EC (A0=1 ); eventually, it develops into complicated EC (A0>1 ) . The reversed bell-shaped behavior of A0(VN) is evidence of ISR. The present ISR may be explained by taking into account colored noise characterized by its intensity and correlation time.

  16. Personality traits inventory in patients with vocal nodules.

    Mattei, Alexia; Revis, Joana; Giovanni, Antoine


    The objective of the study was to analyze temperament and character in females with vocal nodules (VN) compared to a vocally healthy control population. 61 females were examined over a 17-month period for dysphonia with VN (mean age 46 years, duration of vocal complaints from 2 months to 6 years). 71 control females were recruited in their environment (mean age 34 years). The validated French Version of the Temperament and Character Inventory (TCI) was used. Patients with VN had significantly (p personality-specific maladaptive behaviors. A possible personalized approach to voice therapy could be organized on the basis of the TCI findings.

  17. Reactive Mechanical Alloying Synthesis of Nanocrystalline Cubic Zirconium Nitride

    QIU Li-Xia; YAO Bin; DING Zhan-Hui; ZHAO Xu-Dong; JI Hong; DU Xiao-Bo; JIA Xiao-Peng; ZHENG Wei-Tao


    Zirconium nitride powders with rock salt structure (γ-ZrNx) are prepared by mechanical milling of a mixture of Zirconium and hexagonal boron nitride (h-BN) powders.The products are analysed by x-ray diffraction (XRD),scanning electron microscopy (SEM),and Raman spectroscopy (RS).The formation mechanism of γ-ZrNx by ball milling technique is investigated in detail.N atoms diffuse from amorphous BN (a-BN) into Zr to form Zr(N) solid solution alloy,then the Zr(N) solid solution alloy decomposes into γ-ZrNx.No ZrB2 is observed in the as-milled samples or the samples annealed at 1050℃ for 2 h.

  18. Zirconium carbonitride pellets by internal sol gel and spark plasma sintering as inert matrix fuel material

    Hedberg, Marcus; Cologna, Marco; Cambriani, Andrea; Somers, Joseph; Ekberg, Christian


    Inert matrix fuel is a fuel type where the fissile material is blended with a solid diluent material. In this work zirconium carbonitride microspheres have been produced by internal sol gel technique, followed by carbothermal reduction. Material nitride purities in the produced materials ranged from Zr(N0.45C0.55) to Zr(N0.74C0.26) as determined by X-ray diffraction and application of Vegard's law. The zirconium carbonitride microspheres have been pelletized by spark plasma sintering (SPS) and by conventional cold pressing and sintering. In all SPS experiments cohesive pellets were formed. Maximum final density reached by SPS at 1700 °C was 87% theoretical density (TD) compared to 53% TD in conventional sintering at 1700 °C. Pore sizes in all the produced pellets were in the μm scale and no density gradients could be observed by computer tomography.

  19. Nanoscale Multilayered ZrAlN/ZrB2 Coatings Synthesized by Magnetron Sputtering

    Dejun LI


    Multilayered ZrAlN/ZrB2 coatings containing alternating bilayer periods were synthesized by dc magnetron sputtering technique. The intensities of ZrN (111) or ZrN (200) textures in the structure of the nanolayers depended on the bilayer period as well as N2 gas partial pressure during deposition. Nanoindentation testing showed that hardness and internal stress of the nanolayers varied with the bilayer period and crystallographic orientation in the coatings. The hardness of the nanolayers with bilayer periods of 3~6 nm was enhanced (~27%) over the rule-of-mixture value. A low percent of N2 in processing gas was proved to be benefitial to the synthesis of high hard nanoscale multilayered coatings.

  20. Optical properties of non-stoichiometric sputtered zirconium nitride films

    Benia, H.M.; Guemmaz, M.; Schmerber, G.; Mosser, A.; Parlebas, J.C


    Non-stoichiometric dc magnetron-sputtered ZrN films on silicon have been optically and electrically characterized through spectral reflectance measurements and a four-probe method, respectively. The deposition of the films was monitored by the nitrogen gas flow which has been increased from 1 to 11 sccm. Experimental results show that the reflectivity as well as the electrical resistivity strongly depends on the nitrogen concentration. In order to determine the optical constants of the various ZrN layers, Drude's model was used to fit the reflectance spectra of the films with a metallic behavior, and an extended model for the films with a more insulating behavior. The optical resistivity for the frequency {omega}=0 was derived from the optical constants and compared to the electrical resistivity obtained by the four-probe method. A good agreement between electrical and optical resistivities was obtained.

  1. Recent progress in the synthesis and characterization of amorphous and crystalline carbon nitride coatings

    Widlow, I


    This review summarizes our most recent findings in the structure and properties of amorphous and crystalline carbon nitride coatings, synthesized by reactive magnetron sputtering. By careful control of the plasma conditions via proper choice of process parameters such as substrate bias, target power and gas pressure, one can precisely control film structure and properties. With this approach, we were able to produce amorphous carbon nitride films with controlled hardness and surface roughness. In particular, we can synthesize ultrathin (1 nm thick) amorphous carbon nitride films to be sufficiently dense and uniform that they provide adequate corrosion protection for hard disk applications. We demonstrated the strong correlation between ZrN (111) texture and hardness in CN sub x /ZrN superlattice coatings. Raman spectroscopy and near-edge X-ray absorption show the predominance of sp sup 3 -bonded carbon in these superlattice coatings.

  2. High-yield expression of recombinant SARS coronavirus nucleocapsid protein in methylotrophic yeast Pichia pastoris

    Ru-Shi Liu; Kun-Yu Yang; Jian Lin; Yi-Wei Lin; Zhi-Hong Zhang; Jun Zhang; Ning-Shao Xia


    AIM: Nucleocapsid (N) protein plays an important role in reproduction and pathological reaction of severe acute respiratory syndrome (SARS) coronavirus (SCoV), theantigenicity of the protein is better than spike (S) protein.This study was to find a highly specific and antigenic recombinant SCoV nucleocapsid (rSCoVN) protein, and to provide a basis for further researches on early diagnosis of SARS.METHODS: Full length cDNA of SCoV nucleocapsid (SCoVN)protein was amplified through polymerase chain reaction (PCR) and cloned into yeast expression vector pPIC3.5K to construct plasmid of pPIC3.5K-SCoVN. The plasmid was linearized and then transformed into Pichia pastoris (P. pastoris) GS115 (HisMut+) by electroporation. His+Mut+recombinant strains were identified by PCR and cultivated on MM/MD plates. The influence of different factors on biomass and rSCoVN protein production during induction phase, such as various induction media, dissolved oxygen (DO) and different final concentrations of methanol, was subsequently studied. The expression level and activation were detected by SDS-PAGE and Western-blot respectively.RESULTS: All of the recombinants were His+Mut+ aftertransformation of P. pastoriswith linearized plasmids. The BMMY medium was optimal for recombinant ScoVN (rSCoVN)protein expression and growth of the recombinant strains.The final optimal concentration of methanol was 20 mL/L,the DO had a significant effect on rSCoVN protein expression and growth of recombinant strains. The rSCoVN protein expressed in recombinant strains was about 8% of the total cell protein, 520 mg/L of rSCoVN protein was achieved,and a maximum cell ,A at 600 nm of 62 was achieved in shake flask culture. The rSCoVN protein had a high specificity against mouse-anti-SARS-CoVN-mAb and SARS positive sera, but had no cross-reaction with normal human serum.The biological activity of rSCoVN expressed in P. pastoris was about 4-fold higher than that expressed in E.coliwhen the same rSCoVN protein


    V I Kurpatov


    approaches. V.N. Myasishchev's theory of personality relations in association with its universality, as well as pathogenetic psychotherapy may be the basis for the integration of other methods of psychotherapy

  4. Analisis comparativo de estudios sobre la velocidad de nombrar en espanol y su relacion con la adquisicion de la lectura y sus dificultades

    Suro Sanchez, Judith; Leal Carretero, Fernando; Lopez-Escribano, Carmen; Sanchez-Hipola, Pilar


    La relacion entre las tareas de Velocidad de Nombrar (VN) y la lectura se estudio por primera vez, en lengua inglesa, en la decada de los 70, descubriendose que los ninos con dislexia eran lentos e inconsistentes en estas tareas...

  5. An antioxidant nanozyme that uncovers the cytoprotective potential of vanadia nanowires

    Vernekar, Amit A.; Sinha, Devanjan; Srivastava, Shubhi; Paramasivam, Prasath U.; D'Silva, Patrick; Mugesh, Govindasamy


    Nanomaterials with enzyme-like properties has attracted significant interest, although limited information is available on their biological activities in cells. Here we show that V2O5 nanowires (Vn) functionally mimic the antioxidant enzyme glutathione peroxidase by using cellular glutathione. Although bulk V2O5 is known to be toxic to the cells, the property is altered when converted into a nanomaterial form. The Vn nanozymes readily internalize into mammalian cells of multiple origin (kidney, neuronal, prostate, cervical) and exhibit robust enzyme-like activity by scavenging the reactive oxygen species when challenged against intrinsic and extrinsic oxidative stress. The Vn nanozymes fully restore the redox balance without perturbing the cellular antioxidant defense, thus providing an important cytoprotection for biomolecules against harmful oxidative damage. Based on our findings, we envision that biocompatible Vn nanowires can provide future therapeutic potential to prevent ageing, cardiac disorders and several neurological conditions, including Parkinson’s and Alzheimer’s disease.

  6. Gene : CBRC-XTRO-01-2949 [SEVENS


  7. Disease: H00722 [KEGG MEDICUS

    Full Text Available Mutations are identified in KRT9. Mild form of EPPK is linked to KRT1. Skin and c...hgal VN, Sardana K, Sharma S, Raut D Hereditary palmoplantar (epidermolytic) keratoderma: illustration through a familial report. Ski

  8. Rahvuskaaslased Siberi Krasnojarski krais / Anu Korb ; foto: Andreas Kalkun

    Korb, Anu


    Eesti Rahvaluule Arhiivi ekspeditsioonigrupi järjekordsest reisist Krasnojarski krai lõunaeestlaste ja setode juurde, Kani ja Mana jõe piirkonda, Haiti (vn. Haidak), Bulatnovkasse, Krestjanskisse ja Uus-Petseri külla

  9. Gene : CBRC-MDOM-03-0396 [SEVENS


  10. Pärt: Fratres / Robert Cowan

    Cowan, Robert


    Uuest heliplaadist "Pärt: Fratres (seven versions). Festina Lente. Cantus in Memory of Benjamin Britten. Summa. Peter Manning (vn.), France Springuel (vc.), Mireille Gleizes (pf.), I Fiamminghi. Telare CD CD80387 (79 minutes)

  11. Gene : CBRC-MDOM-06-0020 [SEVENS


  12. Rahvuskaaslased Siberi Krasnojarski krais / Anu Korb ; foto: Andreas Kalkun

    Korb, Anu


    Eesti Rahvaluule Arhiivi ekspeditsioonigrupi järjekordsest reisist Krasnojarski krai lõunaeestlaste ja setode juurde, Kani ja Mana jõe piirkonda, Haiti (vn. Haidak), Bulatnovkasse, Krestjanskisse ja Uus-Petseri külla

  13. An In-defect complex as a possible explanation for high luminous efficacy of InGaN and AlInN based devices

    Kessler, Patrick; Miranda, Sérgio MC; Correia, João Guilherme; Johnston, Karl; Vianden, Reiner


    The role of indium in GaN and AlN films is investigated with the method of the perturbed angular correlation (PAC). Using the PAC probe $^{111}$In in addition to indium on substitutional cation sites a large fraction of probes is found in a distinctly different microscopic environment which was attributed to the formation of an indium nitrogen-vacancy (VN) complex. The influence of an electron capture induced after ef fect is ruled out by additional measurements with the PAC probes $^{111m}$Cd and $^{117}$Cd and using GaN with different dopants. It is shown that the VN is not bound to substitutional Cd impurities suggesting that the In-VN complex formation is a particularity of In in GaN and AlN. Finally, a preliminary model is presented to explain the temperature behavior of the electric field gradient, observed in the In-VN complex measured with $^{111}$In.

  14. Crowd Energy Management:New Paradigm for Electricity Market

    Mario Gstrein; Stephanie Teufel


    Abstract-The traditionally centralized approach of electricity networks is progressively undergoing a shift towards a decentralized, distributed structure. The local and crowd-based principle is transforming the existing supply chain and related activities into a value network (VN). Previous researches on crowd value network concepts focus on the activities of infrastructure and load management and neglect activities that generate collaboration. Collaboration with and within crowds particularly demands a different mindset and management of sharing values, information, benefit, and risks. Furthermore, these concepts must integrate technical, processual, and social aspects. Thus, this article proposes a holistic framework of electricity VN management for crowd energy. It redefines VN activities for infrastructure and load management while appending VN activities for social electricity handling. Additionally, the framework illustrates the interactions among these three elements and concludes with an adaption cycle for the crowd value network.

  15. Pärt: Fratres / Robert Cowan

    Cowan, Robert


    Uuest heliplaadist "Pärt: Fratres (seven versions). Festina Lente. Cantus in Memory of Benjamin Britten. Summa. Peter Manning (vn.), France Springuel (vc.), Mireille Gleizes (pf.), I Fiamminghi. Telare CD CD80387 (79 minutes)

  16. Critical role of nitrogen during high temperature scaling of zirconium

    Evans, E. B.; Tsangarakis, N.; Probst, H. B.; Garibotti, N. J.


    The mechanisms of scale cracking, scale color changes, and scale growth, and their interrelations, were studied in zirconium specimens at elevated temperatures in air, oxygen and nitrogen. Nitrogen was found to be responsible for monoclinic-to-cubic ZrO2 conversion, for scale cracking and breakaway on zirconium nitride, and for the formation of ZrN on the metal interface underneath an outer oxide layer.

  17. Study of optical and electronic properties of semiconductors, Sbsbr, Sbsei, and Sbsi. Interim report, 1 Oct 1974--30 Jun 1975

    Fong, C.Y.; Wooten, F.O.


    A preliminary energy band structure of SbSI obtained by empirical pseudopotential method is discussed with references to existing optical data and other calculations. Brief discussions on band structure results for niobium, of calculations on the angular-dependent photoemission from GaAs and charge distributions in transition metal compounds, TiC, TiN, ZrC, and ZrN are included.

  18. Powder-XRD and (14) N magic angle-spinning solid-state NMR spectroscopy of some metal nitrides.

    Kempgens, Pierre; Britton, Jonathan


    Some metal nitrides (TiN, ZrN, InN, GaN, Ca3 N2 , Mg3 N2 , and Ge3 N4 ) have been studied by powder X-ray diffraction (XRD) and (14) N magic angle-spinning (MAS) solid-state NMR spectroscopy. For Ca3 N2 , Mg3 N2 , and Ge3 N4 , no (14) N NMR signal was observed. Low speed (νr  = 2 kHz for TiN, ZrN, and GaN; νr  = 1 kHz for InN) and 'high speed' (νr  = 15 kHz for TiN; νr  = 5 kHz for ZrN; νr  = 10 kHz for InN and GaN) MAS NMR experiments were performed. For TiN, ZrN, InN, and GaN, powder-XRD was used to identify the phases present in each sample. The number of peaks observed for each sample in their (14) N MAS solid-state NMR spectrum matches perfectly well with the number of nitrogen-containing phases identified by powder-XRD. The (14) N MAS solid-state NMR spectra are symmetric and dominated by the quadrupolar interaction. The envelopes of the spinning sidebands manifold are Lorentzian, and it is concluded that there is a distribution of the quadrupolar coupling constants Qcc 's arising from structural defects in the compounds studied.

  19. Influence of N{sub 2} partial pressure on structural and microhardness properties of TiN/ZrN multilayers deposited by Ar/N{sub 2} vacuum arc discharge

    Naddaf, M., E-mail: [Department of Molecular Biology and Biotechnology, Atomic Energy Commission of Syria (AECS), P.O. Box 6091, Damascus (Syrian Arab Republic); Abdallah, B. [Department of Physics, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Ahmad, M. [IBA Laboratory, Department of Chemistry, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); A-Kharroub, M. [Department of Physics, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic)


    The influence of N{sub 2} partial pressure on structural, mechanical and wetting properties of multilayered TiN/ZrN thin films deposited on silicon substrates by vacuum arc discharge of (N{sub 2} + Ar) gas mixtures is investigated. X-ray diffraction (XRD) results show that the average texturing coefficient of (1 1 1) orientation and the grain size of both TiN and ZrN individual layers increase with increasing the N{sub 2} partial pressure. The Rutherford back scattering (RBS) measurements and analysis reveal that incorporation of the nitrogen in the film increases with increasing the N{sub 2} partial pressure and both TiN and ZrN individual layers have a nitrogen over-stoichiometry for N{sub 2} partial pressure ⩾50%. The change in the film micro-hardness is correlated to the changes in crystallographic texture, grain size, stoichiometry and the residual stress in the film as a function of the N{sub 2} partial pressure. In particular, stoichiometry of ZrN and TiN individual is found to play the vital role in determining the multilayer hardness. The multilayer film deposited at N{sub 2} partial pressure of 25% has the best stoichiometric ratio of both TiN and ZrN layers and the highest micro-hardness of about 32 GPa. In addition, water contact angle (WCA) measurements and analysis show a decrease in the work of adhesion on increasing the N{sub 2} partial pressure.

  20. Wavefield Synthetics in 3D and Fully Automatic Event Locations,


    approximation (Ryzhikov and Troyan 1992 a,b) and presuming linearity of w with respect to f, we may rewrite eq.(11) for dimensionless values I = f/fm...production, Bull.Seism.Soc.Am, 83, 660-679. Ryzhikov, G.A. and Troyan , V.N., 1992a. Diffraction tomography. Part 1: Construction and in- terpretation...Ryzhikov, G.A. and Troyan , V.N., 1992b. Diffraction tomography. Part 2: Reconstruction al- gorithm with statistical regularization, in Proceedings of

  1. Research on Balanced Construction Algorithm of Virtual Network%均衡虚拟网构建算法研究

    齐宁; 王保进; 汪斌强; 张栋


    如何在物理资源有限的条件下构建出满足用户需求的虚拟网是一个热点问题.该文针对虚拟网(VirtualNetwork,VN)的构建方法进行了论述,分析了虚拟网构建的数学模型,给出了构建策略的若干重要原则,为提高构网成功率,分别提出基于链路负载均衡度和节点负载均衡度的虚拟网构建算法,在此基础上提出了考虑均衡的自适应虚拟网构建算法(Balanced Adaptive VN Construction Algorithm,BACA)以及链路失效后的处理方法和迁移策略.最后,通过仿真实验,从虚拟网构建需求接收率和构建后整个网络的链路均衡度以及节点均衡度3个方面验证了BACA的优越性.%How to construct Virtual Networks (VNs) which satisfies user's demand efficiently under the situation of limited resources is a hot issue. Mathematics model of VN construction is analyzed. Under some important principles of VN construction, balanced link load VN construction algorithm and balanced node load VN construction algorithm are given. Based on these two algorithms Balanced Adaptive VN Construction Algorithm (BACA) is proposed. The remapping of failure virtual links and VN reconfiguration are discussed when link failure occurs. The efficiency of BACA is evaluated by emulation experiment according to construction requirements acceptance ratio and link and node load balance ratio of the whole substrate network.

  2. Precision calculation of energy levels for four-valent Si I

    Imanbaeva, R T; Konovalova, E A


    We report results of the calculation of the low-lying levels of neutral Si using a combination of the configuration interaction and many-body perturbation theory (CI+MBPT method). We treat Si I as an atom with four valence electrons and use two different starting approximations, namely $V^{N-2}$ and $V^{N-4}$. We conclude that both approximations provide comparable accuracy, on the level of 1%.

  3. Ocular vestibular evoked myogenic potential to air conducted sound stimulation and video head impulse test in acute vestibular neuritis.

    Walther, Leif Erik; Blödow, Alexander


    Air-conducted (ACS) cervical VEMP (cVEMP) reflect both saccular and inferior vestibular nerve function. Ocular VEMP (oVEMP) to air and bone-conducted vibration (BCV) are critically discussed, whether they reflect predominantly utricular and superior vestibular nerve function. The video head impulse test (vHIT) accurately detects changes in the high frequency range (5-7 Hz) of the vestibular ocular reflex (VOR) in all 3 planes and can be used to assess semicircular canals (SCC) impairment. To evaluate oVEMP and cVEMP in response to 500 Hz ACS stimulation and to compare these with vHIT results in acute unilateral vestibular neuritis (VN) to classify the probable involvement of SCC and otolith organs. Patients with VN were studied. ACS oVEMP and ACS cVEMP (100 dB nHL 500 Hz tone burst stimulation) were recorded. The vHIT for the 3 SCC were performed simultaneously. ACS oVEMP and ACS cVEMP in combination with vHIT allows the differentiation of 4 types of VN: entire VN (EVN), superior VN (SVN), inferior VN (IVN), and ampullary VN (AVN). Lesions of EVN, SVN, and IVN may be either complete or partial. ACS oVEMP and ACS cVEMP to 500 Hz stimulation together with the vHIT allows a better differentiation of receptor involvement in VN. Results suggest a different origin of AC oVEMP and AC cVEMP to 500 Hz in complete SVN and IVN. Partial SVN and IVN may indicate a role of saccular fibers in oVEMP.

  4. Three-Terminal Superconducting Device Research


    L.G., and Fistul, MXV JETP Leut. 30, 213 (1979), Sov. Phys. JETP 54, 206 (198 1). Alfeev, V.N., and Gritsenko , N.I. Soy. Phys. Sol. State 22, 1951 (1980...Phys. Semicond. 13,93 (1979). Alfeev. V.N., and Gritsenko , N.I. Soy. Phys. Sol. State 24, 1258 (1982). SoL’. J. Low Temp. Phys. 9, 290 (1983); 10


    Longfei GU; Zhongxiang ZHANG


    In this paper, the integral representation for some polyharmonic functions with values in a universal Clifford algebra Cl(Vn,n) is studied and Gauss-mean value formula for triharmonic functions with values in a Clifford algebra Cl(Vn,n) are proved by using Stokes formula and higher order Cauchy-Pompeiu formula. As application some results about growth condition at infinity are obtained.

  6. Blow-up Estimates of the Positive Solution of a Parabolic System

    Pedersen, Michael; Zhigui, Lin


    This paper establishes the blowup estimates for the systems: $u_t-\\Delta u=0,$ $v_t-\\Delta v=0$ in $B_R\\times (0,T)$, $B_R\\subset\\Bbb R^n$, with the nonlinear boundary conditions $\\frac{\\partial u}{\\partial \\eta}=u^{m_1}v^{n_1}$ and $\\frac{\\partial v}{\\partial \\eta}=u^{m_2}v^{n_2}$ on $S_R\\times ...

  7. Early life DNA vaccination with the H gene of Canine distemper virus induces robust protection against distemper

    Jensen, Trine Hammer; Nielsen, Line; Aasted, Bent;


    Young mink kits (n = 8)were vaccinated withDNA plasmids encoding the viral haemagglutinin protein (H) of a vaccine strain of Canine distemper virus (CDV). Virus neutralising (VN) antibodieswere induced after 2 immunisations and after the third immunisation all kits had high VN antibody titres...... demonstrate that early life DNA vaccination with the H gene of a CDV vaccine strain induced robust protective immunity against a recent wild type CDV....

  8. NCBI nr-aa BLAST: CBRC-MMUS-06-0123 [SEVENS

    Full Text Available CBRC-MMUS-06-0123 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-140 80% ...

  9. NCBI nr-aa BLAST: CBRC-CPOR-01-1266 [SEVENS

    Full Text Available CBRC-CPOR-01-1266 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 6e-64 44% ...

  10. NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

    Full Text Available CBRC-RNOR-04-0238 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-133 80% ...

  11. NCBI nr-aa BLAST: CBRC-RNOR-04-0246 [SEVENS

    Full Text Available CBRC-RNOR-04-0246 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-125 75% ...

  12. NCBI nr-aa BLAST: CBRC-RNOR-04-0252 [SEVENS

    Full Text Available CBRC-RNOR-04-0252 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-94 63% ...

  13. NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

    Full Text Available CBRC-RNOR-04-0259 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-126 74% ...

  14. NCBI nr-aa BLAST: CBRC-RNOR-04-0249 [SEVENS

    Full Text Available CBRC-RNOR-04-0249 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-134 76% ...

  15. NCBI nr-aa BLAST: CBRC-RNOR-04-0240 [SEVENS

    Full Text Available CBRC-RNOR-04-0240 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...

  16. NCBI nr-aa BLAST: CBRC-MMUS-20-0071 [SEVENS

    Full Text Available CBRC-MMUS-20-0071 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-140 80% ...

  17. NCBI nr-aa BLAST: CBRC-RNOR-04-0243 [SEVENS

    Full Text Available CBRC-RNOR-04-0243 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...

  18. NCBI nr-aa BLAST: CBRC-OCUN-01-0923 [SEVENS

    Full Text Available CBRC-OCUN-01-0923 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 8e-74 48% ...

  19. NCBI nr-aa BLAST: CBRC-RNOR-04-0255 [SEVENS

    Full Text Available CBRC-RNOR-04-0255 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-120 74% ...

  20. NCBI nr-aa BLAST: CBRC-RNOR-04-0244 [SEVENS

    Full Text Available CBRC-RNOR-04-0244 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-175 100% ...

  1. Thermomechanically modulated nanoscale multilayered materials for application in electromagnetic gun systems

    Otooni, M.A. [Army ARDEC, Picatinny Arsenal, NJ (United States); Brown, I.G.; Monteiro, O. [Lawrence Berkeley Lab., CA (United States)


    Fired rails from electromagnetic railguns show severe damage from arcing and tribological mismatch. The authors have fabricated and studied several different nanoscale multilayered materials as possible routes to improve the thermal transport and thermomechanical properties of the rail and armature materials. A vacuum-arc-based plasma deposition technique with wide control of ion energy was used for the film synthesis, and high-energy high-dose (energy up to {approximately}150 keV, dose up to {approximately}1 {times} 10{sup 17} cm{sup {minus}2}) metal ion implantation was also used. The multilayered film structures formed and investigated included sublayers of Ti, TiCo, ZrN, TaN and dlc (diamond-like carbon) in the following combinations: (1) ZrN on TiCo on TaN on dlc on a Cu substrate, (2) ZrN on TiCo on TaN on dlc on an Al substrate, (3) TiN on TiCo on TaN on a stainless steel substrate, and (4) Ti on TiCo on a stainless steel substrate. Individual sublayer film thickness was in the range of 400 {angstrom}--7{micro}. The surfaces were characterized by SEM, TEM, RBS, high energy electron diffraction, and microhardness measurements. Significant improvements in the material surface properties were obtained for virtually all of the surface structures investigated. Here the authors outline the material synthesis and surface modification techniques used and the materials characterization results obtained.

  2. Probing initial-stages of ALD growth with dynamic in situ spectroscopic ellipsometry

    Muneshwar, Triratna; Cadien, Ken


    The initial stages of ALD surface reactions are probed using dynamic in situ spectroscopic ellipsometry (d-iSE) technique during plasma-enhanced ALD of zirconium nitride (ZrN) thin films in spectral range of 0.73-6.4 eV. The measured change in the ellipsometry parameter Δ, with every precursor (TDMAZr) and reactant (forming gas plasma) exposure is interpreted as the combined effect of film growth and change in surface chemistry during ALD. We present application of Bruggeman's effective-medium approximation (B-EMA) in the analysis of d-iSE data to determine fractional surface coverage (θ) of ALD grown film at the end of every deposition cycle. During the deposition of first few ZrN monolayers, d-iSE datasets are analyzed on the basis of surface diffusion enhanced ALD growth, where the surface adsorbed precursor molecules can diffuse over substrate surface to occupy energetically favorable surface sites. The determined surface coverage of ZrN films highlights the effects of substrate enhanced ALD growth.

  3. Complex network structure of flocks in the Vicsek Model with Vectorial Noise

    Baglietto, Gabriel; Albano, Ezequiel V.; Candia, Julián


    In the Vicsek Model (VM), self-driven individuals try to adopt the direction of movement of their neighbors under the influence of noise, thus leading to a noise-driven order-disorder phase transition. By implementing the so-called Vectorial Noise (VN) variant of the VM (i.e. the VM-VN model), this phase transition has been shown to be discontinuous (first-order). In this paper, we perform an extensive complex network study of VM-VN flocks and show that their topology can be described as highly clustered, assortative, and nonhierarchical. We also study the behavior of the VM-VN model in the case of "frozen flocks" in which, after the flocks are formed using the full dynamics, particle displacements are suppressed (i.e. only rotations are allowed). Under this kind of restricted dynamics, we show that VM-VN flocks are unable to support the ordered phase. Therefore, we conclude that the particle displacements at every time-step in the VM-VN dynamics are a key element needed to sustain long-range ordering throughout.

  4. The smelling of Hedione results in sex-differentiated human brain activity.

    Wallrabenstein, I; Gerber, J; Rasche, S; Croy, I; Kurtenbach, S; Hummel, T; Hatt, H


    A large family of vomeronasal receptors recognizes pheromone cues in many animals including most amphibia, reptiles, rhodents, and other mammals. Humans possess five vomeronasal-type 1 receptor genes (VN1R1-VN1R5), which code for proteins that are functional in recombinant expression systems. We used two different recombinant expression systems and identified Hedione as a ligand for the putative human pheromone receptor VN1R1 expressed in the human olfactory mucosa. Following the ligand identification, we employed functional magnetic resonance imaging (fMRI) in healthy volunteers to characterize the in vivo action of the VN1R1 ligand Hedione. In comparison to a common floral odor (phenylethyl alcohol), Hedione exhibited significantly enhanced activation in limbic areas (amygdala, hippocampus) and elicited a sex-differentiated response in a hypothalamic region that is associated with hormonal release. Utilizing a novel combination of methods, our results indicate that the putative human pheromone receptor VN1R1 is involved in extra-olfactory neuronal activations induced by the odorous substance Hedione. The activation of VN1R1 might play a role in gender-specific modulation of hormonal secretion in humans.

  5. Effect of the Interaction of Veratrum Nigrum with Panax Ginseng on Estrogenic Activity In Vivo and In Vitro

    Xu, Ying; Ding, Jie; An, Jin-na; Qu, Ya-kun; Li, Xin; Ma, Xiao-ping; Zhang, Yi-min; Dai, Guo-jing; Lin, Na


    Panax ginseng (GS) and Veratrum nigrum (VN) are representative of incompatible pairs in “eighteen antagonistic medicaments” that have been recorded in the Chinese medicinal literature for over 2,000 years. However, evidence linking interference effects with combination use is scare. Based on the estrogen-like effect of GS described in our previous studies, we undertake a characterization of the interaction on estrogenic activity of GS and VN using in vivo models of immature and ovariectomized (OVX) mice and in vitro studies with MCF-7 cells for further mechanism. VN decreased the estrogenic efficacy of GS on promoting the development of the uterus and vagina in immature mice, and reversing the atrophy of reproductive tissues in OVX mice. VN interfered with the estrogenic efficacy of GS by decreasing the increase of the serum estradiol and the up-regulation of ERα and ERβ expressions by treatment with GS. And VN antagonized the estrogenic efficacy of GS on promoting the viability of MCF-7 cells and up-regulation of protein and gene expressions of ERs. In conclusion, this study provided evidence that GS and VN decreased effects on estrogenic activity, which might be related to regulation of estrogen secretion and ERs. PMID:27229740

  6. Voice parameters and videonasolaryngoscopy in children with vocal nodules: a longitudinal study, before and after voice therapy.

    Valadez, Victor; Ysunza, Antonio; Ocharan-Hernandez, Esther; Garrido-Bustamante, Norma; Sanchez-Valerio, Araceli; Pamplona, Ma C


    Vocal Nodules (VN) are a functional voice disorder associated with voice misuse and abuse in children. There are few reports addressing vocal parameters in children with VN, especially after a period of vocal rehabilitation. The purpose of this study is to describe measurements of vocal parameters including Fundamental Frequency (FF), Shimmer (S), and Jitter (J), videonasolaryngoscopy examination and clinical perceptual assessment, before and after voice therapy in children with VN. Voice therapy was provided using visual support through Speech-Viewer software. Twenty patients with VN were studied. An acoustical analysis of voice was performed and compared with data from subjects from a control group matched by age and gender. Also, clinical perceptual assessment of voice and videonasolaryngoscopy were performed to all patients with VN. After a period of voice therapy, provided with visual support using Speech Viewer-III (SV-III-IBM) software, new acoustical analyses, perceptual assessments and videonasolaryngoscopies were performed. Before the onset of voice therapy, there was a significant difference (ptherapy period, a significant improvement (pvocal nodules were no longer discernible on the vocal folds in any of the cases. SV-III software seems to be a safe and reliable method for providing voice therapy in children with VN. Acoustic voice parameters, perceptual data and videonasolaryngoscopy were significantly improved after the speech therapy period was completed. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  7. Meningococcal surface fibril (Msf) binds to activated vitronectin and inhibits the terminal complement pathway to increase serum resistance.

    Griffiths, Natalie J; Hill, Darryl J; Borodina, Elena; Sessions, Richard B; Devos, Nathalie I; Feron, Christiane M; Poolman, Jan T; Virji, Mumtaz


    Complement evasion is an important survival strategy of Neisseria meningitidis (Nm) during colonization and infection. Previously, we have shown that Nm Opc binds to serum vitronectin to inhibit complement-mediated killing. In this study, we demonstrate meningococcal interactions with vitronectin via a novel adhesin, Msf (meningococcal surface fibril, previously NhhA or Hsf). As with Opc, Msf binds preferentially to activated vitronectin (aVn), engaging at its N-terminal region but the C-terminal heparin binding domain may also participate. However, unlike Opc, the latter binding is not heparin-mediated. By binding to aVn, Msf or Opc can impart serum resistance, which is further increased in coexpressers, a phenomenon dependent on serum aVn concentrations. The survival fitness of aVn-binding derivatives was evident from mixed population studies, in which msf/opc mutants were preferentially depleted. In addition, using vitronectin peptides to block Msf-aVn interactions, aVn-induced inhibition of lytic C5b-9 formation and of serum killing could be reversed. As Msf-encoding gene is ubiquitous in the meningococcal strains examined and is expressed in vivo, serum resistance via Msf may be of significance to meningococcal pathogenesis. The data imply that vitronectin binding may be an important strategy for the in vivo survival of Nm for which the bacterium has evolved redundant mechanisms.

  8. Inhibitory effects of Veratrum nigrum L. Var. ussurience Nakai alkaloids on the hypertrophy of cardiomyocytes from neonatal rat

    WANG Li; LI Shu-yuan; LI Hua; ZHOU Qin


    Objective To examine the effects of Veratrum nigrum L. Vat. ussurience Nakai alkaloids (VnA) on angiotensin Ⅱ (Ang Ⅱ)-induced cardiomyocyte hypertrophy and to explore its possible mechanism. Methods The cadiocytes were induced by Ang Ⅱ to set up myocardial hypertrophy model, the animals were divided into six groups according to the different treatments: control group, model group, positive control group, VnA group (low, middle and high dose). The cell protein content, the cell diameter and the expression of calcineurin (CAN) were measured respectively by BCA method, the micrometer and immunofluo-rescence analysis. Results VnA (middle and high dose) and Captopril inhibited significantly the increase in the protein content induced by Ang Ⅱ (P<0.01). VnA and Captopril inhibited significantly the increase in the diameters induced by Ang Ⅱ (P< 0.01). By immunofluorescence analysis, the expression of calcineurin (CAN) was obviously increased in the Ang Ⅱ-induced model group. VnA decreased the expression of CaN significantly. Conclusions VnA could inhibit the cardiomyocyte hypertrophy induced by Ang Ⅱ significantly in a dose-dependent manner. The possible mechanism may be related to the inhibition of CAN expression.

  9. A virtual network mapping algorithm based on integer programming

    Bo LU; Jian-ya CHEN; Hong-yan CUI; Tao HUANG; Yun-jie LIU


    The virtual network (VN) embedding/mapping problem is recognized as an essential question of network virtualiza-tion. The VN embedding problem is a major challenge in this field. Its target is to efficiently map the virtual nodes and virtual links onto the substrate network resources. Previous research focused on designing heuristic-based algorithms or attempting two-stage solutions by solving node mapping in the first stage and link mapping in the second stage. In this study, we propose a new VN embedding algorithm based on integer programming. We build a model of an augmented substrate graph, and formulate the VN embedding problem as an integer program with an objective function and some constraints. A factor of topology-awareness is added to the objective function. The VN embedding problem is solved in one stage. Simulation results show that our algorithm greatly enhances the acceptance ratio, and increases the revenue/cost (R/C) ratio and the revenue while decreasing the cost of the VN embedding problem.

  10. Normal Caloric Responses during Acute Phase of Vestibular Neuritis

    Lee, Sun-Uk; Park, Seong-Ho; Kim, Hyo-Jung; Koo, Ja-Won


    Background and Purpose We report a novel finding of caloric conversion from normal responses into unilateral paresis during the acute phase of vestibular neuritis (VN). Methods We recruited 893 patients with a diagnosis of VN at Dizziness Clinic of Seoul National University Bundang Hospital from 2003 to 2014 after excluding 28 patients with isolated inferior divisional VN (n=14) and those without follow-up tests despite normal caloric responses initially (n=14). We retrospectively analyzed the neurotological findings in four (0.5%) of the patients who showed a conversion from initially normal caloric responses into unilateral paresis during the acute phase. Results In those four patients, the initial caloric tests were performed within 2 days of symptom onset, and conversion into unilateral caloric paresis was documented 1–4 days later. The clinical and laboratory findings during the initial evaluation were consistent with VN in all four patients except for normal findings in bedside head impulse tests in one of them. Conclusions Normal findings in caloric tests should be interpreted with caution during the acute phase of suspected VN. Follow-up evaluation should be considered when the findings of the initial caloric test are normal, but VN remains the most plausible diagnosis. PMID:26932259

  11. Effect of Vitronectin Bound to Insulin-Like Growth Factor-I and Insulin-Like Growth Factor Binding Protein-3 on Porcine Enamel Organ-Derived Epithelial Cells

    Yoshinori Shinohara


    Full Text Available The aim of this paper was to determine whether the interaction between IGF, IGFBP, and VN modulates the functions of porcine EOE cells. Enamel organs from 6-month-old porcine third molars were dissociated into single epithelial cells and subcultured on culture dishes pretreated with VN, IGF-I, and IGFBP-3 (IGF-IGFBP-VN complex. The subcultured EOE cells retained their capacity for ameloblast-related gene expression, as shown by semiquantitative reverse transcription-polymerase chain reaction. Amelogenin expression was detected in the subcultured EOE cells by immunostaining. The subcultured EOE cells were then seeded onto collagen sponge scaffolds in combination with fresh dental mesenchymal cells and transplanted into athymic rats. After 4 weeks, enamel-dentin-like complex structures were present in the implanted constructs. These results show that EOE cells cultured on IGF-IGFBP-VN complex differentiated into ameloblasts-like cells that were able to secrete amelogenin proteins and form enamel-like tissues in vivo. Functional assays demonstrated that the IGF/IGFBP/VN complex significantly enhanced porcine EOE cell proliferation and tissue forming capacity for enamel. This is the first study to demonstrate a functional role of the IGF-IGFBP-VN complex in EOE cells. This application of the subculturing technique provides a foundation for further tooth-tissue engineering and for improving our understanding of ameloblast biology.

  12. Effect of vitronectin bound to insulin-like growth factor-I and insulin-like growth factor binding protein-3 on porcine enamel organ-derived epithelial cells.

    Shinohara, Yoshinori; Tsuchiya, Shuhei; Hatae, Kazuo; Honda, Masaki J


    The aim of this paper was to determine whether the interaction between IGF, IGFBP, and VN modulates the functions of porcine EOE cells. Enamel organs from 6-month-old porcine third molars were dissociated into single epithelial cells and subcultured on culture dishes pretreated with VN, IGF-I, and IGFBP-3 (IGF-IGFBP-VN complex). The subcultured EOE cells retained their capacity for ameloblast-related gene expression, as shown by semiquantitative reverse transcription-polymerase chain reaction. Amelogenin expression was detected in the subcultured EOE cells by immunostaining. The subcultured EOE cells were then seeded onto collagen sponge scaffolds in combination with fresh dental mesenchymal cells and transplanted into athymic rats. After 4 weeks, enamel-dentin-like complex structures were present in the implanted constructs. These results show that EOE cells cultured on IGF-IGFBP-VN complex differentiated into ameloblasts-like cells that were able to secrete amelogenin proteins and form enamel-like tissues in vivo. Functional assays demonstrated that the IGF/IGFBP/VN complex significantly enhanced porcine EOE cell proliferation and tissue forming capacity for enamel. This is the first study to demonstrate a functional role of the IGF-IGFBP-VN complex in EOE cells. This application of the subculturing technique provides a foundation for further tooth-tissue engineering and for improving our understanding of ameloblast biology.

  13. Abrogation of plasminogen activator inhibitor-1-vitronectin interaction ameliorates acute kidney injury in murine endotoxemia.

    Kamlesh K Gupta

    Full Text Available Sepsis-induced acute kidney injury (AKI contributes to the high mortality and morbidity in patients. Although the pathogenesis of AKI during sepsis is poorly understood, it is well accepted that plasminogen activator inhibitor-1 (PAI-1 and vitronectin (Vn are involved in AKI. However, the functional cooperation between PAI-1 and Vn in septic AKI has not been completely elucidated. To address this issue, mice were utilized lacking either PAI-1 (PAI-1-/- or expressing a PAI-1-mutant (PAI-1R101A/Q123K in which the interaction between PAI-1 and Vn is abrogated, while other functions of PAI-1 are retained. It was found that both PAI-1-/- and PAI-1R101A/Q123K mice are associated with decreased renal dysfunction, apoptosis, inflammation, and ERK activation as compared to wild-type (WT mice after LPS challenge. Also, PAI-1-/- mice showed attenuated fibrin deposition in the kidneys. Furthermore, a lack of PAI-1 or PAI-1-Vn interaction was found to be associated with an increase in activated Protein C (aPC in plasma. These results demonstrate that PAI-1, through its interaction with Vn, exerts multiple deleterious mechanisms to induce AKI. Therefore, targeting of the PAI-1-Vn interaction in kidney represents an appealing therapeutic strategy for the treatment of septic AKI by not only altering the fibrinolytic capacity but also regulating PC activity.

  14. Process stabilization by peak current regulation in reactive high-power impulse magnetron sputtering of hafnium nitride

    Shimizu, T.; Villamayor, M.; Lundin, D.; Helmersson, U.


    A simple and cost effective approach to stabilize the sputtering process in the transition zone during reactive high-power impulse magnetron sputtering (HiPIMS) is proposed. The method is based on real-time monitoring and control of the discharge current waveforms. To stabilize the process conditions at a given set point, a feedback control system was implemented that automatically regulates the pulse frequency, and thereby the average sputtering power, to maintain a constant maximum discharge current. In the present study, the variation of the pulse current waveforms over a wide range of reactive gas flows and pulse frequencies during a reactive HiPIMS process of Hf-N in an Ar-N2 atmosphere illustrates that the discharge current waveform is a an excellent indicator of the process conditions. Activating the reactive HiPIMS peak current regulation, stable process conditions were maintained when varying the N2 flow from 2.1 to 3.5 sccm by an automatic adjustment of the pulse frequency from 600 Hz to 1150 Hz and consequently an increase of the average power from 110 to 270 W. Hf-N films deposited using peak current regulation exhibited a stable stoichiometry, a nearly constant power-normalized deposition rate, and a polycrystalline cubic phase Hf-N with (1 1 1)-preferred orientation over the entire reactive gas flow range investigated. The physical reasons for the change in the current pulse waveform for different process conditions are discussed in some detail.

  15. Spasmolytic and Antibacterial Activity of Two Citrus sinensis Osbeck Varieties Cultivated in Mexico

    Sánchez-Recillas, Amanda; Arroyo-Herrera, Ana Ly; Araujo-León, Jesús Alfredo; Hernández Núñez, Emanuel


    Antibacterial activity on ATCC strains of Escherichia coli, Salmonella enterica, Salmonella enteritidis, and Salmonella choleraesuis and spasmolytic effect on contraction on rat ileum trips were determinate. Eight organic extracts (hexanic and methanolic) of albedo (mesocarp) and flavedo (pericarp) of two varieties (Valencian and National) of Citrus sinensis (L.) Osbeck of Yucatán, México, were studied. Additionally, chromatographic fingerprints were obtained and correlated with their pharmacological effects. MAN, MAV, and HFN extract caused inhibition against S. choleraesuis (MIC: 1000 µg/mL) and S. enteritidis (MIC: 1000 µg/mL). Regarding the spasmolytic effect, the Valencian extracts variety was more efficient on spontaneous contraction, HAV (Emax = 51.98 ± 1.98%), MAV (Emax = 35.98 ± 1.42%), HFV (Emax = 68.91 ± 4.14%), and MFV (Emax = 51.28 ± 2.59%), versus National variety, HAN (Emax = 43.80 ± 6.32%), MAN (Emax = 14.62 ± 1.69%), HFN (Emax = 64.87 ± 3.04%), and MFN (Emax = 31.01 ± 3.92%). Chromatographic fingerprints of HFV and HFN were found to have some similar signals that belong to monoterpenes, whereas for HAN and HAV similar signals were found belonging to fatty acids and triterpenoids. Methanolic extracts showed signals of (1) furfural, (2) furfural acetone (3) furfuraldehyde and (4) β–sitosterol compounds. Flavedo portion of C. sinensis possessed spasmolytic effect on rat ileum strips and antibacterial activity against Salmonella strains. This species is source for obtaining bioactive compounds with therapeutic potential in the treatment of infectious diarrhea. PMID:28356916

  16. Ferroelectric phase stabilization of HfO2 by nitrogen doping

    Xu, Lun; Nishimura, Tomonori; Shibayama, Shigehisa; Yajima, Takeaki; Migita, Shinji; Toriumi, Akira


    We report that nitrogen (N) doping can drive the ferroelectricity of HfO2. It was found that N doping can cause the transition from a monoclinic phase to a highly symmetric phase. The role of N doping is discussed from the viewpoints of charge balance and bond-constraining effects. The former is responsible for the structural transformation from a paraelectric phase to a ferroelectric phase by forming an oxygen vacancy. In addition, Hf-N and N-O bonds with covalent characteristics have strong effects on HfO2 structural and electrical properties, and thus contribute to a marked HfO2 para-/ferroelectric transition.

  17. Dicty_cDB: CHF272 [Dicty_cDB

    Full Text Available CH (Link to library) CHF272 (Link to dictyBase) - - - Contig-U16524-1 - (Link to Original site) - - CHF...272Z 127 - - - - Show CHF272 Library CH (Link to library) Clone ID CHF272 (Link to Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHF272 (CHF272Q) /CSM/CH/CHF2-C/CHF272Q.Seq.d/ XXXXXXXXXXTGTTGGC...KKKKTIITFQ Frame B: ---laywk*nxnxxy**lxtlkkkk***lrikkkkl**hfn Frame C: ---wptgnktxtxninnxxx*kkrnnnn*e*kkknyn

  18. HfO2 Gate Dielectrics for Future Generation of CMOS Device Application

    H.Y.Yu; J.F.Kang; Ren Chi; M.F.Li; D.L.Kwong


    The material and electrical properties of HfO2 high-k gate dielectric are reported.In the first part,the band alignment of HfO2 and (HfO2)x(Al2O3)1-x to (100)Si substrate and their thermal stability are studied by X-ray photoelectron spectroscopy and TEM.The energy gap of (HfO2)x(Al2O3)1-x,the valence band offset,and the conduction band offset between (HfO2)x(Al2O3)1-x and the Si substrate as functions of x are obtained based on the XPS results.Our XPS results also demonstrate that both the thermal stability and the resistance to oxygen diffusion of HfO2 are improved by adding Al to form Hf aluminates.In the second part,a thermally stable and high quality HfN/HfO2 gate stack is reported.Negligible changes in equivalent oxide thickness (EOT),gate leakage,and work function (close to Si mid-gap) of HfN/HfO2 gate stack are demonstrated even after 1000℃ post-metal annealing(PMA),which is attributed to the superior oxygen diffusion barrier of HfN as well as the thermal stability of the HfN/HfO2 interface.Therefore,even without surface nitridation prior to HfO2 deposition,the EOT of HfN/HfO2 gate stack has been successfully scaled down to less than 1nm after 1000℃ PMA with excellent leakage and long-term reliability.The last part demonstrates a novel replacement gate process employing a HfN dummy gate and sub-1nm EOT HfO2 gate dielectric.The excellent thermal stability of the HfN/HfO2 gate stack enables its use in high temperature CMOS processes.The replacement of HfN with other metal gate materials with work functions adequate for n- and p-MOS is facilitated by a high etch selectivity of HfN with respect to HfO2,without any degradation to the EOT,gate leakage,or TDDB characteristics of HfO2.

  19. Neurogenesis in the vomeronasal epithelium of adult garter snakes: 3. Use of /sup 3/H-thymidine autoradiography to trace the genesis and migration of bipolar neurons

    Wang, R.T.; Halpern, M.


    Use of 3H-thymidine autoradiography and unilateral vomeronasal (VN) axotomy has permitted us to demonstrate directly the existence of VN stem cells in the adult garter snake and to trace continuous bipolar neuron development and migration in the normal VN and deafferentated VN epithelium in the same animal. The vomeronasal epithelium and olfactory epithelium of adult garter snakes are both capable of incorporating 3H-thymidine. In the sensory epithelium of the vomeronasal organ, 3H-thymidine-labeled cells were initially restricted to the base of the undifferentiated cell layer in animals surviving 1 day following 3H-thymidine injection. With increasing survival time, labeled cells progressively migrated vertically within the receptor cell column toward the apex of the bipolar neuron layer. In both the normal and denervated VN epithelium, labeled cells were observed through the 56 days of postoperative survival. In the normal epithelium, labeled cells were always located within the matrix of the intact receptor cell columns. However, labeled cells of the denervated epithelium were always located at the apical front of the newly formed cell mass following depletion of the original neuronal cell population. In addition, at postoperative days 28 and 56, labeled cells of the denervated VN epithelium achieved neuronal differentiation and maturation by migrating much farther away from the base of the receptor cell column than the labeled cells on the normal, unoperated contralateral side. This study directly demonstrates that basal cells initially incorporating 3H-thymidine are indeed stem cells of the VN epithelium in adult garter snakes.

  20. Neurovirulence of H5N1 infection in ferrets is mediated by multifocal replication in distinct permissive neuronal cell regions.

    Jennifer R Plourde

    Full Text Available Highly pathogenic avian influenza A (HPAI, subtype H5N1, remains an emergent threat to the human population. While respiratory disease is a hallmark of influenza infection, H5N1 has a high incidence of neurological sequelae in many animal species and sporadically in humans. We elucidate the temporal/spatial infection of H5N1 in the brain of ferrets following a low dose, intranasal infection of two HPAI strains of varying neurovirulence and lethality. A/Vietnam/1203/2004 (VN1203 induced mortality in 100% of infected ferrets while A/Hong Kong/483/1997 (HK483 induced lethality in only 20% of ferrets, with death occurring significantly later following infection. Neurological signs were prominent in VN1203 infection, but not HK483, with seizures observed three days post challenge and torticollis or paresis at later time points. VN1203 and HK483 replication kinetics were similar in primary differentiated ferret nasal turbinate cells, and similar viral titers were measured in the nasal turbinates of infected ferrets. Pulmonary viral titers were not different between strains and pathological findings in the lungs were similar in severity. VN1203 replicated to high titers in the olfactory bulb, cerebral cortex, and brain stem; whereas HK483 was not recovered in these tissues. VN1203 was identified adjacent to and within the olfactory nerve tract, and multifocal infection was observed throughout the frontal cortex and cerebrum. VN1203 was also detected throughout the cerebellum, specifically in Purkinje cells and regions that coordinate voluntary movements. These findings suggest the increased lethality of VN1203 in ferrets is due to increased replication in brain regions important in higher order function and explains the neurological signs observed during H5N1 neurovirulence.

  1. Molecular electrostatic potential analysis of non-covalent complexes



    Ab initio MP4/Aug-cc-pvDZ//MP2/6-311++g(d,p) level interaction energy (Eint) and molecular electrostatic potential analysis (MESP) of a large variety of non-covalent intermolecular complexes, viz. tetrel, chalcogen, pnicogen, halogen, hydrogen, dihydrogen and lithium bonded complexes have been reported. The electronic changes associated with the non-covalent complex formation is monitored in terms of MESP minimum (Vmin) in the free and complexed states of the donor and acceptor molecules as well as in terms ofMESP at the donor and acceptor atoms (Vn) of the free monomers and complexes. The change in Vmin or Vn on the donor molecule (ΔVmin(D) or ΔVn(D)) during complex formation is proportional to its electron donating ability while such a change on the acceptor molecule (ΔVmin(A) or ΔVn(A)) is proportional to its electron accepting ability. Further, the quantities ΔΔVmin = ΔVmin(D) −ΔVmin(A) and ΔΔVn = ΔVn(D) −ΔVn(A) have shown strong linear correlations with Eint of the complex (Eint values fall in the range 0.7 to 46.2 kcal/mol for 54 complexes) and suggest that the intermolecular non-covalent interactions in a wide variety of systems can be monitored and assessed in terms of change in MESP due to complex formation in the gas phase. With the incorporation of solvent effect in the calculation, charged systems showed significant deviations from the linear correlation. The MESP based analysis proposes that the large variety of intermolecular non-covalent complexes considered in this study can be grouped under the general category of electron donor-acceptor (eDA) complexes

  2. Non-Abelian bremsstrahlung and azimuthal asymmetries in high energy p+A reactions

    Gyulassy, M.; Levai, P.; Vitev, I.; Biró, T. S.


    We apply the GLV reaction operator solution to the Vitev-Gunion-Bertsch (VGB) boundary conditions to compute to all orders in nuclear opacity the non-Abelian gluon bremsstrahlung of event-by-event fluctuating beam jets in nuclear collisions. We evaluate analytically azimuthal Fourier moments of single gluon, vnM{1}, and even numbered 2ℓ gluon distribution, vnM{2ℓ}, inclusive distributions in high-energy p +A reactions as a function of harmonic n, target recoil cluster number, M, and gluon number, 2ℓ, at the RHIC and LHC. Multiple resolved clusters of recoiling target beam jets together with the projectile beam jet form color scintillation antenna (CSA) arrays that lead to characteristic boost-noninvariant trapezoidal rapidity distributions in asymmetric B+A nuclear collisions. The scaling of the intrinsically azimuthally anisotropic and long range in η nature of the non-Abelian bremsstrahlung leads to vn moments that are similar to results from hydrodynamic models, but due entirely to non-Abelian wave interference phenomena sourced by the fluctuating CSA. Our analytic nonflow solutions are similar to recent numerical saturation model predictions but differ by predicting a simple power-law hierarchy of both even and odd vn without invoking kT factorization. A test of the CSA mechanism is the predicted nearly linear η rapidity dependence of the vn(kT,η). Non-Abelian beam jet bremsstrahlung may, thus, provide a simple analytic solution to the beam energy scan puzzle of the near √s independence of vn(pT) moments observed down to 10 AGeV, where large-x valence-quark beam jets dominate inelastic dynamics. Recoil bremsstrahlung from multiple independent CSA clusters could also provide a partial explanation for the unexpected similarity of vn in p(D)+A and noncentral A+A at the same dN/dη multiplicity as observed at the RHIC and LHC.

  3. Harmonic decomposition of two particle angular correlations in Pb-Pb collisions at √{sNN} = 2.76 TeV

    Aamodt, K.; Abelev, B.; Abrahantes Quintana, A.; Adamová, D.; Adare, A. M.; Aggarwal, M. M.; Aglieri Rinella, G.; Agocs, A. G.; Agostinelli, A.; Aguilar Salazar, S.; Ahammed, Z.; Ahmad, N.; Ahmad Masoodi, A.; Ahn, S. U.; Akindinov, A.; Aleksandrov, D.; Alessandro, B.; Alfaro Molina, R.; Alici, A.; Alkin, A.; Almaráz Aviña, E.; Alme, J.; Alt, T.; Altini, V.; Altinpinar, S.; Altsybeev, I.; Andrei, C.; Andronic, A.; Anguelov, V.; Anielski, J.; Antičić, T.; Antinori, F.; Antonioli, P.; Aphecetche, L.; Appelshäuser, H.; Arbor, N.; Arcelli, S.; Arend, A.; Armesto, N.; Arnaldi, R.; Aronsson, T.; Arsene, I. C.; Arslandok, M.; Asryan, A.; Augustinus, A.; Averbeck, R.; Awes, T. C.; Äystö, J.; Azmi, M. D.; Bach, M.; Badalà, A.; Baek, Y. W.; Bailhache, R.; Bala, R.; Baldini Ferroli, R.; Baldisseri, A.; Baldit, A.; Baltasar Dos Santos Pedrosa, F.; Bán, J.; Baral, R. C.; Barbera, R.; Barile, F.; Barnaföldi, G. G.; Barnby, L. S.; Barret, V.; Bartke, J.; Basile, M.; Bastid, N.; Bathen, B.; Batigne, G.; Batyunya, B.; Baumann, C.; Bearden, I. G.; Beck, H.; Belikov, I.; Bellini, F.; Bellwied, R.; Belmont-Moreno, E.; Beole, S.; Berceanu, I.; Bercuci, A.; Berdnikov, Y.; Berenyi, D.; Bergmann, C.; Betev, L.; Bhasin, A.; Bhati, A. K.; Bianchi, L.; Bianchi, N.; Bianchin, C.; Bielčík, J.; Bielčíková, J.; Bilandzic, A.; Biolcati, E.; Blanco, F.; Blanco, F.; Blau, D.; Blume, C.; Bock, N.; Bogdanov, A.; Bøggild, H.; Bogolyubsky, M.; Boldizsár, L.; Bombara, M.; Bombonati, C.; Book, J.; Borel, H.; Borissov, A.; Bortolin, C.; Bose, S.; Bossú, F.; Botje, M.; Böttger, S.; Boyer, B.; Braun-Munzinger, P.; Bregant, M.; Breitner, T.; Broz, M.; Brun, R.; Bruna, E.; Bruno, G. E.; Budnikov, D.; Buesching, H.; Bufalino, S.; Bugaiev, K.; Busch, O.; Buthelezi, Z.; Caffarri, D.; Cai, X.; Caines, H.; Calvo Villar, E.; Camerini, P.; Canoa Roman, V.; Cara Romeo, G.; Carena, F.; Carena, W.; Carminati, F.; Casanova Díaz, A.; Caselle, M.; Castillo Castellanos, J.; Casula, E. A. R.; Catanescu, V.; Cavicchioli, C.; Cepila, J.; Cerello, P.; Chang, B.; Chapeland, S.; Charvet, J. L.; Chattopadhyay, S.; Chattopadhyay, S.; Cherney, M.; Cheshkov, C.; Cheynis, B.; Chiavassa, E.; Chibante Barroso, V.; Chinellato, D. D.; Chochula, P.; Chojnacki, M.; Christakoglou, P.; Christensen, C. H.; Christiansen, P.; Chujo, T.; Chung, S. U.; Cicalo, C.; Cifarelli, L.; Cindolo, F.; Cleymans, J.; Coccetti, F.; Coffin, J.-P.; Colamaria, F.; Colella, D.; Conesa Balbastre, G.; Conesa Del Valle, Z.; Constantin, P.; Contin, G.; Contreras, J. G.; Cormier, T. M.; Corrales Morales, Y.; Cortés Maldonado, I.; Cortese, P.; Cosentino, M. R.; Costa, F.; Cotallo, M. E.; Crochet, P.; Cruz Alaniz, E.; Cuautle, E.; Cunqueiro, L.; Erasmo, G. D.; Dainese, A.; Dalsgaard, H. H.; Danu, A.; Das, D.; Das, I.; Das, K.; Dash, A.; Dash, S.; de, S.; de Azevedo Moregula, A.; de Barros, G. O. V.; de Caro, A.; de Cataldo, G.; de Cuveland, J.; de Falco, A.; de Gruttola, D.; De Marco, N.; de Pasquale, S.; de Rooij, R.; Del Castillo Sanchez, E.; Delagrange, H.; Deloff, A.; Demanov, V.; Dénes, E.; Deppman, A.; di Bari, D.; di Giglio, C.; di Liberto, S.; di Mauro, A.; di Nezza, P.; Dietel, T.; Divià, R.; Djuvsland, Ø.; Dobrin, A.; Dobrowolski, T.; Domínguez, I.; Dönigus, B.; Dordic, O.; Driga, O.; Dubey, A. K.; Ducroux, L.; Dupieux, P.; Dutta Majumdar, A. K.; Dutta Majumdar, M. R.; Elia, D.; Emschermann, D.; Engel, H.; Erdal, H. A.; Espagnon, B.; Estienne, M.; Esumi, S.; Evans, D.; Eyyubova, G.; Fabris, D.; Faivre, J.; Falchieri, D.; Fantoni, A.; Fasel, M.; Fearick, R.; Fedunov, A.; Fehlker, D.; Felea, D.; Fenton-Olsen, B.; Feofilov, G.; Fernández Téllez, A.; Ferreiro, E. G.; Ferretti, A.; Ferretti, R.; Figiel, J.; Figueredo, M. A. S.; Filchagin, S.; Fini, R.; Finogeev, D.; Fionda, F. M.; Fiore, E. M.; Floris, M.; Foertsch, S.; Foka, P.; Fokin, S.; Fragiacomo, E.; Fragkiadakis, M.; Frankenfeld, U.; Fuchs, U.; Furget, C.; Fusco Girard, M.; Gaardhøje, J. J.; Gagliardi, M.; Gago, A.; Gallio, M.; Gangadharan, D. R.; Ganoti, P.; Garabatos, C.; Garcia-Solis, E.; Garishvili, I.; Gerhard, J.; Germain, M.; Geuna, C.; Gheata, A.; Gheata, M.; Ghidini, B.; Ghosh, P.; Gianotti, P.; Girard, M. R.; Giubellino, P.; Gladysz-Dziadus, E.; Glässel, P.; Gomez, R.; González-Trueba, L. H.; González-Zamora, P.; Gorbunov, S.; Goswami, A.; Gotovac, S.; Grabski, V.; Graczykowski, L. K.; Grajcarek, R.; Grelli, A.; Grigoras, A.; Grigoras, C.; Grigoriev, V.; Grigoryan, A.; Grigoryan, S.; Grinyov, B.; Grion, N.; Grosse-Oetringhaus, J. F.; Grossiord, J.-Y.; Guber, F.; Guernane, R.; Guerra Gutierrez, C.; Guerzoni, B.; Guilbaud, M.; Gulbrandsen, K.; Gunji, T.; Gupta, A.; Gupta, R.; Gutbrod, H.; Haaland, Ø.; Hadjidakis, C.; Haiduc, M.; Hamagaki, H.; Hamar, G.; Hanratty, L. D.; Harmanova, Z.; Harris, J. W.; Hartig, M.; Hasegan, D.; Hatzifotiadou, D.; Hayrapetyan, A.; Heide, M.; Helstrup, H.; Herghelegiu, A.; Herrera Corral, G.; Herrmann, N.; Hetland, K. F.; Hicks, B.; Hille, P. T.; Hippolyte, B.; Horaguchi, T.; Hori, Y.; Hristov, P.; Hřivnáčová, I.; Huang, M.; Huber, S.; Humanic, T. J.; Hwang, D. S.; Ichou, R.; Ilkaev, R.; Ilkiv, I.; Inaba, M.; Incani, E.; Innocenti, G. M.; Ippolitov, M.; Irfan, M.; Ivan, C.; Ivanov, A.; Ivanov, M.; Ivanov, V.; Ivanytskyi, O.; Jacobs, P. M.; Jancurová, L.; Jangal, S.; Janik, M. A.; Janik, R.; Jayarathna, P. H. S. Y.; Jena, S.; Jimenez Bustamante, R. T.; Jirden, L.; Jones, P. G.; Jung, H.; Jung, W.; Jusko, A.; Kalcher, S.; Kaliňák, P.; Kalisky, M.; Kalliokoski, T.; Kalweit, A.; Kanaki, K.; Kang, J. H.; Kaplin, V.; Karasu Uysal, A.; Karavichev, O.; Karavicheva, T.; Karpechev, E.; Kazantsev, A.; Kebschull, U.; Keidel, R.; Khan, M. M.; Khan, P.; Khan, S. A.; Khanzadeev, A.; Kharlov, Y.; Kileng, B.; Kim, B.; Kim, D. J.; Kim, D. W.; Kim, J. H.; Kim, J. S.; Kim, M.; Kim, S.; Kim, S. H.; Kim, T.; Kirsch, S.; Kisel, I.; Kiselev, S.; Kisiel, A.; Klay, J. L.; Klein, J.; Klein-Bösing, C.; Kliemant, M.; Kluge, A.; Knichel, M. L.; Koch, K.; Köhler, M. K.; Kolojvari, A.; Kondratiev, V.; Kondratyeva, N.; Konevskikh, A.; Kottachchi Kankanamge Don, C.; Kour, R.; Kowalski, M.; Kox, S.; Koyithatta Meethaleveedu, G.; Kral, J.; Králik, I.; Kramer, F.; Kraus, I.; Krawutschke, T.; Kretz, M.; Krivda, M.; Krizek, F.; Krus, M.; Kryshen, E.; Krzewicki, M.; Kucheriaev, Y.; Kuhn, C.; Kuijer, P. G.; Kurashvili, P.; Kurepin, A.; Kurepin, A. B.; Kuryakin, A.; Kushpil, S.; Kushpil, V.; Kweon, M. J.; Kwon, Y.; La Rocca, P.; Ladrón de Guevara, P.; Lakomov, I.; Lara, C.; Lardeux, A.; Larsen, D. T.; Lazzeroni, C.; Le Bornec, Y.; Lea, R.; Lechman, M.; Lee, K. S.; Lee, S. C.; Lefèvre, F.; Lehnert, J.; Leistam, L.; Lenhardt, M.; Lenti, V.; León Monzón, I.; León Vargas, H.; Lévai, P.; Li, X.; Lien, J.; Lietava, R.; Lindal, S.; Lindenstruth, V.; Lippmann, C.; Lisa, M. A.; Liu, L.; Loenne, P. I.; Loggins, V. R.; Loginov, V.; Lohn, S.; Lohner, D.; Loizides, C.; Loo, K. K.; Lopez, X.; López Torres, E.; Løvhøiden, G.; Lu, X.-G.; Luettig, P.; Lunardon, M.; Luo, J.; Luparello, G.; Luquin, L.; Luzzi, C.; Ma, R.; Maevskaya, A.; Mager, M.; Mahapatra, D. P.; Maire, A.; Malaev, M.; Maldonado Cervantes, I.; Malinina, L.; Mal'Kevich, D.; Malzacher, P.; Mamonov, A.; Manceau, L.; Manko, V.; Manso, F.; Manzari, V.; Mao, Y.; Marchisone, M.; Mareš, J.; Margagliotti, G. V.; Margotti, A.; Marín, A.; Markert, C.; Martashvili, I.; Martinengo, P.; Martínez, M. I.; Martínez Davalos, A.; Martínez García, G.; Martynov, Y.; Mas, A.; Masciocchi, S.; Masera, M.; Masoni, A.; Massacrier, L.; Mastromarco, M.; Mastroserio, A.; Matthews, Z. L.; Matyja, A.; Mayani, D.; Mayer, C.; Mazzoni, M. A.; Meddi, F.; Menchaca-Rocha, A.; Mercado Pérez, J.; Meres, M.; Miake, Y.; Michalon, A.; Midori, J.; Milano, L.; Milosevic, J.; Mischke, A.; Mishra, A. N.; Miśkowiec, D.; Mitu, C.; Mlynarz, J.; Mohanty, A. K.; Mohanty, B.; Molnar, L.; Montaño Zetina, L.; Monteno, M.; Montes, E.; Moon, T.; Morando, M.; Moreira de Godoy, D. A.; Moretto, S.; Morsch, A.; Muccifora, V.; Mudnic, E.; Müller, H.; Muhuri, S.; Munhoz, M. G.; Musa, L.; Musso, A.; Nagle, J. L.; Nandi, B. K.; Nania, R.; Nappi, E.; Nattrass, C.; Naumov, N. P.; Navin, S.; Nayak, T. K.; Nazarenko, S.; Nazarov, G.; Nedosekin, A.; Nicassio, M.; Nielsen, B. S.; Niida, T.; Nikolaev, S.; Nikolic, V.; Nikulin, S.; Nikulin, V.; Nilsen, B. S.; Nilsson, M. S.; Noferini, F.; Nomokonov, P.; Nooren, G.; Novitzky, N.; Nyanin, A.; Nyatha, A.; Nygaard, C.; Nystrand, J.; Obayashi, H.; Ochirov, A.; Oeschler, H.; Oh, S. K.; Oleniacz, J.; Oppedisano, C.; Ortiz Velasquez, A.; Ortona, G.; Oskarsson, A.; Otterlund, I.; Otwinowski, J.; Øvrebekk, G.; Oyama, K.; Pachmayer, Y.; Pachr, M.; Padilla, F.; Pagano, P.; Paić, G.; Painke, F.; Pajares, C.; Pal, S.; Pal, S. K.; Palaha, A.; Palmeri, A.; Pappalardo, G. S.; Park, W. J.; Passfeld, A.; Patalakha, D. I.; Paticchio, V.; Pavlinov, A.; Pawlak, T.; Peitzmann, T.; Pereira de Oliveira Filho, E.; Peresunko, D.; Pérez Lara, C. E.; Perez Lezama, E.; Perini, D.; Perrino, D.; Peryt, W.; Pesci, A.; Peskov, V.; Pestov, Y.; Petráček, V.; Petran, M.; Petris, M.; Petrov, P.; Petrovici, M.; Petta, C.; Piano, S.; Piccotti, A.; Pikna, M.; Pillot, P.; Pinazza, O.; Pinsky, L.; Pitz, N.; Piuz, F.; Piyarathna, D. B.; Płoskoń, M.; Pluta, J.; Pocheptsov, T.; Pochybova, S.; Podesta-Lerma, P. L. M.; Poghosyan, M. G.; Polichtchouk, B.; Pop, A.; Porteboeuf-Houssais, S.; Pospíšil, V.; Potukuchi, B.; Prasad, S. K.; Preghenella, R.; Prino, F.; Pruneau, C. A.; Pshenichnov, I.; Puddu, G.; Pulvirenti, A.; Punin, V.; Putiš, M.; Putschke, J.; Quercigh, E.; Qvigstad, H.; Rachevski, A.; Rademakers, A.; Radomski, S.; Räihä, T. S.; Rak, J.; Rakotozafindrabe, A.; Ramello, L.; Ramírez Reyes, A.; Raniwala, R.; Raniwala, S.; Räsänen, S. S.; Rascanu, B. T.; Rathee, D.; Read, K. F.; Real, J. S.; Redlich, K.; Reichelt, P.; Reicher, M.; Renfordt, R.; Reolon, A. R.; Reshetin, A.; Rettig, F.; Revol, J.-P.; Reygers, K.; Ricaud, H.; Riccati, L.; Ricci, R. A.; Richter, M.; Riedler, P.; Riegler, W.; Riggi, F.; Rodríguez Cahuantzi, M.; Rohr, D.; Röhrich, D.; Romita, R.; Ronchetti, F.; Rosnet, P.; Rossegger, S.; Rossi, A.; Roukoutakis, F.; Roy, C.; Roy, P.; Rubio Montero, A. J.; Rui, R.; Ryabinkin, E.; Rybicki, A.; Sadovsky, S.; Šafařík, K.; Sahu, P. K.; Saini, J.; Sakaguchi, H.; Sakai, S.; Sakata, D.; Salgado, C. A.; Sambyal, S.; Samsonov, V.; Sanchez Castro, X.; Šándor, L.; Sandoval, A.; Sano, M.; Sano, S.; Santo, R.; Santoro, R.; Sarkamo, J.; Scapparone, E.; Scarlassara, F.; Scharenberg, R. P.; Schiaua, C.; Schicker, R.; Schmidt, C.; Schmidt, H. R.; Schreiner, S.; Schuchmann, S.; Schukraft, J.; Schutz, Y.; Schwarz, K.; Schweda, K.; Scioli, G.; Scomparin, E.; Scott, P. A.; Scott, R.; Segato, G.; Selyuzhenkov, I.; Senyukov, S.; Serci, S.; Serradilla, E.; Sevcenco, A.; Sgura, I.; Shabratova, G.; Shahoyan, R.; Sharma, N.; Sharma, S.; Shigaki, K.; Shimomura, M.; Shtejer, K.; Sibiriak, Y.; Siciliano, M.; Sicking, E.; Siddhanta, S.; Siemiarczuk, T.; Silvermyr, D.; Simonetti, G.; Singaraju, R.; Singh, R.; Singha, S.; Sinha, B. C.; Sinha, T.; Sitar, B.; Sitta, M.; Skaali, T. B.; Skjerdal, K.; Smakal, R.; Smirnov, N.; Snellings, R.; Søgaard, C.; Soltz, R.; Son, H.; Song, J.; Song, M.; Soos, C.; Soramel, F.; Spyropoulou-Stassinaki, M.; Srivastava, B. K.; Stachel, J.; Stan, I.; Stefanek, G.; Stefanini, G.; Steinbeck, T.; Steinpreis, M.; Stenlund, E.; Steyn, G.; Stocco, D.; Stolpovskiy, M.; Strmen, P.; Suaide, A. A. P.; Subieta Vásquez, M. A.; Sugitate, T.; Suire, C.; Sukhorukov, M.; Sultanov, R.; Šumbera, M.; Susa, T.; Szanto de Toledo, A.; Szarka, I.; Szostak, A.; Tagridis, C.; Takahashi, J.; Tapia Takaki, J. D.; Tauro, A.; Tejeda Muñoz, G.; Telesca, A.; Terrevoli, C.; Thäder, J.; Thomas, D.; Thomas, J. H.; Tieulent, R.; Timmins, A. R.; Tlusty, D.; Toia, A.; Torii, H.; Tosello, F.; Traczyk, T.; Trzaska, W. H.; Tsuji, T.; Tumkin, A.; Turrisi, R.; Turvey, A. J.; Tveter, T. S.; Ulery, J.; Ullaland, K.; Ulrich, J.; Uras, A.; Urbán, J.; Urciuoli, G. M.; Usai, G. L.; Vajzer, M.; Vala, M.; Valencia Palomo, L.; Vallero, S.; van der Kolk, N.; van Leeuwen, M.; Vande Vyvre, P.; Vannucci, L.; Vargas, A.; Varma, R.; Vasileiou, M.; Vasiliev, A.; Vechernin, V.; Veldhoen, M.; Venaruzzo, M.; Vercellin, E.; Vergara, S.; Vernekohl, D. C.; Vernet, R.; Verweij, M.; Vickovic, L.; Viesti, G.; Vikhlyantsev, O.; Vilakazi, Z.; Villalobos Baillie, O.; Vinogradov, A.; Vinogradov, L.; Vinogradov, Y.; Virgili, T.; Viyogi, Y. P.; Vodopyanov, A.; Voloshin, K.; Voloshin, S.; Volpe, G.; von Haller, B.; Vranic, D.; Vrláková, J.; Vulpescu, B.; Vyushin, A.; Wagner, B.; Wagner, V.; Wan, R.; Wang, D.; Wang, M.; Wang, Y.; Wang, Y.; Watanabe, K.; Wessels, J. P.; Westerhoff, U.; Wiechula, J.; Wikne, J.; Wilde, M.; Wilk, A.; Wilk, G.; Williams, M. C. S.; Windelband, B.; Xaplanteris Karampatsos, L.; Yang, H.; Yasnopolskiy, S.; Yi, J.; Yin, Z.; Yokoyama, H.; Yoo, I.-K.; Yoon, J.; Yu, W.; Yuan, X.; Yushmanov, I.; Zach, C.; Zampolli, C.; Zaporozhets, S.; Zarochentsev, A.; Závada, P.; Zaviyalov, N.; Zbroszczyk, H.; Zelnicek, P.; Zgura, I.; Zhalov, M.; Zhang, X.; Zhou, D.; Zhou, F.; Zhou, Y.; Zhu, X.; Zichichi, A.; Zimmermann, A.; Zinovjev, G.; Zoccarato, Y.; Zynovyev, M.; Alice Collaboration


    Angular correlations between unidentified charged trigger (t) and associated (a) particles are measured by the ALICE experiment in Pb-Pb collisions at √{sNN} = 2.76 TeV for transverse momenta 0.25 pTa. The shapes of the pair correlation distributions are studied in a variety of collision centrality classes between 0 and 50% of the total hadronic cross section for particles in the pseudorapidity interval | η | 0.8, and are referred to as "long-range correlations". Fourier components VnΔ ≡ are extracted from the long-range azimuthal correlation functions. If particle pairs are correlated to one another through their individual correlation to a common symmetry plane, then the pair anisotropy VnΔ (pTt ,pTa) is fully described in terms of single-particle anisotropies vn (pT) as VnΔ (pTt ,pTa) =vn (pTt)vn (pTa). This expectation is tested for 1 ⩽ n ⩽ 5 by applying a global fit of all VnΔ (pTt ,pTa) to obtain the best values vn { GF } (pT). It is found that for 2 ⩽ n ⩽ 5, the fit agrees well with data up to pTa ˜ 3- 4 GeV / c, with a trend of increasing deviation as pTt and pTa are increased or as collisions become more peripheral. This suggests that no pair correlation harmonic can be described over the full 0.25 vn (pT) curve; such a description is however approximately possible for 2 ⩽ n ⩽ 5 when pTa < 4 GeV / c. For the n = 1 harmonic, however, a single v1 (pT) curve is not obtained even within the reduced range pTa < 4 GeV / c.

  4. On the heterostructured photocatalysts Ag{sub 3}VO{sub 4}/g-C{sub 3}N{sub 4} with enhanced visible light photocatalytic activity

    Wu, Si-Zhan [School of Chemistry and Chemical Engineering, South China University of Technology, 381 Wushan Road, Guangzhou 510640 (China); Institute of Materials Science and Chemical Industry, Tongren University, 103 Qingshui Road, Tongren 554300 (China); Li, Kui [School of Chemistry and Chemical Engineering, South China University of Technology, 381 Wushan Road, Guangzhou 510640 (China); Zhang, Wei-De, E-mail: [School of Chemistry and Chemical Engineering, South China University of Technology, 381 Wushan Road, Guangzhou 510640 (China)


    Highlights: • Novel Ag{sub 3}VO{sub 4}/g-C{sub 3}N{sub 4}-VN composite photocatalysts were prepared by a simple method. • Ag{sub 3}VO{sub 4}/g-C{sub 3}N{sub 4}-VN showed high activity toward degradation of RhB. • Ag{sub 3}VO{sub 4}/g-C{sub 3}N{sub 4}-VN composite with large surface area exhibited excellent stability. - Abstract: Heterostructured photocatalysts Ag{sub 3}VO{sub 4}/g-C{sub 3}N{sub 4} were prepared by deposition-precipitation method in order to anchor Ag{sub 3}VO{sub 4} on the surface of N-vacancy g-C{sub 3}N{sub 4} (g-C{sub 3}N{sub 4}-VN). The photocatalytic activity of the samples was evaluated by degrading rhodamine B (RhB) in aqueous solution. Compared with the pure Ag{sub 3}VO{sub 4} and g-C{sub 3}N{sub 4}-VN, the heterojuncted photocatalyst 65 wt% Ag{sub 3}VO{sub 4}/g-C{sub 3}N{sub 4}-VN exhibits the best activity under visible light irradiation. The photodegradation rate constant of 65 wt% Ag{sub 3}VO{sub 4}/g-C{sub 3}N{sub 4}-VN is 0.0556 min{sup −1}, which is 23.4, 5.8 and 6.4 times of that of pure Ag{sub 3}VO{sub 4}, pure g-C{sub 3}N{sub 4}-VN and P25, respectively. The excellent photocatalytic performance of the Ag{sub 3}VO{sub 4}/g-C{sub 3}N{sub 4}-VN catalysts can be ascribed to the matched band structures of Ag{sub 3}VO{sub 4} and g-C{sub 3}N{sub 4}, which strengthened the formation of the heterojuncted photocatalyst. The unique heterostructured photocatalyst is favorable for retarding the recombination of photogenerated electrons and holes, thus the photocatalytic activity is significantly increased. Further experiment also reveals that the • O{sub 2}{sup −} and h{sup +} are the major active species in the degradation of RhB.

  5. Inhibition of histamine-induced bronchoconstriction in Guinea pig and Swine by pulsed electrical vagus nerve stimulation.

    Hoffmann, Thomas J; Mendez, Steven; Staats, Peter; Emala, Charles W; Guo, Puyun


    Objective. Smooth muscle help regulate the diameter of the airways and their constriction can contribute to the pathology of acute asthma attacks. This study sought to determine if applying a specific electrical signal to the vagus nerve (VN) could minimize histamine-induced bronchoconstriction. Methods. Sixteen guinea pigs and three swine were anesthetized and had bipolar electrodes positioned on the cervical VNs. After the animals stabilized, i.v. histamine was titrated to elicit a moderate 2-4 cm H(2) O increase in pulmonary inflation pressure (Ppi). Histamine was then dosed with or without concurrent low voltage VN stimulation. Results. The peak change in Ppi following a histamine challenge was reduced in the guinea pig by VN stimulation (3.4 ± 0.4 vs. 2.1 ± 0.2 cm H(2) O, p < 0.001). The results were confirmed in a limited study in swine and indicate VN treatment is applicable to larger animals. Conclusion. This study suggests that VN stimulation can reduce bronchoconstriction and may prove useful as a rescue therapy in the treatment of acute asthma.

  6. Use of factor scores for predicting body weight from linear body measurements in three South African indigenous chicken breeds.

    Malomane, Dorcus Kholofelo; Norris, David; Banga, Cuthbert B; Ngambi, Jones W


    Body weight and weight of body parts are of economic importance. It is difficult to directly predict body weight from highly correlated morphological traits through multiple regression. Factor analysis was carried out to examine the relationship between body weight and five linear body measurements (body length, body girth, wing length, shank thickness, and shank length) in South African Venda (VN), Naked neck (NN), and Potchefstroom koekoek (PK) indigenous chicken breeds, with a view to identify those factors that define body conformation. Multiple regression was subsequently performed to predict body weight, using orthogonal traits derived from the factor analysis. Measurements were obtained from 210 chickens, 22 weeks of age, 70 chickens per breed. High correlations were obtained between body weight and all body measurements except for wing length in PK. Two factors extracted after varimax rotation explained 91, 95, and 83% of total variation in VN, NN, and PK, respectively. Factor 1 explained 73, 90, and 64% in VN, NN, and PK, respectively, and was loaded on all body measurements except for wing length in VN and PK. In a multiple regression, these two factors accounted for 72% variation in body weight in VN, while only factor 1 accounted for 83 and 74% variation in body weight in NN and PK, respectively. The two factors could be used to define body size and conformation of these breeds. Factor 1 could predict body weight in all three breeds. Body measurements can be better selected jointly to improve body weight in these breeds.

  7. Right intercostal insertion of a Veress needle for laparoscopy in dogs.

    Fiorbianco, Valentina; Skalicky, Monika; Doerner, Judith; Findik, Murat; Dupré, Gilles


    To evaluate right intercostal Veress needle (VN) insertion for laparoscopy in dogs. Longitudinal cohort study. Female dogs (n = 56). The VN was inserted in the last palpable right intercostal space, either 1/3 (Group T; 28 dogs) or mid distance (Group H; 28 dogs) from the xiphoid cartilage to the most caudal extent of the costal arch. Problems encountered during VN insertion and injuries were recorded, graded, and compared between groups, and also between the first and last 20 insertions. Pneumoperitoneum was successfully achieved by VN insertion in 49 (88%) dogs after a single (45 dogs) or 2nd attempt (4 dogs). Frequency of complications was as follows: 20 grade 1 (subcutaneous emphysema, omentum, or falciform injuries); 6 grade 2 (liver or spleen injury), and 1 grade 3 complication (pneumothorax occurred). No significant difference was found between the 2 groups or between the first and last 20 dogs. Right intercostal VN insertion facilitates pneumoperitoneum in dogs with few consequential complications. No significant difference was found between entry sites; however, the mid distance insertion site in the last palpable intercostal space with dog positioned in dorsal recumbency is likely to result in less complications. © Copyright 2012 by The American College of Veterinary Surgeons.

  8. Vestibular compensation: the neuro-otologist's best friend.

    Lacour, Michel; Helmchen, Christoph; Vidal, Pierre-Paul


    Why vestibular compensation (VC) after an acute unilateral vestibular loss is the neuro-otologist's best friend is the question at the heart of this paper. The different plasticity mechanisms underlying VC are first reviewed, and the authors present thereafter the dual concept of vestibulo-centric versus distributed learning processes to explain the compensation of deficits resulting from the static versus dynamic vestibular imbalance. The main challenges for the plastic events occurring in the vestibular nuclei (VN) during a post-lesion critical period are neural protection, structural reorganization and rebalance of VN activity on both sides. Data from animal models show that modulation of the ipsilesional VN activity by the contralateral drive substitutes for the normal push-pull mechanism. On the other hand, sensory and behavioural substitutions are the main mechanisms implicated in the recovery of the dynamic functions. These newly elaborated sensorimotor reorganizations are vicarious idiosyncratic strategies implicating the VN and multisensory brain regions. Imaging studies in unilateral vestibular loss patients show the implication of a large neuronal network (VN, commissural pathways, vestibulo-cerebellum, thalamus, temporoparietal cortex, hippocampus, somatosensory and visual cortical areas). Changes in gray matter volume in these multisensory brain regions are structural changes supporting the sensory substitution mechanisms of VC. Finally, the authors summarize the two ways to improve VC in humans (neuropharmacology and vestibular rehabilitation therapy), and they conclude that VC would follow a "top-down" strategy in patients with acute vestibular lesions. Future challenges to understand VC are proposed.

  9. Vestibular neurectomy vs. chemical labyrinthectomy in the treatment of disabling Menière's disease: a long-term comparative study.

    Schmerber, Sébastien; Dumas, Georges; Morel, Nils; Chahine, Karim; Karkas, Alexandre


    To compare the efficiency of vestibular neurectomy (VN) and chemical labyrinthectomy (CL) in the treatment of Menière's disease's disabling vertigo, and to assess their subsequent effects on hearing. This is a retrospective study of 58 VN procedures and 35 CL procedures. Treatment results were assessed by caloric testing and pure-tone audiometry performed before and after treatment. Subjective success was defined by the number of recurrent attacks of vertigo and by the AAO-HNS vertigo scale. Caloric testing revealed strong vestibular hyporeflexia in 91.0% of VN cases and 86.0% of CL cases. Vertigo recurred in 7.0% of cases in the VN group and in 11.4% of cases in the CL group. Mean pure-tone auditory thresholds increased from 45.00dB HL to 50.84dB HL (p=0.19) in the VN group and from 69.11dB HL to 74.51dB HL (p=0.41) in the CL group. Vestibular neurectomy and chemical labyrinthectomy offer similar control of vertigo in patients with Menière's disease. CL is a simple, minimally invasive procedure that emerges as an effective method for treating Menière's disabling vertigo without causing significant hearing deterioration.

  10. Válvula nasal: anatomia e fisiologia Nasal valve: anatomy and physiology

    Carlos Eduardo Nazareth Nigro


    Full Text Available A porção anterior das cavidades nasais, da narina à válvula nasal (VN, é a região de maior resistência nasal ao fluxo aerífero, de suma importância para a fisiologia nasal. Na literatura existem terminologias diferentes para se referir às mesmas estruturas anatômicas e, ainda, o mesmo termo se referindo a estruturas anatômicas diferentes. OBJETIVO: Realizamos este trabalho com o objetivo de revisarmos o funcionamento da VN e definirmos com mais clareza estruturas anatômicas da porção anterior das cavidades nasais, principalmente a região da VN. CONCLUSÃO: Existe controvérsia na literatura quanto à nomenclatura das estruturas da VN. Neste trabalho definimos VN como uma estrutura tridimensional compreendida anteriormente pelo ostium internum e posteriormente pelo isthmus nasi.The anterior portion of the nasal cavities, from the nostril to the nasal valve (NV, is the place of highest nasal resistance to airflow, paramount to nasal physiology. There are different terminologies for the same anatomic structures in the literature. AIM: The aim of this paper was to study the NV function and define clearly the structures of the anterior portion of the nasal cavities, mainly the region of the NV. CONCLUSION: Internum ostium is the anterior segment and isthmus nasi is the posterior segment of the NV region.

  11. Some Relations of Generalized Fibonacci Sequence and Lucas Sequence%广义Fibonacci数列和Lucsa数列的关系式



    根据广义的Fibonacci数列{un}:un+1=Aun+Bun-1和广义Lucas数列{vn}:vn+1=Avn+Bvn-1的定义,采用初等方法证明了广义的Fibonacci数列和Lucas数列的几个新的关系式∑uivn-i=(n+1)un、2n+1un+1=nΣi-02iviAn-i、n∑i=0(-B)ivn-2i=2un+1、3n+1un+1=n∑i=03ivAn-i+n+1∑i=03i-1uiAn+1-i、nΣi=0vivn-i=(n+1)vn+2un+1=(n+2)vn+ Aun、(A2 +4B)n∑i=0uiun-i=(n+1)vn-2un+1=nvn-Aun,将Fibonacci数列和Lucsa数列关系的结论进行了推广.

  12. Comparison of enzyme-linked immunosorbent assays and virus neutralization test for detection of antibodies to avian pneumovirus.

    Alkahalaf, A N; Halvorson, D A; Saif, Y M


    Two different whole-virus enzyme-linked immunosorbent assays (ELISAs), developed in Ohio (OH) with APV/Minnesota/turkey/2a/97 and in Minnesota (MN) with APV/Colorado/turkey/97, and the virus neutralization (VN) test were used to test 270 turkey serum samples from 27 Minnesota turkey flocks for avian pneumovirus (APV) antibodies. In addition, 77 turkey serum samples and 128 ostrich serum samples from Ohio were tested. None of the turkey samples from Ohio had antibodies to APV by the VN test and OH ELISA. The ostrich samples were only tested with the VN test and were all negative for antibodies to APV. For the Minnesota serum samples, 107, 115, and 120 were positive by the VN test, the OH ELISA, and the MN ELISA, respectively. The Kappa values of 0.938 and 0.825 showed excellent agreement between the VN test and the OH ELISA and the MN ELISA, respectively, for detection of antibodies to the APV. The OH ELISA and MN ELISA had sensitivities of 1.0 and 0.953, specificities of 0.950 and 0.889, and accuracies of 0.970 and 0.914, respectively. Our results indicate that the 3 methods are sensitive and specific for diagnosis of the APV infection.

  13. Chronic exposure to low frequency noise at moderate levels causes impaired balance in mice.

    Haruka Tamura

    Full Text Available We are routinely exposed to low frequency noise (LFN; below 0.5 kHz at moderate levels of 60-70 dB sound pressure level (SPL generated from various sources in occupational and daily environments. LFN has been reported to affect balance in humans. However, there is limited information about the influence of chronic exposure to LFN at moderate levels for balance. In this study, we investigated whether chronic exposure to LFN at a moderate level of 70 dB SPL affects the vestibule, which is one of the organs responsible for balance in mice. Wild-type ICR mice were exposed for 1 month to LFN (0.1 kHz and high frequency noise (HFN; 16 kHz at 70 dB SPL at a distance of approximately 10-20 cm. Behavior analyses including rotarod, beam-crossing and footprint analyses showed impairments of balance in LFN-exposed mice but not in non-exposed mice or HFN-exposed mice. Immunohistochemical analysis showed a decreased number of vestibular hair cells and increased levels of oxidative stress in LFN-exposed mice compared to those in non-exposed mice. Our results suggest that chronic exposure to LFN at moderate levels causes impaired balance involving morphological impairments of the vestibule with enhanced levels of oxidative stress. Thus, the results of this study indicate the importance of considering the risk of chronic exposure to LFN at a moderate level for imbalance.

  14. Activity of Caudate Nucleus Neurons in a Visual Fixation Paradigm in Behaving Cats.

    Tamás Nagypál

    Full Text Available Beside its motor functions, the caudate nucleus (CN, the main input structure of the basal ganglia, is also sensitive to various sensory modalities. The goal of the present study was to investigate the effects of visual stimulation on the CN by using a behaving, head-restrained, eye movement-controlled feline model developed recently for this purpose. Extracellular multielectrode recordings were made from the CN of two cats in a visual fixation paradigm applying static and dynamic stimuli. The recorded neurons were classified in three groups according to their electrophysiological properties: phasically active (PAN, tonically active (TAN and high-firing (HFN neurons. The response characteristics were investigated according to this classification. The PAN and TAN neurons were sensitive primarily to static stimuli, while the HFN neurons responded primarily to changes in the visual environment i.e. to optic flow and the offset of the stimuli. The HFNs were the most sensitive to visual stimulation; their responses were stronger than those of the PANs and TANs. The majority of the recorded units were insensitive to the direction of the optic flow, regardless of group, but a small number of direction-sensitive neurons were also found. Our results demonstrate that both the static and the dynamic components of the visual information are represented in the CN. Furthermore, these results provide the first piece of evidence on optic flow processing in the CN, which, in more general terms, indicates the possible role of this structure in dynamic visual information processing.

  15. The clinical significance of detection to heart rate deceleration capacity and heart rate variability in patients with chronic heart failure

    Jiang-rong Zhou


    Full Text Available Objective: To study the change of heart rate deceleration capacity ( DC and heart rate variability in patients with chronic heart failure (CHF and its relationship with left ventricular ejection fraction (LVEF. Methods: DC, LVEF, time and frequency domain parameters of HRV were measured in 66 patients with CHF and 34 healthy adults (control group by using 24h Holter recordings and Echocardiography. The standard deviation of normal R-R intervals( SDNN, squares of differences between adjacent NN intervals ( RMSSD,low frequency power( LFn and high frequency power( HFn and the changes of LVEF were compared between  the two groups,the relationship between DC,LVEF and HRV were studied in patients with CHF. Results: The median value of DC in the patients with CHF was significantly lower than that in control group( 3.1 ± 2.4 ms vs 7.2 ± 1.3 ms,P <0.01.Incidence of abnormal DC in the CHF group was 57.5%,which was significantly higher than that in the control group (P <0.01.The HRV index, including SDNN、RMSSD、LFn、HFn, in the CHF group was significantly lower than that in normal control group (P < 0.01. Significant positive correlation between HRV index and LVEF were confirmed (P < 0.01. Conclusions: DC and HRV index are lower in patients with CHF and have a good correlation with the left ventricular ejection fraction.

  16. Measurements of Higher Order Flow Harmonics in Au+Au Collisions at sNN=200GeV

    Adare, A.; Afanasiev, S.; Aidala, C.; Ajitanand, N. N.; Akiba, Y.; Al-Bataineh, H.; Alexander, J.; Aoki, K.; Aramaki, Y.; Atomssa, E. T.; Averbeck, R.; Awes, T. C.; Azmoun, B.; Babintsev, V.; Bai, M.; Baksay, G.; Baksay, L.; Barish, K. N.; Bassalleck, B.; Basye, A. T.; Bathe, S.; Baublis, V.; Baumann, C.; Bazilevsky, A.; Belikov, S.; Belmont, R.; Bennett, R.; Berdnikov, A.; Berdnikov, Y.; Bickley, A. A.; Bok, J. S.; Boyle, K.; Brooks, M. L.; Buesching, H.; Bumazhnov, V.; Bunce, G.; Butsyk, S.; Camacho, C. M.; Campbell, S.; Chen, C.-H.; Chi, C. Y.; Chiu, M.; Choi, I. J.; Choudhury, R. K.; Christiansen, P.; Chujo, T.; Chung, P.; Chvala, O.; Cianciolo, V.; Citron, Z.; Cole, B. A.; Connors, M.; Constantin, P.; Csanád, M.; Csörgő, T.; Dahms, T.; Dairaku, S.; Danchev, I.; Das, K.; Datta, A.; David, G.; Denisov, A.; Deshpande, A.; Desmond, E. J.; Dietzsch, O.; Dion, A.; Donadelli, M.; Drapier, O.; Drees, A.; Drees, K. A.; Durham, J. M.; Durum, A.; Dutta, D.; Edwards, S.; Efremenko, Y. V.; Ellinghaus, F.; Engelmore, T.; Enokizono, A.; En'Yo, H.; Esumi, S.; Fadem, B.; Fields, D. E.; Finger, M.; Finger, M., Jr.; Fleuret, F.; Fokin, S. L.; Fraenkel, Z.; Frantz, J. E.; Franz, A.; Frawley, A. D.; Fujiwara, K.; Fukao, Y.; Fusayasu, T.; Garishvili, I.; Glenn, A.; Gong, H.; Gonin, M.; Goto, Y.; Granier de Cassagnac, R.; Grau, N.; Greene, S. V.; Grosse Perdekamp, M.; Gunji, T.; Gustafsson, H.-Å.; Haggerty, J. S.; Hahn, K. I.; Hamagaki, H.; Hamblen, J.; Han, R.; Hanks, J.; Hartouni, E. P.; Haslum, E.; Hayano, R.; He, X.; Heffner, M.; Hemmick, T. K.; Hester, T.; Hill, J. C.; Hohlmann, M.; Holzmann, W.; Homma, K.; Hong, B.; Horaguchi, T.; Hornback, D.; Huang, S.; Ichihara, T.; Ichimiya, R.; Ide, J.; Ikeda, Y.; Imai, K.; Inaba, M.; Isenhower, D.; Ishihara, M.; Isobe, T.; Issah, M.; Isupov, A.; Ivanischev, D.; Jacak, B. V.; Jia, J.; Jin, J.; Johnson, B. M.; Joo, K. S.; Jouan, D.; Jumper, D. S.; Kajihara, F.; Kametani, S.; Kamihara, N.; Kamin, J.; Kang, J. H.; Kapustinsky, J.; Karatsu, K.; Kawall, D.; Kawashima, M.; Kazantsev, A. V.; Kempel, T.; Khanzadeev, A.; Kijima, K. M.; Kim, B. I.; Kim, D. H.; Kim, D. J.; Kim, E.; Kim, E. J.; Kim, S. H.; Kim, Y. J.; Kinney, E.; Kiriluk, K.; Kiss, Á.; Kistenev, E.; Kochenda, L.; Komkov, B.; Konno, M.; Koster, J.; Kotchetkov, D.; Kozlov, A.; Král, A.; Kravitz, A.; Kunde, G. J.; Kurita, K.; Kurosawa, M.; Kwon, Y.; Kyle, G. S.; Lacey, R.; Lai, Y. S.; Lajoie, J. G.; Lebedev, A.; Lee, D. M.; Lee, J.; Lee, K.; Lee, K. B.; Lee, K. S.; Leitch, M. J.; Leite, M. A. L.; Leitner, E.; Lenzi, B.; Li, X.; Liebing, P.; Linden Levy, L. A.; Liška, T.; Litvinenko, A.; Liu, H.; Liu, M. X.; Love, B.; Luechtenborg, R.; Lynch, D.; Maguire, C. F.; Makdisi, Y. I.; Malakhov, A.; Malik, M. D.; Manko, V. I.; Mannel, E.; Mao, Y.; Masui, H.; Matathias, F.; McCumber, M.; McGaughey, P. L.; Means, N.; Meredith, B.; Miake, Y.; Mignerey, A. C.; Mikeš, P.; Miki, K.; Milov, A.; Mishra, M.; Mitchell, J. T.; Mohanty, A. K.; Morino, Y.; Morreale, A.; Morrison, D. P.; Moukhanova, T. V.; Murata, J.; Nagamiya, S.; Nagle, J. L.; Naglis, M.; Nagy, M. I.; Nakagawa, I.; Nakamiya, Y.; Nakamura, T.; Nakano, K.; Newby, J.; Nguyen, M.; Nouicer, R.; Nyanin, A. S.; O'Brien, E.; Oda, S. X.; Ogilvie, C. A.; Oka, M.; Okada, K.; Onuki, Y.; Oskarsson, A.; Ouchida, M.; Ozawa, K.; Pak, R.; Pantuev, V.; Papavassiliou, V.; Park, I. H.; Park, J.; Park, S. K.; Park, W. J.; Pate, S. F.; Pei, H.; Peng, J.-C.; Pereira, H.; Peresedov, V.; Peressounko, D. Yu.; Pinkenburg, C.; Pisani, R. P.; Proissl, M.; Purschke, M. L.; Purwar, A. K.; Qu, H.; Rak, J.; Rakotozafindrabe, A.; Ravinovich, I.; Read, K. F.; Reygers, K.; Riabov, V.; Riabov, Y.; Richardson, E.; Roach, D.; Roche, G.; Rolnick, S. D.; Rosati, M.; Rosen, C. A.; Rosendahl, S. S. E.; Rosnet, P.; Rukoyatkin, P.; Ružička, P.; Sahlmueller, B.; Saito, N.; Sakaguchi, T.; Sakashita, K.; Samsonov, V.; Sano, S.; Sato, T.; Sawada, S.; Sedgwick, K.; Seele, J.; Seidl, R.; Semenov, A. Yu.; Seto, R.; Sharma, D.; Shein, I.; Shibata, T.-A.; Shigaki, K.; Shimomura, M.; Shoji, K.; Shukla, P.; Sickles, A.; Silva, C. L.; Silvermyr, D.; Silvestre, C.; Sim, K. S.; Singh, B. K.; Singh, C. P.; Singh, V.; Slunečka, M.; Soltz, R. A.; Sondheim, W. E.; Sorensen, S. P.; Sourikova, I. V.; Sparks, N. A.; Stankus, P. W.; Stenlund, E.; Stoll, S. P.; Sugitate, T.; Sukhanov, A.; Sziklai, J.; Takagui, E. M.; Taketani, A.; Tanabe, R.; Tanaka, Y.; Tanida, K.; Tannenbaum, M. J.; Tarafdar, S.; Taranenko, A.; Tarján, P.; Themann, H.; Thomas, T. L.; Togawa, M.; Toia, A.; Tomášek, L.; Torii, H.; Towell, R. S.; Tserruya, I.; Tsuchimoto, Y.; Vale, C.; Valle, H.; van Hecke, H. W.; Vazquez-Zambrano, E.; Veicht, A.; Velkovska, J.; Vértesi, R.; Vinogradov, A. A.; Virius, M.; Vrba, V.; Vznuzdaev, E.; Wang, X. R.; Watanabe, D.; Watanabe, K.; Watanabe, Y.; Wei, F.; Wei, R.; Wessels, J.; White, S. N.; Winter, D.; Wood, J. P.; Woody, C. L.; Wright, R. M.; Wysocki, M.; Xie, W.; Yamaguchi, Y. L.; Yamaura, K.; Yang, R.; Yanovich, A.; Ying, J.; Yokkaichi, S.; You, Z.; Young, G. R.; Younus, I.; Yushmanov, I. E.; Zajc, W. A.; Zhang, C.; Zhou, S.; Zolin, L.


    Flow coefficients vn for n=2, 3, 4, characterizing the anisotropic collective flow in Au+Au collisions at sNN=200GeV, are measured relative to event planes Ψn, determined at large rapidity. We report vn as a function of transverse momentum and collision centrality, and study the correlations among the event planes of different order n. The vn are well described by hydrodynamic models which employ a Glauber Monte Carlo initial state geometry with fluctuations, providing additional constraining power on the interplay between initial conditions and the effects of viscosity as the system evolves. This new constraint can serve to improve the precision of the extracted shear viscosity to entropy density ratio η/s.

  17. Effects of Modality Principle in Tutorial Video Streaming

    Ali H. AbuSaada


    Full Text Available This study aimed to investigate the effects of Modality Principle in video streaming of ICDL course for trainee-teachers. Two modes of video streaming were used, namely video and narration (VN mode, and video and text (VT mode of ICDL course. The sample consisted of 202 trainee-teachers in the National Institute for Training (NIT in Gaza. The results showed that the learners using the VN mode attained significant better achievement than the learners using the VT mode. The learners using the VN mode are learn better and more deeply than the VT mode. The presented information in both visual and auditory modes imposes lesser cognitive demands on learners’ without overloading working memory. Thus, more working memory capacity remains available for information processing and improve the learning outcomes.

  18. Measurements of Higher-Order Flow Harmonics in Au+Au Collisions at sqrt(s_NN) = 200 GeV

    Adare, A; Aidala, C; Ajitanand, N N; Akiba, Y; Al-Bataineh, H; Alexander, J; Aoki, K; Aramaki, Y; Atomssa, E T; Averbeck, R; Awes, T C; Azmoun, B; Babintsev, V; Bai, M; Baksay, G; Baksay, L; Barish, K N; Bassalleck, B; Basye, A T; Bathe, S; Baublis, V; Baumann, C; Bazilevsky, A; Belikov, S; Belmont, R; Bennett, R; Berdnikov, A; Berdnikov, Y; Bickley, A A; Bok, J S; Boyle, K; Brooks, M L; Buesching, H; Bumazhnov, V; Bunce, G; Butsyk, S; Camacho, C M; Campbell, S; Chen, C -H; Chi, C Y; Chiu, M; Choi, I J; Choudhury, R K; Christiansen, P; Chujo, T; Chung, P; Chvala, O; Cianciolo, V; Citron, Z; Cole, B A; Connors, M; Constantin, P; Csanád, M; Csörg\\Ho, T; Dahms, T; Dairaku, S; Danchev, I; Das, K; Datta, A; David, G; Denisov, A; Deshpande, A; Desmond, E J; Dietzsch, O; Dion, A; Donadelli, M; Drapier, O; Drees, A; Drees, K A; Durham, J M; Durum, A; Dutta, D; Edwards, S; Efremenko, Y V; Ellinghaus, F; Engelmore, T; Enokizono, A; En'yo, H; Esumi, S; Fadem, B; Fields, D E; Finger, M; Finger, M; \\,; Jr.,; Fleuret, F; Fokin, S L; Fraenkel, Z; Frantz, J E; Franz, A; Frawley, A D; Fujiwara, K; Fukao, Y; Fusayasu, T; Garishvili, I; Glenn, A; Gong, H; Gonin, M; Goto, Y; de Cassagnac, R Granier; Grau, N; Greene, S V; Perdekamp, M Grosse; Gunji, T; Gustafsson, H -\\AA; Haggerty, J S; Hahn, K I; Hamagaki, H; Hamblen, J; Han, R; Hanks, J; Hartouni, E P; Haslum, E; Hayano, R; He, X; Heffner, M; Hemmick, T K; Hester, T; Hill, J C; Hohlmann, M; Holzmann, W; Homma, K; Hong, B; Horaguchi, T; Hornback, D; Huang, S; Ichihara, T; Ichimiya, R; Ide, J; Ikeda, Y; Imai, K; Inaba, M; Isenhower, D; Ishihara, M; Isobe, T; Issah, M; Isupov, A; Ivanischev, D; Jacak, B V; Jia, J; Jin, J; Johnson, B M; Joo, K S; Jouan, D; Jumper, D S; Kajihara, F; Kametani, S; Kamihara, N; Kamin, J; Kang, J H; Kapustinsky, J; Karatsu, K; Kawall, D; Kawashima, M; Kazantsev, A V; Kempel, T; Khanzadeev, A; Kijima, K M; Kim, B I; Kim, D H; Kim, D J; Kim, E; Kim, E J; Kim, S H; Kim, Y J; Kinney, E; Kiriluk, K; Kiss, Á; Kistenev, E; Kochenda, L; Komkov, B; Konno, M; Koster, J; Kotchetkov, D; Kozlov, A; Král, A; Kravitz, A; Kunde, G J; Kurita, K; Kurosawa, M; Kwon, Y; Kyle, G S; Lacey, R; Lai, Y S; Lajoie, J G; Lebedev, A; Lee, D M; Lee, J; Lee, K; Lee, K B; Lee, K S; Leitch, M J; Leite, M A L; Leitner, E; Lenzi, B; Li, X; Liebing, P; Levy, L A Linden; Li\\vska, T; Litvinenko, A; Liu, H; Liu, M X; Love, B; Luechtenborg, R; Lynch, D; Maguire, C F; Makdisi, Y I; Malakhov, A; Malik, M D; Manko, V I; Mannel, E; Mao, Y; Masui, H; Matathias, F; McCumber, M; McGaughey, P L; Means, N; Meredith, B; Miake, Y; Mignerey, A C; Mike\\vs, P; Miki, K; Milov, A; Mishra, M; Mitchell, J T; Mohanty, A K; Morino, Y; Morreale, A; Morrison, D P; Moukhanova, T V; Murata, J; Nagamiya, S; Nagle, J L; Naglis, M; Nagy, M I; Nakagawa, I; Nakamiya, Y; Nakamura, T; Nakano, K; Newby, J; Nguyen, M; Nouicer, R; Nyanin, A S; O'Brien, E; Oda, S X; Ogilvie, C A; Oka, M; Okada, K; Onuki, Y; Oskarsson, A; Ouchida, M; Ozawa, K; Pak, R; Pantuev, V; Papavassiliou, V; Park, I H; Park, J; Park, S K; Park, W J; Pate, S F; Pei, H; Peng, J -C; Pereira, H; Peresedov, V; Peressounko, D Yu; Pinkenburg, C; Pisani, R P; Proissl, M; Purschke, M L; Purwar, A K; Qu, H; Rak, J; Rakotozafindrabe, A; Ravinovich, I; Read, K F; Reygers, K; Riabov, V; Riabov, Y; Richardson, E; Roach, D; Roche, G; Rolnick, S D; Rosati, M; Rosen, C A; Rosendahl, S S E; Rosnet, P; Rukoyatkin, P; Ru\\vzi\\vcka, P; Sahlmueller, B; Saito, N; Sakaguchi, T; Sakashita, K; Samsonov, V; Sano, S; Sato, T; Sawada, S; Sedgwick, K; Seele, J; Seidl, R; Semenov, A Yu; Seto, R; Sharma, D; Shein, I; Shibata, T -A; Shigaki, K; Shimomura, M; Shoji, K; Shukla, P; Sickles, A; Silva, C L; Silvermyr, D; Silvestre, C; Sim, K S; Singh, B K; Singh, C P; Singh, V; Slune\\vcka, M; Soltz, R A; Sondheim, W E; Sorensen, S P; Sourikova, I V; Sparks, N A; Stankus, P W; Stenlund, E; Stoll, S P; Sugitate, T; Sukhanov, A; Sziklai, J; Takagui, E M; Taketani, A; Tanabe, R; Tanaka, Y; Tanida, K; Tannenbaum, M J; Tarafdar, S; Taranenko, A; Tarján, P; Themann, H; Thomas, T L; Togawa, M; Toia, A; Tomá\\vsek, L; Torii, H; Towell, R S; Tserruya, I; Tsuchimoto, Y; Vale, C; Valle, H; van Hecke, H W; Vazquez-Zambrano, E; Veicht, A; Velkovska, J; Vértesi, R; Vinogradov, A A; Virius, M; Vrba, V; Vznuzdaev, E; Wang, X R; Watanabe, D; Watanabe, K; Watanabe, Y; Wei, F; Wei, R; Wessels, J; White, S N; Winter, D; Wood, J P; Woody, C L; Wright, R M; Wysocki, M; Xie, W; Yamaguchi, Y L; Yamaura, K; Yang, R; Yanovich, A; Ying, J; Yokkaichi, S; You, Z; Young, G R; Younus, I; Yushmanov, I E; Zajc, W A; Zhang, C; Zhou, S; Zolin, L


    Flow coefficients v_n for n = 2, 3, 4, characterizing the anisotropic collective flow in Au+Au collisions at sqrt(s_NN) = 200 GeV, are measured relative to event planes \\Psi_n determined at large rapidity. We report v_n as a function of transverse momentum and collision centrality, and study the correlations among the event planes of different order n. The v_n are well described by hydrodynamic models which employ a Glauber Monte Carlo initial state geometry with fluctuations, providing additional constraining power on the interplay between initial conditions and the effects of viscosity as the system evolves. This new constraint improves precision of the extracted viscosity to entropy density ratio eta/s.

  19. Development and evaluation of a blocking enzyme-linked immunosorbent assay and virus neutralization assay to detect antibodies to viral hemorrhagic septicemia virus

    Wilson, Anna; Goldberg, Tony; Marcquenski, Susan; Olson, Wendy; Goetz, Frederick; Hershberger, Paul; Hart, Lucas M.; Toohey-Kurth, Kathy


    Viral hemorrhagic septicemia virus (VHSV) is a target of surveillance by many state and federal agencies in the United States. Currently, the detection of VHSV relies on virus isolation, which is lethal to fish and indicates only the current infection status. A serological method is required to ascertain prior exposure. Here, we report two serologic tests for VHSV that are nonlethal, rapid, and species independent, a virus neutralization (VN) assay and a blocking enzyme-linked immunosorbent assay (ELISA). The results show that the VN assay had a specificity of 100% and sensitivity of 42.9%; the anti-nucleocapsid-blocking ELISA detected nonneutralizing VHSV antibodies at a specificity of 88.2% and a sensitivity of 96.4%. The VN assay and ELISA are valuable tools for assessing exposure to VHSV.

  20. Simultaneous submicrometric 3D imaging of the micro-vascular network and the neuronal system in a mouse spinal cord

    Fratini, Michela; Campi, Gaetano; Brun, Francesco; Tromba, Giuliana; Modregger, Peter; Bucci, Domenico; Battaglia, Giuseppe; Spadon, Raffaele; Mastrogiacomo, Maddalena; Requardt, Herwig; Giove, Federico; Bravin, Alberto; Cedola, Alessia


    Defaults in vascular (VN) and neuronal networks of spinal cord are responsible for serious neurodegenerative pathologies. Because of inadequate investigation tools, the lacking knowledge of the complete fine structure of VN and neuronal systems is a crucial problem. Conventional 2D imaging yields incomplete spatial coverage leading to possible data misinterpretation, whereas standard 3D computed tomography imaging achieves insufficient resolution and contrast. We show that X-ray high-resolution phase-contrast tomography allows the simultaneous visualization of three-dimensional VN and neuronal systems of mouse spinal cord at scales spanning from millimeters to hundreds of nanometers, with neither contrast agent nor a destructive sample-preparation. We image both the 3D distribution of micro-capillary network and the micrometric nerve fibers, axon-bundles and neuron soma. Our approach is a crucial tool for pre-clinical investigation of neurodegenerative pathologies and spinal-cord-injuries. In particular, it s...

  1. Subsequential Convergence Conditions

    İbrahim Çanak


    Full Text Available Let (un be a sequence of real numbers and let L be any (C,1 regular limitable method. We prove that, under some assumptions, if a sequence (un or its generator sequence (Vn(0(Δu generated regularly by a sequence in a class 𝒜 of sequences is a subsequential convergence condition for L, then for any integer m≥1, the mth repeated arithmetic means of (Vn(0(Δu, (Vn(m(Δu, generated regularly by a sequence in the class 𝒜(m, is also a subsequential convergence condition for L.

  2. NCBI nr-aa BLAST: CBRC-STRI-01-2687 [SEVENS

    Full Text Available CBRC-STRI-01-2687 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 2e-30 35% ...

  3. Ultrasound of the peripheral nerves in systemic vasculitic neuropathies.

    Grimm, Alexander; Décard, Bernhard F; Bischof, Antje; Axer, Hubertus


    Ultrasound of the peripheral nerves (PNUS) can be used to visualize nerve pathologies in polyneuropathies (PNP). The aim of this study was to investigate, whether PNUS provides additional information in patients with proven systemic vasculitic neuropathies (VN). Systematic ultrasound measurements of several peripheral nerves, the vagal nerve and the 6th cervical nerve root were performed in 14 patients and 22 healthy controls. Nerve conduction studies of the corresponding nerves were undertaken. Finally, the measured results were compared to a study population of demyelinating immune-mediated and axonal neuropathies. Patients with VN displayed significant smaller amplitudes of compound muscle action potentials (CMAP) (pneuropathies than in other axonal neuropathies, but significantly rarer than in demyelinating neuropathies. Focal CSA enlargement in one or more nerves in electrophysiologically axonal neuropathies can be a hint for VN and thus facilitate diagnostic and therapeutic procedures. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. NCBI nr-aa BLAST: CBRC-MMUS-06-0131 [SEVENS

    Full Text Available CBRC-MMUS-06-0131 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-133 76% ...

  5. Fracture resistance of structurally compromised and normal endodontically treated teeth restored with different post systems: An in vitro study

    Vajihesadat Mortazavi


    Full Text Available Background: With the aim of developing methods that could increase the fracture resistance of structurally compromised endodontically treated teeth, this study was conducted to compare the effect of three esthetic post systems on the fracture resistance and failure modes of structurally compromised and normal roots. Materials and Methods: Forty five extracted and endodontically treated maxillary central teeth were assigned to 5 experimental groups (n=9. In two groups, the post spaces were prepared with the corresponding drills of the post systems to be restored with double taper light posts (DT.Light-Post (group DT.N and zirconia posts (Cosmopost (group Zr.N. In other 3 groups thin wall canals were simulated to be restored with Double taper Light posts (DT.W, double taper Light posts and Ribbond fibers (DT+R.W and Zirconia posts (Zr.W. After access cavity restoration and thermocycling, compressive load was applied and the fracture strength values and failure modes were evaluated. Data were analyzed using two-way ANOVA, Tukey and Fisher exact tests (P<0.05. Results: The mean failure loads (N were 678.56, 638.22, 732.44, 603.44 and 573.67 for groups DT.N, Zr.N, DT.W, DT+R.W and Zr.w respectively. Group DT+R.W exhibited significantly higher resistance to fracture compared to groups Zr.N, DT.W and Zr.w (P<0.05. A significant difference was detected between groups DT.N and Zr.W (P=0.027. Zirconia posts showed significantly higher root fracture compared to fiber posts (P=0.004. Conclusion: The structurally compromised teeth restored with double taper light posts and Ribbond fibers showed the most fracture resistance and their strengths were comparable to those of normal roots restored with double taper light posts. More desirable fracture patterns were observed in teeth restored with fiber posts.

  6. Active and passive immune responses to transmissible gastroenteritis virus (TGEV) in swine inoculated with recombinant baculovirus-expressed TGEV spike glycoprotein vaccines.

    Shoup, D I; Jackwood, D J; Saif, L J


    Baculovirus-expressed transmissible gastroenteritis virus (TGEV) spike (S) glycoprotein vaccines were inoculated parenterally in swine to determine whether such vaccines could induce serum and whey virus-neutralizing (VN) antibodies and protective lactogenic immunity for TGEV-challenge-exposed pigs. ANIMALS AND PROCEDURES: 3 recombinant baculoviruses that expressed full or partial length TGEV Miller strain S glycoproteins were inoculated SC in 17 conventionally raised 11-day-old TGEV-seronegative pigs to determine whether the recombinant S glycoproteins would elicit serum VN antibodies. Eleven TGEV-seronegative pregnant sows were inoculated SC or intramammarily with subunit vaccines (R2-2 or R3-5) or control proteins. Pigs born to 9 of the 11 sows were challenge exposed at 4 to 5 days of age with the virulent Miller strain, and passive immunity was assessed. Serum and whey antibody responses to TGEV were analyzed by VN and ELISA testing. Recombinant S glycoproteins (R2-2 or R3-5) containing the 4 major antigenic sites induced similar VN antibody titers to TGEV in serum and colostrum, but low (some sows) or no VN antibody titer was detected in milk. Subcutaneous inoculation of sows with R2-2 or R3-5 elicited IgG, but not IgA antibodies to TGEV in colostrum. Morbidity was 100%, and mortality ranged from 20 to 80% in TGEV challenge-exposed pigs nursing sows inoculated SC or intramammarily with TGEV S glycoprotein vaccines. Parenterally administered TGEV S glycoprotein vaccines elicit VN antibodies to TGEV in serum and colostrum that do not fully provide active or passive immunity in swine.

  7. Anti-nephrotoxic activity of some medicinal plants from tribal rich pockets of Odisha

    Satyaranjan Mishra


    Full Text Available Background: Gentamicin, a strong cationic drug accumulated at biological membranes causes net increase in oxidative stress and lipid peroxidation leading to necrotic changes in renal tubles and consequently precipitates acute nephrotoxicity. Several phytoconstituents and plants extracts demonstrated significant anti-oxidant and cyto-protective activities. Vitex negundo Linn. (VN, Oroxylum indicum Vent. (OI and Barringtonia acutangula Linn. (BA are widely found throughout the Asian sub-continent including India, used extensively in different forms of Indian traditional medicine like Ayurveda and Unani. Objective: Nephroprotective activity of extracts of VN roots, OI whole plant and BA leaves were investigated against experimentally induced acute nephrotoxicity [Gentamicin (i.p; 80mg/kg for 7 days] in Wistar rats as test animals. Materials and Methods: The rats were treated with Cystone (5 mL/kg; p.o taken as positive control and methanol-dichloromethane (1:1 extracts of VN, OI and BA (200 mg/kg; p.o as test drugs for 7 days. Following the said treatments, biochemical parameters of urine (volume, creatinine and lactate dehydrogenase (LDH and serum (urea, creatinine, albumin and total protein were estimated. Renal anti-oxidant markers viz., superoxide dismutase (SOD, catalase (CAT, glutathione peroxidase (GPx and lipid peroxidation (LPO in renal tissue were assayed. Tissue sections of kidneys from different groups were made and histopathological features were observed. Result: The extracts of VN, OI and BA significantly attenuated the nephrotoxicity by elevation of body weight, CAT, GPx and SOD or lowering urine LDH and creatinine, serum urea; serum creatinine and LPO respectively. Histopathological score of VN, OI and BA treated groups were 1+, 2+ and 2+ respectively against 4+ of the toxic group. Conclusion: The findings suggested the significant nephroprotection of VN roots followed by OI whole plant and BA leaves.

  8. Reconsidering the role of neuronal intrinsic properties and neuromodulation in vestibular homeostasis

    Mathieu eBeraneck


    Full Text Available The sensorimotor transformations performed by central vestibular neurons (2°VN constantly adapt as the animal faces conflicting sensory information or sustains injuries. In order to ensure the homeostasis of vestibular-related functions, neural changes could in part rely on the regulation of 2°VN intrinsic properties. Here, we review evidence which demonstrates modulation and plasticity of 2°VN intrinsic properties. We first present partition of rodents 2°VN into distinct subtypes, namely type A and type B. Then, we focus on the respective properties of each type and their putative roles in vestibular functions. The intrinsic properties of 2°VN can be swiftly modulated by a wealth of neuromodulators, to adapt rapidly, for example, to temporary changes of the ecophysiological surroundings. To illustrate how intrinsic excitability can rapidly be modified in physiological conditions and therefore be targeted in the clinic, we present the modulation of vestibular reflexes in relation to the neuromodulatory fluctuation of the sleep/wake cycle. On the other hand, intrinsic properties can also be slowly yet deeply modified in response to major perturbations as is the case following a unilateral labyrinthectomy (UL. We revisit the experimental evidence which demonstrate that drastic alterations of the 2°VN intrinsic properties occur following UL, however with a slow dynamic, more on par with the compensation of dynamic deficits than static ones. Data are interpreted in the framework of a distributed process which progress from the global, large scale coping mechanisms (e.g. changes in behavioural strategies to the local, small scale ones (e.g. changes in intrinsic properties. Within this framework, the compensation of dynamic deficits improves with time as deeper modifications are engraved within the finer parts of the vestibular-related networks. Finally, we propose perspectives and working hypotheses to pave the way for future research aiming at

  9. Computer-generated global map of valley networks on Mars

    Luo, Wei; Stepinski, T. F.


    The presence of valley networks (VN) on Mars suggests that early Mars was warmer and wetter than present. However, detailed geomorphic analyses of individual networks have not led to a consensus regarding their origin. An additional line of evidence can be provided by the global pattern of dissection on Mars, but the currently available global map of VN, compiled from Viking images, is incomplete and outdated. We created an updated map of VN by using a computer algorithm that parses topographic data and recognizes valleys by their morphologic signature. This computer-generated map was visually inspected and edited to produce the final updated map of VN. The new map shows an increase in total VN length by a factor of 2.3. A global map of dissection density, D, derived from the new VN map, shows that the most highly dissected region forms a belt located between the equator and mid-southern latitudes. The most prominent regions of high values of D are the northern Terra Cimmeria and the Margaritifer Terra where D reaches the value of 0.12 km-1 over extended areas. The average value of D is 0.062 km-1, only 2.6 times lower than the terrestrial value of D as measured in the same fashion. These relatively high values of dissection density over extensive regions of the planet point toward precipitation-fed runoff erosion as the primary mechanism of valley formation. Assuming a warm and wet early Mars, peculiarity of the global pattern of dissection is interpreted in the terms of climate controlling factors influenced by the topographic dichotomy.

  10. Shield gas induced cracks during nanosecond-pulsed laser irradiation of Zr-based metallic glass

    Huang, Hu; Noguchi, Jun; Yan, Jiwang [Keio University, Department of Mechanical Engineering, Faculty of Science and Technology, Yokohama (Japan)


    Laser processing techniques have been given increasing attentions in the field of metallic glasses (MGs). In this work, effects of two kinds of shield gases, nitrogen and argon, on nanosecond-pulsed laser irradiation of Zr-based MG were comparatively investigated. Results showed that compared to argon gas, nitrogen gas remarkably promoted the formation of cracks during laser irradiation. Furthermore, crack formation in nitrogen gas was enhanced by increasing the peak laser power intensity or decreasing the laser scanning speed. X-ray diffraction and micro-Raman spectroscopy indicated that the reason for enhanced cracks in nitrogen gas was the formation of ZrN. (orig.)

  11. Evaluation of Alternate Materials for Coated Particle Fuels for the Gas-Cooled Fast Reactor. Laboratory Directed Research and Development Program FY 2006 Final Report

    Paul A. Demkowicz; Karen Wright; Jian Gan; David Petti; Todd Allen; Jake Blanchard


    Candidate ceramic materials were studied to determine their suitability as Gas-Cooled Fast Reactor particle fuel coatings. The ceramics examined in this work were: TiC, TiN, ZrC, ZrN, AlN, and SiC. The studies focused on (i) chemical reactivity of the ceramics with fission products palladium and rhodium, (ii) the thermomechanical stresses that develop in the fuel coatings from a variety of causes during burnup, and (iii) the radiation resiliency of the materials. The chemical reactivity of TiC, TiN, ZrC, and ZrN with Pd and Rh were all found to be much lower than that of SiC. A number of important chemical behaviors were observed at the ceramic-metal interfaces, including the formation of specific intermetallic phases and a variation in reaction rates for the different ceramics investigated. Based on the data collected in this work, the nitride ceramics (TiN and ZrN) exhibit chemical behavior that is characterized by lower reaction rates with Pd and Rh than the carbides TiC and ZrC. The thermomechanical stresses in spherical fuel particle ceramic coatings were modeled using finite element analysis, and included contributions from differential thermal expansion, fission gas pressure, fuel kernel swelling, and thermal creep. In general the tangential stresses in the coatings during full reactor operation are tensile, with ZrC showing the lowest values among TiC, ZrC, and SiC (TiN and ZrN were excluded from the comprehensive calculations due to a lack of available materials data). The work has highlighted the fact that thermal creep plays a critical role in the development of the stress state of the coatings by relaxing many of the stresses at high temperatures. To perform ion irradiations of sample materials, an irradiation beamline and high-temperature sample irradiation stage was constructed at the University of Wisconsin’s 1.7MV Tandem Accelerator Facility. This facility is now capable of irradiating of materials to high dose while controlling sample temperature

  12. Oxides and nitrides as alternative plasmonic materials in the optical range

    Naik, Gururaj V.; Kim, Jongbum; Boltasseva, Alexandra


    As alternatives to conventional metals, new plasmonic materials offer many advantages in the rapidly growing fields of plasmonics and metamaterials. These advantages include low intrinsic loss, semiconductor-based design, compatibility with standard nanofabrication processes, tunability, and others....... Transparent conducting oxides such as Al:ZnO, Ga:ZnO and indium-tin-oxide (ITO) enable many high-performance metamaterial devices operating in the near-IR. Transition-metal nitrides such as TiN or ZrN can be substitutes for conventional metals in the visible frequencies. In this paper we provide the details...

  13. Factors affecting the wettability of different surface materials with vegetable oil at high temperatures and its relation to cleanability

    Ashokkumar, Saranya; Adler-Nissen, Jens; Møller, Per


    materials investigated include stainless steel (reference), PTFE (polytetrafluoroethylene), silicone, quasicrystalline (Al, Fe, Cr) and ceramic coatings: zirconium oxide (ZrO2), zirconium nitride (ZrN) and titanium aluminum nitride (TiAlN). The ceramic coatings were deposited on stainless steel with two...... different levels of roughness. The cosine of the contact angle of olive oil on different surface materials rises linearly with increasing temperature. Among the materials analyzed, polymers (PTFE, silicone) gave the lowest cosθ values. Studies of the effect of roughness and surface flaws on wettability...

  14. Cross-section measurement for Ni(n,x)58(m+g)Co,Ni(n,x)60mCo,Ni(n,x)61Co and Ni(n,x)62mCo reactions induced by neutrons around 14MeV

    FANG Kai-Hong; XU Xiao-San; LAN Chang-Lin; UAN Ji-Long; KONG Xiang-Zhong


    The cross sections of Ni(n,x)58(m+g)CO,Ni(n,x)80mCo,Ni(n,x)61Co and Ni(n,x)62mCo reactions induced by neutrons around [14]MeV were measured in this work and calculated by a previously developed formula in this work.The neutron flux was determined using the monitor reaction 27Al(n,α)24Na and the neutron energies were measured with the method of cross-section ratios for 89Zr(n,2n)89Zr to 93Nb(n,2n)92mNbreactions.

  15. Shield gas induced cracks during nanosecond-pulsed laser irradiation of Zr-based metallic glass

    Huang, Hu; Noguchi, Jun; Yan, Jiwang


    Laser processing techniques have been given increasing attentions in the field of metallic glasses (MGs). In this work, effects of two kinds of shield gases, nitrogen and argon, on nanosecond-pulsed laser irradiation of Zr-based MG were comparatively investigated. Results showed that compared to argon gas, nitrogen gas remarkably promoted the formation of cracks during laser irradiation. Furthermore, crack formation in nitrogen gas was enhanced by increasing the peak laser power intensity or decreasing the laser scanning speed. X-ray diffraction and micro-Raman spectroscopy indicated that the reason for enhanced cracks in nitrogen gas was the formation of ZrN.

  16. Crustal evolution and recycling in a juvenile continent: Oxygen isotope ratio of zircon in the northern Arabian Nubian Shield

    Be'eri-Shlevin, Yaron; Katzir, Yaron; Valley, John W.


    Crustal recycling patterns during the evolution of the Neoproterozoic Arabian-Nubian Shield (ANS) were defined using the oxygen isotope ratio of zircon [ δ18O(Zrn)]. Evidence for early (~ 870-740 Ma) crustal recycling in the northernmost ANS (southern Israel and Sinai, Egypt) is given by laser fluorination analysis of bulk zircon separates, which yield higher than mantle δ18O(Zrn) values of several island arc complex (IAC) orthogneisses (6.9 to 8.2‰) and also from the average δ18O(Zrn) value of 6.4‰ determined for detrital zircons (~ 870-780 Ma) from the Elat-schist; the latter representing the oldest known rock sources in the region. These results indicate prolonged availability of surface-derived rocks for burial or subduction, melting, and assimilation at the very early stages of island arc formation in the ANS. Other IAC intrusions of ~ 800 Ma show mantle-like δ18O(Zrn) values, implying that not all magmas involved supracrustal contribution. Much younger (650-625 Ma) deformed syn-collisional calc-alkaline (CA1) intrusions are characterized by δ18O(Zrn) values of 5.0 to 7.9‰ indicating continued recycling of the felsic crust. The main sample set of this study comprises rocks from the mostly granitic, post-collisional calc-alkaline (CA2: ~ 635-590 Ma) and alkaline (AL: ~ 608-580 Ma) magmatic suites. Despite having distinct geochemical characteristics and petrogenetic paths and spans of magmatic activity, the two suites are indistinguishable by their average δ18O(Zrn) values of 5.7 and 5.8‰ pointing to the dominance of mantle-like δ18O sources in their formation. Nonetheless, grouping the two suites together reveals geographical zoning in δ18O(Zrn) where a large southeastern region of δ18O(Zrn) = 4.5 to 5.9‰ is separated from a northwestern belt with δ18O(Zrn) = 6 to 8‰ by a '6‰ line'. It is thus suggested that all CA2 and AL magmas of the northernmost ANS were derived from mantle-like δ18O reservoirs in the mafic lower-crust and the

  17. Effect of nitrogen flow ratio on structure and properties of zirconium nitride films on Si(100) prepared by ion beam sputtering

    Shahab Norouzian; Majid Mojtahedzadeh Larijani; Reza Afzalzadeh


    In this study, zirconium nitride thin films were deposited on Si substrates by ion beam sputtering (IBS). Influence of N2/(N2+Ar) on the structural and physical properties of the films has been investigated with respect to the atomic ratio between nitrogen and zirconium. It was found that the thickness of layers decreased by increasing the F(N2). Moreover, crystalline plane peaks such as (111), (200) and (220) with (111) preferred orientation were observed due to strain energy which associate with (111) orientation in ZrN. Also, the fluctuation in nitrogen flow ratio results in colour and electrical resistivity of films.

  18. Radiation Damage and Fission Product Release in Zirconium Nitride

    Egeland, Gerald W. [New Mexico Inst. of Mining and Technology, Socorro, NM (United States)


    Zirconium nitride is a material of interest to the AFCI program due to some of its particular properties, such as its high melting point, strength and thermal conductivity. It is to be used as an inert matrix or diluent with a nuclear fuel based on transuranics. As such, it must sustain not only high temperatures, but also continuous irradiation from fission and decay products. This study addresses the issues of irradiation damage and fission product retention in zirconium nitride through an assessment of defects that are produced, how they react, and how predictions can be made as to the overall lifespan of the complete nuclear fuel package. Ion irradiation experiments are a standard method for producing radiation damage to a surface for observation. Cryogenic irradiations are performed to produce the maximum accumulation of defects, while elevated temperature irradiations may be used to allow defects to migrate and react to form clusters and loops. Cross-sectional transmission electron microscopy and grazing-incidence x-ray diffractometry were used in evaluating the effects that irradiation has on the crystal structure and microstructure of the material. Other techniques were employed to evaluate physical effects, such as nanoindentation and helium release measurements. Results of the irradiations showed that, at cryogenic temperatures, ZrN withstood over 200 displacements per atom without amorphization. No significant change to the lattice or microstructure was observed. At elevated temperatures, the large amount of damage showed mobility, but did not anneal significantly. Defect clustering was possibly observed, yet the size was too small to evaluate, and bubble formation was not observed. Defects, specifically nitrogen vacancies, affect the mechanical behavior of ZrN dramatically. Current and previous work on dislocations shows a distinct change in slip plane, which is evidence of the bonding characteristics. The stacking-fault energy changes dramatically with

  19. Light propagation in a Cole-Cole nonlinear medium via Burgers-Hopf equation

    Konopelchenko, Boris; Moro, Antonio


    Recently, a new model of propagation of the light through the so-called weakly three-dimensional Cole-Cole nonlinear medium with short-range nonlocality has been proposed. In particular, it has been shown that in the geometrical optics limit, the model is integrable and it is governed by the dispersionless Veselov-Novikov (dVN) equation. Burgers-Hopf equation can be obtained as 1+1-dimensional reduction of dVN equation. We discuss its properties in the specific context of nonlinear geometrica...

  20. Mie Plasmons: Modes Volumes, Quality Factors, and Coupling Strengths (Purcell Factor to a Dipolar Emitter

    G. Colas des Francs


    Full Text Available Using either quasistatic approximation or exact Mie expansion, we characterize the localized surface plasmons supported by a metallic spherical nanoparticle. We estimate the quality factor Qn and define the effective volume Vn of the nth mode in such a way that coupling strength with a neighbouring dipolar emitter is proportional to the ratio Qn/Vn (Purcell factor. The role of Joule losses, far-field scattering, and mode confinement in the coupling mechanism is introduced and discussed with simple physical understanding, with particular attention paid to energy conservation.

  1. Effects of Modality Principle in Tutorial Video Streaming

    Ali H. AbuSaada; Lily Pei Lin Lee; Soon Fook Fong


    This study aimed to investigate the effects of Modality Principle in video streaming of ICDL course for trainee-teachers. Two modes of video streaming were used, namely video and narration (VN) mode, and video and text (VT) mode of ICDL course. The sample consisted of 202 trainee-teachers in the National Institute for Training (NIT) in Gaza. The results showed that the learners using the VN mode attained significant better achievement than the learners using the VT mode. The learners using th...

  2. Better Video - Streaming Lessons among Palestinian Teachers

    Ali H. AbuSaada


    Full Text Available This study aimed to investigate the effects of redundant information in video streaming of ICDL course for Palestinian trainee-teachers. Two modes of video streaming were used, namely video and narration (VN mode, and video and narration cum text (VTN mode of ICDL course. The sample consisted of 203 trainee-teachers in the National Institute for Training (NIT in Gaza. The results showed that redundancy in the VTN mode increases cognitive overload and split attentions; hence inhibiting the learning process. The Findings showed that trainee-teachers using the VN mode performed significantly better in post-test scores than counterparts in the VTN modes.

  3. Architects – Founders of the Union of Architects in Irkutsk

    Andrei Lyapin


    Full Text Available The article refers to foundation of the East-Siberian (Irkutsk Branch of the Union of Architects. It presents the role of the Organizational Bureau in formation of the Union of Architects, which included such architects as K.V. Mital, B.M. Kerbel, I.G. Efimov, S.M. Zaslavsky, V.N. Kolyanovsky and V.N. Volkov. The article tells about the first Board of the Union of Architects in Irkutsk and gives the plan of the Union’s activity in the pre-war period.

  4. Analog Processing of Optical Wavefront Using Integrated Guided-Wave Optics


    detector, voltage comparator and feedback control system . The advantages of this "on-chip processing" are the reduction of the number of leads that are...individual component variations. For maximum output of the detector in Fig. I the feedback control system will set the value of VN with respect to V( that the phase shift (04 - ON-I ) between the outputs of the two straight waveguides is zero. The details of the feedback control system are not

  5. Datenqualitätsbegutachtungen der Volkswirtschaftlichen Gesamtrechnungen auf der internationalen Ebene

    Müller, Patrick


    Wir untersuchen die Datenqualität (DQ) bezüglich Aktualität, Verfügbarkeit und Zuverlässigkeit von Daten der Volkswirtschaftlichen Gesamtrechnung (VGR) die von Ländern an internationale Organisationen gemeldet und dort veröffentlicht werden. Die existierende DQ Untersuchung der Vereinten Nationen (VN) für Aktualität reflektiert nicht die Zeit (in Jahren) die seitens der Länder benötigt wird um diese Daten zu produzieren. Die Untersuchungen der VN zur Verfügbarkeit legen den alten „Mindes...

  6. Polymer-Based Materials of Controlled Permeability and Application of Photoinduced Magnetism


    organic-based magnetic semiconductor, V(TCNE)x (x ~ 2;Tc ~ 400 K), and its function as a spin injector /detector in hybrid magnetic multilayer devices...Nanoparticle Spin Injectors , Synthetic Metals 160, 235-237 (2010). 43. J.-W. Yoo, V.N. Prigodin, A.J. Epstein, Spintronic Applications of Organic...Mesocopic Magnetism”, Delphi , Greece, September 2-5, 2008. 19. A.J. Epstein, J.-W. Yoo, V.N. Prigodin, W.W. Shum, K.I. Pokhodnya, J.S. Miller

  7. High resolution imaging in cross-section of a metal-oxide-semiconductor field-effect-transistor using super-higher-order nonlinear dielectric microscopy

    Chinone, N.; Yamasue, K.; Honda, K.; Cho, Y.


    Scanning nonlinear dielectric microscopy (SNDM) can evaluate carrier or charge distribution in semiconductor devices. High sensitivity to capacitance variation enables SNDM to measure the super-high-order (higher than 3rd) derivative of local capacitance-voltage (C-V) characteristics directly under the tip (dnC/dVn,n = 3, 4, ...). We demonstrate improvement of carrier density resolution by measurement of dnC/dVn,n = 1, 2, 3, 4 (super-higher-order method) in the cross-sectional observation of metal-oxide-semiconductor field-effect-transistor.

  8. Konvergenz afferenter und kommissuraler Signale aus den Bogengängen und den Otolithenorganen beim Grasfrosch (Rana temporaria)

    Holler, Stefan


    In vitro-Experimente wurden am isolierten Hirnstamm von Fröschen durchgeführt. Die einzelnen Nervenäste der Bogengänge und der Lagena wurden auf jeder Seite des Gehirns getrennt elektrisch stimuliert. Afferente und kommissurale Antworten wurden intrazellulär in vestibulären Neuronen zweiter Ordnung (2°VN) gemessen. Das Projektionsmuster eines Teils dieser 2°VN wurde durch antidrome Stimulation der okulomotorischen Kerne und des zervikalen Rückenmarks bestimmt. Bei der Hälfte...

  9. Vagus nerve stimulation: state of the art of stimulation and recording strategies to address autonomic function neuromodulation

    Guiraud, David; Andreu, David; Bonnet, Stéphane; Carrault, Guy; Couderc, Pascal; Hagège, Albert; Henry, Christine; Hernandez, Alfredo; Karam, Nicole; Le Rolle, Virginie; Mabo, Philippe; Maciejasz, Paweł; Malbert, Charles-Henri; Marijon, Eloi; Maubert, Sandrine; Picq, Chloé; Rossel, Olivier; Bonnet, Jean-Luc


    Objective. Neural signals along the vagus nerve (VN) drive many somatic and autonomic functions. The clinical interest of VN stimulation (VNS) is thus potentially huge and has already been demonstrated in epilepsy. However, side effects are often elicited, in addition to the targeted neuromodulation. Approach. This review examines the state of the art of VNS applied to two emerging modulations of autonomic function: heart failure and obesity, especially morbid obesity. Main results. We report that VNS may benefit from improved stimulation delivery using very advanced technologies. However, most of the results from fundamental animal studies still need to be demonstrated in humans.

  10. Investigation of ZrO{sub x}/ZrC-ZrN/Zr thin-film structural evolution and their degradation using X-ray diffraction and Raman spectrometry

    Usmani, B.; Dixit, A. [Indian Institute of Technology Jodhpur, Department of Physics and Center for Solar Energy, Jodhpur, Rajasthan (India); Vijay, V. [Indian Institute of Technology Jodhpur, Department of Mathematics, Jodhpur, Rajasthan (India); Chhibber, R. [Indian Institute of Technology Jodhpur, Department of Mechanical Engineering, Jodhpur, Rajasthan (India)


    The thin-film structures of DC/FR magnetron-sputtered ZrO{sub x}/ZrC-ZrN/Zr tandem solar-selective coatings are investigated using X-ray diffraction and room-temperature Raman spectroscopic measurements. These studies suggest that the major contribution is coming from h-ZrN{sub 0.28}, c-ZrC, h-Zr{sub 3}C{sub 2} crystallographic phases in ZrN-ZrC absorber layer, in conjunction with mixed ZrO{sub x} crystallographic phases. The change in structure for thermally annealed samples has been examined and observed that cubic and hexagonal ZrO{sub x} phase converted partially into tetragonal and monoclinic ZrO{sub x} phases, whereas hexagonal and cubic ZrN phases, from absorber layer, have not been observed for these thermally treated samples in air. These studies suggest that thermal treatment may lead to the loss of ZrN phase in absorber, degrading the thermal response for the desired wavelength range in open ambient conditions in contrast to vacuum conditions. (orig.)

  11. Analyses of antibacterial activity and cell compatibility of titanium coated with a Zr-C-N film.

    Yin-Yu Chang

    Full Text Available OBJECTIVE: The purpose of this study was to verify the antibacterial performance and cell proliferation activity of zirconium (Zr-carbon (C-nitride (N coatings on commercially pure titanium (Ti with different C contents. MATERIALS AND METHODS: Reactive nitrogen gas (N(2 with and without acetylene (C(2H(2 was activated by Zr plasma in a cathodic-arc evaporation system to deposit either a zirconium nitride (ZrN or a Zr-C-N coating onto Ti plates. The bacterial activity of the coatings was evaluated against Staphylococcus aureus with the aid of SYTO9 nucleic acid staining and scanning electron microscopy (SEM. Cell compatibility, mRNA expression, and morphology related to human gingival fibroblasts (HGFs on the coated samples were also determined by using the MTT assay, reverse transcriptase-polymerase chain reaction, and SEM. RESULTS: The Zr-C-N coating with the highest C content (21.7 at% exhibited the lowest bacterial preservation (P<0.001. Biological responses including proliferation, gene expression, and attachment of HGF cells to ZrN and Zr-C-N coatings were comparable to those of the uncoated Ti plate. CONCLUSIONS: High-C-content Zr-C-N coatings not only provide short-term antibacterial activity against S. aureus but are also biocompatible with HGF cells.

  12. The influence of silver content on the tribological and antimicrobial properties of ZrN/Ag nanocomposite coatings.

    Kelly, P J; Whitehead, K A; Li, H; Verran, J; Arnell, R D


    ZrN/Ag nanocomposite coatings with varying silver contents were produced by co-deposition in a dual pulsed magnetron sputtering system. The coatings were characterised using scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDX), X-ray diffraction (XRD), scratch adhesion testing, thrust washer wear testing and nanoindentation. The hardness of the ZrN/Ag coatings and the friction coefficient running unlubricated against a steel counterface decreased with increasing silver content, whereas the coating-to-substrate adhesion increased for coatings with higher silver contents, compared to a 'pure' ZrN coating. The antimicrobial properties of the coatings were investigated using two well established microbiological assay techniques: zones of inhibition and a NBT (nitro-blue tetrazolium) redox dye. Zones of inhibition were used to determine the extent of silver ion release from the nanocomposite materials, and a NBT (nitro-blue tetrazolium) redox dye was used to determine the antimicrobial effectiveness of the surfaces following incubation. The microorganisms tested were Pseudomonas aeruginosa (P. aeruginosa), Escherichia coli (E. coli) and Staphylococcus aureus (S. aureus). Whilst no zones of inhibition were observed for S. aureus, on any of the surfaces, the diameter of the 'kill' zones generally increased with increasing silver content for the other microorganisms. For the NBT assays, after incubation, no P. aeruginosa colony forming units were observed on any surface and the number of viable cells of E. coli and S. aureus decreased with increasing silver content, compared to a 'pure' ZrN surface.

  13. The effects of annealing temperature on the magnetic properties of Fe sub 7 sub 5 sub . sub 5 Zr sub 8 sub . sub 3 N sub 1 sub 6 sub . sub 2 /SiO sub 2 multilayer thin films

    Kim, T S; Kim, C O; Chung, H S; Hwang, Y


    [Fe sub 7 sub 5 sub . sub 5 Zr sub 8 sub . sub 3 N sub 1 sub 6 sub . sub 2 (800 A)/SiO sub 2 (250 A)] sub 1 sub 0 multilayer thin films were fabricated by using an rf magnetron reactive sputtering method. The saturation magnetic flux density and the coercive force were measured as functions of the annealing temperature. The effective permeability at high frequencies and the thermal stability were also examined. The magnetic properties of the [Fe sub 7 sub 5 sub . sub 5 Zr sub 8 sub . sub 3 N sub 1 sub 6 sub . sub 2 (800 A)/SiO sub 2 (250 A)] sub 1 sub 0 multilayer thin films showed a saturation flux density of 1.08 T, a coercive force of 0.41 Oe, and an effective permeability of about 4000 at 1 MHz. The observed good magnetic softness is attributed to the prohibition of the growth of alpha-Fe grains due to the precipitation of nanocrystalline ZrN particles. The sizes of the alpha-Fe grains and the nanocrystalline ZrN particles were 40 approx 50 A and 10 approx 15 A, respectively. The effective permeability of...

  14. Band engineering of ternary metal nitride system Ti1-x ZrxN for plasmonic applications

    Kumar, Mukesh; Umezawa, Naoto; Nagao, Tadaaki


    Chemical composition is the primary factor that determines the electronic band structure and thus also influences the optical properties of plasmonic ceramics including nitrides and oxides. In this work, the optical and plasmonic properties of TiN, ZrN and their hypothetical intermediate alloys Ti1-xZrxN (x= 0, 0.25, 0.50, 0.75, and 1), are studied by using first-principles density functional theory. We demonstrate the effects of electronic band structure tuning (band engineering) on the dielectric properties by varying the concentration of metallic constituents. Our calculations reveal that bulk plasma frequency, onset of interband transitions, width of bulk plasmon resonance and cross-over frequency, can be tuned flexibly in visible spectrum region by varying the amount of Zr concentration in Ti1-xZrxN alloy system. We found that low threshold interband energy onset (~1.95 eV) leads to high losses in Ti rich compounds than that of ZrN which points to lower losses.

  15. Effect of pulsed bias on the properties of ZrN/TiZrN films deposited by a cathodic vacuum arc

    Zhang Guo-Ping; Wang Xing-Quan; Lü Guo-Hua; Zhou Lan; Huang Jun; Chen Wei; Yang Si-Ze


    .ZrN/TiZrN multilayers are deposited by using the cathodic vacuum arc method with different substrate bias (from 0 to-800 V),using Ti and Zr plasma flows in residual N2 atmosphere,combined with ion bombardment of sample surfaces.The effect of pulsed bias on the structure and properties of films is investigated.Microstructure of the coating is analyzed by X-ray diffraction (XRD),and scanning electron microscopy (SEM).In addition,nanohardness,Young's modulus,and scratch tests are performed.The experimental results show that the films exhibit a nanoscale multilayer structure consisting of TiZrN and ZrN phases.Solid solutions are formed for component TiZrN films.The dominant preferred orientation of TiZrN films is (111) and (220).At a pulsed bias of-200 V,the nanohardness and the adhesion strength of the ZrN/TiZrN multilayer reach a maximum of 38 GPa,and 78 N,respectively.The ZrN/TiZrN multilayer demonstrates an enhanced nanohardness compared with binary TiN and ZrN films deposited under equivalent conditions.

  16. Microstructure and Wear Behavior of Ti-6Al-4V Treated by Plasma Zr-alloying and Plasma Nitriding

    CHEN Kai; LIU Xiaoping; LIU Xiaozhen; MENG Tianxu; GUO Qi; WANG Zhenxia; LIN Naimin


    A duplex treatment of plasma Zr-alloying and plasma nitriding was used to improve the tribological properties of Ti-6Al-4V. The microstructure of the Zr-N composite (alloyed) layer formed on Ti-6Al-4V and its hardness, friction and wear properties were investigated by using OM, SEM, GDOES, EDS, microhardness tester as well as ball-on-disk tribometer. The results of microstructural analysis show that the alloyed layer is compact and uniform and is mainly composed of ZrN, TiN0.3 and AlN. A very tiny adhesive and slight oxidation wear is the primary wear mechanism for the modiifed Ti-6Al-4V. The tribological property is improved signiifcantly after the duplex treatment. The good combination of antifriction and wear resistance for modiifed Ti-6Al-4V is mainly attributed to the higher surface hardness of metal nitrides formed on the surface and enhanced supporting of the Zr-diffusing layer.

  17. Resistencia a la corrosión de recubrimientos de nitruros metálicos depositados sobre acero AISI M2

    Jhon Jairo Olaya Florez


    Full Text Available En este trabajo se estudia el comportamiento frente a la corrosión de películas de nitruro de zirconio (ZrN, nitruro de titanio (TiN, nitruro de cromo (CrN, nitruro de niobio (NbN y nitruro de tantalio (TaN depositadas sobre acero para herramientas AISI M2 mediante la técnica de sputtering con magnetrón desbalanceado (UBM. La resistencia a la corrosión fue evaluada con ensayos de espectroscopía de impedancia electroquímica (EIS en una solución al 3% de NaCl variando el tiempo de ensayo desde 1 h hasta 7 d. En general, los mejores resultados de resistencia a la corrosión se presentaron en las películas de ZrN y NbN cuando son producidas en la configuración de menor bombardeo iónico en un sistema UBM. Los recubrimientos muestran degradación en el tiempo de ensayo debido a los defectos presentes en su microestructura, que se convierten en canales de difusión por los que la solución corrosiva llega a la superficie del sustrato. Los mecanismos de corrosión para los recubrimientos producidos son discutidos en esta investigación.

  18. Structure and properties of hard and superhard Zr-Cu-N nanocomposite coatings

    Zeman, P.; Cerstvy, R.; Musil, J. [Univ. of West Bohemia, Plzen (Czech Republic). Dept. of Phys.; Mayrhofer, P.H.; Mitterer, C. [Institut fuer Metallkunde und Werkstoffpruefung, Montanuniversitaet, Franz-Josef-Strasse 18, A-8700, Leoben (Austria)


    Zr-Cu-N nanocomposite films represent a new material of the type-nanocrystalline transition metal nitride (nc-MeN)/metal. In the present work, films were deposited onto steel substrates using unbalanced dc reactive magnetron sputtering of a Zr-Cu (62/38 at.%) target. Film structure, chemical composition, mechanical and optical properties were investigated by means of X-ray diffraction (XRD), scanning electron microscopy, transmission electron microscopy, energy dispersive X-ray spectroscopy, wavelength dispersive electron probe microanalysis, depth-sensing microindentation and spectroscopic ellipsometry. It was found that (i) there is a strong correlation between the film structure, Cu content and film properties and (ii) either hard or superhard Zr-Cu-N films can be formed. The superhard coatings with hardness H>40 GPa are characterized by a columnar structure, a strong 111 XRD peak from ZrN grains and no diffraction peaks from Cu. These films exhibit a high elastic recovery of about 80% and contain a very low amount of Cu, approximately 1-2 at.%. In contrast, the hard (<40 GPa) Zr-Cu-N films are characterized by many diffraction peaks from polyoriented ZrN and Cu grains, a more random microstructure and a Cu content higher than 2 at.%. The optical properties of nanocomposite Zr-Cu-N films depend on the stoichiometry of the hard ZrN{sub x} compound and the content of Cu in the film. (orig.)

  19. Adsorption of water on TiN (1 0 0), (1 1 0) and (1 1 1) surfaces: A first-principles study

    Sanyal, Suchismita; Waghmare, Umesh V.; Ruud, James A.


    We use first-principles density functional theory-based calculations in the analysis of the interaction of H 2O with (1 0 0), (1 1 0) and (1 1 1) surfaces of TiN, and develop understanding in terms of surface energies, polarity of the surface and chemistry of the cation, through comparison with H 2O adsorption on ZrN. While water molecule physisorbs preferentially at Ti site of (1 0 0) and (1 1 1) surfaces, it adsorbs dissociatively on (1 1 0) surface of TiN with binding stronger than almost 1.32 eV/molecule. Our analysis reveals the following general trends: (a) surfaces with higher energies typically lead to stronger adsorption, (b) dissociative adsorption of H 2O necessarily occurs on a charge neutral high energy surface and (c) lower symmetry of the (1 1 0) plane results in many configurations of comparable stability, as opposed to the higher symmetry (1 0 0) and (1 1 1) surfaces, which also consistently explain the results of H 2O adsorption on MgO available in literature. Finally, weaker adsorption of H 2O on TiN than on ZrN can be rationalized in terms of greater chemical stability of Ti arising from its ability to be in mixed valence.

  20. Fabrication of nitride fuels for transmutation of minor actinides

    Minato, Kazuo; Akabori, Mitsuo; Takano, Masahide; Arai, Yasuo; Nakajima, Kunihisa; Itoh, Akinori; Ogawa, Toru


    At the Japan Atomic Energy Research Institute, the concept of the transmutation of minor actinides (MA: Np, Am and Cm) with accelerator-driven systems is being studied. The MA nitride fuel has been chosen as a candidate because of the possible mutual solubility among the actinide mononitrides and excellent thermal properties besides supporting hard neutron spectrum. MA nitrides of NpN, (Np, Pu)N, (Np, U)N, AmN, (Am, Y)N, (Am, Zr)N and (Cm, Pu)N were prepared from the oxides by the carbothermic reduction method. The prepared MA nitrides were examined by X-ray diffraction and the contents of impurities of oxygen and carbon were measured. The fabrication conditions for MA nitrides were improved so as to reduce the impurity contents. For an irradiation test of U-free nitride fuels, pellets of (Pu, Zr)N and PuN + TiN were prepared and a He-bonded fuel pin was fabricated. The irradiation test started in May 2002 and will go on for two years in the Japan Materials Testing Reactor.

  1. Microstructure and Erosion Resistance Performance of ZrAlN/Cu Coating

    Du, Jun; Zhu, Xiaoying; Zhang, Ping; Cai, Zhihai

    ZrAlN/Cu coating has been deposited onto Ti-6Al-4 V substrate by reactive magnetron sputtering in order to improve its erosion resistance. The morphology and microstructure were studied combined with Field Emission Scanning Electron Microscrope(FSEM), X-ray Diffraction(XRD), X-ray Photoelectron Spectroscopy(XPS) and Transmission Electron Microscopy(TEM). Coatings hardness and toughness were measured by nano-indentation method and Vicker indentation method respectively. It has been found that Zr0.79Al0.19Cu0.02N coating possess dense columnar structure with 20∼40 nm columnar grains exbibiting (100) preferential orientation. XRD reflection peaks slightly shifts to higher angle, showing some of 19at%Al and 2at%Cu substitutely dissolves into face-centered cubic(FCC) ZrN lattice, XPS proves the existence of AlN and Cu phase in coating. Zr0.79Al0.19Cu0.02N coating demonstrates best erosion resistance at 15°∼90° impingement angle compared with Ti6Al4 V substrate, ZrN and Zr0.80Al0.20N coating, attributing to combination of high hardness(40.7 GPa) and good toughness.

  2. The structure and mechanical properties of multilayer nanocrystalline TiN/ZrN coatings obtained by vacuum-arc deposition

    A.V. Demchyshyn


    Full Text Available TiN/ZrN multilayered condensates on BK-8 carbide tips substrates (62 HRC were produced by the vacuumarc deposition technique, using Ti and Zr plasma flows in reactive nitrogen gas medium with working pressure of 6.6·10–1 Pa. The TiN/ZrN multilayered condensates consist of TiN and ZrN sublayers, which have a thickness of ~100 nm, controlled by the processing parameters of the used deposition technique. The obtained coatings have hardness of 45 GPa and Young’s modulus of 320 GPa. The obtained results show that mechanical properties of such multilayered composites are considerably improved in comparison to those for the single-component coatings, TiN and ZrN. The dependence of hardness and Young’s modulus of the composites on sublayer thickness within a range of 100 nm was determined. The investigated structure and improved mechanical properties of the TiN/ZrN multilayered condensates would be very good platform for finding their industrial application, such as hard coatings with different purposes.

  3. JPRS Report, Science & Technology, Europe & Latin America


    QUADRO RIASSUNTIVO DEGLI IMPEGNI DEL PIANO SPAZIALE NAZIONALE (mrliardi di lire) Progr. (1) Fasi (2) (3) Totale ( h Fino a! progr. vn/1987...Marco D/L Gestione (27) Struttura Psn/Cnr (28) Supporto ( 29 ) Assistenza tecnica (30 ) Anticipation! (31 ) 1.912.32 172.50 259.50 2.344.33 410.83

  4. Origin of the mass splitting of azimuthal anisotropies in a multi-phase transport model

    Li, Hanlin; Lin, Zi-Wei; Molnar, Denes; Wang, Fuqiang; Xie, Wei


    The mass splitting of azimuthal anisotropy ($v_n$) at low transverse momentum ($p_{\\perp}$) is considered as a hallmark of hydrodynamic collective flow. We investigate a multi-phase transport (AMPT) model where the $v_n$ is mainly generated by the escape mechanism, not of the hydrodynamic flow nature, and where the mass splitting is also observed. This paper provides extensive details to our published work on Au+Au and d+Au collisions at the Relativistic Heavy Ion Collider (arXiv:1601.05390); it also includes new results on p+Pb collisions at the Large Hadron Collider. We demonstrate that the mass splitting of $v_n$ in AMPT partly arises from kinematics in the quark coalescence hadronization process but more dominantly from hadronic rescatterings, even though the contribution from the latter to the overall charged hadron $v_n$ is small. It is also found that hadronic decays reduce the degree of mass splitting. These findings are qualitatively the same as those from hybrid models that combine hydrodynamics wit...

  5. [Vestibular neuronitis: pathophysiology, diagnosis and treatment].

    Zaper, Dinka; Adamec, Ivan; Gabelić, Tereza; Krbot, Magdalena; Isgum, Velimir; Hajnsek, Sanja; Habek, Mario


    Vestibular neuritis (VN) is one of the most common causes of peripheral vertigo. Caloric testing has been the traditional gold standard for detecting a peripheral vestibular deficit, but some recently developed bedside tests (head thrust, head heave, head shake and vibration test) were evaluated as a good alternative with similar sensitivity and specificity. These tests have shown both diagnostic value in the short term and prognostic value in the long term, and have availability and ease of use as an advantage. As an addition to clinical examination, vestibular evoked myogenic potentials can differentiate between involvement of superior and inferior branch of the vestibular nerve, but also between peripheral and central lesions. Although glucocorticoids are currently widely used in the treatment of VN, there is a lack of evidence for the validity of their administration. There are a number of high quality clinical trials that suggest vestibular rehabilitation exercises, which are based on the mechanisms of vestibular compensation, in the managment of VN. This review will focus on the latest developments in the pathophysiology, diagnosis and treatment of patients with VN.


    E. I. Marukovich


    Full Text Available The groups of alloy steel scrap. suitable for wear-resistant synthetic chromium and iron grades ich18VN ich18VM are studied and defined. Found that the number of alloyed steel scrap in the charge for these irons can be more than 85%, and the price of the charge decreases from 30 to 45%.

  7. Role of vacancy-type defects in magnetism of GaMnN

    Hai-Ying, Xing; Yu, Chen; Chen, Ji; Sheng-Xiang, Jiang; Meng-Yao, Yuan; Zhi-Ying, Guo; Kun, Li; Ming-Qi, Cui; Guo-Yi, Zhang


    Role of vacancy-type (N vacancy (VN) and Ga vacancy (VGa)) defects in magnetism of GaMnN is investigated by first-principle calculation. Theoretical results show that both the VN and VGa influence the ferromagnetic state of a system. The VN can induce antiferromagnetic state and the VGa indirectly modify the stability of the ferromagnetic state by depopulating the Mn levels in GaMnN. The transfer of electrons between the vacancy defects and Mn ions results in converting Mn3+ (d4) into Mn2+ (d5). The introduced VN and the ferromagnetism become stronger and then gradually weaker with Mn concentration increasing, as well as the coexistence of Mn3+ (d4) and Mn2+ (d5) are found in GaMnN films grown by metal-organic chemical vapor deposition. The analysis suggests that a big proportion of Mn3+ changing into Mn2+ will reduce the exchange interaction and magnetic correlation of Mn atoms and lead to the reduction of ferromagnetism of material. Project supported by the National Natural Science Foundation of China (Grant Nos. 61204008, 11075176, and 11505211) and the National Key Basic Research Special Foundation of China (Grant No. 2013CB328705).

  8. 一般二阶线性递归多项式的积分序列%Integration Sequences of General Second-Order Linear Recursive Polynomials



    将Jacobsthal多项式和Jacobsthal-Lucas多项式推广到了更一般的二阶线性递归多项式un(x),vn(x),研究了此多项式的积分序列Sn(x)=x∫0un(s)ds和Tn(x)=x∫0vn(s)ds),给出了它们的封闭表示,利用广义调和数,对数列Sn(1),Tn1)的性质作了较为全面的探讨.%In this paper, we are concerned with the more general second-order linear recursive polynomials un(x), vn(x) have studied the basic properties of the following sequences Sn (x)= x∫0 un(s)ds and Tn(x)= x∫0 vn(s)ds. After establishing closed-form expressions for the numbers Sn(1) and Tn(1), we present several identities involving them by using generalized harmonic numbers.

  9. Vietnam as a Case Example of School-Based Mental Health Services in Low and Middle Income Countries: Efficacy and Effects of Risk Status

    Dang, Hoang-Minh; Weiss, Bahr; Nguyen, Cao Minh; Tran, Nam; Pollack, Amie


    The purposes of this study were to (a) assess the efficacy of a universal classroom-based mental health and social skills program for primary school students in Vietnam, and (b) given the universal nature of the intervention, assess outcomes as a function of risk status (high versus low). RECAP-VN is a semi-structured program that provides…

  10. Changes in fungal population of fly ash and vinasse mixture during vermicomposting by Eudrilus eugeniae and Eisenia fetida: documentation of cellulase isozymes in vermicompost.

    Pramanik, Prabhat; Chung, Young Ryun


    Fly ash (FA) and vinasse (VN), two industrial wastes, are generated in huge amounts and cause serious hazards to the environment. In this experiment, different proportions of these two wastes were used as food for two epigeic earthworms (Eisenia fetida and Eudrilus eugeniae) to standardize the recycling technique of these two wastes and to study their effect on fungal especially cellulolytic fungal population, cellulase activity and their isozyme pattern, chitin content and microbial biomass of waste mixture during vermicomposting. Increasing VN proportion from 25% to 50% or even higher, counts of both fungi and cellulolytic fungi in waste mixtures were significantly (P ≤ 0.05) increased during vermicomposting. Higher cellulase activity in treatments having 50% or more vinasse might be attributed to the significantly (P ≤ 0.05) higher concentration of group I isozyme while concentrations of other isozymes (group II and III) of cellulase were statistically at par. Higher chitin content in vinasse-enriched treatments suggested that fungal biomass and fungi-to-microbial biomass ratio in these treatments were also increased due to vermicomposting. Results revealed that Eudrilus eugeniae and Eisenia fetida had comparable effect on FA and VN mixture during vermicomposting. Periodical analysis of above-mentioned biochemical and microbial properties and nutrient content of final vermicompost samples indicated that equal proportion (1:1, w/w) of FA and VN is probably the optimum composition to obtain best quality vermicompost.

  11. Relative contributions of measles virus hemagglutinin- and fusion protein- specific serum antibodies to virus neutralization.

    R.L. de Swart (Rik); S. Yüksel (Selma); A.D.M.E. Osterhaus (Albert)


    textabstractThe relative contribution of measles virus hemagglutinin (H)- or fusion protein (F)-specific antibodies to virus neutralization (VN) has not been demonstrated. We have depleted these specific antibodies from sera collected from young adults, who had been vaccinated during childhood, by

  12. An Automatic Collocation Writing Assistant for Taiwanese EFL Learners: A Case of Corpus-Based NLP Technology

    Chang, Yu-Chia; Chang, Jason S.; Chen, Hao-Jan; Liou, Hsien-Chin


    Previous work in the literature reveals that EFL learners were deficient in collocations that are a hallmark of near native fluency in learner's writing. Among different types of collocations, the verb-noun (V-N) one was found to be particularly difficult to master, and learners' first language was also found to heavily influence their collocation…

  13. Voedselzekerheid is complex vraagstuk

    Dorp, van M.


    In 2009 had meer dan een miljard mensen te weinig te eten, het hoogste aantal sinds 1970. Dat blijkt uit cijfers van de VN. Jarenlang daalde het aantal mensen met honger, maar de laatste jaren is die trend gekeerd, mede door de wereldwijde economische crisis en de enorme prijsstijgingen van voedsel

  14. The interaction between uPAR and vitronectin triggers ligand-independent adhesion signalling by integrins.

    Ferraris, Gian Maria Sarra; Schulte, Carsten; Buttiglione, Valentina; De Lorenzi, Valentina; Piontini, Andrea; Galluzzi, Massimiliano; Podestà, Alessandro; Madsen, Chris D; Sidenius, Nicolai


    The urokinase-type plasminogen activator receptor (uPAR) is a non-integrin vitronectin (VN) cell adhesion receptor linked to the plasma membrane by a glycolipid anchor. Through structure-function analyses of uPAR, VN and integrins, we document that uPAR-mediated cell adhesion to VN triggers a novel type of integrin signalling that is independent of integrin-matrix engagement. The signalling is fully active on VN mutants deficient in integrin binding site and is also efficiently transduced by integrins deficient in ligand binding. Although integrin ligation is dispensable, signalling is crucially dependent upon an active conformation of the integrin and its association with intracellular adaptors such as talin. This non-canonical integrin signalling is not restricted to uPAR as it poses no structural constraints to the receptor mediating cell attachment. In contrast to canonical integrin signalling, where integrins form direct mechanical links between the ECM and the cytoskeleton, the molecular mechanism enabling the crosstalk between non-integrin adhesion receptors and integrins is dependent upon membrane tension. This suggests that for this type of signalling, the membrane represents a critical component of the molecular clutch. © 2014 The Authors.

  15. Study of Particle Motion in He II Counterflow Across a Wide Heat Flux Range

    Mastracci, Brian; Takada, Suguru; Guo, Wei


    Some discrepancy exists in the results of He II counterflow experiments obtained using particle image velocimetry (PIV) when compared with those obtained using particle tracking velocimetry (PTV): using PIV, it was observed that tracer particles move at roughly half the expected normal fluid velocity, v_n/2 , while tracer particles observed using PTV moved at approximately v_n . A suggested explanation is that two different flow regimes were examined since the range of heat flux applied in each experiment was adjacent but non-overlapping. Another PTV experiment attempted to test this model, but the applied heat flux did not overlap with any PIV experiments. We report on the beginnings of a study of solid D_2 particle motion in counterflow using PTV, and the heat flux range overlaps that of all previous visualization studies. The observed particle velocity distribution transitions from a two-peak structure to a single peak as the heat flux is increased. Furthermore, the mean value of one peak in the bi-modal distributions grows at approximately the same rate as v_n , while the mean value of the single-peak distributions grows at roughly 0.4v_n , in reasonable agreement with both previous experiments and with the suggested model.

  16. Propolis modulates vitronectin, laminin, and heparan sulfate/heparin expression during experimental burn healing

    Pawel OLCZYK; Katarzyna KOMOSI(N)SKA-VASSEV; Katarzyna WINSZ-SZCZOTKA; Ewa M.KO(Z)MA; Grzegorz WISOWSKI; Jerzy STOJKO; Katarzyna KLIMEK; Krystyna OLCZYK


    Objective:This study was aimed at assessing the dynamics of vitronectin (VN),laminin (LN),and heparan sulfate/heparin (HS/HP) content changes during experimental burn healing.Methods:VN,LN,and HS/HP were isolated and purified from normal and injured skin of domestic pigs,on the 3rd,5th,10th,15th,and 21st days following thermal damage.The wounds were treated with apitherapeutic agent (propolis),silver sulfadiazine (SSD),physiological salt solution,and propolis vehicle.VN and LN were quantified using an immunoenzymatic assay and HS/HP was estimated by densitometric analysis.Results:Propolis treatment stimulated significant increases in VN,LN,and HS/HP contents during the initial phase of study,followed by a reduction in the estimated extracellular matrix molecules.Similar patterns,although less extreme,were observed after treatment with SSD.Conclusions:The beneficial effects of propolis on experimental wounds make it a potential apitherapeutic agent in topical burn management.

  17. Field Performance of Three-Phase Amorphous Metal Core Distribution Transformers at Pearl Harbor, Hawaii


    power gerwation) ;2 2,n~tr-octcn mathodo and mztcr1,es iinolug carro -ion 30 Controls and electrical conservation (eectrcal systes. Control, coatings...Eng.rieen Teat Faclftles power systems. solar systems. wind systems, energy storage 7 F~Re Pr*vn+nton and c;ontrol systems) 3A.1untsmJ, *scnocgy 33

  18. Spreading of the conception of permanent resonance to wave motions over lattices

    Zakhariev, B N


    Discovered by us [1] special (permanent) resonance mechanism of spectral zone creation in periodic structures is generalized to the case of discrete space lattices and finite difference Schroedinger equation with local V(n) and minimally nonlocal U(n). It would be interesting to generalize the periodicity formalism to the multidiagonal finite-difference potentials.

  19. Hafnium implanted in iron .2.Isolated Hafnium Nitrogen Complexes

    de Bakker, J.M.G.J.; Pleiter, F; Smulders, P.J M


    We have used the perturbed angular correlation technique to study the interaction of interstitially diffusing nitrogen atoms with substitutional hafnium atoms implanted in iron. It was found that after post-implantation of 250 eV nitrogen ions at 450 K, isolated HfVN(x) complexes with x = 1, 2 are


    Alena I. Arkhipova


    Full Text Available The article considers governors’ reports in terms of imperial narrative presence. The author attempts to show Yakutskaya Oblast Governors V.N. Skrypitsyn and I.I. Kraft’s attitude towards non-Russian inhabitants, their views of region further development and its place in all-Imperial space.

  1. NCBI nr-aa BLAST: CBRC-MMUS-20-0071 [SEVENS

    Full Text Available CBRC-MMUS-20-0071 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-137 79% ...

  2. NCBI nr-aa BLAST: CBRC-RNOR-04-0256 [SEVENS

    Full Text Available CBRC-RNOR-04-0256 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 2e-74 71% ...

  3. NCBI nr-aa BLAST: CBRC-MMUS-06-0128 [SEVENS

    Full Text Available CBRC-MMUS-06-0128 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-175 99% ...

  4. NCBI nr-aa BLAST: CBRC-RNOR-04-0239 [SEVENS

    Full Text Available CBRC-RNOR-04-0239 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-139 80% ...

  5. NCBI nr-aa BLAST: CBRC-RNOR-04-0249 [SEVENS

    Full Text Available CBRC-RNOR-04-0249 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-133 77% ...

  6. NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

    Full Text Available CBRC-RNOR-04-0259 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-124 73% ...

  7. NCBI nr-aa BLAST: CBRC-MMUS-06-0123 [SEVENS

    Full Text Available CBRC-MMUS-06-0123 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-137 79% ...

  8. NCBI nr-aa BLAST: CBRC-OCUN-01-0056 [SEVENS

    Full Text Available CBRC-OCUN-01-0056 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 8e-47 57% ...

  9. NCBI nr-aa BLAST: CBRC-MMUS-06-0141 [SEVENS

    Full Text Available CBRC-MMUS-06-0141 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-141 82% ...

  10. NCBI nr-aa BLAST: CBRC-MMUS-06-0122 [SEVENS

    Full Text Available CBRC-MMUS-06-0122 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-142 80% ...

  11. NCBI nr-aa BLAST: CBRC-MMUS-06-0131 [SEVENS

    Full Text Available CBRC-MMUS-06-0131 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-137 80% ...

  12. NCBI nr-aa BLAST: CBRC-MMUS-06-0136 [SEVENS

    Full Text Available CBRC-MMUS-06-0136 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-138 77% ...

  13. NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

    Full Text Available CBRC-RNOR-04-0238 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-135 82% ...

  14. NCBI nr-aa BLAST: CBRC-RNOR-04-0255 [SEVENS

    Full Text Available CBRC-RNOR-04-0255 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-122 74% ...

  15. NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

    Full Text Available CBRC-MMUS-06-0135 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 1e-141 82% ...

  16. NCBI nr-aa BLAST: CBRC-CPOR-01-0246 [SEVENS

    Full Text Available CBRC-CPOR-01-0246 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 4e-32 55% ...

  17. NCBI nr-aa BLAST: CBRC-OCUN-01-0645 [SEVENS

    Full Text Available CBRC-OCUN-01-0645 sp|Q9EQ47|VN1B4_MOUSE Vomeronasal type-1 receptor B4 (Vomeronasal... type-1 receptor A10) (Vomeronasal type-1 receptor B11) gb|AAI07186.1| V1rb4 protein [Mus musculus] Q9EQ47 4e-49 57% ...

  18. Disease: H00212 [KEGG MEDICUS

    Full Text Available H00212 Acrodermatitis enteropathica (AEZ) Acrodermatitis enteropathica is an autoso...acterized by intermittent simultaneous occurrence of diarrhea and dermatitis with failure to thrive. Inherit...90629 Maverakis E, Fung MA, Lynch PJ, Draznin M, Michael DJ, Ruben B, Fazel N Acrodermatitis enteropathica a...209 Sehgal VN, Jain S Acrodermatitis enteropathica. Clin Dermatol 18:745-8 (2000) ...

  19. Stravinsky: Symphonies, Concertos, Ballets and other works / David S. Gutman

    Gutman, David S.


    Uuest heliplaadist "Stravinsky: Symphonies, Concertos, Ballets and other works. Gabriele Schnaut (sop), Peter Svensson (ten), Franz Grundheber (bar), Günther von Kannen (bass), Jean Piat (narr), Lydia Mordkovitch (vn), Geoffrey Tozer, Boris Berman (pfs), Suisse Romande Chamber Choir, Lausanne Pro Arte Choir, Brassus Choral Society, Suisse Romande Ochestra, Neeme Järvi. Chandos CD CHAN 9240

  20. Low-Pt loaded on a vanadium nitride/graphitic carbon composite as an efficient electrocatalyst for the oxygen reduction reaction.

    Yin, Jie; Wang, Lei; Tian, Chungui; Tan, Taixing; Mu, Guang; Zhao, Lu; Fu, Honggang


    The high cost of platinum electrocatalysts for the oxygen reduction reaction (ORR) has hindered the commercialization of fuel cells. An effective support can reduce the usage of Pt and improve the reactivity of Pt through synergistic effects. Herein, the vanadium nitride/graphitic carbon (VN/GC) nanocomposites, which act as an enhanced carrier of Pt nanoparticles (NPs) towards ORR, have been synthesized for the first time. In the synthesis, the VN/GC composite could be obtained by introducing VO3 (-) and [Fe(CN)6 ](4-) ions into the polyacrylic weak-acid anion-exchanged resin (PWAR) through an in-situ anion-exchanged route, followed by carbonization and a subsequent nitridation process. After loading only 10 % Pt NPs, the resulting Pt-VN/GC catalyst demonstrates a more positive onset potential (1.01 V), higher mass activity (137.2 mA mg(-1) ), and better cyclic stability (99 % electrochemical active surface area (ECSA) retention after 2000 cycles) towards ORR than the commercial 20 % Pt/C. Importantly, the Pt-VN/GC catalyst mainly exhibits a 4 e(-) -transfer mechanism and a low yield of peroxide species, suggesting its potential application as a low-cost and highly efficient ORR catalyst in fuel cells.

  1. Simulations of fine structures on the zero field steps of Josephson tunnel junctions

    Scheuermann, M.; Chi, C. C.; Pedersen, Niels Falsig;


    are generated by the interaction of the bias current with the fluxon at the junction edges. On the first zero field step, the voltages of successive fine structures are given by Vn=[h-bar]/2e(2omegap/n), where n is an even integer. Applied Physics Letters is copyrighted by The American Institute of Physics....

  2. Electrical Stimulation at the ST36 Acupoint Protects against Sepsis Lethality and Reduces Serum TNF Levels through Vagus Nerve- and Catecholamine-Dependent Mechanisms

    Albino Villegas-Bastida


    Full Text Available Electrical vagus nerve (VN stimulation during sepsis attenuates tumor necrosis factor (TNF production through the cholinergic anti-inflammatory pathway, which depends on the integrity of the VN and catecholamine production. To characterize the effect of electroacupuncture at ST36 (EA-ST36 on serum TNF, IL-6, nitrite, and HMGB1 levels and survival rates, based on VN integrity and catecholamine production, a sepsis model was induced in rats using cecal ligation and puncture (CLP. The septic rats were subsequently treated with EA-ST36 (CLP+ST36, and serum samples were collected and analyzed for cytokines levels. The serum TNF, IL-6, nitrite, and HMGB1 levels in the CLP+ST36 group were significantly lower compared with the group without treatment, the survival rates were significantly higher (P<0.05, and the acute organ injury induced by CLP was mitigated by EA-ST36; however, when subdiaphragmatic vagotomy was performed, the serum levels of TNF in the CLP+ST36 group did not show a significant difference compared with the group without electrostimulation, and, similarly, no significant difference in serum TNF levels was found under the pharmacological blockade of catecholamines. These results suggest that in rats with CLP sepsis models EA-ST36 reduces serum TNF levels through VN- and atecholamine-dependent mechanisms.

  3. SYMBOLANG - A Slip Extension for Algebraic Manipulation


    MAN7 MANY MTLIST \\T r: Tin TAT lie II vnL NUMPY POPBOT PRIPUT REED RITE I SCHATL SEQSL SQOUT SUB SUMPY TRCAL ZERO MONO MRKLSS ..^..~ ^^w.^^w^. _..~ n„ -~-/ x • o-- • (54) NUMPY (LIST, QUANT) NUMPY is one of the older SYMBOLANG routines

  4. Pseudorapidity Dependence of Anisotropic Azimuthal Flow with the ALICE Detector

    Hansen, Alexander Colliander

    In ultra-relativistic heavy-ion collisions a new state of matter known as the strongly interacting quark-gluon plasma (sQGP) is produced. A key observable in the study of the sQGP is anisotropic azimuthal ow. The anisotropies are described by ow harmonics, vn. In this thesis, bias arising from non...

  5. Gene : CBRC-MDOM-01-0564 [SEVENS


  6. Stravinsky: Symphonies, Concertos, Ballets and other works / David S. Gutman

    Gutman, David S.


    Uuest heliplaadist "Stravinsky: Symphonies, Concertos, Ballets and other works. Gabriele Schnaut (sop), Peter Svensson (ten), Franz Grundheber (bar), Günther von Kannen (bass), Jean Piat (narr), Lydia Mordkovitch (vn), Geoffrey Tozer, Boris Berman (pfs), Suisse Romande Chamber Choir, Lausanne Pro Arte Choir, Brassus Choral Society, Suisse Romande Ochestra, Neeme Järvi. Chandos CD CHAN 9240

  7. Towards hard yet self-lubricious CrAlSiN coatings

    Qiu, Yuexiu [Central Iron and Steel Research Institute, 76 South Xueyuanlu Rd, Haidan District, Beijing 100081 (China); Advanced Technology and Materials Co., Ltd, 76 South Xueyuanlu Rd, Haidan District, Beijing 100081 (China); Zhang, Sam [School of Mechanical and Aerospace Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore 639798 (Singapore); Lee, Jyh-Wei [Department of Materials Engineering, Ming Chi University of Technology, 84 Gung Juan Road, Taishan, Taipei 24301, Taiwan (China); Center for Thin Film Technologies and Applications, Ming Chi University of Technology, 84 Gung Juan Road, Taishan, Taipei 24301, Taiwan (China); Li, Bo [Central Iron and Steel Research Institute, 76 South Xueyuanlu Rd, Haidan District, Beijing 100081 (China); Wang, Yuxi [School of Mechanical and Aerospace Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore 639798 (Singapore); Zhao, Dongliang [Central Iron and Steel Research Institute, 76 South Xueyuanlu Rd, Haidan District, Beijing 100081 (China); Sun, Deen [School of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China)


    Highlights: • Hard yet self-lubricious CrAlSiVN coatings are developed. • Incorporating vanadium into CrAlSiN structure refines crystal grains. • Tribo-oxidized vanadium provides CrAlSiN coatings lubriciousness. - Abstract: CrAlSiN coatings are of high hardness, excellent wear and oxidation resistance but lack of lubriciousness. Vanadium nitride (VN) is easily oxidized to form vanadium oxides and becomes lubricious under stress. Incorporating VN into CrAlSiN to form CrAlSiVN coating renders both hardness and self-lubrication in dry machining. This study investigates the effect of vanadium content on hard yet self-lubricious coating’s mechanical and tribological properties. The coatings are deposited on cemented tungsten carbide and Si wafer (1 0 0) substrates in an in-line magnetron sputtering system. Grazing incidence X-ray diffractometer, scanning electron microscopy, transmission electron microscopy, electron probe micro-analyzer, X-ray photoelectron spectroscopy and energy dispersive X-ray spectroscopy are employed to characterize the microstructures and chemistry. Nanoindentation and ball-on-disc tribo-tester are used in characterization of the mechanical and tribological properties. The coatings demonstrate lubriciousness of coefficient of friction with tungsten carbide from 0.55 down to 0.39 with acceptable loss of hardness (from ∼35 GPa down to ∼30 GPa)

  8. [Multifrequency vestibular study after vestibular neurotomy and chemical labyrinthectomy].

    Morel, N; Dumas, G; Righini, C; Karkas, A; Hitter, A; Schmerber, S


    Vestibular neurotomy (VN) and chemical labyrinthectomy (CL) are the two most common techniques of vestibular deafferention to treat patients with intractable vertigo. A long-term evaluation of vestibular function has been performed with a variety of vestibular tests to find out whether there persisted any residual vestibular function after each technique. We called in all patients who have been treated for the last 10 years and have no known vestibular disease in the non treated ear. Low frequencies were analyzed with caloric tests, medium frequencies with the head-shaking test and head-impulse test, and high frequencies with the skull vibration test. The otolithic function was explored with the subjective vertical visual analysis and otolithic myogenic evoked potentials. Nine patients treated with VN and 12 with CL presented to our department. We were thus able to compare VN and CL patients with a group of 10 normal patients and another group of nine patients that had had a translabyrinthine approach for an acoustic neuroma. We found out that vestibular responses did persist in seven out of nine (78 %) patients after VN and 11 out of 12 (92 %) patients after CL. On the other hand, no vestibular response was detected following resection of vestibular schwannoma through a translabyrinthine approach. We came to the conclusion that the two latter techniques, unlike vestibulocochlear nerve section via the translabyrinthine approach, are only incomplete methods of vestibular deafferention.

  9. Toughness enhancement in hard ceramic thin films by alloy design

    Kindlund, H.; Sangiovanni, D. G.; Martínez-de-Olcoz, L.; Lu, J.; Jensen, J.; Birch, J.; Petrov, I.; Greene, J. E.; Chirita, V.; Hultman, L.


    Hardness is an essential property for a wide range of applications. However, hardness alone, typically accompanied by brittleness, is not sufficient to prevent failure in ceramic films exposed to high stresses. Using VN as a model system, we demonstrate with experiment and density functional theory (DFT) that refractory VMoN alloys exhibit not only enhanced hardness, but dramatically increased ductility. V0.5Mo0.5N hardness is 25% higher than that of VN. In addition, while nanoindented VN, as well as TiN reference samples, suffer from severe cracking typical of brittle ceramics, V0.5Mo0.5N films do not crack. Instead, they exhibit material pile-up around nanoindents, characteristic of plastic flow in ductile materials. Moreover, the wear resistance of V0.5Mo0.5N is considerably higher than that of VN. DFT results show that tuning the occupancy of d-t2g metallic bonding states in VMoN facilitates dislocation glide, and hence enhances toughness, via the formation of stronger metal/metal bonds along the slip direction and weaker metal/N bonds across the slip plane.

  10. Symptombehandling og betonpædagogik

    Hansen, Erik W.


    Det korte af det lange er, at forholdet mellem danskskriftsprog og dansk udtale ikke bliver behandlet rationelt af de personer (Dansk Sprognævn), der har en eller anden form for autorisation til at ændre skriftsproget. I den løbende diskussion om ændringer af dansk skriftsprog bliver det rationel...

  11. [Surgery treatment of vast abdominal hernias with application of unpressed syntetic mesh--preliminary communications].

    Waz, Krzyszrof; Buczynowska, Mirosława; Cienciała, Antoni; Friediger, Jerzy; Topa, Jacek; Steczko-Sieczkowska, Małgorzata; Kisiel, Andrzej; Pedziwiatr, Wiesław; Gotfryd-Bugajska, Katarzyna


    This presentation present outcome of surgery treatment of vast abdominal hernias occurred in 9 patients with application of unpressed synthetic mesh: Gore-Dualmesh and SurgimeshVN. All of operated hernias was complications post previous surgery. Surgery perfomed by 5 male and 4 female patients. One of implanted mesh was removed due to faecal fistula. Patients were followed for 2 to 12 month.

  12. E-health Sense: Digital Health Services

    Kulyk, Olga Anatoliyivna


    In oktober heeft een workshop 'Kwaliteitseisen Digitale Hulpverlening in het Kader van e-health Sense' plaatsgevonden tijdens de digitale leerweek van Soa Aids Nederland en V&VN. Tijdens een focusgroepdiscussie met sociaal-verpleegkundigen seksuele gezondheid kwamen vragen aan de orde over het

  13. A Tauberian Theorem with a Generalized One-Sided Condition

    İbrahim Çanak


    Full Text Available We prove a Tauberian theorem to recover moderate oscillation of a real sequence u=(un out of Abel limitability of the sequence (Vn(1(Δu and some additional condition on the general control modulo of oscillatory behavior of integer order of u=(un.

  14. Blood pressure control with selective vagal nerve stimulation and minimal side effects

    Plachta, Dennis T. T.; Gierthmuehlen, Mortimer; Cota, Oscar; Espinosa, Nayeli; Boeser, Fabian; Herrera, Taliana C.; Stieglitz, Thomas; Zentner, Joseph


    Objective. Hypertension is the largest threat to patient health and a burden to health care systems. Despite various options, 30% of patients do not respond sufficiently to medical treatment. Mechanoreceptors in the aortic arch relay blood pressure (BP) levels through vagal nerve (VN) fibers to the brainstem and trigger the baroreflex, lowering the BP. Selective electrical stimulation of these nerve fibers reduced BP in rats. However, there is no technique described to localize and stimulate these fibers inside the VN without inadvertent stimulation of non-baroreceptive fibers causing side effects like bradycardia and bradypnea. Approach. We present a novel method for selective VN stimulation to reduce BP without the aforementioned side effects. Baroreceptor compound activity of rat VN (n = 5) was localized using a multichannel cuff electrode, true tripolar recording and a coherent averaging algorithm triggered by BP or electrocardiogram. Main results. Tripolar stimulation over electrodes near the barofibers reduced the BP without triggering significant bradycardia and bradypnea. The BP drop was adjusted to 60% of the initial value by varying the stimulation pulse width and duration, and lasted up to five times longer than the stimulation. Significance. The presented method is robust to impedance changes, independent of the electrode's relative position, does not compromise the nerve and can run on implantable, ultra-low power signal processors.

  15. Models to quantify excretion of dry matter, nitrogen, phosphorus and carbon in growing pigs fed regional diets

    Jørgensen, Henry; Poulsen, Hanne Damgaard; Prapaspongsa, Trakarn


    used in a digestibility and balance experiment. Excretion of dry matter (DM), nitrogen (N), phosphorus (P) and carbon (C) of the experimental diets were determined. Due to the highest dietary fibre content, VN had the lowest digestibility of N, P and C (73, 49, and 73%, respectively) compared...

  16. Vasoactive neuropeptides in clinical ophthalmology: An association with autoimmune retinopathy?

    Donald R Staines


    Full Text Available Donald R Staines1,2, Ekua W Brenu2, Sonya Marshall-Gradisnik21Queensland Health, Gold Coast Population Health Unit, Southport, Gold Coast, Queensland, Australia; 2Faculty of Health Science and Medicine, Population Health and Neuroimmunology Unit, Bond University, Robina, Queensland, AustraliaAbstract: The mammalian eye is protected against pathogens and inflammation in a relatively immune-privileged environment. Stringent mechanisms are activated that regulate external injury, infection, and autoimmunity. The eye contains a variety of cells expressing vasoactive neuropeptides (VNs, and their receptors, located in the sclera, cornea, iris, ciliary body, ciliary process, and the retina. VNs are important activators of adenylate cyclase, deriving cyclic adenosine monophosphate (cAMP from adenosine triphosphate (ATP. Impairment of VN function would arguably impede cAMP production and impede utilization of ATP. Thus VN autoimmunity may be an etiological factor in retinopathy involving perturbations of purinergic signaling. A sound blood supply is necessary for the existence and functional properties of the retina. This paper postulates that impairments in the endothelial barriers and the blood–retinal barrier, as well as certain inflammatory responses, may arise from disruption to VN function. Phosphodiesterase inhibitors and purinergic modulators may have a role in the treatment of postulated VN autoimmune retinopathy.Keywords: retinopathy, autoimmune, vasoactive neuropeptides, phosphodiesterase inhibitors

  17. Large deviation tail estimates and related limit laws for stochastic fixed point equations

    Collamore, Jeffrey F.; Vidyashankar, Anand N.


    between the forward and backward recursions and develop techniques for estimating the exceedance probability. In the process, we establish an interesting connection between the regularity properties of $\\{V_n\\}$ and the recurrence properties of an associated $\\xi$-shifted Markov chain. We illustrate...

  18. Bibliography of Soviet Laser Developments, Number 76, March - April 1985.


    487. Kukhtarev, N.V.; Semenets, T.I.; Starkov , V.N. (. Optical bistability and hysteresis in light wavefront reversal in ferroelectrics...V V 78 STARIK A N 13 TROITSKIY YU V 13,18,29,83 STARKOV V N 56 TABARIN V A 50 TRDN’FO V 48 STAROSTENKO B V 83 TABIRYAN N V 17 TROPCHENKO A YU 64

  19. Installation Restoration Program Records Search for Alaska DEW Line Stations


    full service and logistics support for its sector; (2) the Auxiliary station consisting of one 25-module train, equipped with rotating radar and self ...mmear 70 Sompsse modeate que5aftw of besuleeem mintem -VN 1 ienire "aciinsaee at bassezime, ’ estee 16 Sooreem lagge qwuaAt~sei of hases ome ’ea u to

  20. Design of a Compact Pulsed Power Accelerator


    A 100 kA/60 ns compact pulsed power accelerator was designed to study the influence to the X-pinch by the load. It is composed of a Marx generator, a combined pulse forming (PFL), a gas-filled V/N field distortion switch, a transfer line,

  1. Studies on the effect of a newly synthesized Schiff base compound from phenazone and vanillin on the corrosion of steel in 2M HCl

    Emreguel, Kaan C. [Department of Chemistry/Physical Chemistry, Faculty of Sciences, University of Ankara, 06100 Tandogan, Ankara (Turkey)]. E-mail:; Hayvali, Mustafa [Department of Chemistry/Inorganic Chemistry, Faculty of Sciences, University of Ankara, 06100 Tandogan, Ankara (Turkey)


    The inhibiting action of a Schiff base 4-[(4-hydroxy-3-hydroxymethyl-benzylidene)-amino]-1,5-dimethyl-2-phenyl-1,2 -dihydro-pyrazol-3-one (phv), derived from 4-amino-1,5-dimethyl-2-phenyl-1,2-dihydro-pyrazol-3-one (phz) and 4-hydroxy-3-methoxy-benzaldehyde (vn), towards the corrosion behavior of steel in 2M HCl solution has been studied using weight loss, polarization and electrochemical impedance spectroscopy (EIS) techniques. Although vn and phz were found to retard the corrosion rate of steel, the compound synthesized from vn and phz was seen to retard the corrosion rate even more. At constant temperature, the corrosion rate decreases with increasing inhibitor concentration. However, at any inhibitor concentration the increase in temperature leads to an increase in the corrosion rate of steel. The activations energies, {delta}E{sub a}, as well as other thermodynamic parameters ({delta}G{sub ads}{sup 0}, {delta}H{sub ads}{sup 0}) for the inhibitor process were calculated. The inhibitor efficiencies calculated from all the applied methods were in agreement and were found to be in the order: phv>phz>vn.

  2. Malnormal subgroups of lattices and the Pukanszky invariant in group factors

    Robertson, Guyan


    Let $G$ be a connected semisimple real algebraic group. Assume that $G(\\bb R)$ has no compact factors and let $\\Gamma$ be a torsion-free uniform lattice subgroup of $G(\\bb R)$. Then $\\Gamma$ contains a malnormal abelian subgroup $A$. This implies that the $\\tto$ factor $\\vn(\\Gamma)$ contains a masa $\\fk A$ with Puk\\'anszky invariant $\\{\\infty\\}$.

  3. Visual dependency and dizziness after vestibular neuritis.

    Sian Cousins

    Full Text Available Symptomatic recovery after acute vestibular neuritis (VN is variable, with around 50% of patients reporting long term vestibular symptoms; hence, it is essential to identify factors related to poor clinical outcome. Here we investigated whether excessive reliance on visual input for spatial orientation (visual dependence was associated with long term vestibular symptoms following acute VN. Twenty-eight patients with VN and 25 normal control subjects were included. Patients were enrolled at least 6 months after acute illness. Recovery status was not a criterion for study entry, allowing recruitment of patients with a full range of persistent symptoms. We measured visual dependence with a laptop-based Rod-and-Disk Test and severity of symptoms with the Dizziness Handicap Inventory (DHI. The third of patients showing the worst clinical outcomes (mean DHI score 36-80 had significantly greater visual dependence than normal subjects (6.35° error vs. 3.39° respectively, p = 0.03. Asymptomatic patients and those with minor residual symptoms did not differ from controls. Visual dependence was associated with high levels of persistent vestibular symptoms after acute VN. Over-reliance on visual information for spatial orientation is one characteristic of poorly recovered vestibular neuritis patients. The finding may be clinically useful given that visual dependence may be modified through rehabilitation desensitization techniques.

  4. Relative contributions of measles virus hemagglutinin- and fusion protein- specific serum antibodies to virus neutralization.

    R.L. de Swart (Rik); S. Yüksel (Selma); A.D.M.E. Osterhaus (Albert)


    textabstractThe relative contribution of measles virus hemagglutinin (H)- or fusion protein (F)-specific antibodies to virus neutralization (VN) has not been demonstrated. We have depleted these specific antibodies from sera collected from young adults, who had been vaccinated during childhood, by p

  5. The First Trocar Entry in the Laparoscopic Cholecystectomy, Which Technique?

    Ahmet Serdar Karaca


    Full Text Available Aim: We planned a comparison of veress needle (VN and direct trocar (DT insertion techniques, which have been commonly used in laparoscopic surgical procedures, via a prospective randomized clinical study. Material and Method: 400 patients who had undergone laparoscopic cholecystectomy were included to the present prospective randomized clinical study. SPSS 17.0 (SPSS Inc., Chicago, IL was used for the statistical analysis. Insufflation-related technical complications were investigated in two groups. The cases requiring open surgery (mesenteric laceration, bleeding, organ perforation, solid organ injury and blood vessel injuries were determined as major complications. Minor complications (subcutaneous emphysema, phison and extraperitoneal insufflation were established as factors not changing the length of hospital stay. Results: Mortality was not observed in both groups. There was no difference between the groups with respect to mean age, male to female ratio, BMI and duration of surgery. 33 minor complications were detected. 27 of these complications were observed in the VN group, whereas the number of minor complications seen in the DT group was 6. Major complications seen in the VN and DT groups were respectively 3 and 1. Discussion: If pneumoperitoneum is established by close method, there is no safety-related significant difference between the insertion of DT and VN.

  6. Photoluminescence of hexagonal boron nitride: effect of surface oxidation under UV-laser irradiation

    Museur, Luc; Petitet, Jean-Pierre; Michel, Jean Pierre; Kanaev, Andrei V


    We report on the UV laser induced fluorescence of hexagonal boron nitride (h-BN) following nanosecond laser irradiation of the surface under vacuum and in different environments of nitrogen gas and ambient air. The observed fluorescence bands are tentatively ascribed to impurity and mono (VN), or multiple (m-VN with m = 2 or 3) nitrogen vacancies. A structured fluorescence band between 300 nm and 350 nm is assigned to impurity-band transition and its complex lineshape is attributed to phonon replicas. An additional band at 340 nm, assigned to VN vacancies on surface, is observed under vacuum and quenched by adsorbed molecular oxygen. UV-irradiation of h-BN under vacuum results in a broad asymmetric fluorescence at ~400 nm assigned to m-VN vacancies; further irradiation breaks more B-N bonds enriching the surface with elemental boron. However, no boron deposit appears under irradiation of samples in ambient atmosphere. This effect is explained by oxygen healing of radiation-induced surface defects. Formation o...

  7. Electrical Stimulation at the ST36 Acupoint Protects against Sepsis Lethality and Reduces Serum TNF Levels through Vagus Nerve- and Catecholamine-Dependent Mechanisms

    Villegas-Bastida, Albino; Torres-Rosas, Rafael; Arriaga-Pizano, Lourdes Andrea; Flores-Estrada, Javier; Gustavo-Acosta, Altamirano; Moreno-Eutimio, Mario Adan


    Electrical vagus nerve (VN) stimulation during sepsis attenuates tumor necrosis factor (TNF) production through the cholinergic anti-inflammatory pathway, which depends on the integrity of the VN and catecholamine production. To characterize the effect of electroacupuncture at ST36 (EA-ST36) on serum TNF, IL-6, nitrite, and HMGB1 levels and survival rates, based on VN integrity and catecholamine production, a sepsis model was induced in rats using cecal ligation and puncture (CLP). The septic rats were subsequently treated with EA-ST36 (CLP+ST36), and serum samples were collected and analyzed for cytokines levels. The serum TNF, IL-6, nitrite, and HMGB1 levels in the CLP+ST36 group were significantly lower compared with the group without treatment, the survival rates were significantly higher (P < 0.05), and the acute organ injury induced by CLP was mitigated by EA-ST36; however, when subdiaphragmatic vagotomy was performed, the serum levels of TNF in the CLP+ST36 group did not show a significant difference compared with the group without electrostimulation, and, similarly, no significant difference in serum TNF levels was found under the pharmacological blockade of catecholamines. These results suggest that in rats with CLP sepsis models EA-ST36 reduces serum TNF levels through VN- and atecholamine-dependent mechanisms. PMID:25057275

  8. 40 CFR 98.343 - Calculating GHG emissions.


    ... records, or best available data. YrOpen = Year in which the landfill first received waste from company records or best available data. If no data are available for estimating YrOpen for a closed landfill, use... sampling, use N = 52. n = Index for measurement period. (V)n = Daily average volumetric flow rate for day n...

  9. Det evidensbaserede liv

    Bjerre, Jørn


    Hvor mange stykker frugt om dagen? Hvor mange timers søvn? Hvor meget sex? Og hvilken type partner passer bedst til mig? I det aftraditionaliserede samfunds overskud af handlemuligheder har vi brug for sikkerhed for, at det vi gør, er det rigtige, så vi forsøger at leve det evidensbaserede liv. Men...

  10. Film adhesion in amorphous silicon solar cells

    A R M Yusoff; M N Syahrul; K Henkel


    A major issue encountered during fabrication of triple junction -Si solar cells on polyimide substrates is the adhesion of the solar cell thin films to the substrates. Here, we present our study of film adhesion in amorphous silicon solar cells made on different polyimide substrates (Kapton VN, Upilex-S and Gouldflex), and the effect of tie coats on film adhesion.

  11. Vinterbyggeri med forhindringer

    Hansen, Ernst Jan de Place; Larsen, Jacob Norvig


    Lav aktivitet i byggeriet om vinteren forbindes normalt med klimaets indflydelse på forholdene på byggepladsen, ikke mindst på nordlige breddegrader. Det er en udbredt holdning, at en ujævn aktivitet fører til en fordyrelse af byggeriet, som følge af at materiel og arbejdskraft ikke udnyttes opti...

  12. The Role of Natural Killer (NK) Cells and NK Cell Receptor Polymorphisms in the Assessment of HIV-1 Neutralization


    LW GK VRP . Performed the experiments: BKB LW GK KL MW. Analyzed the data: BKB LW KL DCM VRP . Contributed reagents/materials/analysis tools: JC JCK CO...VN. Wrote the paper: BKB DCM VRP . Program oversight: MM NM DCM. References 1. Rerks-Ngarm S, Pitisuttithum P, Nitayaphan S, Kaewkungwal J, Chiu J, et

  13. Data of evolutionary structure change: 1BT8B-1UNFX [Confc[Archive


  14. Antagonistic intestinal microflora produces antimicrobial substance inhibitory to Pseudomonas species and other spoilage organisms.

    Hatew, Bayissa; Delessa, Tenagne; Zakin, Vered; Gollop, Natan


    Chicken intestine harbors a vast number of bacterial strains. In the present study, antimicrobial substance produced by lactic acid bacteria (LAB) isolated from the gastrointestinal tract of healthy chicken was detected, characterized, and purified. Based on 16S rRNA sequencing, the bacteria were identified as Lactobacillus plantarum vN. The antimicrobial substance produced by this bacterium was designated vN-1 and exhibited a broad-spectrum of activity against many important pathogenic and spoilage microorganisms, including Pseudomonas aeruginosa, Staphylococcus aureus, Micrococcus luteus, Salmonella Typhimurium, and Erwinia amylovova. vN-1 was determined to be thermostable, insensitive to pH values ranging from 2.0 to 8.0, resistant to various organic solvents and to enzymatic inactivation. The inhibition kinetics displayed a bactericidal mode of action. This study revealed an antimicrobial substance with low molecular mass of less than 1 kDa as determined by ultrafiltration and having features not previously reported for LAB isolated from chicken intestines. The detection of this antimicrobial substance addresses an important aspect of biotechnological control agents of spoilage caused by Pseudomonas spp. and promises the possibility for preservation of refrigerated poultry meat. Practical Application:  The newly characterized antimicrobial substance and designated as vN-1 may have the potential to be used in food preservation.

  15. Biodegradation of differently cross-linked collagen membranes: an experimental study in the rat.

    Rothamel, D.; Schwarz, F.; Sager, M.; Herten, M. van; Sculean, A.; Becker, J.M.


    The aim of the present study was to compare the biodegradation of differently cross-linked collagen membranes in rats. Five commercially available and three experimental membranes (VN) were included: (1) BioGide (BG) (non-cross-linked porcine type I and III collagens), (2) BioMend (BM), (3) BioMendE

  16. Nystagmus induced by electrical stimulation of the vestibular and prepositus hypoglossi nuclei in the monkey: evidence for site of induction of velocity storage

    Yokota, J.; Reisine, H.; Cohen, B.


    Electrical stimulation of the vestibular nuclei (VN) and prepositus hypoglossi nuclei (PPH) of alert cynomolgus monkeys evoked nystagmus and eye deviation while they were in darkness. At some sites in VN, nystagmus and after-nystagmus were induced with characteristics suggesting that velocity storage had been excited. We analyzed these responses and compared them to the slow component of optokinetic nystagmus (OKN) and to optokinetic after-nystagmus (OKAN). We then recorded unit activity in VN and determined which types of nystagmus would be evoked from the sites of recording. Nystagmus and eye deviations were also elicited by electrical stimulation of PPH, and we characterized the responses where unit activity was recorded in PPH. Horizontal slow phase velocity of the VN "storage" responses was contralateral to the side of stimulation. The rising time constants and peak steady-state velocities were similar to those of OKN, and the falling time constants of the after-nystagmus and of OKAN were approximately equal. Both the induced after-nystagmus and OKAN were habituated by stimulation of the VN. When horizontal after-nystagmus was evoked with animals on their sides, it developed yaw and pitch components that tended to shift the vector of the slow phase velocity toward the spatial vertical. Similar "cross-coupling" occurs for horizontal OKAN or for vestibular post-rotatory nystagmus elicited in tilted positions. Thus, the storage component of nystagmus induced by VN stimulation had the same characteristics as the slow component of OKN and the VOR. Positive stimulus sites for inducing nystagmus with typical storage components were located in rostral portions of VN. They lay in caudal ventral superior vestibular nucleus (SVN), dorsal portions of central medial vestibular nucleus (MVN) caudal to the abducens nuclei and in adjacent lateral vestibular nucleus (LVN). More complex stimulus responses, but with contralateral after-nystagmus, were induced from surrounding

  17. Late magmatic stage of the zoned Caleu pluton (Central Chile): insights from zircon crystallization conditions

    Molina, P. G.; Parada, M.; Gutierrez, F. J.; Chang-Qiang, M.; Jianwei, L.; Yuanyuan, L.


    The Caleu pluton consists of three N-S elongated lithological zones: Gabbro-Diorite Zone (GDZ), Tonalite Zone (TZ) and Granodiorite Zone (GZ); western, middle and eastern portions of the pluton, respectively. The zones are thought to be previously differentiated in a common, isotopically depleted (Sr-Nd), subjacent magma reservoir at a 4 kbar equivalent depth. The emplacement should have occurred at the climax of the Cretaceous rifting. We present preliminary results of U238/Pb206 zircon geochronology; zircon saturation, Tsat(Zrn), and crystallization temperatures (Ti-in-Zrn); as well as relative oxidation states at time of crystallization, based on: (i) the sluggish REE and HFSE subsolidus diffusivities in zircon; (ii) the behavior of Ti4+↔Si4+ and Ce4+↔Zr4+ isovalent replacement, in addition to a constrained TiO2 activity in almost all typical crustal rocks; and (iii) relative oxidation states at time of crystallization, respectively. The latter are obtained by interpolation of the partition coefficients of trivalent (REE) and tetravalent (HFSE) curves in Onuma diagrams for each zircon, and then estimating relative Ce(IV)/Ce(III) ratios. Results obtained from 4 samples (a total of 77 zircon grains) collected from the three mentioned lithological zones indicate U/Pb ages of approximately 99.5 ±1.5 Ma, 96.8 ±0.6 Ma, and 94.4 +2.2 -0.8 Ma; and Ti-in Zrn ranges of ca. 720-870°C, ca. 680-820°C and ca. 750-840°C, for the GDZ, TZ and GZ samples, respectively. On the other hand Tsat(Zrn) of ca. 750-780°C in the TZ, and ca. 830-890°C in the GZ, were obtained. As expected saturation temperatures are similar or higher than Ti-in-Zrn obtained in zircon grains of TZ and GZ, respectively. Cathodoluminiscence images in zircon suggest a magmatic origin, due to absence of complex zoning patterns and fairly well conserved morphologies. Exceptionally the GDZ sample zircons show evidence of inheritance, indicating a xenocrystic and/or antecrystic origin. A relative Ce

  18. A chimeric vitronectin: IGF-I protein supports feeder-cell-free and serum-free culture of human embryonic stem cells.

    Manton, Kerry J; Richards, Sean; Van Lonkhuyzen, Derek; Cormack, Luke; Leavesley, David; Upton, Zee


    The therapeutic use of human embryonic stem (hES) cells is severely limited by safety concerns regarding their culture in media containing animal-derived or nondefined factors and on animal-derived feeder cells. Thus, there is a pressing need to develop culture techniques that are xeno-free, fully defined, and synthetic. Our laboratory has discovered that insulin-like growth factor (IGF) and vitronectin (VN) bind to each other resulting in synergistic short-term functional effects in several cell types, including keratinocytes and breast epithelial cells. We have further refined this complex into a single chimeric VN:IGF-I protein that functionally mimics the effects obtained upon binding of IGF-I to VN. The aim of the current study was to determine whether hES cells can be serially propagated in feeder-cell-free and serum-free conditions using medium containing our novel chimeric VN:IGF-I protein. Here we demonstrate that hES cells can be serially propagated and retain their undifferentiated state in vitro for up to 35 passages in our feeder-cell-free, serum-free, chemically defined media. We have utilized real-time polymerase chain reaction (PCR), immunofluorescence, and fluorescence-activated cell sorter (FACS) analysis to show that the hES cells have maintained an undifferentiated phenotype. In vitro differentiation assays demonstrated that the hES cells retain their pluripotent potential and the karyotype of the hES cells remains unchanged. This study demonstrates that the novel, fully defined, synthetic VN:IGF-I chimera-containing medium described herein is a viable alternative to media containing serum, and that in conjunction with laminin-coated plates facilitates feeder-cell-free and serum-free growth of hES.

  19. The role of cervical and ocular vestibular-evoked myogenic potentials in the follow-up of vestibular neuritis.

    Adamec, Ivan; Skorić, Magdalena Krbot; Handžić, Jadranka; Barušić, Anabella Karla; Bach, Ivo; Gabelić, Tereza; Habek, Mario


    This study evaluates the recovery of vestibular nerve function after vestibular neuritis (VN) by vestibular-evoked myogenic potentials (VEMPs). Twenty-six patients with the diagnosis of VN were included. All patients underwent ocular VEMP (oVEMP) and cervical VEMP (cVEMP) recordings, at 6 days and 6 months from the onset of the symptoms. Of the 26 patients, 14 showed improvement on oVEMP at month 6 (group 1), and 12 showed no change or worsening on oVEMP at 6 months (group 2). At the same time, there was no change in the amplitudes of the cVEMP on either healthy or affected sides in both groups. Inability to perform the Fukuda test, and chronic white matter supratentorial lesions present on brain magnetic resonance imaging (MRI) were more frequent in patients with worse outcome on oVEMP (P = 0.044 and 0.045, respectively). Although involvement of the inferior branch of the vestibular nerve was not associated with oVEMP outcome, oVEMP latencies (N10 and P13) were associated with improvement or worsening in oVEMP amplitudes, showing that prolonged latencies correlate with 6-month improvement in oVEMP amplitudes (Pearson correlation -0.472, P = 0.041 and -0.580, P = 0.009, respectively). This study identified clinical, MRI and neurophysiological predictors of recovery in patients with superior VN, and offers additional insight into, and better understanding of, the role of VEMP in diagnosis and prognosis of patients with VN. Further studies are needed to validate this diagnostic procedure and to assess its clinical usefulness in VN management.

  20. Application of π acceptors to the spectrophotometric and spectrofluorimetric determination of vincamine and naftidrofuryl oxalate in their pharmaceutical preparations.

    Ibrahim, Fawzia A; Elbrashy, Amina M; Nasr, Jenny Jeehan M; Badr El-Dien, Mostafa M


    Three different spectrophotometric and two spectrofluorimetric methods have been developed and validated for the determination of vincamine (VN) and naftidrofuryl oxalate (NF) in tablets. The spectrophotometric methods depend on charge transfer complex formation between each of VN and NF with 7,7,8,8-tetracyano-quinodimethane (TCNQ), 2,6-dichloroquinone-4-chloroimide (DCQ) and 2,3-dichloro-5,6-dicyano-1,4-benzoquinone (DDQ) at 843, 580 and 588 nm, respectively. The spectrofluorimetric methods are based on the formation of charge transfer complex between each of the two drugs and TCNQ, with measurement of the fluorophore formed at 312/375 and 284/612 nm, respectively, or with DDQ at 400/475 and 284/396 nm, respectively. In the spectrophotometric measurements, Beer's law was obeyed at concentration ranges of 1.5-16, 10-180 and 12-140 μg/ml for VN with TCNQ, DCQ, and DDQ, respectively. For NF, the corresponding concentrations were 2-28, 5-75 and 25-150 μg/ml with TCNQ, DCQ, and DDQ, respectively. In the spectrofluorimetric measurements, the ranges for VN were 0.05-0.9 and 0.3-4 μg/ml with TCNQ and DDQ, respectively, whereas for NF the ranges were 0.05-0.85 and 0.5-8 μg/ml with TCNQ and DDQ, respectively. The different experimental parameters affecting the development and stability of the formed color or fluorophore were studied and optimized and the molar ratios of the complexes were calculated. The proposed methods were validated according to ICH guidelines and were successfully applied for the determination of VN and NF in their tablet dosage forms.

  1. Significant neutralizing activities against H2N2 influenza A viruses in human intravenous immunoglobulin lots manufactured from 1993 to 2010

    Ikuta K


    Full Text Available Ritsuko Kubota-Koketsu,1,2 Mikihiro Yunoki,2,3 Yoshinobu Okuno,1 Kazuyoshi Ikuta21Kanonji Institute, The Research Foundation for Microbial Diseases of Osaka University, Kagawa; 2Department of Virology, Research Institute for Microbial Diseases, Osaka University, 3Pathogenic Risk Management, Benesis Corporation, Osaka, JapanAbstract: Influenza A H2N2 virus, also known as the Asian flu, spread worldwide from 1957 to 1967, although there have been no cases reported in humans in the past 40 years. A vaccination program was introduced in Japan in the 1960s. Older Japanese donors could have been naturally infected with the H2N2 virus or vaccinated in the early 1960s. Human intravenous immunoglobulin (IVIG reflects the epidemiological status of the donating population in a given time period. Here, the possible viral neutralizing (VN activities of IVIG against the H2N2 virus were examined. Hemagglutination inhibition (HI and VN activities of IVIG lots manufactured from 1993 to 2010 in Japan and the United States were evaluated against H2N2 viruses. High HI and VN activities against H2N2 viruses were found in all the IVIG lots investigated. HI titers were 32–64 against the isolate in 1957 and 64–128 against the isolates in 1965. VN titers were 80–320 against the isolate in 1957 and 1280–5120 against the isolates in 1965. Both the HI and VN titers were higher against the isolate in 1965 than in 1957. Thus, antibody titers of IVIG against influenza viruses are well correlated with the history of infection and the vaccine program in Japan. Therefore, evaluation of antibody titers provides valuable information about IVIGs, which could be used for immune stimulation when a new influenza virus emerges in the human population.Keywords: IVIG, influenza, H2N2, neutralization

  2. Boron effect on the microstructure of 9% Cr ferritic–martensitic steels

    Klimenkov, M., E-mail:; Materna-Morris, E.; Möslang, A.


    Highlights: • Detailed TEM characterization of BN, M{sub 23}C{sub 6}, VN and TaC precipitates in B-alloyed EUROFER97. • Determination of B content influence on density and composition of M{sub 23}C{sub 6} and MX precipitates and herewith on microstructure. • α-Al{sub 2}O{sub 3}–BN–TaC–VN precipitation sequence of different phases during cooling was proposed. • Decreasing of thermal stability of microstructure with boron content was measured. - Abstract: The microstructure of reduces-activation 9Cr–WTaV steel alloyed with 83 and 1160 wt. ppm {sup 10}B was detailed analysed using transmission electron microscopy. The influence of boron content on the precipitation behaviour of M{sub 23}C{sub 6} and MX (VN and TaC) phases and, hence, on the formation process of steel’s grain and lath structure was studied. VN precipitates, which play an important role in the stabilisation of the lath structure, exhibit most sensitive reaction on presence of boron. Their spatial density significantly reduces in the alloy with 83 ppm boron. In the steel with 1160 wt. ppm boron, no formation of VN was detected, whereas TaC particles precipitate at the lath and grain boundaries. These changes in the structure stabilisation mechanism lead to an increasing lath width and a decreasing thermal stability of laths and grains. Analytical investigations of several BN particles reveal their complex multi-phase structure and allow conclusions to be drawn with respect to their precipitation sequence.

  3. Dicty_cDB: CHA290 [Dicty_cDB

    Full Text Available CH (Link to library) CHA290 (Link to dictyBase) - - - Contig-U16397-1 - (Link to Original site) - - CHA29...0Z 209 - - - - Show CHA290 Library CH (Link to library) Clone ID CHA290 (Link to Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHA290 (CHA290Q) /CSM/CH/CHA2-D/CHA290Q.Seq.d/ XXXXXXXXXXTGATGAA...hfn dkg*xxxs Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHA290 (CHA29

  4. Anisotropic thermoelectric properties in layered complex nitrides with α-NaFeO2-type structure

    Isao Ohkubo


    Full Text Available Electronic structures and thermoelectric transport properties of α-NaFeO2-type d0-electron layered complex nitrides AMN2 (A = Sr or Na; M = Zr, Hf, Nb, Ta were evaluated using density-functional theory and Boltzmann theory calculations. Despite the layered crystal structure, all materials had three-dimensional electronic structures. Sr(Zr, HfN2 exhibited isotropic electronic transport properties because of the contribution of the Sr 4d orbitals to the conduction band minimums (CBMs in addition to that of the Zr 4d (Hf 5d orbitals. Na(Nb,TaN2 showed weak anisotropic electronic transport properties due to the main contribution of the Nb 4d (Ta 5d and N 2p orbitals to the CBMs and no contribution of the Na orbitals.

  5. Description of 178 Hfm2 in the Constrained Relativistic Mean Field Theory

    ZHANG Wei; PENG Jing; ZHANG Shuang-Quan


    Properties of the ground state of 178 Hf and the isomeric state 178Hfn2 are studied within the adiabatic and diabatic constrained relativistic mean field (RMF) approaches. The RMF calculations reproduce well the binding energy and the deformation for the ground state of 178Hf. Using the ground state single-particle eigenvalues obtained in the present calculation, the lowest excitation configuration with Kπ = 16+ is found to be v(7/2- [514])-1 (9/2+ [624])1 π(7/2+ [404])-1 (9/2-[514])1. Its excitation energy calculated by the RMF theory with time-odd fields taken into account is equal to 2.801 MeV, i.e., close to the 178 Hfm2 experimental excitation energy 2.446 MeV. The self-consistent procedure accounting for the time-odd component of the meson fields is the most important aspect of the present calculation.

  6. Anisotropic thermoelectric properties in layered complex nitrides with α-NaFeO2-type structure

    Ohkubo, Isao; Mori, Takao


    Electronic structures and thermoelectric transport properties of α-NaFeO2-type d0-electron layered complex nitrides AMN2 (A = Sr or Na; M = Zr, Hf, Nb, Ta) were evaluated using density-functional theory and Boltzmann theory calculations. Despite the layered crystal structure, all materials had three-dimensional electronic structures. Sr(Zr, Hf)N2 exhibited isotropic electronic transport properties because of the contribution of the Sr 4d orbitals to the conduction band minimums (CBMs) in addition to that of the Zr 4d (Hf 5d) orbitals. Na(Nb,Ta)N2 showed weak anisotropic electronic transport properties due to the main contribution of the Nb 4d (Ta 5d) and N 2p orbitals to the CBMs and no contribution of the Na orbitals.

  7. Failure of a dietary model to affect markers of inflammation in domestic cats.

    Verbrugghe, Adronie; Janssens, Geert P J; Van de Velde, Hannelore; Cox, Eric; De Smet, Stefaan; Vlaeminck, Bruno; Hesta, Myriam


    Oxidative stress and inflammation can be altered by dietary factors in various species. However, little data are available in true carnivorous species such as domestic cats. As numerous anti-inflammatory and anti-oxidative additives become available and might be of use in cats with chronic low-grade inflammatory diseases, the current study aimed to develop a model of diet-induced inflammation by use of two opposite diets. It was hypothesized that a high fat diet enhanced in n-6 PUFA and with lower concentrations of antioxidants would evoke inflammation and oxidative stress in domestic cats. Sixteen healthy adult cats were allocated to two groups. One group received a moderate fat diet, containing pork lard and salmon oil (AA:(EPA + DHA) ratio 0.19) (MFn-3), while the other group was fed a high fat diet, containing pork lard and chicken fat (AA:(EPA + DHA) ratio 2.06) (HFn-6) for 12 weeks. Prior to and 2, 4, 6, 8, 10 and 12 weeks after starting the testing period, blood samples were collected. Erythrocytic fatty acid profile showed clear alterations in accordance to the dietary fatty acid profile. Serum thiobarbituric acid reactive substances was higher when fed MFn-3 compared to the HFn-6, suggesting augmented oxidative stress. This was associated with a reduced serum vitamin E status, as serum α-tocopherol concentrations were lower with MFn-3, even with higher dietary levels of vitamin E. Serum cytokine and serum amyloid A concentrations were not influenced by diet. These results point towards a resistance of cats to develop dietary fat-induced inflammation, but also suggest a high susceptibility to oxidative stress when fed a fish oil-supplemented diet even with moderate fat level and additional vitamin E.

  8. Post-exercise heart-rate recovery correlates to resting heart-rate variability in healthy men.

    Molina, Guilherme Eckhardt; Fontana, Keila Elizabeth; Porto, Luiz Guilherme Grossi; Junqueira, Luiz Fernando


    The relationship between post-exercise heart-rate recovery (HRR) and resting cardiac autonomic modulation is an incompletely explored issue. To correlate HRR with resting supine and orthostatic autonomic status. HRR at the 1st, 3th, and 5th min following maximal treadmill exercise were correlated with 5-min time-domain (CV, pNN50 and rMSSD) and frequency-domain (TP, LF, HF, LFn, HFn, and LF/HF ratio) indices of heart-rate variability (HRV) in both supine and standing positions in 31 healthy physically active non-athletes men. Statistical analysis employed non-parametric tests with two-tailed p value set at 5 %. Absolute HRR and Δ %HRR at each post-exercise time did not correlated with HRV in supine position, as well as at 1st min in standing position. At the 3rd min and 5th min, these measures negatively correlated with pNN50, rMSSD, TP, and HF indices, and only in the 5th min, they showed negative correlation with HFn and positive correlation with LF, LFn, and LF/HF ratio in the standing position. Coefficient of HRR (CHRR) at the 1st min negatively correlated with pNN50 and rMSSD and at 3rd and 5th min showed positive correlation with LFn and LF/HF ratio in supine position. With HRV indices in standing position CHRR from the 1st to 5th min showed the same respective negative and positive correlations as the other measures. HRR from the 1st to 5th min post-exercise negatively correlated with parasympathetic modulation in resting orthostatic, but showed no correlation in supine position. At the 3rd and 5th min, a positive correlation with combined sympathetic-parasympathetic modulation in both positions was observed.

  9. Light and heavy fractions of soil organic matter in response to climate warming and increased precipitation in a temperate steppe.

    Song, Bing; Niu, Shuli; Zhang, Zhe; Yang, Haijun; Li, Linghao; Wan, Shiqiang


    Soil is one of the most important carbon (C) and nitrogen (N) pools and plays a crucial role in ecosystem C and N cycling. Climate change profoundly affects soil C and N storage via changing C and N inputs and outputs. However, the influences of climate warming and changing precipitation regime on labile and recalcitrant fractions of soil organic C and N remain unclear. Here, we investigated soil labile and recalcitrant C and N under 6 years' treatments of experimental warming and increased precipitation in a temperate steppe in Northern China. We measured soil light fraction C (LFC) and N (LFN), microbial biomass C (MBC) and N (MBN), dissolved organic C (DOC) and heavy fraction C (HFC) and N (HFN). The results showed that increased precipitation significantly stimulated soil LFC and LFN by 16.1% and 18.5%, respectively, and increased LFC:HFC ratio and LFN:HFN ratio, suggesting that increased precipitation transferred more soil organic carbon into the quick-decayed carbon pool. Experimental warming reduced soil labile C (LFC, MBC, and DOC). In contrast, soil heavy fraction C and N, and total C and N were not significantly impacted by increased precipitation or warming. Soil labile C significantly correlated with gross ecosystem productivity, ecosystem respiration and soil respiration, but not with soil moisture and temperature, suggesting that biotic processes rather than abiotic factors determine variations in soil labile C. Our results indicate that certain soil carbon fraction is sensitive to climate change in the temperate steppe, which may in turn impact ecosystem carbon fluxes in response and feedback to climate change.

  10. Anisotropic high-k deposition for gate-last processing of metal-oxide-semiconductor field-effect transistor utilizing electron-cyclotron-resonance plasma sputtering

    Kikuchi, Yoshiaki, E-mail:; Gao, Jun; Sano, Takahiro; Ohmi, Shun-ichiro, E-mail:


    A high-k/metal gate structure has been investigated for application to state-of-the-art metal-oxide-semiconductor field-effect transistors. In the high-k/metal gate structure, the 32-nm technology node was realized by using the high-k-last, metal-last integration process. We investigated anisotropic deposition for 3-dimensional gate structures on Si substrates utilizing electron-cyclotron-resonance plasma sputtering to reduce parasitic capacitance. Anisotropic HfN film deposition was realized and the deposition thickness on the side wall was reduced with decreasing sputtering gas pressure, from 0.15 to 0.06 Pa, corresponding to Ar/N{sub 2} flow ratios of 20/1 and 5/1 sccm. The HfSiON gate insulator formed from the anisotropically deposited HfN film showed an equivalent-oxide-thickness of 2.1 nm and a gate leakage of 3.1 Multiplication-Sign 10{sup -6}A/cm{sup 2} at V{sub FB}-1.0. - Highlights: Black-Right-Pointing-Pointer High-k film deposition was controlled by the deposition pressure. Black-Right-Pointing-Pointer The pressure decreases with a reduction of gas flow rate during the high-k film deposition. Black-Right-Pointing-Pointer A flat band voltage shows negative shifts with reduction of gas flow rates. Black-Right-Pointing-Pointer A reason of the flat band voltage shift is an increase in Si-N bonding.

  11. Structure and Topology Dynamics of Hyper-Frequency Networks during Rest and Auditory Oddball Performance.

    Müller, Viktor; Perdikis, Dionysios; von Oertzen, Timo; Sleimen-Malkoun, Rita; Jirsa, Viktor; Lindenberger, Ulman


    Resting-state and task-related recordings are characterized by oscillatory brain activity and widely distributed networks of synchronized oscillatory circuits. Electroencephalographic recordings (EEG) were used to assess network structure and network dynamics during resting state with eyes open and closed, and auditory oddball performance through phase synchronization between EEG channels. For this assessment, we constructed a hyper-frequency network (HFN) based on within- and cross-frequency coupling (WFC and CFC, respectively) at 10 oscillation frequencies ranging between 2 and 20 Hz. We found that CFC generally differentiates between task conditions better than WFC. CFC was the highest during resting state with eyes open. Using a graph-theoretical approach (GTA), we found that HFNs possess small-world network (SWN) topology with a slight tendency to random network characteristics. Moreover, analysis of the temporal fluctuations of HFNs revealed specific network topology dynamics (NTD), i.e., temporal changes of different graph-theoretical measures such as strength, clustering coefficient, characteristic path length (CPL), local, and global efficiency determined for HFNs at different time windows. The different topology metrics showed significant differences between conditions in the mean and standard deviation of these metrics both across time and nodes. In addition, using an artificial neural network approach, we found stimulus-related dynamics that varied across the different network topology metrics. We conclude that functional connectivity dynamics (FCD), or NTD, which was found using the HFN approach during rest and stimulus processing, reflects temporal and topological changes in the functional organization and reorganization of neuronal cell assemblies.

  12. [Vestibular neurotomy versus chemical labyrinthectomy for disabling Menière disease].

    Morel, N; Dumas, G; Nguyen, D-Q; Mohr, E; Hitter, A; Schmerber, S


    To evaluate the efficiency on the vertigos and the impact on the audition of the vestibular neurotomy (VN) and the chemical labyrinthectomy (CL) in patients with severe Menière's disease, in order to determine the precise place for each technique in treatment algorithm. Retrospective study of 71 VN (performed between 1986 and 2003) and 35 CL (performed between 1997 and 2003). These two treatments both aim at obtaining a vestibular deafferentation in order to free definitely the patient of vertigo manifestations. Vestibular results have been assessed by caloric tests performed before and 6 months after treatment. Subjective success was evaluated by searching for recurrent attacks of vertigo and by the AAO-HNS (American Academy of Otolaryngology-Head and Neck Society) scale of subjective evaluation of vertigos (follow-up of 6.4 years after VN and 2.4 years after CL). Pure tone audiometry before treatment and then 6 months later was performed. Complications of two types of treatment were recorded and evaluated. In 90% of the cases after VN and 86% of the cases after CL, caloric tests indicated a strong vestibular hyporeflexy (hypovalence > 90%). Attacks of vertigo reoccurred in 5.6% of the cases when the hyporeflexy was strong and 85.7% of the cases when it was weak. The quality of the vestibular results on vertigo depends on the degree of hypovalence after treatment. An improvement of the AAO-HNS scale have been obtained in 93% of the cases in the NV group and in 81% of the cases in the LC group. Attacks of vertigo were recurrent in 7% of the patients operated on by VN and 11.4% of the patients treated by CL. Mean pure tone auditory thresholds changed from 50.24 dB HL to 55.64 dB HL (p=0.003) in the VN group and from 69.11 dB HL to 74.51 dB HL (p=0.41) in the CL group. Comparison of the variations of the mean pure tone auditory thresholds before treatment and 6 months after the end of the treatment doesn't show any significant difference between the 2 groups (p > 0




    Full Text Available El objetivo de esta investigación es estudiar la influencia de la configuración del campo magnético sobre los parámetros del plasma y algunas propiedades de recubrimientos de TaN, TiN, NbN, ZrN y CrN producidos con un sistema de sputtering con magnetrón desbalanceado (UBM. Este sistema permite modificar la densidad de corriente iónica y la energía de los iones que llegan al substrato por medio de la variación en la configuración del campo magnético sin modificar otras condiciones del depósito. Las diferentes configuraciones del campo magnético se cuantificaron a través del coeficiente de desbalance, KG, el cual es proporcional a la posición del punto de campo cero del magnetrón. El efecto más importante del aumento del bombardeo iónico al variar la configuración del campo magnético se observó en la microestructura de las películas, particularmente en la orientación preferencial. Usando la configuración KG = 1.3, se observó la orientación preferencial [200] en todos los recubrimientos. Sin embargo, cuando KG = 0.85 la respuesta fue diferente para cada material. Otra consecuencia del aumento del bombardeo iónico fue el aumento de los esfuerzos residuales de compresión que resultó mayor para las películas de TaN, mientras que en las películas de CrN se obtuvo la menor concentración de esfuerzos. Las durezas más altas se observaron en las películas de TaN, NbN y ZrN, la mejor resistencia a la corrosión en las películas de ZrN y la mejor resistencia al desgaste en las películas de NbN.

  14. Sample-scale zircon geochemical and geochronological heterogeneities as indicators of residual liquid infiltration events in the incrementally assembled Caleu Pluton, Central Chile

    Molina, P. G.; Parada, M. A.; Gutiérrez, F. J.; Ma, C.; Li, J.; Liu, Y.


    The Upper Cretaceous metaluminous Caleu Pluton is emplaced at a depth equivalent of 2kbar and consists of four lithological zones: the Gabbro-Dioritic Zone (GDZ), the Quartz-Monzodioritic Zone (QMDZ), the Granodioritic Zone (GZ) and the Monzogranitic Zone (MGZ). The zones would have been fed from a deeper magma reservoir emplaced at a 4 kbar. U238/Pb206 LA-ICP-MS geochronology of zircon grains of the four lithological zones (82 analyzed spots, 4 samples) indicates a maximum zircon crystallization range of ca. 106-91 Ma for the pluton as a whole. The U-Pb zircon age distribution of the four samples shows three inflection points at about 101, 99 and 96 Ma, separating four zircon crystallization events with the following weighted average ages and 2σ confidence intervals: 103.×1.6 Ma (n=4), 100.3×0.68 Ma (n=14), 97.49×0.49 Ma (n=25) and 94.66×0.44 Ma (n=30). The GDZ sample records the first three events, the GZ and QMDZ samples record the last three events while the MGZ only have zircons formed during the last two events. It is interesting to note that the youngest event of zircon formation coincide with the Ar/Ar cooling ages (95-93 Ma) previously obtained in hornblende, biotite and plagioclase of the four lithological zones, as a consequence of a rapid pluton exhumation. Temperatures of zircon crystallization (Ti-in-Zrn) obtained in each sample are variable and roughly lower than the zircon saturation temperatures. Most of the Ti-in-Zrn temperatures indicate late-stage crystallization conditions, consistent with the calculated melt composition from which zircons would have crystallized and the observed coexistence of zircons with quartz-orthoclase symplectites, hornblende and interstitial anhedral biotite. There are variable and overlapped total incompatible element concentrations in zircons of the four lithological zones regardless its age and Ti-in-Zrn temperatures, indicating that the melts from which zircon crystallized at different moments, were equivalent

  15. (tert-Butylimidobis(η5-cyclopentadienylpyridinezirconium(IV

    Katharina Kaleta


    Full Text Available The title compound, [Zr(C5H52(C4H9N(C5H5N], was obtained from the reaction of (C5H52Zr(py(η2-Me3SiC2SiMe3 (py is pyridine and tBuN=C=NtBu alongside the formation of (C5H52Zr(CNtBu(η2-Me3SiC2SiMe3. The zirconium atom is coordinated in a distorted tetrahedral geometry by two cyclopentadienyl ligands, a pyridine ligand, and a tert-butylimido ligand via a Zr=N double bond. The tert-butyl group is disordered over two positions in a 0.634 (5:0.366 (5 ratio.

  16. Determination of the fission-neutron averaged cross sections of some high-energy threshold reactions of interest for reactor dosimetry

    Arribere, M A; Ribeiro-Guevara, S; Korochinsky, S; Blostein, J J


    For three high threshold reactions, we have measured the cross sections averaged over a sup 2 sup 3 sup 5 U fission neutron spectrum. The measured reactions, and corresponding averaged cross sections found, are: sup 1 sup 2 sup 7 I(n,2n) sup 1 sup 2 sup 6 I, (1.36+-0.12) mb; sup 9 sup 0 Zr(n,2n) sup 8 sup 9 sup m Zr, (13.86+-0.83) mu b; and sup 5 sup 8 Ni(n,d+np+pn) sup 5 sup 7 Co, (274+-15) mu b; all referred to the well known standard of (111+-3) mb for the sup 5 sup 8 Ni(n,p) sup 5 sup 8 sup m sup + sup g Co averaged cross section. The measured cross sections are of interest in nuclear engineering for the characterization of the fast neutron component in the energy distribution of reactor neutrons. (author)

  17. Measurement of thermal neutron capture cross section

    Huang Xiao Long; LuHanLin; Yu Wei Xiang; Zhao Wen Rong


    The thermal neutron capture cross sections of sup 7 sup 1 Ga(n, gamma) sup 7 sup 2 Ga, sup 9 sup 4 Zr(n, gamma) sup 9 sup 5 Zr and sup 1 sup 9 sup 1 Ir(n, gamma) sup 1 sup 9 sup 2 Ir sup m sup 1 sup + sup g sup , sup m sup 2 reactions were measured by using activation method and compared with other measured data. Meanwhile the half-life of sup 7 sup 2 Ga was also measured. The samples were irradiated with the neutron in the thermal column of heavy water reactor of China Institute of Atomic Energy. The activities of the reaction products were measured by well-calibrated Ge(Li) detector

  18. Evaluation Study for the Production of the Medical Isotope ^90Y, using a Cyclotron

    Necsoiu, D.; Morgan, I. L.; Hupf, Homer; Armbruster, J.; Boyce, D.; El Bouanani, M.; McDaniel, F. D.


    The use of radioisotopes in therapy, medical imaging and laboratory tests is well-established worldwide. ^90Y is a very good therapeutic candidate for radioimmunotherapy applications. Traditionally, medical radioisotopes are produced using either nuclear reactors or proton accelerators. In this study, the medical isotope ^90Y has been produced using ^90Zr(n,p)^90Y nuclear reaction. Neutrons for the activation process were produced using ^natRh(p,xn) reaction with a 27 MeV proton beam from a cyclotron. Since ^90Y is a pure beta emitter, the gamma rays from the ^90Zr(n,2n)^89Zr reaction were used to quantify the incident neutron flux on the ^90Zr sample. Experimental results of the neutron production and ^90Y activity are presented.

  19. The role of subsurface oxygen in the local oxidation of zirconium and zirconium nitride thin films

    Farkas, N.; Zhang, G.; Donnelly, K.M.; Evans, E.A.; Ramsier, R.D.; Dagata, J.A


    This paper discusses the growth kinetics of nanometer scale oxide structures grown by atomic force microscope (AFM) assisted lithography. The addition of nitrogen into the sputtering gas during zirconium deposition results in a crystalline ZrN material with oxygen held in solid solution. The diffusion rate of oxygen is high through the crystalline material, allowing it to participate in local anodization and resulting in tall oxide features at low relative humidity. These nanostructures are, in some cases, an order of magnitude higher than previously seen in other material systems. Higher nitrogen content in the plasma results in a crystalline to amorphous transition in the films, and the height enhancement of the AFM-grown features disappears. We propose that mass transport of subsurface oxygen has an influence on surface oxidation kinetics in this material system.

  20. High-temperature thermodynamic activities of zirconium in platinum alloys determined by nitrogen-nitride equilibria

    Goodman, D.A.


    A high-temperature nitrogen-nitride equilibrium apparatus is constructed for the study of alloy thermodynamics to 2300/sup 0/C. Zirconium-platinum alloys are studied by means of the reaction 9ZrN + 11Pt ..-->.. Zr/sub 9/Pt/sub 11/ + 9/2 N/sub 2/. Carful attention is paid to the problems of diffusion-limited reaction and ternary phase formation. The results of this study are and a/sub Zr//sup 1985/sup 0/C/ = 2.4 x 10/sup -4/ in Zr/sub 9/Pt/sub 11/ f 1985/sup 0/C//sup 0/ Zr/sub 9/Pt/sub 11/ less than or equal to -16.6 kcal/g atom. These results are in full accord with the valence bond theory developed by Engel and Brewer; this confirms their prediction of an unusual interaction of these alloys.

  1. Development of Enhanced, Permanently-Installed, Neutron Activation Diagnostic Hardware for NIF

    Edwards, E. R.; Jedlovec, D. R.; Carrera, J. A.; Yeamans, C. B.


    Neutron activation diagnostics are baseline neutron yield and flux measurement instruments at the National Ignition Facility. Up to 19 activation samples are distributed around the target chamber. Currently the samples must be removed to be counted, creating a 1-2 week data turn-around time and considerable labor costs. An improved system consisting of a commercially available LaBr3(Ce) scintillator and Power over Ethernet electronics is under development. A machined zirconium-702 cap over the detector is the activation medium to measure the 90Zr(n,2n)89Zr reaction. The detectors are located at the current neutron activation diagnostic sites and monitored remotely. Because they collect data in real time yield values are returned within a few hours after a NIF shot.

  2. Proceedings of the DTNSRDC (David W. Taylor Naval Ship Research and Development Center) Workshop on Ship Wave-Resistance Computations (2nd) Held at Bethesda, Maryland on 16-17 November 1983,


    the experimental error. Generally speaking , C^-Cy^^ is greater than C^ at Froude numbers less than 0.23. C^-C^^ is also compared with the...CI -1.0) 0 Vn/^x10-2 without wave efleds Fn«0.257 ■Fn-0.304 rL-Vy^xlO -2 (! =10) ■2-0 -1.0 0 J L X=0.1 1—^x10 -2 X-OJ Vn^ and round-ended hull forms, are reported. The second major motivation for the present preliminary wave-resistance calculations for simple hull

  3. 能抢滩的轮车——美国海军陆战队两栖突击车(ACV)



  4. Anisotropic flow studies with identified particles with ALICE: a tool to probe different stages of a heavy-ion collision

    CERN. Geneva


    Anisotropic flow studies play a crucial role in the characterization of the nature of the quark gluon plasma (QGP) created in collisions of heavy ions at ultra-relativistic energies. These studies rely on measuring the coefficients vn of the Fourier expansion of the azimuthal particle distribution. They have been essential in establishing that the QGP is a strongly coupled, almost perfect fluid. In this seminar, I review the latest results from measurements of elliptic (v2), triangular (v3), quadrangular (v4) and pentagonal (v5) flow of identified particles at the LHC measured with ALICE. I will discuss how these results allow us to gain insight into the transport properties of the QGP and the initial conditions of a heavy-ion collision. In addition, they reveal the role of different hadronisation mechanisms as well as the highly dissipative hadronic rescattering phase to the development of vn.

  5. Azimuthal correlations and mixed higher order flow harmonics from CMS at the LHC

    Stojanovic, Milan


    Two-particle correlations measurements of $v_{n}$ (n=2-4) in 8.16 TeV pPb collisions, and event-by-event correlations of different $v_{n}$ measured using symmetric cumulants in 13 TeV pp, 5.02 and 8.16TeV pPb and 5.02 TeV PbPb collisions at the LHC. These new results give important insights to the origin of collectivity observed in small collision systems. Additionally, using the scalar product method and the method of two-particle correlations, the mixed higher order flow harmonics and extracted nonlinear response coefficients of charged particles are measured for the first time as a function of $p_{T}$ and centrality in 2.76 and 5.02 TeV PbPb collisions. The obtained results are compared with different theoretical predictions.

  6. Development of a data assimilation algorithm

    Thomsen, Per Grove; Zlatev, Zahari


    assimilation technique is applied. Therefore, it is important to study the interplay between the three components of the variational data assimilation techniques as well as to apply powerful parallel computers in the computations. Some results obtained in the search for a good combination of numerical methods......, splitting techniques and optimization algorithms will be reported. Parallel techniques described in [V.N. Alexandrov, W. Owczarz, P.G. Thomsen, Z. Zlatev, Parallel runs of a large air pollution model on a grid of Sun computers, Mathematics and Computers in Simulation, 65 (2004) 557–577] are used in the runs....... Modules from a particular large-scale mathematical model, the Unified Danish Eulerian Model (UNI-DEM), are used in the experiments. The mathematical background of UNI-DEM is discussed in [V.N. Alexandrov,W. Owczarz, P.G. Thomsen, Z. Zlatev, Parallel runs of a large air pollution model on a grid of Sun...

  7. Worst-case-efficient dynamic arrays in practice

    Katajainen, Jyrki


    on their mutual superiority. Most library implementations only guarantee O(1) amortized cost per operation. Four variations with good worst-case performance were benchmarked: (1) resizable array relying on doubling, halving, and incremental copying; (2) level-wiseallocated pile; (3) sliced array with fixed......The basic operations of a dynamic array are operator[], push back, and pop back. This study is an examination of variations of dynamic arrays that support these operations at O(1) worst-case cost. In the literature, many solutions have been proposed, but little information is available......|n+O(|V*| lg n), |V|(n + S) + O(|V*|n/S), and |V|n + O((|V| + |V*| + |V**|) √n) bytes, respectively. A sliced array that uses a few per cent of extra space turned out to be a reasonable solution in practice. In general, for worst-case-efficient variations, the operations were measurably slower than those...

  8. Victor Nikolaevich Shitov (1947–2013

    Zeleneev Yuriy A.


    Full Text Available The article is dedicated to the memory of Victor Nikolaevich Shitov (October 1, 1947-October 31, 2013, who had been the intellectual leader of the archaeologists of the Republic of Mordovia for many years. The basic stages of his scientific biography are elucidated. The first independent studies conducted by V.N. Shitov were associated with the Shoksha burial ground referring to the Ryazan-Oka culture. Since then, the ancient Mordovian culture of the 1st millennium AD had been playing the dominant role in his studies. In 1976, V.N. Shitov became a research fellow of the sector of Archeology and Ethnography, the Mordovian Research Institute of language, literature, history and economics. The last period of his scientific activity was connected with the preparation and organizational work on the multi-volume edition “The archaeology of the Mordovian land”.

  9. Activation of noradrenergic neurons projecting to the diencephalon following central administration of histamine is mediated by H1 receptors.

    Fleckenstein, A E; Lookingland, K J; Moore, K E


    The effect of histamine on the activity of noradrenergic neurons terminating in discrete regions of the diencephalon was examined in male rats. Noradrenergic neuronal activity was estimated by measuring the concentration of norepinephrine and its metabolite 3-methoxy-4-hydroxyphenylethyleneglycol [MHPG] in the medial zona incerta [MZI] and in the dorsomedial [DMN], periventricular [PeVN] and medial preoptic hypothalamic nuclei [MPN]. The intracerebroventricular administration of histamine effected a time-related increase in MHPG concentrations in the MZI, DMN, PeVN and MPN; these effects were blocked by the H1 antagonist mepyramine but not the H2 antagonist zolantidine. Neither mepyramine nor zolantidine affected basal MHPG concentrations in any of the brain regions examined. These results indicate that central administration of histamine increases the activity of noradrenergic neurons projecting to the diencephalon via an action at H1 but not H2 receptors.

  10. Observation of correlated azimuthal anisotropy Fourier harmonics in pp and pPb collisions at the LHC

    Sirunyan, Albert M; et al.


    The azimuthal anisotropy Fourier coefficients ($v_n$) in 8.16 TeV pPb data are extracted via long-range two-particle correlations as a function of event multiplicity and compared to corresponding results in pp and PbPb collisions. Using a four-particle cumulant technique, $v_n$ correlations are measured for the first time in pp and pPb collisions. The $v_2$ and $v_4$ coefficients are found to be positively correlated in all collision systems. For high multiplicity pPb collisions an anticorrelation of $v_2$ and $v_3$ is observed, with a similar correlation strength as in PbPb data at the same multiplicity. The new correlation results strengthen the case for a common origin of the collectivity seen in pPb and PbPb collisions in the measured multiplicity range.

  11. Copper(II) ions increase plasminogen activator inhibitor type 1 dynamics in key structural regions that govern stability

    Bucci, Joel C; Trelle, Morten Beck; McClintock, Carlee S;


    demonstrated that Cu(II) and other transition metals modulate the stability of PAI-1, exhibiting effects that are dependent on the presence or absence of the somatomedin B (SMB) domain of VN. The study presented here dissects the changes in molecular dynamics underlying the destabilizing effects of Cu...... effects are not a result of coordination of Cu(II) to these histidine residues. Finally, addition of Cu(II) results in an acceleration of the local unfolding kinetics of PAI-1 presumed to be on pathway to the latency conversion. The effect of ligands on the dynamics of PAI-1 adds another intriguing......Plasminogen activator inhibitor type 1 (PAI-1) regulates the fibrinolysis pathway by inhibiting the protease activity of plasminogen activators. PAI-1 works in concert with vitronectin (VN), an extracellular protein that aids in localization of active PAI-1 to tissues. The Peterson laboratory...

  12. Converting an Unstructured Quadrilateral/Hexahedral Mesh to a Rational T-spline


    For the sake of integration of engineering design and analy- sis, isogeometric analysis was proposed [4, 1] which utilizes NURBS (Non-Uniform Rational B...results, and Section 7 draws conclusions. 2 Rational T-spline T-splines [13] are generalized from NURBS [8], the prevail- ing industrial standard for...and v= [v0,v1, · · · ,vn+d ,vn+d+1], the NURBS surface is defined as SN(u,v) = m ∑ i=0 n ∑ j=0 Ci jwi jNi,d(u)N j,d(v) m ∑ i=0 n ∑ j=0 wi jNi,d(u)N j,d

  13. Compositional Models for Video Event Detection: A Multiple Kernel Learning Latent Variable Approach (Open Access)


    then formulated as: min w,b,ξ≥0,d≥0 1 2 ∑ i wTi wi + ρ ∑ n ξn + λ 2 ∑ i d2i (2) s.t. yn(max v∈Vn ∑ i √ diw T i Ψi(xn,v) + b) ≥ 1− ξn ∀n, where λ is a...min w,b,ξ≥0,d≥0 1 2 ∑ i wTi wi di + ρ ∑ n ξn + λ 2 ∑ i d2i (3) s.t. yn( ∑ i wTi Ψi(xn,v) + b) ≥ 1− ξn ∀n, ∀v ∈ Vn The objective function in Eq. 3


    Zhilyaev, S Yu; Moskvin, A N; Platonova, T F; Demchenko, I T


    The activation of autonomic afferents (achieved through the vagus nerve (VN) electrical stimulation) on CNS O2 toxicity and cardiovascular function was investigated. In conscious rabbits at 5 ATA 02, prodromal signs of CNS O2 toxicity and convulsion latency were determined with and without vagus nerve (VN) stimulation. EEG, ECG and respiration were also recorded. In rabbits at 5 ATA, sympathetic overdrive and specific patterns on the EEG (synchronization of slow-waves), ECG (tachycardia) and respiration (respiratory minute volume increase) preceded motor convulsions. Vagus nerve stimulation increased parasympathetic component of autonomic drive and significantly delayed prodromal signs of oxygen toxicity and convulsion latency. Autonomic afferent input to the brain is a novel target for preventing CNS toxicity in HBO2.

  15. Vagus Nerve and Vagus Nerve Stimulation, a Comprehensive Review: Part II.

    Yuan, Hsiangkuo; Silberstein, Stephen D


    The development of vagus nerve stimulation (VNS) began in the 19th century. Although it did not work well initially, it introduced the idea that led to many VNS-related animal studies for seizure control. In the 1990s, with the success of several early clinical trials, VNS was approved for the treatment of refractory epilepsy, and later for the refractory depression. To date, several novel electrical stimulating devices are being developed. New invasive devices are designed to automate the seizure control and for use in heart failure. Non-invasive transcutaneous devices, which stimulate auricular VN or carotid VN, are also undergoing clinical trials for treatment of epilepsy, pain, headache, and others. Noninvasive VNS (nVNS) exhibits greater safety profiles and seems similarly effective to their invasive counterpart. In this review, we discuss the history and development of VNS, as well as recent progress in invasive and nVNS.

  16. Longitudinal multiplicity fluctuations and flow decorrelations in Pb+Pb collisions with the ATLAS detector

    Derendarz, Dominik; The ATLAS collaboration


    A comprehensive study of decorrelations of flow harmonics vn is done for Pb+Pb collisions at 2.76 and 5.02 TeV. The decorrelation of vn between η1 and η2 is found to follow a linear dependence on the pseudorapidity separation |η1−η2| for v2−5, and shows a small but a measurable variation with the collision energy. Furthermore, the higher order moments of flow decorrelations are measured. The first measurement of non-linear mode-mixing effects between lower and higher order flow harmonics as a function of pseudorapidity is also presented. These results will help to constrain initial conditions along longitudinal direction and also help to understand the longitudinal evolution of the fireball.

  17. Measurement of the distributions of event-by-event flow harmonics in lead--lead collisions at $\\sqrt{s_{NN}}$=2.76 TeV with the ATLAS detector at the LHC

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdelalim, Ahmed Ali; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahles, Florian; Ahmad, Ashfaq; Ahsan, Mahsana; Aielli, Giulio; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Artamonov, Andrei; Artoni, Giacomo; Arutinov, David; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Axen, David; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Piyali; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Bardin, Dmitri; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartsch, Valeria; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battaglia, Andreas; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beale, Steven; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Becks, Karl-Heinz; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blocki, Jacek; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Boddy, Christopher Richard; Boehler, Michael; Boek, Jennifer; Boek, Thorsten Tobias; Boelaert, Nele; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Bohm, Jan; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Bolnet, Nayanka Myriam; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Bordoni, Stefania; Borer, Claudia; Borisov, Anatoly; Borissov, Guennadi; Borri, Marcello; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Bouchami, Jihene; Boudreau, Joseph; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boutouil, Sara; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozovic-Jelisavcic, Ivanka; Bracinik, Juraj; Branchini, Paolo; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Brelier, Bertrand; Bremer, Johan; Brendlinger, Kurt; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Broggi, Francesco; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brost, Elizabeth; Brown, Gareth; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchanan, James; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Budick, Burton; Bugge, Lars; Bulekov, Oleg; Bundock, Aaron Colin; Bunse, Moritz; Buran, Torleiv; Burckhart, Helfried; Burdin, Sergey; Burgess, Thomas; Burke, Stephen; Busato, Emmanuel; Büscher, Volker; Bussey, Peter; Buszello, Claus-Peter; Butler, Bart; Butler, John; Buttar, Craig; Butterworth, Jonathan; Buttinger, William; Byszewski, Marcin; Cabrera Urbán, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Caloi, Rita; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarri, Paolo; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Canale, Vincenzo; Canelli, Florencia; Canepa, Anadi; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capriotti, Daniele; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Antony; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Cascella, Michele; Caso, Carlo; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Cataldi, Gabriella; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caughron, Seth; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerqueira, Augusto Santiago; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chan, Kevin; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Chapman, John Wehrley; Charlton, Dave; Chavda, Vikash; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Shenjian; Chen, Xin; Chen, Yujiao; Cheng, Yangyang; Cheplakov, Alexander; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Cheung, Sing-Leung; Chevalier, Laurent; Chiarella, Vitaliano; Chiefari, Giovanni; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Choudalakis, Georgios; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christidi, Ilektra-Athanasia; Christov, Asen; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Ciapetti, Guido; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciocio, Alessandra; Cirilli, Manuela; Cirkovic, Predrag; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Clarke, Robert; Clemens, Jean-Claude; Clement, Benoit; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coelli, Simone; Coffey, Laurel; Cogan, Joshua Godfrey; Coggeshall, James; Colas, Jacques; Cole, Stephen; Colijn, Auke-Pieter; Collins, Neil; Collins-Tooth, Christopher; Collot, Johann; Colombo, Tommaso; Colon, German; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cooper-Smith, Neil; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Côté, David; Cottin, Giovanna; Courneyea, Lorraine; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cristinziani, Markus; Crosetti, Giovanni; Cuciuc, Constantin-Mihai; Cuenca Almenar, Cristóbal; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Curtis, Chris; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; D'Orazio, Alessia; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Damiani, Daniel; Daniells, Andrew Christopher; Danielsson, Hans Olof; Dao, Valerio; Darbo, Giovanni; Darlea, Georgiana Lavinia; Darmora, Smita; Dassoulas, James; Davey, Will; Davidek, Tomas; Davidson, Nadia; Davies, Eleanor; Davies, Merlin; Davignon, Olivier; Davison, Adam; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; de Graat, Julien; De Groot, Nicolo; de Jong, Paul; De La Taille, Christophe; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; De Zorzi, Guido; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dechenaux, Benjamin; Dedovich, Dmitri; Degenhardt, James; Del Peso, Jose; Del Prete, Tarcisio; Delemontex, Thomas; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Demirkoz, Bilge; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deviveiros, Pier-Olivier; Dewhurst, Alastair; DeWilde, Burton; Dhaliwal, Saminder; Dhullipudi, Ramasudhakar; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Luise, Silvestro; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dindar Yagci, Kamile; Dingfelder, Jochen; Dinut, Florin; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; do Vale, Maria Aline Barros; Do Valle Wemans, André; Doan, Thi Kieu Oanh; Dobos, Daniel; Dobson, Ellie; Dodd, Jeremy; Doglioni, Caterina; Doherty, Tom; Dohmae, Takeshi; Doi, Yoshikuni; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dos Anjos, Andre; Dotti, Andrea; Dova, Maria-Teresa; Doyle, Tony; Dris, Manolis; Dubbert, Jörg; Dube, Sourabh; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Duda, Dominik; Dudarev, Alexey; Dudziak, Fanny; Duflot, Laurent; Dufour, Marc-Andre; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Dwuznik, Michal; Ebke, Johannes; Eckweiler, Sebastian; Edson, William; Edwards, Clive; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Eisenhandler, Eric; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Katherine; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Engelmann, Roderich; Engl, Albert; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Espinal Curull, Xavier; Esposito, Bellisario; Etienne, Francois; Etienvre, Anne-Isabelle; Etzion, Erez; Evangelakou, Despoina; Evans, Hal; Fabbri, Laura; Fabre, Caroline; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Fatholahzadeh, Baharak; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Fehling-Kaschek, Mirjam; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Ferencei, Jozef; Fernando, Waruna; Ferrag, Samir; Ferrando, James; Ferrara, Valentina; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Julia; Fisher, Matthew; Fitzgerald, Eric Andrew; Flechl, Martin; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Florez Bustos, Andres Carlos; Flowerdew, Michael; Fonseca Martin, Teresa; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Fournier, Daniel; Fox, Harald; Francavilla, Paolo; Franchini, Matteo; Franchino, Silvia; Francis, David; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; Fratina, Sasa; French, Sky; Friedrich, Conrad; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadfort, Thomas; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Gan, KK; Gandrajula, Reddy Pratap; Gao, Yongsheng; Gaponenko, Andrei; Garay Walls, Francisca; Garberson, Ford; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Adam; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gillman, Tony; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Francesco Michelangelo; Giovannini, Paola; Giraud, Pierre-Francois; Giugni, Danilo; Giuliani, Claudia; Giunta, Michele; Gjelsten, Børge Kile; Gkialas, Ioannis; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glazov, Alexandre; Glonti, George; Goddard, Jack Robert; Godfrey, Jennifer; Godlewski, Jan; Goebel, Martin; Goeringer, Christian; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez Silva, Laura; Gonzalez-Sevilla, Sergio; Goodson, Jeremiah Jet; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorfine, Grant; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Gough Eschrich, Ivo; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Graber, Lars; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Gramstad, Eirik; Grancagnolo, Francesco; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Gray, Julia Ann; Graziani, Enrico; Grebenyuk, Oleg; Greenshaw, Timothy; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grigalashvili, Nugzar; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Groth-Jensen, Jacob; Grybel, Kai; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guicheney, Christophe; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gunther, Jaroslav; Guo, Jun; Gutierrez, Phillip; Guttman, Nir; Gutzwiller, Olivier; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haas, Stefan; Haber, Carl; Hadavand, Haleh Khani; Haefner, Petra; Hajduk, Zbigniew; Hakobyan, Hrachya; Hall, David; Halladjian, Garabed; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Handel, Carsten; Hanke, Paul; Hansen, John Renner; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hansson, Per; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Hartert, Jochen; Hartjes, Fred; Haruyama, Tomiyoshi; Harvey, Alex; Hasegawa, Satoshi; Hasegawa, Yoji; Hassani, Samira; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayakawa, Takashi; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heinemann, Beate; Heisterkamp, Simon; Hejbal, Jiri; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Henke, Michael; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Hensel, Carsten; Herbert, Geoffrey Henry; Hernandez, Carlos Medina; Hernández Jiménez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, John; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoffman, Julia; Hoffmann, Dirk; Hofmann, Julia Isabell; Hohlfeld, Marc; Holmgren, Sven-Olof; Holzbauer, Jenny; Hong, Tae Min; Hooft van Huysduynen, Loek; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Xueye; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huettmann, Antje; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Hurwitz, Martina; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Idarraga, John; Iengo, Paolo; Igonkina, Olga; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Iliadis, Dimitrios; Ilic, Nikolina; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ivashin, Anton; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, John; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansen, Hendrik; Janssen, Jens; Jantsch, Andreas; Janus, Michel; Jared, Richard; Jarlskog, Göran; Jeanty, Laura; Jeng, Geng-yuan; Jen-La Plante, Imai; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jež, Pavel; Jézéquel, Stéphane; Jha, Manoj Kumar; Ji, Haoshuang; Ji, Weina; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Shan; Jinnouchi, Osamu; Joergensen, Morten Dam; Joffe, David; Johansen, Marianne; Johansson, Erik; Johansson, Per; Johnert, Sebastian; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Jovin, Tatjana; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Jussel, Patrick; Juste Rozas, Aurelio; Kabana, Sonja; Kaci, Mohammed; Kaczmarska, Anna; Kadlecik, Peter; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kajomovitz, Enrique; Kalinin, Sergey; Kama, Sami; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kanno, Takayuki; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karnevskiy, Mikhail; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Keener, Paul; Kehoe, Robert; Keil, Markus; Keller, John; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharchenko, Dmitri; Khodinov, Alexander; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hyeon Jin; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kitamura, Takumi; Kittelmann, Thomas; Kiuchi, Kenji; Kladiva, Eduard; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klemetti, Miika; Klier, Amit; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klinkby, Esben; Klioutchnikova, Tatiana; Klok, Peter; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Ko, Byeong Rok; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koenig, Sebastian; Koetsveld, Folkert; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohn, Fabian; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Koll, James; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Köneke, Karsten; König, Adriaan; Kono, Takanori; Kononov, Anatoly; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotov, Sergey; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Nina; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurata, Masakazu; Kurochkin, Yurii; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwee, Regina; La Rosa, Alessandro; La Rotonda, Laura; Labarga, Luis; Lablak, Said; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laier, Heiko; Laisne, Emmanuel; Lambourne, Luke; Lampen, Caleb; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, Clemens; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Larner, Aimee; Lassnig, Mario; Laurelli, Paolo; Lavorini, Vincenzo; Lavrijsen, Wim; Laycock, Paul; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legendre, Marie; Legger, Federica; Leggett, Charles; Lehmacher, Marc; Lehmann Miotto, Giovanna; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Lendermann, Victor; Leney, Katharine; Lenz, Tatiana; Lenzen, Georg; Lenzi, Bruno; Leonhardt, Kathrin; Leontsinis, Stefanos; Lepold, Florian; Leroy, Claude; Lessard, Jean-Raphael; Lester, Christopher; Lester, Christopher Michael; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Bo; Li, Haifeng; Li, Ho Ling; Li, Shu; Li, Xuefei; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Limper, Maaike; Lin, Simon; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Dong; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loddenkoetter, Thomas; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Loh, Chang Wei; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Lombardo, Vincenzo Paolo; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Losty, Michael; Lou, XinChou; Lounis, Abdenour; Loureiro, Karina; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Ludwig, Dörthe; Ludwig, Inga; Ludwig, Jens; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lund, Esben; Lundberg, Johan; Lundberg, Olof; Lund-Jensen, Bengt; Lundquist, Johan; Lungwitz, Matthias; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Maček, Boštjan; Machado Miguens, Joana; Macina, Daniela; Mackeprang, Rasmus; Madar, Romain; Madaras, Ronald; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeno, Mayuko; Maeno, Tadashi; Magnoni, Luca; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Mahmoud, Sara; Mahout, Gilles; Maiani, Camilla; Maidantchik, Carmen; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Malecki, Piotr; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany Andreina; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchese, Fabrizio; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marques, Carlos; Marroquim, Fernando; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian; Martin, Brian; Martin, Jean-Pierre; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Homero; Martinez, Mario; Martin-Haugh, Stewart; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Matsunaga, Hiroyuki; Matsushita, Takashi; Mättig, Peter; Mättig, Stefan; Mattravers, Carly; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazur, Michael; Mazzaferro, Luca; Mazzanti, Marcello; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; Mclaughlan, Tom; McMahon, Steve; McPherson, Robert; Meade, Andrew; Mechnich, Joerg; Mechtel, Markus; Medinnis, Mike; Meehan, Samuel; Meera-Lebbai, Razzak; Meguro, Tatsuma; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mendoza Navas, Luis; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Meric, Nicolas; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer, Joerg; Michal, Sebastien; Middleton, Robin; Migas, Sylwia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Miller, David; Mills, Bill; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Minaenko, Andrey; Miñano Moya, Mercedes; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Mitrevski, Jovan; Mitsou, Vasiliki A; Mitsui, Shingo; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Moeller, Victoria; Mohapatra, Soumya; Mohr, Wolfgang; Moles-Valls, Regina; Molfetas, Angelos; Mönig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Mora Herrera, Clemencia; Moraes, Arthur; Morange, Nicolas; Morel, Julien; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Morvaj, Ljiljana; Möser, Nicolas; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Thibaut; Mueller, Timo; Muenstermann, Daniel; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Mussche, Ido; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Nanava, Gizo; Napier, Austin; Narayan, Rohin; Nash, Michael; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negri, Guido; Negrini, Matteo; Nektarijevic, Snezana; Nelson, Andrew; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neusiedl, Andrea; Neves, Ricardo; Nevski, Pavel; Newcomer, Mitchel; Newman, Paul; Nguyen, Duong Hai; Nguyen Thi Hong, Van; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Niedercorn, Francois; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Norberg, Scarlet; Nordberg, Markus; Novakova, Jana; Nozaki, Mitsuaki; Nozka, Libor; Nuncio-Quiroz, Adriana-Elizabeth; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; O'Brien, Brendan Joseph; O'Neil, Dugan; O'Shea, Val; Oakes, Louise Beth; Oakham, Gerald; Oberlack, Horst; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Oda, Susumu; Odaka, Shigeru; Odier, Jerome; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohshima, Takayoshi; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira, Miguel Alfonso; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olivito, Dominick; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Ottersbach, John; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Simon; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Paleari, Chiara; Palestini, Sandro; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panduro Vazquez, William; Pani, Priscilla; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Papadelis, Aras; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Park, Woochun; Parker, Michael Andrew; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pashapour, Shabnaz; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pearce, James; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedraza Morales, Maria Isabel; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penson, Alexander; Penwell, John; Perez Cavalcanti, Tiago; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrino, Roberto; Perrodo, Pascal; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Jorgen; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Petschull, Dennis; Petteni, Michele; Pezoa, Raquel; Phan, Anna; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Piec, Sebastian Marcin; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pizio, Caterina; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Poddar, Sahill; Podlyski, Fabrice; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Pohl, Martin; Polesello, Giacomo; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Polychronakos, Venetios; Pomeroy, Daniel; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Pospelov, Guennady; Pospisil, Stanislav; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Prabhu, Robindra; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Pretzl, Klaus Peter; Price, Darren; Price, Joe; Price, Lawrence; Prieur, Damien; Primavera, Margherita; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Prudent, Xavier; Przybycien, Mariusz; Przysiezniak, Helenka; Psoroulas, Serena; Ptacek, Elizabeth; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Pylypchenko, Yuriy; Qian, Jianming; Quadt, Arnulf; Quarrie, David; Quayle, William; Quilty, Donnchadha; Raas, Marcel; Radeka, Veljko; Radescu, Voica; Radloff, Peter; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Rammes, Marcus; Randle-Conde, Aidan Sean; Randrianarivony, Koloina; Rangel-Smith, Camila; Rao, Kanury; Rauscher, Felix; Rave, Tobias Christian; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Reinsch, Andreas; Reisinger, Ingo; Relich, Matthew; Rembser, Christoph; Ren, Zhongliang; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Resende, Bernardo; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter-Was, Elzbieta; Ridel, Melissa; Rieck, Patrick; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Rios, Ryan Randy; Ritsch, Elmar; Riu, Imma; Rivoltella, Giancesare; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Rocha de Lima, Jose Guilherme; Roda, Chiara; Roda Dos Santos, Denis; Roe, Adam; Roe, Shaun; Røhne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romeo, Gaston; Romero Adam, Elena; Rompotis, Nikolaos; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Anthony; Rose, Matthew; Rosenbaum, Gabriel; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Ruckstuhl, Nicole; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rumyantsev, Leonid; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Rutherfoord, John; Ruthmann, Nils; Ruzicka, Pavel; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Saddique, Asif; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvachua Ferrando, Belén; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Saraiva, João; Sarangi, Tapas; Sarkisyan-Grinbaum, Edward; Sarrazin, Bjorn; Sarri, Francesca; Sartisohn, Georg; Sasaki, Osamu; Sasaki, Yuichi; Sasao, Noboru; Satsounkevitch, Igor; Sauvage, Gilles; Sauvan, Emmanuel; Sauvan, Jean-Baptiste; Savard, Pierre; Savinov, Vladimir; Savu, Dan Octavian; Sawyer, Craig; Sawyer, Lee; Saxon, David; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scannicchio, Diana; Scarcella, Mark; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaelicke, Andreas; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R~Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Christopher; Schmitt, Sebastian; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schram, Malachi; Schroeder, Christian; Schroer, Nicolai; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwartzman, Ariel; Schwegler, Philipp; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scott, Bill; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekula, Stephen; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellers, Graham; Seman, Michal; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Seuster, Rolf; Severini, Horst; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shank, James; Shao, Qi Tao; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Sherwood, Peter; Shimizu, Shima; Shimojima, Makoto; Shin, Taeksu; Shiyakova, Mariya; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Sicho, Petr; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silbert, Ohad; Silva, José; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simoniello, Rosa; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinnari, Louise Anastasia; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snow, Joel; Snyder, Scott; Sobie, Randall; Sodomka, Jaromir; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solfaroli Camillocci, Elena; Solodkov, Alexander; Solovyanov, Oleg; Solovyev, Victor; Soni, Nitesh; Sood, Alexander; Sopko, Vit; Sopko, Bruno; Sosebee, Mark; Soualah, Rachik; Soueid, Paul; Soukharev, Andrey; South, David; Spagnolo, Stefania; Spanò, Francesco; Spighi, Roberto; Spigo, Giancarlo; Spiwoks, Ralf; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Stahlman, Jonathan; Stamen, Rainer; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Staude, Arnold; Stavina, Pavel; Steele, Genevieve; Steinbach, Peter; Steinberg, Peter; Stekl, Ivan; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoerig, Kathrin; Stoicea, Gabriel; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strang, Michael; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Strong, John; Stroynowski, Ryszard; Stugu, Bjarne; Stumer, Iuliu; Stupak, John; Sturm, Philipp; Styles, Nicholas Adam; Su, Dong; Subramania, Halasya Siva; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Suzuki, Yuta; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Tackmann, Kerstin; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takahashi, Yuta; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tamsett, Matthew; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanasijczuk, Andres Jorge; Tani, Kazutoshi; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tayalati, Yahya; Taylor, Christopher; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teinturier, Marthe; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Terada, Susumu; Terashi, Koji; Terron, Juan; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thoma, Sascha; Thomas, Juergen; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thong, Wai Meng; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tic, Tomáš; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Tonoyan, Arshak; Topfel, Cyril; Topilin, Nikolai; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Tran, Huong Lan; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Triplett, Nathan; Trischuk, William; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiakiris, Menelaos; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsung, Jieh-Wen; Tsuno, Soshi; Tsybychev, Dmitri; Tua, Alan; Tudorache, Alexandra; Tudorache, Valentina; Tuggle, Joseph; Tuna, Alexander Naip; Turala, Michal; Turecek, Daniel; Turk Cakir, Ilkay; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Urbaniec, Dustin; Urquijo, Phillip; Usai, Giulio; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Vahsen, Sven; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Berg, Richard; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; Vanadia, Marco; Vandelli, Wainer; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Virzi, Joseph; Vitells, Ofer; Viti, Michele; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Adrian; Vokac, Petr; Volpi, Guido; Volpi, Matteo; Volpini, Giovanni; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Wolfgang; Wagner, Peter; Wahrmund, Sebastian; Wakabayashi, Jun; Walch, Shannon; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Walsh, Brian; Wang, Chiho; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watanabe, Ippei; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Anthony; Waugh, Ben; Weber, Michele; Webster, Jordan S; Weidberg, Anthony; Weigell, Philipp; Weingarten, Jens; Weiser, Christian; Wells, Phillippa; Wenaus, Torre; Wendland, Dennis; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Werth, Michael; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whitehead, Samuel Robert; Whiteson, Daniel; Whittington, Denver; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilhelm, Ivan; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Eric; Williams, Hugh; Williams, Sarah; Willis, William; Willocq, Stephane; Wilson, John; Wilson, Alan; Wingerter-Seez, Isabelle; Winkelmann, Stefan; Winklmeier, Frank; Wittgen, Matthias; Wittig, Tobias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wong, Wei-Cheng; Wooden, Gemma; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wraight, Kenneth; Wright, Michael; Wrona, Bozydar; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xie, Song; Xu, Chao; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yamada, Miho; Yamaguchi, Hiroshi; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Takayuki; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Un-Ki; Yang, Yi; Yang, Zhaoyu; Yanush, Serguei; Yao, Liwen; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yen, Andy L; Yildirim, Eda; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, Dantong; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zaytsev, Alexander; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhang, Dongliang; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Lei; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Ning; Zhou, Yue; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zibell, Andre; Zieminska, Daria; Zimin, Nikolai; Zimmermann, Christoph; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Zinonos, Zinonas; Ziolkowski, Michael; Zitoun, Robert; Živković, Lidija; Zmouchko, Viatcheslav; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zutshi, Vishnu; Zwalinski, Lukasz


    The distributions of event-by-event harmonic flow coefficients $v_n$ for n=2-4 are measured in $\\sqrt{s_{NN}}$=2.76 TeV Pb+Pb collisions using the ATLAS detector at the LHC. The measurements are performed using charged particles with transverse momentum $p_T$ > 0.5 GeV and in the pseudorapidity range |$\\eta$| 1 GeV. When these distributions are rescaled to the same mean values, the adjusted shapes are found to be nearly the same for these two $p_T$ ranges. The $v_n$ distributions are compared with the eccentricity distributions from two models for the initial collision geometry: a Glauber model and a model that includes corrections to the initial geometry due to gluon saturation effects. Both models fail to describe the experimental data consistently over most of the measured centrality range.

  18. Auxiliary basis sets for density fitting second-order Møller-Plesset perturbation theory: correlation consistent basis sets for the 5d elements Hf-Pt.

    Hill, J Grant


    Auxiliary basis sets specifically matched to the correlation consistent cc-pVnZ-PP, cc-pwCVnZ-PP, aug-cc-pVnZ-PP, and aug-cc-pwCVnZ-PP orbital basis sets (used in conjunction with pseudopotentials) for the 5d transition metal elements Hf-Pt have been optimized for use in density fitting second-order Møller-Plesset perturbation theory and other correlated ab initio methods. Calculations of the second-order Møller-Plesset perturbation theory correlation energy, for a test set of small to medium sized molecules, indicate that the density fitting error when utilizing these sets is negligible at three to four orders of magnitude smaller than the orbital basis set incompleteness error.

  19. Observation of correlated azimuthal anisotropy Fourier harmonics in pp and pPb collisions at the LHC

    Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Grossmann, Johannes; Hrubec, Josef; Jeitler, Manfred; König, Axel; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Pree, Elias; Rabady, Dinyar; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Karapostoli, Georgia; Lenzi, Thomas; Luetic, Jelena; Maerschalk, Thierry; Marinov, Andrey; Randle-conde, Aidan; Seva, Tomislav; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Cimmino, Anna; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Salva Diblen, Sinem; Tytgat, Michael; Verbeke, Willem; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; Caudron, Adrien; De Visscher, Simon; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Jafari, Abideh; Komm, Matthias; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Quertenmont, Loic; Vidal Marono, Miguel; Wertz, Sébastien; Beliy, Nikita; Aldá Júnior, Walter Luiz; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Stoykova, Stefka; Sultanov, Georgi; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhang, Sijing; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Ruiz Alvarez, José David; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Carrera Jarrin, Edgar; Assran, Yasser; Mahmoud, Mohammed; Mahrous, Ayman; Dewanjee, Ram Krishna; Kadastik, Mario; Perrini, Lucia; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Pekkanen, Juska; Voutilainen, Mikko; Härkönen, Jaakko; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Ghosh, Saranya; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Kucher, Inna; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Charlot, Claude; Granier de Cassagnac, Raphael; Jo, Mihee; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Schomakers, Christian; Schulz, Johannes; Verlage, Tobias; Zhukov, Valery; Albert, Andreas; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hamer, Matthias; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Knutzen, Simon; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Teyssier, Daniel; Thüer, Sebastian; Flügge, Günter; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Lingemann, Joschka; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Eren, Engin; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Harb, Ali; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Korol, Ievgen; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Leonard, Jessica; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Ntomari, Eleni; Pitzl, Daniel; Raspereza, Alexei; Roland, Benoit; Savitskyi, Mykola; Saxena, Pooja; Shevchenko, Rostyslav; Spannagel, Simon; Stefaniuk, Nazar; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Bein, Samuel; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Lapsien, Tobias; Marchesini, Ivan; Marconi, Daniele; Meyer, Mareike; Niedziela, Marek; Nowatschin, Dominik; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Scharf, Christian; Schleper, Peter; Schmidt, Alexander; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Freund, Benedikt; Friese, Raphael; Giffels, Manuel; Haitz, Dominik; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Kudella, Simon; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Kousouris, Konstantinos; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Csanad, Mate; Filipovic, Nicolas; Pasztor, Gabriella; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Bahinipati, Seema; Bhowmik, Sandeep; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chawla, Ridhi; Dhingra, Nitish; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kumar, Ramandeep; Kumari, Priyanka; Mehta, Ankita; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Chauhan, Sushil; Choudhary, Brajesh C; Garg, Rocky Bala; Keshri, Sumit; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukhopadhyay, Supratik; Nandan, Saswati; Purohit, Arnab; Roy, Ashim; Roy, Debarati; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Dugad, Shashikant; Mahakud, Bibhuprasad; Mitra, Soureek; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sarkar, Tanmay; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Errico, Filippo; Fiore, Luigi; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Costa, Salvatore; Di Mattia, Alessandro; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pauwels, Kristof; Pedrini, Daniele; Pigazzini, Simone; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Fienga, Francesco; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Carvalho Antunes De Oliveira, Alexandra; Checchia, Paolo; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Margoni, Martino; Meneguzzo, Anna Teresa; Pozzobon, Nicola; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Manca, Elisabetta; Mandorli, Giulio; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Margaroli, Fabrizio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Traczyk, Piotr; Belforte, Stefano; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Lee, Ari; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Brochero Cifuentes, Javier Andres; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Kim, Yongsun; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Choi, Minkyoo; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chistov, Ruslan; Danilov, Mikhail; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Tarkovskii, Evgenii; Zhemchugov, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Ershov, Alexander; Gribushin, Andrey; Kaminskiy, Alexandre; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Skovpen, Yuri; Shtol, Dmitry; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Rekovic, Vladimir; Stojanovic, Milan; Alcaraz Maestre, Juan; Barrio Luna, Mar; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Curras, Esteban; Duarte Campderros, Jordi; Fernandez, Marcos; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bianco, Michele; Bloch, Philippe; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Castello, Roberto; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Roeck, Albert; Dobson, Marc; Dorney, Brian; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Kirschenmann, Henning; Knünz, Valentin; Kornmayer, Andreas; Kortelainen, Matti J; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Neugebauer, Hannes; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Stoye, Markus; Tosi, Mia; Treille, Daniel; Triossi, Andrea; Tsirou, Andromachi; Veckalns, Viesturs; Verweij, Marta; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Bäni, Lukas; Berger, Pirmin; Bianchini, Lorenzo; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Klijnsma, Thomas; Lustermann, Werner; Mangano, Boris; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Quittnat, Milena; Reichmann, Michael; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Candelise, Vieri; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Fiori, Francesco; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Kovitanggoon, Kittikul; Singh, Gurpreet; Srimanobhas, Norraphat; Boran, Fatma; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Sunar Cerci, Deniz; Tali, Bayram; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Bilin, Bugra; Karapinar, Guler; Ocalan, Kadir; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Nazlim Agaras, Merve; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Grynyov, Boris; Levchuk, Leonid; Aggleton, Robin; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Sakuma, Tai; Seif El Nasr-storey, Sarah; Smith, Dominic; Smith, Vincent J; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Calligaris, Luigi; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Auzinger, Georg; Bainbridge, Robert; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Di Maria, Riccardo; Elwood, Adam; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Lane, Rebecca; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mastrolorenzo, Luca; Matsushita, Takashi; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Avetisyan, Aram; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Cutts, David; Garabedian, Alex; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Mao, Zaixing; Narain, Meenakshi; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Gardner, Michael; Ko, Winston; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Smith, John; Stolp, Dustin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Heilman, Jesse; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Shrinivas, Amithabh; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Macneill, Ian; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Heller, Ryan; Incandela, Joe; Mullin, Sam Daniel; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Yoo, Jaehyeok; Anderson, Dustin; Bendavid, Joshua; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Pena, Cristian; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; Mulholland, Troy; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Magini, Nicolo; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Furic, Ivan-Kresimir; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Rank, Douglas; Sperka, David; Terentyev, Nikolay; Thomas, Laurent; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Joshi, Yagya Raj; Linn, Stephan; Markowitz, Pete; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Trauger, Hallie; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Yi, Kai; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Royon, Christophe; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Toda, Sachiko; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hsu, Dylan; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Alyari, Maral; Dolen, James; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Liu, Bingxuan; Luo, Wuming; Puigh, Darren; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Lange, David; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Das, Souvik; Folgueras, Santiago; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xie, Wei; Cheng, Tongguang; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Chen, Zhenyu; Ecklund, Karl Matthew; Geurts, Frank JM; Guilbaud, Maxime; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Tu, Zhoudunming; Zabel, James; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Verzetti, Mauro; Ciesielski, Robert; Goulianos, Konstantin; Mesropian, Christina; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Foerster, Mark; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Faulkner, James; Gurpinar, Emine; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Sturdy, Jared; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Pierro, Giuseppe Antonio; Polese, Giovanni; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel


    The azimuthal anisotropy Fourier coefficients ($v_n$) in 8.16 TeV pPb data are extracted via long-range two-particle correlations as a function of event multiplicity and compared to corresponding results in pp and PbPb collisions. Using a four-particle cumulant technique, $v_n$ correlations are measured for the first time in pp and pPb collisions. The $v_2$ and $v_4$ coefficients are found to be positively correlated in all collision systems. For high multiplicity pPb collisions an anticorrelation of $v_2$ and $v_3$ is observed, with a similar correlation strength as in PbPb data at the same multiplicity. The new correlation results strengthen the case for a common origin of the collectivity seen in pPb and PbPb collisions in the measured multiplicity range.

  20. The evaluation of the pyrochemistry for the treatment of Gen IV nuclear fuels Inert matrix chlorination studies in the gas phase or molten chloride salts

    Bourg, S.; Péron, F.; Lacquement, J.


    The structure of the fuels for the future Gen IV nuclear reactors will be totally different from those of PWR, especially for the GFR concept including a closed cycle. In these reactors, fissile materials (carbides or nitrides of actinides) should be surrounded by an inert matrix. In order to build a reprocessing process scheme, the behavior of the potential inert matrices (silicon carbide, titanium nitride, and zirconium carbide and nitride) was studied by hydro- and pyrometallurgy. This paper deals with the chlorination results at high temperature by pyrometallurgy. For the first time, the reactivity of the matrix towards chlorine gas was assessed in the gas phase. TiN, ZrN and ZrC are very reactive from 400 °C whereas it is necessary to be over 900 °C for SiC to be as fast. In molten chloride melts, the bubbling of chlorine gas is less efficient than in gas phase but it is possible to attack the matrices. Electrochemical methods were also used to dissolve the refractory materials, leading to promising results with TiN, ZrN and ZrC. The massive SiC samples used were not conductive enough to be studied and in this case specific SiC-coated carbon electrodes were used. The key point of these studies was to find a method to separate the matrix compounds from the fissile material in order to link the head to the core of the process (electrochemical separation or liquid-liquid reductive extraction in the case of a pyrochemical reprocessing).