WorldWideScience

Sample records for zrn hfn vn

  1. Fretting wear of ZrN and Zr(21% Hf)N coatings

    Energy Technology Data Exchange (ETDEWEB)

    Atar, E. [Gebze Inst. of Tech., Material Science and Engineering Dept., Kocaeli (Turkey); Cimenoglu, H.; Kayali, E.S. [Istanbul Technical Univ., Dept. of Metallurgy and Materials Engineering, Istanbul (Turkey)

    2004-07-01

    In this study, the wear behaviours of ZrN and Zr(21% Hf)N coatings, deposited on hardened AISI D2 cold work tool steel were examined by a fretting wear tester. The hardness of ZrN and Zr(21% Hf)N coatings were almost the same, where as they exhibited different wear resistance. Addition of 21% Hf to ZrN coating achieved about 25% increase in the wear resistance. (orig.)

  2. Fretting wear of ZrN and Zr(21% Hf)N coatings

    International Nuclear Information System (INIS)

    Atar, E.; Cimenoglu, H.; Kayali, E.S.

    2004-01-01

    In this study, the wear behaviours of ZrN and Zr(21% Hf)N coatings, deposited on hardened AISI D2 cold work tool steel were examined by a fretting wear tester. The hardness of ZrN and Zr(21% Hf)N coatings were almost the same, where as they exhibited different wear resistance. Addition of 21% Hf to ZrN coating achieved about 25% increase in the wear resistance. (orig.)

  3. The cross section measurements for the 51V(n, α)48Sc and 51V(n,p)51Ti reactions

    International Nuclear Information System (INIS)

    Hu Shangbin; Kong Xiangzhong; Yang Jingkang

    1999-01-01

    The cross sections for 51 V(n, α) 48 Sc and 51 V(n,p) 51 Ti have been measured by using the activation method relative to the cross sections of 27 Al(n, α) 24 Na in the neutron energy range 13.4 --14.8 MeV. The results are compared with the published data. The neutron energies were determined by the method of cross section ratios for the reactions 90 Zr(n.2n) 89 Zr by 93 Nb(n,2n) 92m Nb

  4. Electrical and structural properties of group-4 transition-metal nitride (TiN, ZrN, and HfN) contacts on Ge

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Keisuke; Nakashima, Hiroshi, E-mail: nakasima@astec.kyushu-u.ac.jp [Art, Science and Technology Center for Cooperative Research, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Noguchi, Ryutaro; Wang, Dong [Interdisciplinary Graduate School of Engineering Sciences, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Mitsuhara, Masatoshi; Nishida, Minoru [Department of Engineering Sciences for Electronics and Materials, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Hara, Toru [National Institute for Materials Science, 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan)

    2015-09-21

    Electrical and structural properties were investigated for group-4 transition-metal nitride contacts on Ge (TiN/Ge, ZrN/Ge, and HfN/Ge), which were prepared by direct sputter depositions using nitride targets. These contacts could alleviate the intrinsic Fermi-level pinning (FLP) position toward the conduction band edge. It was revealed that this phenomenon is induced by an amorphous interlayer (a-IL) containing nitrogen atoms at the nitride/Ge interfaces. The strength of FLP alleviation positively depended on the thickness of a-IL. TiN/Ge and ZrN/Ge contacts with ∼2 nm-thick a-ILs showed strong FLP alleviations with hole barrier heights (Φ{sub BP}) in the range of 0.52–56 eV, and a HfN/Ge contact with an ∼1 nm-thick a-IL showed a weaker one with a Φ{sub BP} of 0.39 eV. However, TaN/Ge contact without a-IL did not show such FLP alleviation. Based on the results of depth distributions for respective elements, we discussed the formation kinetics of a-ILs at TiN/Ge and ZrN/Ge interfaces. Finally, we proposed an interfacial dipole model to explain the FLP alleviation.

  5. Raman scattering from epitaxial HfN layers grown on MgO(001)

    International Nuclear Information System (INIS)

    Stoehr, M.; Seo, H.-S.; Petrov, I.; Greene, J.E.

    2006-01-01

    Stoichiometric single-crystal HfN layers grown on MgO(001) are analyzed by Raman spectroscopy. Second-order Raman scattering predominates, but first-order modes in the acoustic and optical ranges are also visible. The latter indicates that the O h symmetry of NaCl-structure HfN is broken. The large mass difference between Hf and N leads to a correspondingly large separation, 250 cm -1 , between the first-order acoustic and optical bands. Within this gap, four Raman lines are clearly observed. The first three are the second-order transverse acoustic mode (240 cm -1 ), the sum of the first-order transverse and longitudinal acoustic modes (280 cm -1 ), and the second-order longitudinal acoustic mode (325 cm -1 ). The fourth line at 380 cm -1 is identified as the difference between the first-order optical and acoustic modes. The observed first-order Raman scattering, as well as the width of the gap between the first-order acoustic and optical modes, is in good agreement with previously calculated HfN phonon density of states

  6. Defects in TiN and HfN studied by helium thermal desorption spectrometry

    International Nuclear Information System (INIS)

    Hoondert, W.H.B.; Thijsse, B.J.; Beuckel, A. van den

    1994-01-01

    Point defects in sub-stoichiometric TiN 1-x and HfN 1-x were investigated by helium thermal desorption spectrometry (300-1800K) following He + ion implantation at energies up to 3000eV. It was found that the low energy spectra are dominated by helium dissociating from the structural vacancies on the nitrogen sublattice; the activation energy for dissociation is 2.2eV for TiN. Above a few hundred electron volts the ions begin to produce several other types of defects, from which helium dissociates with activation energies in the range 2.6-4.0eV. The identity of these defects is discussed. The results for the two nitrides were similar in many respects. The most significant difference observed is that in TiN low energy He + ions generate damage on the N sublattice of a type that is not observed for HfN. Activation energies for HfN are found to be consistently 0.7eV lower than for TiN. ((orig.))

  7. Effect of oxidation on the wear behavior of a ZrN coating

    Energy Technology Data Exchange (ETDEWEB)

    Atar, E. [Gebze Inst. of Tech., Material Science and Engineering Dept., Kocaeli (Turkey); Cimenoglu, H.; Kayali, E.S. [Istanbul Technical Univ., Dept. of Metallurgy and Materials Engineering, Azazaga, Istanbul (Turkey)

    2005-07-01

    In the present study tribological performance of ZrN coatings deposited on hardened AISI D2 quality cold work tool steel by arc-physical vapor deposition technique has been examined in as-deposited and oxidized conditions. ZrN coatings were oxidized at 400 C for various times up to 12 h. Reciprocating wear tests carried out by rubbing Al{sub 2}O{sub 3} balls on the coatings, revealed significant improvement in wear resistance of ZrN coating upon oxidation. Oxidation treatment at 400 C for 12 h yielded seven times higher wear resistance than as-deposited ZrN coating, beside significant reduction in the wear of counterface (Al{sub 2}O{sub 3} ball). (orig.)

  8. Effect of oxidation on the wear behavior of a ZrN coating

    International Nuclear Information System (INIS)

    Atar, E.; Cimenoglu, H.; Kayali, E.S.

    2005-01-01

    In the present study tribological performance of ZrN coatings deposited on hardened AISI D2 quality cold work tool steel by arc-physical vapor deposition technique has been examined in as-deposited and oxidized conditions. ZrN coatings were oxidized at 400 C for various times up to 12 h. Reciprocating wear tests carried out by rubbing Al 2 O 3 balls on the coatings, revealed significant improvement in wear resistance of ZrN coating upon oxidation. Oxidation treatment at 400 C for 12 h yielded seven times higher wear resistance than as-deposited ZrN coating, beside significant reduction in the wear of counterface (Al 2 O 3 ball). (orig.)

  9. Atom economy and green elimination of nitric oxide using ZrN powders.

    Science.gov (United States)

    Chen, Ning; Wang, Jigang; Yin, Wenyan; Li, Zhen; Li, Peishen; Guo, Ming; Wang, Qiang; Li, Chunlei; Wang, Changzheng; Chen, Shaowei

    2018-05-01

    Nitric oxide (NO) may cause serious environmental problems, such as acid rain, haze weather, global warming and even death. Herein, a new low-cost, highly efficient and green method for the elimination of NO using zirconium nitride (ZrN) is reported for the first time, which does not produce any waste or any by-product. Relevant experimental parameters, such as reaction temperature and gas concentration, were investigated to explore the reaction mechanism. Interestingly, NO can be easily decomposed into nitrogen (N 2 ) by ZrN powders at 600°C with ZrN simultaneously transformed into zirconium dioxide (ZrO 2 ) gradually. The time for the complete conversion of NO into N 2 was approximately 14 h over 0.5 g of ZrN at a NO concentration of 500 ppm. This green elimination process of NO demonstrated good atom economy and practical significance in mitigating environmental problems.

  10. Study of the AlON-VN composite ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Sainbaatar; Zhang Zuotai; Li Wenchao; Wang Xidong [Dept. of Physical Chemistry of Metallurgy, Univ. of Science and Technology Beijing, BJ (China)

    2005-07-01

    Aluminium oxynitride-vanadium nitride (AlON-VN) composite ceramic was fabricated based on thermodynamic analysis of V-Al-O-N systems. The results indicated that the VN dispersed homogeneously in AlON matrix and can reinforce AlON matrix. Oxidation behavior was studied and the results showed that it belongs to self-protective oxidation due to the good adherence of oxidation product. Therefore, AlON-VN composites have excellent oxidation resistance. (orig.)

  11. [Effects of magnetron sputtered ZrN on the bonding strength of titanium porcelain].

    Science.gov (United States)

    Zhou, Shu; Zhang, Wen-yan; Guang, Han-bing; Xia, Yang; Zhang, Fei-min

    2009-04-01

    To investigate the effect of magnetron sputtered ZrN on the bonding strength between a low-fusing porcelain (Ti/Vita titankeramik system) and commercially pure cast titanium. Sixteen specimens were randomly assigned to test group and control group (n=8). The control group received no surface treated. Magnetron sputtered ZrN film was deposited on the surface of specimens in the test group. Then the sixteen titanium-porcelain specimens were prepared in a rectangular shape and went through three-point bending test on a universal test machine. The bond strength of Ti/porcelain was recorded. The phase composition of the specimens was analyzed using X-ray diffraction (XRD). The interface at titanium and porcelain and the titanium surface after debonding were observed with a scanning electron microscopy (SEM) and analyzed using energy depressive spectrum (EDS). New phase of ZrN was found with XRD in the test group. Statistical analysis showed higher bond strength following ZrN surface treatment in the test group [(45.991+/-0.648) MPa] than that in the control group [(29.483+/-1.007) MPa] (P=0.000). Bonded ceramic could be observed in test group, the amount of bonded ceramic was more than that in the control group. No obvious bonded ceramic in control group was found. Magnetron sputtered ZrN can improve bond strength of Ti/Vita titankeramik system significantly.

  12. Mechanism of plutonium metal dissolution in HNO3-HF-N2H4 solution

    International Nuclear Information System (INIS)

    Karraker, D.G.

    1985-01-01

    An oxidation-reduction balance of the products of the dissolution of plutonium metal and alloys in HNO 3 -HF-N 2 H 4 solution shows that the major reactions during dissolution are the reduction of nitrate to NH 3 , N 2 and N 2 O by the metal, and the oxidation of H free radicals to NH 3 by N 2 H 4 . Reactions between HNO 3 and N 2 H 4 produce varying amounts of HN 3 . The reaction rate is greater for delta-Pu than alpha-Pu, and is increased by higher concentrations of HF and HNO 3 . The low yield of reduced nitrogen species indicates that nitrate is reduced on the metal surface without producing a significant concentration of species that react with N 2 H 4 . It is conjectured that intermediate Pu valences and electron transfer within the metal are involved. 7 refs., 3 tabs

  13. Epitaxial growth of high purity cubic InN films on MgO substrates using HfN buffer layers by pulsed laser deposition

    International Nuclear Information System (INIS)

    Ohba, R.; Ohta, J.; Shimomoto, K.; Fujii, T.; Okamoto, K.; Aoyama, A.; Nakano, T.; Kobayashi, A.; Fujioka, H.; Oshima, M.

    2009-01-01

    Cubic InN films have been grown on MgO substrates with HfN buffer layers by pulsed laser deposition (PLD). It has been found that the use of HfN (100) buffer layers allows us to grow cubic InN (100) films with an in-plane epitaxial relationship of [001] InN //[001] HfN //[001] MgO . X-ray diffraction and electron back-scattered diffraction measurements have revealed that the phase purity of the cubic InN films was as high as 99%, which can be attributed to the use of HfN buffer layers and the enhanced surface migration of the film precursors by the use of PLD. - Graphical abstract: Cubic InN films have been grown on MgO substrates with HfN buffer layers by pulsed laser deposition (PLD). It has been revealed that the phase purity of the cubic InN films was as high as 99 %, which can be attributed to the use of HfN buffer layers and the enhanced surface migration of the film precursors by the use of PLD.

  14. Effect of thickness on structural, corrosion and mechanical properties of a thin ZrN film deposited by medium frequency (MF) reactive sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Kavitha, Ayyalu; Kannan, Raman [Anna Univ., Dindigul (India). Dept. of Physics; Loganathan, Subramani [Titan Industries, Hosur, Tamilnadu (India). Ion Plating Dept.

    2016-07-01

    Zirconium nitride (ZrN) thin films were prepared on stainless steel (SS) substrates by medium frequency (MF) reactive sputtering with gas ion source (GIS) by varying the deposition time and obtained thickness (t{sub ZrN}) in the range of 1.25 to 3.24 μm. The effect of thickness on the structural and microstructural properties was studied using XRD and AFM. XRD characterization revealed that the texture of the ZrN thin films changes as a function of thickness. Both, the (111) and (200) peak, appear initially and (111) becomes more intense with increasing t{sub ZrN}. AFM imaging revealed that the ZrN thin film coated with t{sub ZrN} ∼ 3.24 μm shows larger grains that are uniformly distributed over the surface. An average hardness value of 19.79 GPa was observed for ZrN thin films having t{sub ZrN} ∼ 3.24 μm. The ZrN thin films having t{sub ZrN} ∼ 3.24 μm exhibits better adhesion strength up to 20 N. The electrochemical polarization studies indicated that the ZrN thin film having larger thickness shows improved corrosion resistance compared to SS in 3.5 % NaCl solution.

  15. Properties of ZrN films as substrate masks in liquid phase epitaxial lateral overgrowth of compound semiconductors

    International Nuclear Information System (INIS)

    Dobosz, D.; Zytkiewicz, Z.R.; Jakiela, R.; Golaszewska, K.; Kaminska, E.; Piotrowska, A.; Piotrowski, T.T.; Barcz, A.

    2005-01-01

    The usefulness of ZrN films as masks for epitaxial lateral overgrowth of GaAs and GaSb by liquid phase epitaxy is studied. It was observed that during the growth process ZrN masks are mechanically stable, they adhere strongly to the substrate and do not show any signs of degradation even at the growth temperature as high as 750 C. Moreover, perfect selectivity of GaAs and GaSb epitaxy was obtained on ZrN masked substrates ensuring the growth wide and thin layers. To study the influence of growth conditions on electrical resistivity of the mask, ZrN films deposited on GaAs substrates were annealed in various atmospheres. It was found that at temperatures higher than about 580 C the ZrN masks become highly resistive when heat-treated in hydrogen flow employed during growth. Usually, LPE growth temperature for GaAs is higher. Thus, ELO growth of GaAs by LPE becomes more difficult, though still possible, if ZrN masks are to be applied as buried electrical contacts. For GaSb ELO layers however, typical LPE growth temperature is about 480 C. This allows us to grow high quality GaSb ELO layers by LPE still preserving high electrical conductivity of ZrN mask. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  16. Influence of aluminium incorporation on the structure of ZrN films deposited at low temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Araiza, J J [Unidad Academica de Fisica, Universidad Autonoma de Zacatecas, Paseo a la Bufa esq, Calzada Solidaridad s/n 98060, Zacatecas (Mexico); Sanchez, O [Departamento de Fisica e Ingenieria de Superficies, Instituto de Ciencia de Materiales de Madrid-CSIC, C/ Sor Juana Ines de la Cruz 3, 28049 Cantoblanco, Madrid (Spain)], E-mail: olgas@icmm.csic.es

    2009-06-07

    We have studied the influence of Al incorporation in the crystalline structure of ZrN thin films deposited by dc magnetron sputtering at low temperature. The amount of aluminium in the films depends directly on the power applied to the aluminium cathode during the deposition. Energy dispersive x-ray analysis and x-ray diffraction (XRD) were used to obtain the chemical composition and crystalline structure of the films, respectively. When Al atoms are incorporated into the ZrN coatings, the strong ZrN (2 0 0) orientation is modified by a combination of other ones such as ZrN (1 1 1), Zr{sub 3}N{sub 4} (2 1 1) and hexagonal AlN (1 0 0) as detected from the XRD spectra for high aluminium concentrations. Fourier-transform infrared spectroscopy allowed us to identify oxides and nitrides, ZrO, AlO and AlN, incorporated into the deposited films. The effect of a bias voltage applied to the substrate has also been investigated and related to the changes in the microstructure and in the nanohardness values of the ZrAlN films.

  17. Influence of aluminium incorporation on the structure of ZrN films deposited at low temperatures

    International Nuclear Information System (INIS)

    Araiza, J J; Sanchez, O

    2009-01-01

    We have studied the influence of Al incorporation in the crystalline structure of ZrN thin films deposited by dc magnetron sputtering at low temperature. The amount of aluminium in the films depends directly on the power applied to the aluminium cathode during the deposition. Energy dispersive x-ray analysis and x-ray diffraction (XRD) were used to obtain the chemical composition and crystalline structure of the films, respectively. When Al atoms are incorporated into the ZrN coatings, the strong ZrN (2 0 0) orientation is modified by a combination of other ones such as ZrN (1 1 1), Zr 3 N 4 (2 1 1) and hexagonal AlN (1 0 0) as detected from the XRD spectra for high aluminium concentrations. Fourier-transform infrared spectroscopy allowed us to identify oxides and nitrides, ZrO, AlO and AlN, incorporated into the deposited films. The effect of a bias voltage applied to the substrate has also been investigated and related to the changes in the microstructure and in the nanohardness values of the ZrAlN films.

  18. Barrier capability of Zr-N films with titanium addition against copper diffusion

    International Nuclear Information System (INIS)

    Wang Ying; Cao Fei; Yang Xiaodong; Ding Minghui

    2009-01-01

    Zr-Ti-N film prepared by sputtering deposition has been employed as a potential diffusion barrier for Cu metallization. It is thought that the existing states of Ti and Zr in the films are Ti-N and Zr-N phase in Zr-Ti-N films. Material analysis by XRD, XPS and sheet resistance measurement reveal that the failure of Zr-N film is mainly due to the formation of Cu 3 Si precipitates at the Zr-N/Si interface by Cu diffusion through the grain boundaries or local defects of the Zr-N barrier layer into Si substrate. In conjunction with sheet resistance measurement, XRD and XPS analyses, the Cu/Zr-Ti-N/Si contact system has high thermal stability at least up to 700 deg. C. The incorporation of Ti atoms into Zr-N barrier layer was shown to be beneficial in improving the thermal stability of the Cu/barrier/Si contact system.

  19. Ab initio investigations of the electronic structure and chemical bonding of Li2ZrN2

    International Nuclear Information System (INIS)

    Matar, S.F.; Pöttgen, R.; Al Alam, A.F.; Ouaini, N.

    2012-01-01

    The electronic structure of the ternary nitride Li 2 ZrN 2 is examined from ab initio with DFT computations for an assessment of the properties of chemical bonding. The compound is found insulating with 1.8 eV band gap; it becomes metallic and less ionic upon removal of one equivalent of Li. The chemical interaction is found mainly between Zr and N on one hand and Li and N on the other hand. While all pair interactions are bonding, antibonding N–N interactions are found dominant at the top of the valence band of Li 2 ZrN 2 and they become less intense upon removal of Li. From energy differences the partial delithiation leading to Li 2−x ZrN 2 (x=∼1) is favored. - Graphical abstract: Trigonal structure of Li 2 ZrN 2 showing the Zr–N–Li layers along the c-axis. Highlights: ► Li 2 ZrN 2 calculated insulating with a 1.8 eV gap in agreement with its light green color. ► Lithium de-intercalation is energetically favored for one out of two Li equivalents. ► Li plays little role in the change of the structure, ensured by Zr and N binding. ► Similar changes in the electronic structure as for various intercalated phases of ZrN.

  20. Radiation tolerance of nanostructured ZrN coatings against swift heavy ion irradiation

    International Nuclear Information System (INIS)

    Janse van Vuuren, A.; Skuratov, V.A.; Uglov, V.V.; Neethling, J.H.; Zlotski, S.V.

    2013-01-01

    Nano-structured zirconium nitride layers – on Si substrates – of various thicknesses (0.1, 3, 10 and 20 μm) were irradiated with 167 MeV Xe, 250 MeV Kr and 695 MeV Bi ions to fluences in the range from 3 × 10 12 to 2.6 × 10 15 cm −2 for Xe, 1 × 10 13 to 7.06 × 10 13 cm −2 for Kr and 10 12 to 10 13 cm −2 for Bi. The purpose of these irradiation experiments is to simulate the effects of fission fragment bombardment on nanocrystalline ZrN. The irradiated layers where subsequently analysed by X-ray diffraction (XRD), transmission electron microscopy (TEM) and nano-indentation hardness testing (NIH) techniques. XRD, TEM and NIH results indicate that ZrN has a very high tolerance to the effects of high energy irradiation

  1. Mechanical and electrochemical characterization of vanadium nitride (VN) thin films

    Energy Technology Data Exchange (ETDEWEB)

    Caicedo, J.C., E-mail: Jcesarca@calima.univalle.edu.co [Grupo de Peliculas Delgadas, Departamento de Fisica, Universidad del Valle, Cali (Colombia); Zambrano, G. [Grupo de Peliculas Delgadas, Departamento de Fisica, Universidad del Valle, Cali (Colombia); Aperador, W. [Ingenieria Mecatronica, Universidad Militar Nueva Granada, Bogota (Colombia); Escobar-Alarcon, L.; Camps, E. [Departamento de Fisica, Instituto Nacional de Investigaciones Nucleares, Apdo. Postal 18-1027, Mexico, DF 11801 (Mexico)

    2011-10-15

    Vanadium nitride (V-N) thin films were grown using a reactive d.c. magnetron sputtering process, from a vanadium target (99.999%) in an Ar/N{sub 2} gas mixture at different deposition bias voltage. Films were deposited onto silicon (1 0 0) and RUS-3 steel substrates at 400 deg. C. Structural, compositional, mechanical and electrochemical characterizations were performed by X-ray diffraction (XRD), elastic forward analysis (EFA), nanoindentation, electrochemical impedance spectroscopy (EIS), and Tafel polarization curves, respectively. X-ray diffraction patterns show the presence of (1 1 1) and (2 0 0) crystallographic orientations associated to the V-N cubic phase. Nanoindentation measurements revealed that when the bias voltage increases from 0 V to -150 V the hardness and elastic modulus are increased from 11 GPa to 20 GPa and from 187 GPa to 221 GPa, respectively. EIS and Tafel curves showed that the corrosion rate of steel, coated with V-N single layer films deposited without bias voltage, diminishes 90% compared to the steel without this coating. On the other hand, when the V-N coating was deposited at the highest d.c. bias voltage (-150 V), the corrosion rate was greater than in the steel coated with zero-voltage (0 V) V-N films. This last result could be attributed to the formation of porosities produced by the ion bombardment during the deposition process.

  2. Mechanical and electrochemical characterization of vanadium nitride (VN) thin films

    International Nuclear Information System (INIS)

    Caicedo, J.C.; Zambrano, G.; Aperador, W.; Escobar-Alarcon, L.; Camps, E.

    2011-01-01

    Vanadium nitride (V-N) thin films were grown using a reactive d.c. magnetron sputtering process, from a vanadium target (99.999%) in an Ar/N 2 gas mixture at different deposition bias voltage. Films were deposited onto silicon (1 0 0) and RUS-3 steel substrates at 400 deg. C. Structural, compositional, mechanical and electrochemical characterizations were performed by X-ray diffraction (XRD), elastic forward analysis (EFA), nanoindentation, electrochemical impedance spectroscopy (EIS), and Tafel polarization curves, respectively. X-ray diffraction patterns show the presence of (1 1 1) and (2 0 0) crystallographic orientations associated to the V-N cubic phase. Nanoindentation measurements revealed that when the bias voltage increases from 0 V to -150 V the hardness and elastic modulus are increased from 11 GPa to 20 GPa and from 187 GPa to 221 GPa, respectively. EIS and Tafel curves showed that the corrosion rate of steel, coated with V-N single layer films deposited without bias voltage, diminishes 90% compared to the steel without this coating. On the other hand, when the V-N coating was deposited at the highest d.c. bias voltage (-150 V), the corrosion rate was greater than in the steel coated with zero-voltage (0 V) V-N films. This last result could be attributed to the formation of porosities produced by the ion bombardment during the deposition process.

  3. Optical properties of Ar ions irradiated nanocrystalline ZrC and ZrN thin films

    Energy Technology Data Exchange (ETDEWEB)

    Martin, C. [Ramapo College of New Jersey, Mahwah, NJ 07430 (United States); Miller, K.H. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Makino, H. [Research Institute, Kochi University of Technology, Kami, Kochi, 782-8502 (Japan); Craciun, D. [National Institute for Laser, Plasma, and Radiation Physics, Bucharest-Magurele (Romania); Simeone, D. [CEA/DEN/DANS/DM2S/SERMA/LEPP-LRC CARMEN CEN Saclay France & CNRS/ SPMS UMR8785 LRC CARMEN, Ecole Centrale de Paris, F92292, Chatenay Malabry (United States); Craciun, V., E-mail: valentin.craciun@inflpr.ro [National Institute for Laser, Plasma, and Radiation Physics, Bucharest-Magurele (Romania)

    2017-05-15

    Employing wide spectral range (0.06–6 eV) optical reflectance measurements and high energy X-ray photoemission spectroscopy (HE-XPS), we studied the effect of 800 keV Ar ion irradiation on optical and electronic properties of nanocrystalline ZrC and ZrN thin films, which were obtain by the pulsed laser deposition technique. Both in ZrC and ZrN, we observed that irradiation affects the optical properties of the films mostly at low frequencies, which is dominated by the free carriers response. In both materials, we found a significant reduction in the free carriers scattering rate and an increase of the zero frequency conductivity, i.e. possible increase in mobility, at higher irradiation fluence. This is consistent with our previous findings that irradiation affects the crystallite size and the micro-strain, but it does not induce major changes in the chemical bonding. HE-XPS investigations further confirms the stability of the Zr-C and Zr-N bonds, despite a small increase in the surface region of the Zr-O bonds fraction with increasing irradiation fluence.

  4. Development of quantum device simulator NEMO-VN1

    Science.gov (United States)

    Hien, Dinh Sy; Thi Luong, Nguyen; Hoang Minh, Le; Tien Phuc, Tran; Thanh Trung, Pham; Dong, Bui An; Thu Thao, Huynh Lam; Van Le Thanh, Nguyen; Tuan, Thi Tran Anh; Hoang Trung, Huynh; Thi Thanh Nhan, Nguyen; Viet Nga, Dinh

    2009-09-01

    We have developed NEMO-VN1 (NanoElectronic MOdelling), a new modelling tool that simulates a wide variety of quantum devices including Quantum Dot (QD), Resonant Tunneling Diode (RTD), Resonant Tunneling Transistor (RTT), Single Electron Transistor (SET), Molecular FET (MFET), Carbon Nanotube FET (CNTFET), Spin FET (SPINFET). It has a collection of models that allow user to trade off between calculation speed and accuracy. NEMO-VN1 also includes a graphic user interface of Matlab that enables parameter entry, calculation control, intuitive display of calculation results, and in-situ data analysis methods.

  5. Development of quantum device simulator NEMO-VN1

    International Nuclear Information System (INIS)

    Dinh Sy Hien; Nguyen Thi Luong; Le Hoang Minh; Tran Tien Phuc; Pham Thanh Trung; Bui An Dong; Huynh Lam Thu Thao; Nguyen Van Le Thanh; Thi Tran Anh Tuan; Huynh Hoang Trung; Nguyen Thi Thanh Nhan; Dinh Viet Nga

    2009-01-01

    We have developed NEMO-VN1 (NanoElectronic MOdelling), a new modelling tool that simulates a wide variety of quantum devices including Quantum Dot (QD), Resonant Tunneling Diode (RTD), Resonant Tunneling Transistor (RTT), Single Electron Transistor (SET), Molecular FET (MFET), Carbon Nanotube FET (CNTFET), Spin FET (SPINFET). It has a collection of models that allow user to trade off between calculation speed and accuracy. NEMO-VN1 also includes a graphic user interface of Matlab that enables parameter entry, calculation control, intuitive display of calculation results, and in-situ data analysis methods.

  6. Novel VN/C nanocomposites as methanol-tolerant oxygen reduction electrocatalyst in alkaline electrolyte

    OpenAIRE

    K. Huang; K. Bi; C. Liang; S. Lin; R. Zhang; W. J. Wang; H. L. Tang; M. Lei

    2015-01-01

    A novel VN/C nanostructure consisting of VN nanoparticles and graphite-dominant carbon layers is synthesized by nitridation of V2O5 using melamine as reductant under inert atmosphere. High crystalline VN nanoparticles are observed to be uniformly distributed in carbon layers with an average size of ca13.45?nm. Moreover, the electrocatalytic performance of VN/C towards oxygen reduction reaction (ORR) in alkaline electrolyte is fascinating. The results show that VN/C has a considerable ORR acti...

  7. Effects of HfB2 and HfN Additions on the Microstructures and Mechanical Properties of TiB2-Based Ceramic Tool Materials

    Science.gov (United States)

    An, Jing; Song, Jinpeng; Liang, Guoxing; Gao, Jiaojiao; Xie, Juncai; Cao, Lei; Wang, Shiying; Lv, Ming

    2017-01-01

    The effects of HfB2 and HfN additions on the microstructures and mechanical properties of TiB2-based ceramic tool materials were investigated. The results showed that the HfB2 additive not only can inhibit the TiB2 grain growth but can also change the morphology of some TiB2 grains from bigger polygons to smaller polygons or longer ovals that are advantageous for forming a relatively fine microstructure, and that the HfN additive had a tendency toward agglomeration. The improvement of flexural strength and Vickers hardness of the TiB2-HfB2 ceramics was due to the relatively fine microstructure; the decrease of fracture toughness was ascribed to the formation of a weaker grain boundary strength due to the brittle rim phase and the poor wettability between HfB2 and Ni. The decrease of the flexural strength and Vickers hardness of the TiB2-HfN ceramics was due to the increase of defects such as TiB2 coarse grains and HfN agglomeration; the enhancement of fracture toughness was mainly attributed to the decrease of the pore number and the increase of the rim phase and TiB2 coarse grains. The toughening mechanisms of TiB2-HfB2 ceramics mainly included crack bridging and transgranular fracture, while the toughening mechanisms of TiB2-HfN ceramics mainly included crack deflection, crack bridging, transgranular fracture, and the core-rim structure. PMID:28772821

  8. Effects of HfB2 and HfN Additions on the Microstructures and Mechanical Properties of TiB2-Based Ceramic Tool Materials

    Directory of Open Access Journals (Sweden)

    Jing An

    2017-04-01

    Full Text Available The effects of HfB2 and HfN additions on the microstructures and mechanical properties of TiB2-based ceramic tool materials were investigated. The results showed that the HfB2 additive not only can inhibit the TiB2 grain growth but can also change the morphology of some TiB2 grains from bigger polygons to smaller polygons or longer ovals that are advantageous for forming a relatively fine microstructure, and that the HfN additive had a tendency toward agglomeration. The improvement of flexural strength and Vickers hardness of the TiB2-HfB2 ceramics was due to the relatively fine microstructure; the decrease of fracture toughness was ascribed to the formation of a weaker grain boundary strength due to the brittle rim phase and the poor wettability between HfB2 and Ni. The decrease of the flexural strength and Vickers hardness of the TiB2-HfN ceramics was due to the increase of defects such as TiB2 coarse grains and HfN agglomeration; the enhancement of fracture toughness was mainly attributed to the decrease of the pore number and the increase of the rim phase and TiB2 coarse grains. The toughening mechanisms of TiB2-HfB2 ceramics mainly included crack bridging and transgranular fracture, while the toughening mechanisms of TiB2-HfN ceramics mainly included crack deflection, crack bridging, transgranular fracture, and the core-rim structure.

  9. Post Irradiation TEM Investigation of ZrN Coated U(Mo) Particles Prepared with FIB

    Energy Technology Data Exchange (ETDEWEB)

    Van Renterghem, W.; Leenaers, A.; Van den Berghe, S.; Miller, B. D.; Gan, J.; Madden, J. W.; Keiser, D. D.; Palancher, H.; Hofman, G. L.; Breitkreuz, H.

    2015-10-01

    In the framework of the Selenium project, two dispersion fuel plates were fabricated with Si and ZrN coated fuel particles and irradiated in the Br2 reactor of SCK•CEN to high burn-up. The first analysis of the irradiated plate proved the reduced swelling of the fuel plate and interaction layer growth up to 70% burn-up. The question was raised how the structure of the interaction layer had been affected by the irradiation and how the structure of the fuel particles had evolved. Hereto, samples from the ZrN coated UMo particles were prepared for transmission electron microscopy (TEM) using focused ion beam milling (FIB) at INL. The FIB technique allowed to precisely select the area of the interaction layer and/or fuel to produce a sample that is TEM transparent over an area of 20 by 20 µm. In this contribution, the first TEM results will be presented from the 66% burn-up sample.

  10. Radiation tolerance of nanostructured ZrN coatings against swift heavy ion irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Janse van Vuuren, A., E-mail: arnojvv@gmail.com [Centre for HRTEM, Physics Department, Nelson Mandela Metropolitan University, Port Elizabeth (South Africa); Skuratov, V.A. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna (Russian Federation); Uglov, V.V. [Department of Solid State Physics, Physics Faculty Belarusian State University, Minsk (Belarus); Neethling, J.H. [Centre for HRTEM, Physics Department, Nelson Mandela Metropolitan University, Port Elizabeth (South Africa); Zlotski, S.V. [Department of Solid State Physics, Physics Faculty Belarusian State University, Minsk (Belarus)

    2013-11-15

    Nano-structured zirconium nitride layers – on Si substrates – of various thicknesses (0.1, 3, 10 and 20 μm) were irradiated with 167 MeV Xe, 250 MeV Kr and 695 MeV Bi ions to fluences in the range from 3 × 10{sup 12} to 2.6 × 10{sup 15} cm{sup −2} for Xe, 1 × 10{sup 13} to 7.06 × 10{sup 13} cm{sup −2} for Kr and 10{sup 12} to 10{sup 13} cm{sup −2} for Bi. The purpose of these irradiation experiments is to simulate the effects of fission fragment bombardment on nanocrystalline ZrN. The irradiated layers where subsequently analysed by X-ray diffraction (XRD), transmission electron microscopy (TEM) and nano-indentation hardness testing (NIH) techniques. XRD, TEM and NIH results indicate that ZrN has a very high tolerance to the effects of high energy irradiation.

  11. Deposition and characterization of zirconium nitride (ZrN) thin films by reactive magnetron sputtering with linear gas ion source and bias voltage

    Energy Technology Data Exchange (ETDEWEB)

    Kavitha, A.; Kannan, R. [Department of Physics, University College of Engineering, Anna University, Dindugal-624622 (India); Subramanian, N. Sankara [Department of Physics, Thiagarajar College of Engineering, Madurai -625015, Tamilnadu (India); Loganathan, S. [Ion Plating, Titan Industries Ltd., Hosur - 635126, Tamilnadu (India)

    2014-04-24

    Zirconium nitride thin films have been prepared on stainless steel substrate (304L grade) by reactive cylindrical magnetron sputtering method with Gas Ion Source (GIS) and bias voltage using optimized coating parameters. The structure and surface morphologies of the ZrN films were characterized using X-ray diffraction, atomic microscopy and scanning electron microscopy. The adhesion property of ZrN thin film has been increased due to the GIS. The coating exhibits better adhesion strength up to 10 N whereas the ZrN thin film with bias voltage exhibits adhesion up to 500 mN.

  12. Comparing XPS on bare and capped ZrN films grown by plasma enhanced ALD: Effect of ambient oxidation

    Science.gov (United States)

    Muneshwar, Triratna; Cadien, Ken

    2018-03-01

    In this article we compare x-ray photoelectron spectroscopy (XPS) measurements on bare- and capped- zirconium nitride (ZrN) films to investigate the effect of ambient sample oxidation on the detected bound O in the form of oxide ZrO2 and/or oxynitride ZrOxNy. ZrN films in both bare- and Al2O3/AlN capped- XPS samples were grown by plasma-enhanced atomic layer deposition (PEALD) technique using tetrakis dimethylamino zirconium (TDMAZr) precursor, forming gas (5% H2, rest N2) inductively coupled plasma (ICP), and as received research grade process gases under identical process conditions. Capped samples were prepared by depositing 1 nm thick PEALD AlN on ZrN, followed by additional deposition of 1 nm thick ALD Al2O3, without venting of ALD reactor. On bare ZrN sample at room temperature, spectroscopic ellipsometry (SE) measurements with increasing ambient exposure times (texp) showed a self-limiting surface oxidation with the oxide thickness (dox) approaching 3.7 ± 0.02 nm for texp > 120 min. In XPS data measured prior to sample sputtering (tsput = 0), ZrO2 and ZrOxNy were detected in bare- samples, whereas only ZrN and Al2O3/AlN from capping layer were detected in capped- samples. For bare-ZrN samples, appearance of ZrO2 and ZrOxNy up to sputter depth (dsput) of 15 nm in depth-profile XPS data is in contradiction with measured dox = 3.7 nm, but explained from sputtering induced atomic inter-diffusion within analyzed sample. Appearance of artifacts in the XPS spectra from moderately sputtered (dsput = 0.2 nm and 0.4 nm) capped-ZrN sample, provides an evidence to ion-bombardment induced modifications within analyzed sample.

  13. Radiation stability of nanocrystalline ZrN coatings irradiated with high energy Xe and Bi ions

    International Nuclear Information System (INIS)

    Skuratov, V.A.; Sokhatsky, A.S.; Uglov, V.V.; Zlotski, S.V.; Van Vuuren, A.J.; Neethling, Jan; O'Connell, J.

    2011-01-01

    Swift Xe and Bi ion irradiation effects in nanocrystalline ZrN coatings as a function of ion fluence are reported. Zirconium nitride films of different thickness (0.1, 3, 10 and 20 micrometers) synthesized by vacuum arc-vapour deposition in nanocrystalline state (average size of crystallites is ∼4 nm) were irradiated with 167 MeV Xe and 695 MeV Bi ions to fluences in the range 3x10 12 ÷2.6x10 15 cm -2 (Xe) and 10 12 x10 13 cm -2 (Bi) and studied using XRD and TEM techniques. No evidence of amorphization due to high level ionizing energy losses has been found. The measurements of lattice parameter have revealed nonmonotonic dependence of the stress level in irradiated samples on ion fluence. (authors)

  14. Degradation of ZrN films at high temperature under controlled atmosphere

    International Nuclear Information System (INIS)

    Lu, F.-H.; Lo, W.-Z.

    2004-01-01

    The degradation of ZrN films deposited onto Si substrates by unbalanced magnetron sputtering was investigated over temperatures of 300-1200 deg. C in different atmospheres by analyzing changes in color and appearance, as well as microstructures. The atmospheres contained air, nitrogen, and forming gas (N 2 /H 2 =9), which exhibited drastically different oxygen/nitrogen partial pressure ratios. The resultant degradation included mainly color changes and formation of blisters on the film surface. Color change was associated with the oxidation of the nitride film, which was analyzed by looking into the Gibbs free-energy changes at various temperatures and oxygen partial pressures. Two types of blisters occurred at different temperature ranges. Several large round blisters, denoted as A-type blisters, occurring at low temperatures originated from the large residual stress in the films. Many small irregular blisters, denoted as B-type blisters, appearing at relatively high temperatures resulted from the oxidation of the film

  15. Tribology of ZRN, CRN and TIALN thin films deposited by reactive magnetron sputtering

    Directory of Open Access Journals (Sweden)

    Alexander Ruden

    2013-01-01

    Full Text Available El coeficiente de fricción y el coeficiente de desgaste, representan dos variables importantes para la elección de recubrimientos duros en aplicaciones críticas de ingeniería tales como corte y conformado de materiales. Para explicar de manera profunda estas variables, es necesario conocer los diferentes tipos de desgaste que ocurren en estas superficies recubiertas. Se han evaluado recubrimientos de nitruro de circonio (ZrN, nitruro de cromo (CrN y nitruro de titanio aluminio (TiAlN, producidos por la técnica magnetrón sputtering reactivo, determinando las propiedades tribológicas, midiendo coeficientes de fricción (COF y desgaste, y mostrando un análisis de los mecanismos de desgaste presentes para cada recubrimiento durante el contacto tribológico en sistemas cerámicos. Se observó que el voltaje de polarización incrementa las fallas por deformación plástica y la generación de un tercer cuerpo en la superficie del ZrN. El aumento del flujo de nitrógeno en la deposición de CrN, mejora el comportamiento tribológico al segregar la fase cúbica del material, optimizando sus propiedades superficiales. Al incrementar la temperatura de deposición del TiAlN se mejora su calidad superficial (reducción de rugosidad y densidad de poros, reduciendo la abrasión y aumentando la capacidad de carga del compuesto.

  16. The effect of sintering conditions and ZrN volume fraction on the mechanical properties of spark plasma sintered W/ZrN composites

    International Nuclear Information System (INIS)

    Lee, Dongju; Umer, Malik Adeel; Shin, Yoochul; Jeon, Seokwoo; Hong, Soonhyung

    2012-01-01

    Highlights: ► Effect of sintering conditions on properties of W composites was investigated. ► Effect of ZrN volume fraction on properties of W composites was investigated. ► The grain size and relative density increased with increasing sintering temperature. ► ZrN particles led to an increase in strength of W and a decrease in grain size. ► Highest flexural strength was obtained for 10 vol.% W/ZrN with lowest agglomeration. - Abstract: In an effort to improve the room temperature mechanical properties of tungsten, W/ZrN composites were fabricated by high energy ball milling followed by spark plasma sintering at temperatures in a range of 1200–1700 °C under a pressure of 50 MPa. The effects of sintering conditions and ZrN volume fraction on the mechanical properties of the W/ZrN composites were studied and the results were compared to the properties of monolithic tungsten. The grain size of monolith tungsten and W/ZrN composites was found to increase with an increase in sintering temperature and time. In the case of the W/ZrN composites, ZrN particles led to an increase in the compressive strength of tungsten and a decrease in grain size. The increase in compressive strength of the composites was attributed to a reinforcement effect of ZrN particles as well as grain size refinement according to the Hall–Petch relation. Compressive strength of the composites increased with increasing ZrN content while the flexural strength decreased for samples with ZrN content exceeding 10 vol.%. This was attributed to the effects of ZrN agglomeration within the tungsten matrix.

  17. Hybrid MnO2/carbon nanotube-VN/carbon nanotube supercapacitors

    Science.gov (United States)

    Su, Y.; Zhitomirsky, I.

    2014-12-01

    Composite materials, containing fibrous VN nanoparticles and multiwalled carbon nanotubes (MWCNT) are prepared by a chemical method for application in electrochemical supercapacitors. We demonstrate for the first time that VN-MWCNT electrodes exhibit good capacitive behavior in 0.5 M Na2SO4 electrolyte in a negative voltage window of 0.9 V. Quartz crystal microbalance studies provide an insight into the mechanism of charge storage. Composite VN-MWCNT materials show significant improvement in capacitance, compared to individual VN and MWCNT materials. Testing results indicate that VN-MWCNT electrodes exhibit high specific capacitance at high mass loadings in the range of 10-30 mg cm-2, good capacitance retention at scan rates in the range of 2-200 mV s-1 and good cycling stability. The highest specific capacitance of 160 F g-1 is achieved at a scan rate of 2 mV s-1. The new findings open a new and promising strategy in the fabrication of hybrid devices based on VN. The proof-of-principle is demonstrated by the fabrication of hybrid supercapacitor devices based on VN-MWCNT negative electrodes and MnO2 -MWCNT positive electrodes with voltage window of 1.8 V in aqueous 0.5 M Na2SO4 electrolyte. The hybrid VN-MWCNT/MnO2-MWCNT supercapacitor cells show promising capacitive and power-energy characteristics.

  18. Novel VN/C nanocomposites as methanol-tolerant oxygen reduction electrocatalyst in alkaline electrolyte

    Science.gov (United States)

    Huang, K.; Bi, K.; Liang, C.; Lin, S.; Zhang, R.; Wang, W. J.; Tang, H. L.; Lei, M.

    2015-06-01

    A novel VN/C nanostructure consisting of VN nanoparticles and graphite-dominant carbon layers is synthesized by nitridation of V2O5 using melamine as reductant under inert atmosphere. High crystalline VN nanoparticles are observed to be uniformly distributed in carbon layers with an average size of ca13.45 nm. Moreover, the electrocatalytic performance of VN/C towards oxygen reduction reaction (ORR) in alkaline electrolyte is fascinating. The results show that VN/C has a considerable ORR activity, including a 75 percent value of the diffusion-limited current density and a 0.11 V smaller value about the onset potential with respect to Pt/C catalyst. Moreover, the excellent methanol-tolerance performance of VN/C has also been verified with 3 M methanol. Combined with the competitive prices, this VN/C nanocomposite can serve as an appropriate non-precious methanol-tolerant ORR catalyst for alkaline fuel cells.

  19. Predissociation measurements of bond dissociation energies: VC, VN, and VS

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Eric L.; Davis, Quincy C.; Morse, Michael D. [Department of Chemistry, University of Utah, Salt Lake City, Utah 84112 (United States)

    2016-06-21

    The abrupt onset of predissociation in the congested electronic spectra of jet-cooled VC, VN, and VS has been observed using resonant two-photon ionization spectroscopy. It is argued that because of the high density of electronic states in these molecules, the predissociation threshold occurs at the thermochemical threshold for the production of separated atoms in their ground electronic states. As a result, the measured threshold represents the bond dissociation energy. Using this method, bond dissociation energies of D{sub 0}(V C) = 4.1086(25) eV, D{sub 0}(V N) = 4.9968(20) eV, and D{sub 0}(V S) = 4.5353(25) eV are obtained. From these values, enthalpies of formation are derived as Δ{sub f,0K}H°(V C(g)) = 827.0 ± 8 kJ mol{sup −1}, Δ{sub f,0K}H°(V N(g)) = 500.9 ± 8 kJ mol{sup −1}, and Δ{sub f,0K}H°(V S(g)) = 349.3 ± 8 kJ mol{sup −1}. Using a thermochemical cycle and the well-known ionization energies of V, VC, and VN, our results also provide D{sub 0}(V{sup +}–C) = 3.7242(25) eV and D{sub 0}(V{sup +}–N) = 4.6871(20) eV. These values are compared to previous measurements and to computational results. The precision of these bond dissociation energies makes them good candidates for testing computational chemistry methods, particularly those that employ density functional theory.

  20. ZrN coatings deposited by high power impulse magnetron sputtering and cathodic arc techniques

    Energy Technology Data Exchange (ETDEWEB)

    Purandare, Yashodhan, E-mail: Y.Purandare@shu.ac.uk; Ehiasarian, Arutiun; Hovsepian, Papken [Nanotechnology Centre for PVD Research, Materials and Engineering Research Institute, Sheffield Hallam University, Sheffield S1 1WB (United Kingdom); Santana, Antonio [Ionbond AG Olten, Industriestrasse 211, CH-4600 Olten (Switzerland)

    2014-05-15

    Zirconium nitride (ZrN) coatings were deposited on 1 μm finish high speed steel and 316L stainless steel test coupons. Cathodic Arc (CA) and High Power Impulse Magnetron Sputtering (HIPIMS) + Unbalanced Magnetron Sputtering (UBM) techniques were utilized to deposit coatings. CA plasmas are known to be rich in metal and gas ions of the depositing species as well as macroparticles (droplets) emitted from the arc sports. Combining HIPIMS technique with UBM in the same deposition process facilitated increased ion bombardment on the depositing species during coating growth maintaining high deposition rate. Prior to coating deposition, substrates were pretreated with Zr{sup +} rich plasma, for both arc deposited and HIPIMS deposited coatings, which led to a very high scratch adhesion value (L{sub C2}) of 100 N. Characterization results revealed the overall thickness of the coatings in the range of 2.5 μm with hardness in the range of 30–40 GPa depending on the deposition technique. Cross-sectional transmission electron microscopy and tribological experiments such as dry sliding wear tests and corrosion studies have been utilized to study the effects of ion bombardment on the structure and properties of these coatings. In all the cases, HIPIMS assisted UBM deposited coating fared equal or better than the arc deposited coatings, the reasons being discussed in this paper. Thus H+U coatings provide a good alternative to arc deposited where smooth, dense coatings are required and macrodroplets cannot be tolerated.

  1. Limited geographic distribution of the novel cyclovirus CyCV-VN.

    Science.gov (United States)

    Le, Van Tan; de Jong, Menno D; Nguyen, Van Kinh; Nguyen, Vu Trung; Taylor, Walter; Wertheim, Heiman F L; van der Ende, Arie; van der Hoek, Lia; Canuti, Marta; Crusat, Martin; Sona, Soeng; Nguyen, Hanh Uyen; Giri, Abhishek; Nguyen, Thi Thuy Chinh Bkrong; Ho, Dang Trung Nghia; Farrar, Jeremy; Bryant, Juliet E; Tran, Tinh Hien; Nguyen, Van Vinh Chau; van Doorn, H Rogier

    2014-02-05

    A novel cyclovirus, CyCV-VN, was recently identified in cerebrospinal fluid (CSF) from patients with central nervous system (CNS) infections in central and southern Vietnam. To explore the geographic distribution of this novel virus, more than 600 CSF specimens from patients with suspected CNS infections in northern Vietnam, Cambodia, Nepal and The Netherlands were screened for the presence of CyCV-VN but all were negative. Sequence comparison and phylogenetic analysis between CyCV-VN and another novel cyclovirus recently identified in CSF from Malawian patients indicated that these represent distinct cycloviral species, albeit phylogenetically closely related. The data suggest that CyCV-VN has a limited geographic distribution within southern and central Vietnam. Further research is needed to determine the global distribution and diversity of cycloviruses and importantly their possible association with human disease.

  2. Cyclovirus CyCV-VN species distribution is not limited to Vietnam and extends to Africa.

    Science.gov (United States)

    Garigliany, Mutien-Marie; Hagen, Ralf Matthias; Frickmann, Hagen; May, Jürgen; Schwarz, Norbert Georg; Perse, Amanda; Jöst, Hanna; Börstler, Jessica; Shahhosseini, Nariman; Desmecht, Daniel; Mbunkah, Herbert Afegenwi; Daniel, Achukwi Mbunkah; Kingsley, Manchang Tanyi; Campos, Renata de Mendonca; de Paula, Vanessa Salete; Randriamampionona, Njary; Poppert, Sven; Tannich, Egbert; Rakotozandrindrainy, Raphael; Cadar, Daniel; Schmidt-Chanasit, Jonas

    2014-12-18

    Cycloviruses, small ssDNA viruses of the Circoviridae family, have been identified in the cerebrospinal fluid from symptomatic human patients. One of these species, cyclovirus-Vietnam (CyCV-VN), was shown to be restricted to central and southern Vietnam. Here we report the detection of CyCV-VN species in stool samples from pigs and humans from Africa, far beyond their supposed limited geographic distribution.

  3. Investigation of the physical properties of ion assisted ZrN thin films deposited by RF magnetron sputtering

    International Nuclear Information System (INIS)

    Signore, M A; Valerini, D; Rizzo, A; Tapfer, L; Capodieci, L; Cappello, A

    2010-01-01

    Ion bombardment during thin film growth is known to cause structural and morphological changes in the deposited films, thus affecting their physical properties. In this work zirconium nitride films have been deposited by the ion assisted magnetron sputtering technique. The ion energy is controlled by varying the voltage applied to the substrate in the range 0-25 V. The deposited ZrN films are characterized for their structure, surface roughness, oxygen contamination, optical reflectance and electrical resistivity. With increasing substrate voltage crystallinity of the films is enhanced with a preferential orientation of the ZrN grains having the (1 1 1) axis perpendicular to the substrate surface. At the same time, a decrease in electrical resistivity and oxygen contamination content is observed up to 20 V. A higher substrate voltage (25 V) causes an inversion in the observed experimental trends. The role of oxygen contamination decrease and generation of nitrogen vacancies due to ionic assistance have been considered as a possible explanation for the experimental results.

  4. Transmission electron microscopy investigation of neutron irradiated Si and ZrN coated UMo particles prepared using FIB

    Science.gov (United States)

    Van Renterghem, W.; Miller, B. D.; Leenaers, A.; Van den Berghe, S.; Gan, J.; Madden, J. W.; Keiser, D. D.

    2018-01-01

    Two fuel plates, containing Si and ZrN coated U-Mo fuel particles dispersed in an Al matrix, were irradiated in the BR2 reactor of SCK•CEN to a burn-up of ∼70% 235U. Five samples were prepared by INL using focused ion beam milling and transported to SCK•CEN for transmission electron microscopy (TEM) investigation. Two samples were taken from the Si coated U-Mo fuel particles at a burn-up of ∼42% and ∼66% 235U and three samples from the ZrN coated U-Mo at a burn-up of ∼42%, ∼52% and ∼66% 235U. The evolution of the coating, fuel structure, fission products and the formation of interaction layers are discussed. Both coatings appear to be an effective barrier against fuel matrix interaction and only on the samples having received the highest burn-up and power, the formation of an interaction between Al and U(Mo) can be observed on those locations where breaches in the coatings were formed during plate fabrication.

  5. Investigation of the physical properties of ion assisted ZrN thin films deposited by RF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Signore, M A; Valerini, D; Rizzo, A; Tapfer, L; Capodieci, L; Cappello, A [ENEA, Department of Physical Technologies and New Materials, SS7, Appia, km 706, 72100 Brindisi (Italy)

    2010-06-09

    Ion bombardment during thin film growth is known to cause structural and morphological changes in the deposited films, thus affecting their physical properties. In this work zirconium nitride films have been deposited by the ion assisted magnetron sputtering technique. The ion energy is controlled by varying the voltage applied to the substrate in the range 0-25 V. The deposited ZrN films are characterized for their structure, surface roughness, oxygen contamination, optical reflectance and electrical resistivity. With increasing substrate voltage crystallinity of the films is enhanced with a preferential orientation of the ZrN grains having the (1 1 1) axis perpendicular to the substrate surface. At the same time, a decrease in electrical resistivity and oxygen contamination content is observed up to 20 V. A higher substrate voltage (25 V) causes an inversion in the observed experimental trends. The role of oxygen contamination decrease and generation of nitrogen vacancies due to ionic assistance have been considered as a possible explanation for the experimental results.

  6. Preparation of nanocrystalline VN by the melamine reduction of V2O5 xerogel and its supercapacitive behavior

    International Nuclear Information System (INIS)

    Cheng Fukui; He Chun; Shu Dong; Chen Hongyu; Zhang Jie; Tang Shaoqing; Finlow, David E.

    2011-01-01

    Highlights: ► Organic nitridizing agent was employed for preparation of nanocrystalline VN. ► The supercapacitive behavior of VN was studied by electrochemical method. ► The supercapacitive behavior of VN was studied in three kinds of electrolyte. ► The specific capacitance of VN was determined as 273 F g −1 in 1.0 M KOH. ► The supercapacitive mechanism and involved factor on capacitance were analyzed. - Abstract: An organic nitridizing reagent was employed in the preparation of nanocrystalline VN at 800 °C under a N 2 atmosphere. The prepared VN was characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS), and its supercapacitive behavior was studied by cyclic voltammetry (CV) in three different types of aqueous electrolyte, 0.5 M H 2 SO 4 , 2.0 M NaNO 3 and 1.0 M KOH. The XRD results indicate that prepared VN has a cubic structure with space group Fm3m and a lattice parameter of 4.139 Å. The nanocrystalline structure of VN with a low degree of crystallinity was confirmed by TEM imaging. The presence of oxygen on the VN surface was detected by FTIR and XPS, and its molecular composition was determined to be VN 1.02 O 0.1 . The specific capacitances of nanocrystalline VN were determined to be 114, 45.7 and 273 F g −1 in 0.5 M H 2 SO 4 , 2.0 M NaNO 3 and 1.0 M KOH, respectively. Thus, the KOH solution was considered the best aqueous electrolyte for the capacitive performance of VN. The supercapacitive mechanism and the factor that influenced the specific capacitance are also analyzed in this paper.

  7. Investigating the influence of epitaxial modulation on the evolution of superhardness of the VN/TiB{sub 2} multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Pan, Yupeng [Energy and Materials Engineering Centre, College of Physics and Materials Science, Tianjin Normal University, Tianjin 300387 (China); Tianjin International Joint Research Centre of Surface Technology for Energy Storage Materials, Tianjin 300387 (China); Dong, Lei, E-mail: dlei0008@126.com [Energy and Materials Engineering Centre, College of Physics and Materials Science, Tianjin Normal University, Tianjin 300387 (China); Tianjin International Joint Research Centre of Surface Technology for Energy Storage Materials, Tianjin 300387 (China); Liu, Na; Yu, Jiangang; Li, Chun [Energy and Materials Engineering Centre, College of Physics and Materials Science, Tianjin Normal University, Tianjin 300387 (China); Tianjin International Joint Research Centre of Surface Technology for Energy Storage Materials, Tianjin 300387 (China); Li, Dejun, E-mail: dejunli@mail.tjnu.edu.cn [Energy and Materials Engineering Centre, College of Physics and Materials Science, Tianjin Normal University, Tianjin 300387 (China); Tianjin International Joint Research Centre of Surface Technology for Energy Storage Materials, Tianjin 300387 (China)

    2016-12-30

    Graphical abstract: The novel VN/TiB{sub 2} multilayers were produced by a magnetron sputtering system. Reasonable modulation structure affected properties of the multilayers. The double epitaxial growth as shown in HRTEM images was newly found to be a main reason for coherent growth of the VN/TiB{sub 2} multilayers within a certain thickness. The coherent growth model of the multilayer was also used to explain the growth mechanism of the VN/TiB{sub 2} multilayers in this work, which provided a useful inspiration to understand the strategies to enhance the multilayers’ engineering applications. - Highlights: • The VN/TiB{sub 2} multilayers are produced by magnetron sputtering. • A kind of second epitaxial growth is found in multilayer. • The coherent growth model is designed to explain the growth mechanism. • Second epitaxial growth promotes to form superhardness. • Coherent growth appears twice with modulation ratios decreasing. - Abstract: A series of the VN/TiB{sub 2} nanomultilayers with different modulation ratios (t{sub VN}:t{sub TiB2}) and different modulation periods were synthesized via a magnetron sputtering system. The cross-sectional transmission electron microscopy (TEM) and x-ray diffraction (XRD) examinations indicated that in the alternately deposited monolayers of the VN and TiB{sub 2}, due to the influence of the crystal (111){sub VN} texture, TiB{sub 2} layer presented epitaxial growth on the surface of the VN layer when its t{sub VN}:t{sub TiB2} was 5:1. Moreover, the formation of the TiB{sub 2} crystal promoted the growth of (200){sub VN} and significantly improved the preferential growth of nanomultilayers. With decreasing t{sub VN}:t{sub TiB2} to 1:7, the thin VN layer was crystallized under the introduction of crystalline TiB{sub 2} layers. A type of double epitaxial growth was observed to be a main reason for the coherent growth of the VN/TiB{sub 2} nanomultilayers within a certain thickness. Consequently, the multilayers

  8. Effects of Plasma ZrN Metallurgy and Shot Peening Duplex Treatment on Fretting Wear and Fretting Fatigue Behavior of Ti6Al4V Alloy.

    Science.gov (United States)

    Tang, Jingang; Liu, Daoxin; Zhang, Xiaohua; Du, Dongxing; Yu, Shouming

    2016-03-23

    A metallurgical zirconium nitride (ZrN) layer was fabricated using glow metallurgy using nitriding with zirconiuming prior treatment of the Ti6Al4V alloy. The microstructure, composition and microhardness of the corresponding layer were studied. The influence of this treatment on fretting wear (FW) and fretting fatigue (FF) behavior of the Ti6Al4V alloy was studied. The composite layer consisted of an 8-μm-thick ZrN compound layer and a 50-μm-thick nitrogen-rich Zr-Ti solid solution layer. The surface microhardness of the composite layer is 1775 HK 0.1 . A gradient in cross-sectional microhardness distribution exists in the layer. The plasma ZrN metallurgical layer improves the FW resistance of the Ti6Al4V alloy, but reduces the base FF resistance. This occurs because the improvement in surface hardness results in lowering of the toughness and increasing in the notch sensitivity. Compared with shot peening treatment, plasma ZrN metallurgy and shot peening composite treatment improves the FW resistance and enhances the FF resistance of the Ti6Al4V alloy. This is attributed to the introduction of a compressive stress field. The combination of toughness, strength, FW resistance and fatigue resistance enhance the FF resistance for titanium alloy.

  9. TiN/VN composites with core/shell structure for supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Dong, Shanmu; Chen, Xiao [Qingdao Institute of Bioenergy and Bioprocess Technology, Chinese Academy of Sciences, No. 189 Songling Road, Qingdao 266101 (China); Gu, Lin [WPI Advanced Institute for Materials Research, Tohoku University, Sendai 9808577 (Japan); Zhou, Xinhong [Qingdao University of Science and Technology, Qingdao 266101 (China); Wang, Haibo; Liu, Zhihong; Han, Pengxian; Yao, Jianhua; Wang, Li [Qingdao Institute of Bioenergy and Bioprocess Technology, Chinese Academy of Sciences, No. 189 Songling Road, Qingdao 266101 (China); Cui, Guanglei, E-mail: cuigl@qibebt.ac.cn [Qingdao Institute of Bioenergy and Bioprocess Technology, Chinese Academy of Sciences, No. 189 Songling Road, Qingdao 266101 (China); Chen, Liquan [Qingdao Institute of Bioenergy and Bioprocess Technology, Chinese Academy of Sciences, No. 189 Songling Road, Qingdao 266101 (China); Institute of Physics, Chinese Academy of Sciences, Beijing 100080 (China)

    2011-06-15

    Research highlights: {yields} Vanadium and titanium nitride nanocomposite with core-shell structure was prepared. {yields} TiN/VN composites with different V:Ti molar ratios were obtained. {yields} TiN/VN composites can provide promising electronic conductivity and favorable capacity storage. -- Abstract: TiN/VN core-shell composites are prepared by a two-step strategy involving coating of commercial TiN nanoparticles with V{sub 2}O{sub 5}.nH{sub 2}O sols followed by ammonia reduction. The highest specific capacitance of 170 F g{sup -1} is obtained when scanned at 2 mV s{sup -1} and a promising rate capacity performance is maintained at higher voltage sweep rates. These results indicate that these composites with good electronic conductivity can deliver a favorable capacity performance.

  10. Limited geographic distribution of the novel cyclovirus CyCV-VN

    NARCIS (Netherlands)

    Le, Van Tan; de Jong, Menno D.; Nguyen, Van Kinh; Nguyen, Vu Trung; Taylor, Walter; Wertheim, Heiman F. L.; van der Ende, Arie; van der Hoek, Lia; Canuti, Marta; Crusat, Martin; Sona, Soeng; Nguyen, Hanh Uyen; Giri, Abhishek; Nguyen, Thi Thuy Chinh Bkrong; Ho, Dang Trung Nghia; Farrar, Jeremy; Bryant, Juliet E.; Tran, Tinh Hien; Nguyen, Van Vinh Chau; van Doorn, H. Rogier

    2014-01-01

    A novel cyclovirus, CyCV-VN, was recently identified in cerebrospinal fluid (CSF) from patients with central nervous system (CNS) infections in central and southern Vietnam. To explore the geographic distribution of this novel virus, more than 600 CSF specimens from patients with suspected CNS

  11. Potential of HfN, ZrN, and TiH as hot carrier absorber and Al2O3/Ge quantum well/Al2O3 and Al2O3/PbS quantum dots/Al2O3 as energy selective contacts

    Science.gov (United States)

    Shrestha, Santosh; Chung, Simon; Liao, Yuanxun; Wang, Pei; Cao, Wenkai; Wen, Xiaoming; Gupta, Neeti; Conibeer, Gavin

    2017-08-01

    The hot carrier (HC) solar cell is one of the most promising advanced photovoltaic concepts. It aims to minimise two major losses in single junction solar cells due to sub-band gap loss and thermalisation of above band gap photons by using a small bandgap absorber, and, importantly, collecting the photo-generated carriers before they thermalise. In this paper we will present recent development of the two critical components of the HC solar cell, i.e., the absorber and energy selective contacts (ESCs). For absorber, fabrication and carrier cooling rates in potential bulk materials — hafnium nitride, zirconium nitride, and titanium hydride are presented. Results of ESCs employing double barrier resonant tunneling structures Al2O3/Ge quantum well (QW)/Al2O3 and Al2O3/PbS quantum dots (QDs)/Al2O3 are also presented. These results are expected to guide further development of practical HC solar cell devices.

  12. A comparative wear study of sputtered ZrN coatings on Si and titanium modified stainless steel substrates

    International Nuclear Information System (INIS)

    Singh, Akash; Kuppusami, P.; Thirumurugesan, R.; Mohandas, E.; Geetha, M.; Kamaraj, V.; Kumar, Niranjan

    2010-01-01

    In the present work wear behaviour of ZrN films grown by a pulsed direct current magnetron sputtering method is reported. The films were grown on silicon (100) and titanium modified stainless steel (alloy-D9) substrates by reactive sputtering in a mixture of argon and nitrogen gases. The structural parameters, preferred orientation and crystallite size as a function of substrate temperatures in the range 300-873 K were studied using X-Ray Diffraction. Deposition parameters have been found to influence the growth rate, crystalline structure and surface roughness, which affect the tribological behaviour of the films. A comparative wear study was performed on these substrates with steel and ceramic balls to evaluate the frictional properties of films. The best tribological performance was found for the sample grown with low flow rates of nitrogen (≤ 2 SCCM) at 873K. The coefficient of friction was found to be lower for the films deposited at higher temperature using steel and ceramic balls. This behaviour was correlated with microstructure and deformation behaviour of coatings. (author)

  13. Surface structure of VN0.89(100) determined by low-energy electron diffraction

    International Nuclear Information System (INIS)

    Gauthier, Y.; Joly, Y.; Rundgren, J.; Johansson, L.I.; Wincott, P.

    1990-01-01

    The structure of the (100) surface of substoichiometric vanadium nitride was studied by low-energy electron diffraction on a VN 0.89 (100) sample. A simple 1x1 (100) diffractogram was observed. To describe the electron scattering in substoichiometric VN we apply the averaged t-matrix approximation to the nitrogen atoms. We find that the best structural model is one having no nitrogen vacancies in the surface region. It turns out that the first layer is rippled with the N atoms displaced 0.17 A above the subplane of V atoms, that the spacing between this subplane and the second layer is 1.92 A, and that the spacing between the second and the third layer is 2.08 A. In relation to the (100) spacing of the bulk, 2.06 A, these spacings are 6.8% contracted and 1% expanded, respectively. The Debye temperature of VN is found to be 660 K in good agreement with a prediction from entropy data and from neutron diffraction and helium-ion channeling experiments

  14. Autophagy inhibition synergistically enhances anti-cancer efficacy of RAMBA, VN/12-1 in SKBR-3 cells and tumor xenografts

    Science.gov (United States)

    Godbole, Abhijit M.; Purushottamachar, Puranik; Martin, Marlena S.; Daskalakis, Constantine; Njar, Vincent C. O.

    2012-01-01

    VN/12-1 is a novel retinoic acid metabolism blocking agent (RAMBA) discovered in our laboratory. The purpose of the study was to elucidate the molecular mechanism of VN/12-1’s anticancer activity in breast cancer cell lines and in tumor xenografts. We investigated the effects of VN/12-1 on induction of autophagy andapoptosis in SKBR-3 cells. Further, we also examined the impact of pharmacological and genomic inhibition of autophagy on VN/12-1’s anti-cancer activity. Finally, the anti-tumor activity of VN/12-1 was evaluated as a single agent and in combination with autophagy inhibitor chloroquine (CHL) in an SKBR-3 mouse xenograft model. Short exposure of low dose (< 10 µM) of VN/12-1 induced endoplasmic reticulum stress (ERS), autophagy and inhibits G1-S phase transition and caused a protective response. However, higher dose of VN/12-1 initiates apoptosis in vitro. Inhibition of autophagy using either pharmacological inhibitors or RNA interference of Beclin-1 enhanced anti-cancer activity induced by VN/12-1 in SKBR-3 cells by triggering apoptosis. Importantly, VN/12-1 (5 mg/kg twice weekly) and the combination of VN/12-1 (5 mg/kg twice weekly) + chloroquine (50 mg/kg twice weekly) significantly suppressed established SKBR-3 tumor growth by 81.4% (p < 0.001 vs. control) and 96.2% (p < 0.001 vs. control), respectively. Our novel findings suggest that VN/12-1 may be useful as a single agent or in combination with autophagy inhibitors for treating human breast cancers. Our data provides a strong rationale for clinical evaluation of VN/12-1 as single agent or in combination with autophagy inhibitors. PMID:22334589

  15. Effects of nitrogen gas ratio on the structural and corrosion properties of ZrN thin films grown on biodegradable magnesium alloy by ion-beam sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Kiahosseini, Seyed Rahim [Islamic Azad University, Department of Engineering, Damghan Branch, Damghan (Iran, Islamic Republic of); Mojtahedzadeh Larijani, Majid [Nuclear Sciences and Technology Institute, Radiation Application Research School, Tehran (Iran, Islamic Republic of)

    2017-12-15

    Studies on the corrosion resistance of magnesium alloys, which are widely applied as biomaterials, have increased in recent years. In this work, zirconium nitride (ZrN) coatings were deposited on AZ91 magnesium alloy through ion-beam sputtering at 473 K with 0.3, 0.4, 0.5, and 0.6 nitrogen proportions [F(N{sub 2})] in ionized gas. X-ray diffraction, profilometry, hardness tests, scanning electron microscopy, and potentiodynamic polarization techniques were used to analyze the structure, thickness, adhesion, microstructure, and corrosion resistance of coated samples, respectively. Results showed that the (111) crystalline orientation dominated in all coatings. Williamson-Hall technique revealed that the crystallite size of ZrN films decreased from 73 to 20 nm with increasing F(N{sub 2}), and compressive microstrain increased from 0.004 to 0.030. Film thicknesses were inversely correlated with N{sub 2} amount and significantly decreased from 1.7 to 0.8 μm. The maximum dP/dr ratio, a dependent factor of adhesion, was 0.04 kg/cm for the film deposited under the F(N{sub 2}) value of 0.5. The corrosion potential of coated samples was not significantly different from that of uncoated AZ91. Under the F(N{sub 2}) value of 0.6, corrosion current density slightly decreased from 14 to 9.7 μA/cm{sup 2} and significantly increased to 13.5 μA/cm{sup 2}. Results indicated that ZrN film deposited under the F(N{sub 2}) value of 0.5 showed high adhesion and corrosion resistance. (orig.)

  16. Crystallographic study of Si and ZrN coated U–Mo atomised particles and of their interaction with al under thermal annealing

    International Nuclear Information System (INIS)

    Zweifel, T.; Palancher, H.; Leenaers, A.; Bonnin, A.; Honkimaki, V.; Tucoulou, R.; Van Den Berghe, S.; Jungwirth, R.; Charollais, F.; Petry, W.

    2013-01-01

    A new type of high density fuel is needed for the conversion of research and test reactors from high to lower enriched uranium. The most promising one is a dispersion of atomized uranium-molybdenum (U–Mo) particles in an Al matrix. However, during in-pile irradiation the growth of an interaction layer between the U–Mo and the Al matrix strongly limits the fuel’s performance. To improve the in-pile behaviour, the U–Mo particles can be coated with protective layers. The SELENIUM (Surface Engineering of Low ENrIched Uranium–Molybdenum) fuel development project consists of the production, irradiation and post-irradiation examination of 2 flat, full-size dispersion fuel plates containing respectively Si and ZrN coated U–Mo atomized powder dispersed in a pure Al matrix. In this paper X-ray diffraction analyses of the Si and ZrN layers after deposition, fuel plate manufacturing and thermal annealing are reported. It was found for the U–Mo particles coated with ZrN (thickness 1 μm), that the layer is crystalline, and exhibits lower density than the theoretical one. Fuel plate manufacturing does not strongly influence these crystallographic features. For the U–Mo particles coated with Si (thickness 0.6 μm), the measurements of the as received material suggest an amorphous state of the deposited layer. Fuel plate manufacturing strongly modifies its composition: Si reacts with the U–Mo particles and the Al matrix to grow U(Al, Si) 3 and U 3 Si 5 phases. Finally both coatings have shown excellent performances under thermal treatment by limiting drastically the U–Mo/Al interdiffusion

  17. Effects of nitrogen gas ratio on the structural and corrosion properties of ZrN thin films grown on biodegradable magnesium alloy by ion-beam sputtering

    Science.gov (United States)

    Kiahosseini, Seyed Rahim; Mojtahedzadeh Larijani, Majid

    2017-12-01

    Studies on the corrosion resistance of magnesium alloys, which are widely applied as biomaterials, have increased in recent years. In this work, zirconium nitride (ZrN) coatings were deposited on AZ91 magnesium alloy through ion-beam sputtering at 473 K with 0.3, 0.4, 0.5, and 0.6 nitrogen proportions [F(N2)] in ionized gas. X-ray diffraction, profilometry, hardness tests, scanning electron microscopy, and potentiodynamic polarization techniques were used to analyze the structure, thickness, adhesion, microstructure, and corrosion resistance of coated samples, respectively. Results showed that the (111) crystalline orientation dominated in all coatings. Williamson-Hall technique revealed that the crystallite size of ZrN films decreased from 73 to 20 nm with increasing F(N2), and compressive microstrain increased from 0.004 to 0.030. Film thicknesses were inversely correlated with N2 amount and significantly decreased from 1.7 to 0.8 µm. The maximum d P/d r ratio, a dependent factor of adhesion, was 0.04 kg/cm for the film deposited under the F(N2) value of 0.5. The corrosion potential of coated samples was not significantly different from that of uncoated AZ91. Under the F(N2) value of 0.6, corrosion current density slightly decreased from 14 to 9.7 µA/cm2 and significantly increased to 13.5 µA/cm2. Results indicated that ZrN film deposited under the F(N2) value of 0.5 showed high adhesion and corrosion resistance.

  18. Právní aspekty jeruzalémského procesu s Adolfem Eichmannem

    OpenAIRE

    Kohout, David

    2009-01-01

    -89- 6 English Résumé, Key Words Právní aspekty jeruzalémského procesu s Adolfem Eichmannem Legal Aspects of the Jerusalem Trial of Adolf Eichmann Résumé In this diploma thesis I tried to provide a more or less complete overview of legal aspects of the trial of Adolf Eichmann and to point out some of its extra-legal consequences too. This trial took place in Jerusalem and together with the pre-trial proceedings it spanned more than two years. On the course of those two years (and predominan...

  19. Thermodiffusion Mo-B-Si coating on VN-3 niobium alloy

    International Nuclear Information System (INIS)

    Kozlov, A.T.; Lazarev, Eh.M.; Monakhova, L.A.; Shestova, V.F.; Romanovich, I.V.

    1985-01-01

    Protective properties of complex Mo-B-Si-coating on niobium alloy VN-3 (4.7 mass.% Mo, 1.1 mass.% Zr, 0.1 mass.% C) have been studied. It is established, that the complex Mo-B-Si-coating ensures protection from oxidation of niobium alloys in the temperature range of 800-1200 degC for 1000-1500 hr, at 1600 degC - for 10 hr. High heat resistance of Mo-B-Si - coating at 800-1200 degC is determined by the presence of amorphous film of SiOΛ2 over the layer MoSiΛ2 and barrier boride layer on the boundary with the metal protected; decrease in the coating heat resistance at 1600 degC is related to the destruction of boride layer, decomposition of MoSiΛ2 for lower cilicides and loosening of SiOΛ2 film

  20. Interaction of Cr-Ti-Si coating on VN-3 niobium alloy with air environment

    International Nuclear Information System (INIS)

    Lazarev, Eh.M.; Kozlov, A.T.; Monakhova, L.A.

    1985-01-01

    Investigation of heat-resistance, microstructure and phase composition of Cr-Ti-Si coating on VN-3 niobium alloy with air oxidation in the temperature interval of 1200-1600 deg C is conducted. Thermogravimetry, metallography, X-ray diffraction and microprobe analysis methods are used. It is ascertained that the coating is a dense niobium disilicide layer, luriched on the surface with chromium and titanium disilicides and separated and from the protected alloy by a narrow zone of the lowest niobium silicide Nb 5 Si 3 . The coating protective junctions are provided by a selective chromium and titanium disilicides oxidation as well as niobium disilicide oxidation at the temperature of 1600 deg C, and by the rates of niobium and silicon diffusion through Nb 5 SI 3 and NbSi 2 and oxygen diffusion through the amorphous SiO 2

  1. Vnější ekonomické vztahy Chile

    OpenAIRE

    Horáková, Anna

    2007-01-01

    Práce se zabývá vnějšími ekonomickými vztahy Chile. V první části je charakterizována ekonomika Chile. V druhé části je zmapován vývoj obchodní politiky Chile a zapojování Chile do ekonomické integrace. Poslední kapitola nejprve analyzuje vývoj obchodu Chile, ilustruje problém jednostranného zaměření chilského exportu a analyzuje obchodní vztahy s EU, USA a Čínou. Následně jsou naznačeny nové ?role? Chile ve vztahu ke světovému obchodu.

  2. Lattice dynamics and electron/phonon interactions in epitaxial transition-metal nitrides

    Science.gov (United States)

    Mei, Antonio Rodolph Bighetti

    Transition metal (TM) nitrides, due to their unique combination of remarkable physical properties and simple NaCl structure, are presently utilized in a broad range of applications and as model systems in the investigation of complex phenomena. Group-IVB nitrides TiN, ZrN, and HfN have transport properties which include superconductivity and high electrical conductivity; consequentially, they have become technologically important as electrodes and contacts in the semiconducting and superconducting industries. The Group-VB nitride VN, which exhibits enhanced ductility, is a fundamental component in superhard and tough nanostructured hard coatings. In this thesis, I investigate the lattice dynamics responsible for controlling superconductivity and electrical conductivities in Group-IVB nitrides and elasticity and structural stability of the NaCl-structure Group-VB nitride VN. Our group has already synthesized high-quality epitaxial TiN, HfN, and CeN layers on MgO(001) substrates. By irradiating the growth surface with high ion fluxes at energies below the bulk lattice-atom displacement threshold, dense epitaxial single crystal TM nitride films with extremely smooth surfaces have been grown using ultra-high vacuum magnetically-unbalanced magnetron sputter deposition. Using this approach, I completed the Group-IVB nitride series by growing epitaxial ZrN/MgO(001) films and then grew Group-VB nitride VN films epitaxially on MgO(001), MgO(011), and MgO(111). The combination of high-resolution x-ray diffraction (XRD) reciprocal lattice maps (RLMs), high-resolution cross-sectional transmission electron microscopy (HR-XTEM), and selected-area electron diffraction (SAED) show that single-crystal stoichiometric ZrN films grown at 450 °C are epitaxially oriented cube-on-cube with respect to their MgO(001) substrates, (001) ZrN||(001)MgO and [100]ZrN||[100]MgO. The layers are essentially fully relaxed with a lattice parameter of 0.4575 nm. X-ray reflectivity results reveal that

  3. Fuel swelling and interaction layer formation in the SELENIUM Si and ZrN coated U(Mo) dispersion fuel plates irradiated at high power in BR2

    Energy Technology Data Exchange (ETDEWEB)

    Leenaers, A., E-mail: aleenaer@sckcen.be [Nuclear Materials Science Institute, SCK-CEN, Boeretang 200, 2400 Mol (Belgium); Van den Berghe, S.; Koonen, E.; Kuzminov, V. [Nuclear Materials Science Institute, SCK-CEN, Boeretang 200, 2400 Mol (Belgium); Detavernier, C. [Department of Solid State Sciences, Ghent University, Krijgslaan 281/S1, 9000 Ghent (Belgium)

    2015-03-15

    In the framework of the SELENIUM project two full size flat fuel plates were produced with respectively Si and ZrN coated U(Mo) particles and irradiated in the BR2 reactor at SCK• CEN. Non-destructive analysis of the plates showed that the fuel swelling profiles of both SELENIUM plates were very similar to each other and none of the plates showed signs of pillowing or excessive swelling at the end of irradiation at the highest power position (local maximum 70% {sup 235}U). The microstructural analysis showed that the Si coated fuel has less interaction phase formation at low burn-up but at the highest burn-ups, defects start to develop on the IL–matrix interface. The ZrN coated fuel, shows a virtual absence of reaction between the U(Mo) and the Al, up to high fission densities after which the interaction layer formation starts and defects develop in the matrix near the U(Mo) particles. It was found and is confirmed by the SELENIUM (Surface Engineering of Low ENrIched Uranium–Molybdenum) experiment that there are two phenomena at play that need to be controlled: the formation of an interaction layer and swelling of the fuel. As the interaction layer formation occurs at the U(Mo)–matrix interface, applying a diffusion barrier (coating) at that interface should prevent the interaction between U(Mo) and the matrix. The U(Mo) swelling, observed to proceed at an accelerating rate with respect to fission density accumulation, is governed by linear solid state swelling and fission gas bubble swelling due to recrystallization of the fuel. The examination of the SELENIUM fuel plates clearly show that for the U(Mo) dispersion fuel to be qualified, the swelling rate at high burn-up needs to be reduced.

  4. Fuel swelling and interaction layer formation in the SELENIUM Si and ZrN coated U(Mo) dispersion fuel plates irradiated at high power in BR2

    Science.gov (United States)

    Leenaers, A.; Van den Berghe, S.; Koonen, E.; Kuzminov, V.; Detavernier, C.

    2015-03-01

    In the framework of the SELENIUM project two full size flat fuel plates were produced with respectively Si and ZrN coated U(Mo) particles and irradiated in the BR2 reactor at SCK•CEN. Non-destructive analysis of the plates showed that the fuel swelling profiles of both SELENIUM plates were very similar to each other and none of the plates showed signs of pillowing or excessive swelling at the end of irradiation at the highest power position (local maximum 70% 235U). The microstructural analysis showed that the Si coated fuel has less interaction phase formation at low burn-up but at the highest burn-ups, defects start to develop on the IL-matrix interface. The ZrN coated fuel, shows a virtual absence of reaction between the U(Mo) and the Al, up to high fission densities after which the interaction layer formation starts and defects develop in the matrix near the U(Mo) particles. It was found and is confirmed by the SELENIUM (Surface Engineering of Low ENrIched Uranium-Molybdenum) experiment that there are two phenomena at play that need to be controlled: the formation of an interaction layer and swelling of the fuel. As the interaction layer formation occurs at the U(Mo)-matrix interface, applying a diffusion barrier (coating) at that interface should prevent the interaction between U(Mo) and the matrix. The U(Mo) swelling, observed to proceed at an accelerating rate with respect to fission density accumulation, is governed by linear solid state swelling and fission gas bubble swelling due to recrystallization of the fuel. The examination of the SELENIUM fuel plates clearly show that for the U(Mo) dispersion fuel to be qualified, the swelling rate at high burn-up needs to be reduced.

  5. Preparation of nanocrystalline VN by the melamine reduction of V{sub 2}O{sub 5} xerogel and its supercapacitive behavior

    Energy Technology Data Exchange (ETDEWEB)

    Cheng Fukui [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); He Chun [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China); Shu Dong, E-mail: dshu@scnu.edu.cn [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Base of Production, Education and Research on Energy Storage and Power Battery of Guangdong Higher Education Institutes, Guangzhou 510006 (China); Key Laboratory of Electrochemical Technology on Energy Storage and Power Generation of Guangdong Higher Education Institutes, South China Normal University, Guangzhou 510006 (China); Chen Hongyu, E-mail: hychen@scnu.edu.cn [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Base of Production, Education and Research on Energy Storage and Power Battery of Guangdong Higher Education Institutes, Guangzhou 510006 (China); Key Laboratory of Electrochemical Technology on Energy Storage and Power Generation of Guangdong Higher Education Institutes, South China Normal University, Guangzhou 510006 (China); Zhang Jie; Tang Shaoqing; Finlow, David E. [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China)

    2011-12-15

    Highlights: Black-Right-Pointing-Pointer Organic nitridizing agent was employed for preparation of nanocrystalline VN. Black-Right-Pointing-Pointer The supercapacitive behavior of VN was studied by electrochemical method. Black-Right-Pointing-Pointer The supercapacitive behavior of VN was studied in three kinds of electrolyte. Black-Right-Pointing-Pointer The specific capacitance of VN was determined as 273 F g{sup -1} in 1.0 M KOH. Black-Right-Pointing-Pointer The supercapacitive mechanism and involved factor on capacitance were analyzed. - Abstract: An organic nitridizing reagent was employed in the preparation of nanocrystalline VN at 800 Degree-Sign C under a N{sub 2} atmosphere. The prepared VN was characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS), and its supercapacitive behavior was studied by cyclic voltammetry (CV) in three different types of aqueous electrolyte, 0.5 M H{sub 2}SO{sub 4}, 2.0 M NaNO{sub 3} and 1.0 M KOH. The XRD results indicate that prepared VN has a cubic structure with space group Fm3m and a lattice parameter of 4.139 Angstrom-Sign . The nanocrystalline structure of VN with a low degree of crystallinity was confirmed by TEM imaging. The presence of oxygen on the VN surface was detected by FTIR and XPS, and its molecular composition was determined to be VN{sub 1.02}O{sub 0.1}. The specific capacitances of nanocrystalline VN were determined to be 114, 45.7 and 273 F g{sup -1} in 0.5 M H{sub 2}SO{sub 4}, 2.0 M NaNO{sub 3} and 1.0 M KOH, respectively. Thus, the KOH solution was considered the best aqueous electrolyte for the capacitive performance of VN. The supercapacitive mechanism and the factor that influenced the specific capacitance are also analyzed in this paper.

  6. Dureza e resistência ao desgaste da camada de ZrN formada por nitretação a plasma sobre zircônia parcialmente estabilizada com ítria Hardness and wear resistance of the ZrN layer made by plasma nitriding of yttria partially-stabilized zirconia

    Directory of Open Access Journals (Sweden)

    R. Milani

    2010-07-01

    Full Text Available Corpos-de-prova de zircônia parcialmente estabilizada com ítria foram moldados por prensagem uniaxial, sinterizados e nitretados em plasma de micro-ondas à pressão atmosférica. A camada de ZrN sobre zircônia formou-se a uma taxa de 4 µm.min-1, podendo atingir uma espessura de 500 µm. As amostras foram caracterizadas por meio de medidas de dureza e resistência ao desgaste. A superfície nitretada apresentou dureza superior e resistência ao desgaste similar ao substrato de zircônia.Samples of yttria partially-stabilized zirconia were molded by uniaxial pressing, sintered and nitrided in an atmospheric pressure microwave plasma. This procedure leads to the formation of a ZrN layer whose growth rate and thickness reached 4 µm.min-1 and 500 µm, respectively. The samples were characterized by means of hardness and wear resistance tests. The nitrided surface exhibits superior hardness and wear resistance similar to that of the zirconia substrate.

  7. Preparation, composition, and solid state investigations of TiN, ZrN, NbN, and compounds from the pseudobinary systems NbN-NbC, NbN-TiC, and NbN-TiN

    International Nuclear Information System (INIS)

    Christensen, A.N.; Fregerslev, S.

    1977-01-01

    Single crystals of the cubic phases TiN, ZrN, delta-NbN and of compounds from the pseudobinary systems NbN-NbC, NbN-TiC, and NbN-TiN were obtained by zone melting, zone annealing and annealing of the metal carbides in nitrogen gas of 2 MPa. Single crystals of the tetragonal phase gamma-NbN were obtained in a similar way by annealing of niobium. The nitrides are non-stochiometric. TiN was obtained in the composition range TiNsub(0.99) to TiNsub(0.50), ZrN in the range ZrNsub(1.00) to ZrNsub(0.63), and in niobium nitrides were obtained in the composition range NbNsub(0.90) to NbNsub(0.69). The compounds from the pseudobinary systems have up to 35% vacant sites in the nitrogen-carbon sublattice. TiN and ZrN have only vacant sites in the nitrogen sublattice. A correlation is found between the unit cell parameters for titanium nitride and zirconium nitride and the nitrogen-metal ratios. (orig.) [de

  8. $D^{0}$ meson $v_{n}$ harmonics in PbPb collisions at $5.02~\\mathrm{TeV}$

    CERN Document Server

    CMS Collaboration

    2016-01-01

    The Fourier coefficients $v_{2}$ and $v_{3}$, which reflect the azimuthal anisotropy of $D^0$ meson, is measured with scalar-product method in PbPb collisions at $\\sqrt{s_\\mathrm{NN}} = 5.02~\\mathrm{TeV}$ with CMS. The measurement is done in a wide $p_T$ range up to $40~\\mathrm{GeV}/c$, for centrality classes 0-10$\\%$, 10-30$\\%$ and 30-50$\\%$. It is the first measurement on $D^0$ $v_{3}$ and the uncertainties on $D^0$ $v_{2}$ are significantly improved compared with previous measurements. The measured $D^0$ $v_{n}$ (n = 2, 3) is consistent with charged particle $v_{n}$ in central collisions, and begins to be lower than charged particles $v_{n}$ in $p_T$ range 1 to $6~\\mathrm{GeV}/c$ for more peripheral collisions. In high $p_T$ range, non-zero $D^0$ $v_{2}$ is also observed, which indicates the path length dependent energy loss of charm quark.

  9. Prompt $D^0$ meson $v_n$ harmonics in PbPb collisions at 5.02 TeV

    CERN Document Server

    Sun, Jian

    2016-01-01

    Because of their large mass, heavy quarks are produced primarily at early stages of heavy-ion collisions, and therefore experience the full evolution of the system and carry information about the extent of thermalization of the QGP. Azimuthal anisotropy parameters ($v_n$) of charm and bottom hadrons provide unique information about the path length dependent interactions between heavy quarks and the medium. To what extent heavy quarks at low $p_T$ flow with the medium is a good measure of the interaction strength. At high $p_T$, $v_2$ and $v_3$ from path length dependent energy loss provide a powerful tool to study heavy quark energy loss mechanisms. With the large PbPb data sample at 5.02 TeV collected by the CMS detector during the 2015 LHC run, azimuthal anisotropy $v_2$ and $v_3$ of D0 meson is measured over a wide $p_T$ range and at different centralities. In this talk, new results of D0 meson $v_n$ parameters are presented, and compared to the charged hadron $v_n$ at the same energy and the latest theore...

  10. Hot Deformation Behavior of 1Cr12Ni3Mo2VN Martensitic Stainless Steel

    Science.gov (United States)

    He, Xiaomao; Jiang, Peng; Zhou, Leyu; Chen, Chao; Deng, Xiaochun

    2017-08-01

    1Cr12Ni3Mo2VN is a new type of martensitic stainless steel for the last-stage blades of large-capacity nuclear and thermal power turbines. The deformation behavior of this steel was studied by thermal compression experiments that performed on a Gleeble-3500 thermal simulator at a temperature range of 850°C to 1200°C and a strain rate of 0.01s-1 to 20s-1. When the deformation was performed at high temperature and low strain rate, a necklace type of microstructures was observed, the plastic deformation mechanism is grain boundary slip and migration, when at low temperature and lower strain rate, the slip bands were observed, the mechanism is intracrystalline slips, and when at strain rate of 20s-1, twins were observed, the mechanism are slips and twins. The Arrhenius equation was applied to describe the constitutive equation of the flow stress. The accuracy of the equation was verified by using the experimental data and the correlation coefficient R2 = 0.9786, and the equation can provide reasonable data for the design and numerical simulation of the forging process.

  11. THE INVESTIGATION OF PRODUCTIVE AND RECEPTIVE COMPETENCE IN V+N AND ADJ+N COLLOCATIONS AMONG INDONESIAN EFL LEARNERS

    Directory of Open Access Journals (Sweden)

    Saudin Saudin

    2017-05-01

    Full Text Available The important role of collocation in learners’ language proficiency has been acknowledged widely. In Systemic Functional Linguistics (SFL, collocation is known as one prominent member of the super-ordinate lexical cohesion, which contributes significantly to the textual coherence, together with grammatical cohesion and structural cohesion (Halliday & Hasan, 1985. Collocation is also viewed as the hallmark of truly advanced English learners since the higher the learners’ proficiency is, the more they tend to use collocation (Bazzaz & Samad, 2011; Hsu, 2007; Zhang, 1993. Further, knowledge of collocation is regarded as part of the native speakers’ communicative competence (Bazzaz & Samad, 2011; and lack of the knowledge is the most important sign of foreignness among foreign language learners (McArthur, 1992; McCarthy, 1990. Taking the importance of collocation into account, this study is aimed to shed light on Indonesian EFL learners’ levels of collocational competence. In the study, the collocational competence is restricted to v+n and adj+n of collocation but broken down into productive and receptive competence, about which little work has been done (Henriksen, 2013. For this purpose, 49 second-year students of an English department in a state polytechnic were chosen as the subjects. Two sets of tests (filling in the blanks and multiple-choice were administered to obtain the data of the subjects’ levels of productive and receptive competence and to gain information of which type was more problematic for the learners. The test instruments were designed by referring to Brashi’s (2006 test model, and Koya’s (2003. In the analysis of the data, interpretive-qualitative method was used primarily to obtain broad explanatory information. The data analysis showed that the scores of productive competence were lower than those of receptive competence in both v+n and adj+n collocation. The analysis also revealed that the scores of productive

  12. First-principles molecular dynamics investigation of thermal and mechanical stability of the TiN(001)/AlN and ZrN(001)/AlN heterostructures

    International Nuclear Information System (INIS)

    Ivashchenko, V.I.; Veprek, S.; Turchi, P.E.A.; Shevchenko, V.I.; Leszczynski, J.; Gorb, L.; Hill, F.

    2014-01-01

    First-principles quantum molecular dynamics investigations of TiN(001)/AlN and ZrN(001)/AlN heterostructures with one and two monolayers (1 ML and 2 ML) of AlN interfacial layers were carried out in the temperature range of 0–1400 K with subsequent static relaxation. It is shown that the epitaxially stabilized cubic B1-AlN interfacial layers are preserved in all TiN(001)/AlN heterostructures over the whole temperature range. In the ZrN(001)/AlN heterostructures, the B1-AlN(001) interfacial layer exists at 0 K, but it transforms into a distorted one at 10 K consisting of tetrahedral AlN 4 , octahedral AlN 6 , and AlN 5 units. The thermal stability of the interfaces was investigated by studying the phonon dynamic stability of the B1-AlN phase with different lattice parameters. The calculations showed that the B1-AlN interface should be unstable in ZrN(001)/AlN heterostructures and nanocomposites, and in those based on transition metal nitrides with lattice parameters larger than 4.4 Å. Electronic band structure calculations showed that energy gap forms around the Fermi energy for all interfaces. The formation of the interfacial AlN layer in TiN and ZrN crystals reduces their ideal tensile and shear strengths. Upon tensile load, decohesion occurs between Ti (Zr) and N atoms adjacent to the 1 ML AlN interfacial layer, whereas in the case of 2 ML AlN it occurs inside the TiN and ZrN slabs. The experimentally reported strength enhancement in the TiN/AlN and ZrN/AlN heterostructures is attributed to impeding effect of the interfacial layer on the plastic flow. - Highlights: • First-principles quantum molecular dynamics studies were conducted. • TiN- and ZrN-based heterostructures with one and two AlN interfacial layers. • Stability and structural transformation between 0 and 1400 K have been calculated. • Stress–strain relationships and ideal strengths determined. • Systems which may form stable superhard heterostructures are identified

  13. First-principles molecular dynamics investigation of thermal and mechanical stability of the TiN(001)/AlN and ZrN(001)/AlN heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Ivashchenko, V.I., E-mail: ivash@ipms.kiev.ua [Institute of Problems of Material Science, National Academy of Science of Ukraine, Krzhyzhanosky str. 3, 03142 Kyiv (Ukraine); Veprek, S., E-mail: stan.veprek@lrz.tum.de [Department of Chemistry, Technical University Munich, Lichtenbergstrasse 4, D-85747 Garching (Germany); Turchi, P.E.A. [Lawrence Livermore National Laboratory (L-352), P.O. Box 808, Livermore, CA 94551 (United States); Shevchenko, V.I. [Institute of Problems of Material Science, National Academy of Science of Ukraine, Krzhyzhanosky str. 3, 03142 Kyiv (Ukraine); Leszczynski, J. [Department of Chemistry and Biochemistry, Interdisciplinary Center for Nanotoxicity, Jackson State University, Jackson, MS 39217 (United States); Gorb, L. [Department of Chemistry and Biochemistry, Interdisciplinary Center for Nanotoxicity, Jackson State University, Jackson, MS 39217 (United States); U.S. Army ERDC, Vicksburg, MS 39180 (United States); Hill, F. [U.S. Army ERDC, Vicksburg, MS 39180 (United States)

    2014-08-01

    First-principles quantum molecular dynamics investigations of TiN(001)/AlN and ZrN(001)/AlN heterostructures with one and two monolayers (1 ML and 2 ML) of AlN interfacial layers were carried out in the temperature range of 0–1400 K with subsequent static relaxation. It is shown that the epitaxially stabilized cubic B1-AlN interfacial layers are preserved in all TiN(001)/AlN heterostructures over the whole temperature range. In the ZrN(001)/AlN heterostructures, the B1-AlN(001) interfacial layer exists at 0 K, but it transforms into a distorted one at 10 K consisting of tetrahedral AlN{sub 4}, octahedral AlN{sub 6}, and AlN{sub 5} units. The thermal stability of the interfaces was investigated by studying the phonon dynamic stability of the B1-AlN phase with different lattice parameters. The calculations showed that the B1-AlN interface should be unstable in ZrN(001)/AlN heterostructures and nanocomposites, and in those based on transition metal nitrides with lattice parameters larger than 4.4 Å. Electronic band structure calculations showed that energy gap forms around the Fermi energy for all interfaces. The formation of the interfacial AlN layer in TiN and ZrN crystals reduces their ideal tensile and shear strengths. Upon tensile load, decohesion occurs between Ti (Zr) and N atoms adjacent to the 1 ML AlN interfacial layer, whereas in the case of 2 ML AlN it occurs inside the TiN and ZrN slabs. The experimentally reported strength enhancement in the TiN/AlN and ZrN/AlN heterostructures is attributed to impeding effect of the interfacial layer on the plastic flow. - Highlights: • First-principles quantum molecular dynamics studies were conducted. • TiN- and ZrN-based heterostructures with one and two AlN interfacial layers. • Stability and structural transformation between 0 and 1400 K have been calculated. • Stress–strain relationships and ideal strengths determined. • Systems which may form stable superhard heterostructures are identified.

  14. Intrinsic stress in ZrN thin films: Evaluation of grain boundary contribution from in situ wafer curvature and ex situ x-ray diffraction techniques

    International Nuclear Information System (INIS)

    Koutsokeras, L. E.; Abadias, G.

    2012-01-01

    Low-mobility materials, like transition metal nitrides, usually undergo large residual stress when sputter-deposited as thin films. While the origin of stress development has been an active area of research for high-mobility materials, atomistic processes are less understood for low-mobility systems. In the present work, the contribution of grain boundary to intrinsic stress in reactively magnetron-sputtered ZrN films is evaluated by combining in situ wafer curvature measurements, providing information on the overall biaxial stress, and ex situ x-ray diffraction, giving information on elastic strain (and related stress) inside crystallites. The thermal stress contribution was also determined from the in situ stress evolution during cooling down, after deposition was stopped. The stress data are correlated with variations in film microstructure and growth energetics, in the 0.13-0.42 Pa working pressure range investigated, and discussed based on existing stress models. At low pressure (high energetic bombardment conditions), a large compressive stress is observed due to atomic peening, which induces defects inside crystallites but also promotes incorporation of excess atoms in the grain boundary. Above 0.3-0.4 Pa, the adatom surface mobility is reduced, leading to the build-up of tensile stress resulting from attractive forces between under-dense neighbouring column boundary and possible void formation, while crystallites can still remain under compressive stress.

  15. Preparation of c-axis perpendicularly oriented ultra-thin L10-FePt films on MgO and VN underlayers

    Science.gov (United States)

    Futamoto, Masaaki; Shimizu, Tomoki; Ohtake, Mitsuru

    2018-05-01

    Ultra-thin L10-FePt films of 2 nm average thickness are prepared on (001) oriented MgO and VN underlayers epitaxially grown on base substrate of SrTiO3(001) single crystal. Detailed cross-sectional structures are observed by high-resolution transmission electron microscopy. Continuous L10-FePt(001) thin films with very flat surface are prepared on VN(001) underlayer whereas the films prepared on MgO(001) underlayer consist of isolated L10-FePt(001) crystal islands. Presence of misfit dislocation and lattice bending in L10-FePt material is reducing the effective lattice mismatch with respect to the underlayer to be less than 0.5 %. Formation of very flat and continuous FePt layer on VN underlayer is due to the large surface energy of VN material where de-wetting of FePt material at high temperature annealing process is suppressed under a force balance between the surface and interface energies of FePt and VN materials. An employment of underlayer or substrate material with the lattice constant and the surface energy larger than those of L10-FePt is important for the preparation of very thin FePt epitaxial thin continuous film with the c-axis controlled to be perpendicular to the substrate surface.

  16. The aug-cc-pVnZ-F12 basis set family: Correlation consistent basis sets for explicitly correlated benchmark calculations on anions and noncovalent complexes.

    Science.gov (United States)

    Sylvetsky, Nitai; Kesharwani, Manoj K; Martin, Jan M L

    2017-10-07

    We have developed a new basis set family, denoted as aug-cc-pVnZ-F12 (or aVnZ-F12 for short), for explicitly correlated calculations. The sets included in this family were constructed by supplementing the corresponding cc-pVnZ-F12 sets with additional diffuse functions on the higher angular momenta (i.e., additional d-h functions on non-hydrogen atoms and p-g on hydrogen atoms), optimized for the MP2-F12 energy of the relevant atomic anions. The new basis sets have been benchmarked against electron affinities of the first- and second-row atoms, the W4-17 dataset of total atomization energies, the S66 dataset of noncovalent interactions, the Benchmark Energy and Geometry Data Base water cluster subset, and the WATER23 subset of the GMTKN24 and GMTKN30 benchmark suites. The aVnZ-F12 basis sets displayed excellent performance, not just for electron affinities but also for noncovalent interaction energies of neutral and anionic species. Appropriate CABSs (complementary auxiliary basis sets) were explored for the S66 noncovalent interaction benchmark: between similar-sized basis sets, CABSs were found to be more transferable than generally assumed.

  17. Mesoporous C/CrN and C/VN Nanocomposites Obtained by One-Pot Soft-Templating Process

    Directory of Open Access Journals (Sweden)

    Julien Kiener

    2016-07-01

    Full Text Available Nanocomposites of ordered mesoporous carbon associated with chromium nitride (CrN or vanadium nitride (VN nanoparticles were obtained by a simple one-pot synthesis based on the solvent evaporation induced self-assembly (EISA process using Pluronic triblock surfactant as soft-template and a phenol-based resin (resol as carbon precursor. These nanocomposites were characterized by X-ray diffraction, nitrogen physisorption and Transmission Electron Microscopy (TEM techniques. Electron tomography (or 3D-TEM technique was particularly useful for providing direct insight on the internal architecture of C/CrN nanocomposite. Nanocomposites showed a very well organized hexagonal mesoporous carbon structure and a relatively high concentration of nanoparticles well distributed in the porous network. The chromium and vanadium nitrides/mesoporous carbon nanocomposites could have many potential applications in catalysis, Li-ion batteries, and supercapacitors.

  18. Corrosion resistant surface for vanadium nitride and hafnium nitride layers as function of grain size

    Science.gov (United States)

    Escobar, C. A.; Caicedo, J. C.; Aperador, W.

    2014-01-01

    In this research it was studied vanadium nitride (VN) and hafnium nitride (HfN) film, which were deposited onto silicon (Si (100)) and AISI 4140 steel substrates via r.f. magnetron sputtering technique in Ar/N2 atmosphere with purity at 99.99% for both V and Hf metallic targets. Both films were approximately 1.2±0.1 μm thick. The crystallography structures that were evaluated via X-ray diffraction analysis (XRD) showed preferential orientations in the Bragg planes VN (200) and HfN (111). The chemical compositions for both films were characterized by EDX. Atomic Force Microscopy (AFM) was used to study the morphology; the results reveal grain sizes of 78±2 nm for VN and 58±2 nm for HfN and roughness values of 4.2±0.1 nm for VN and 1.5±0.1 nm for HfN films. The electrochemical performance in VN and HfN films deposited onto steel 4140 were studied by Tafel polarization curves and impedance spectroscopy methods (EIS) under contact with sodium chloride at 3.5 wt% solution, therefore, it was found that the corrosion rate decreased about 95% in VN and 99% for HfN films in relation to uncoated 4140 steel, thus demonstrating, the protecting effect of VN and HfN films under a corrosive environment as function of morphological characteristics (grain size). VN(grain size)=78±2.0 nm, VN(roughness)=4.2±0.1 nm, VN(corrosion rate)=40.87 μmy. HfN(grain size)=58±2.0 nm, HfN(roughness)=1.5±0.1 nm, HfN(corrosion rate)=0.205 μmy. It was possible to analyze that films with larger grain size, can be observed smaller grain boundary thus generating a higher corrosion rate, therefore, in this work it was found that the HfN layer has better corrosion resistance (low corrosion rate) in relation to VN film which presents a larger grain size, indicating that the low grain boundary in (VN films) does not restrict movement of the Cl- ion and in this way the corrosion rate increases dramatically.

  19. Technology development and production of elongated shell for reactor vessel active zone of WWER-TOI project from steel 15Cr2NiMoVN class 1

    International Nuclear Information System (INIS)

    Shklyaev, S.Eh.; Titova, T.I.; Ratushev, D.V.; Shul'gan, N.A.; Eroshkin, S.B.; Durynin, V.A.; Efimov, S.V.; Dub, V.S.; Kulikov, A.P.; Romashkin, A.N.

    2015-01-01

    Production process for the elongated shell blank of the active zone of the reactor pressure vessel made from steel 15Cr2NiMoVN Class 1 with finished sizes Dext=4.655 mm, Dint=4.240 mm, H=4.910 mm (height for heat treatment – 5.750 mm) is presented. For the first time in Russia in production site of OMZ-Special steel LLC a unique elongated shell blank of the reactor vessel active zone was made from ingot 420.0 t for WWER-TOI project fully meeting the specified requirements in terms of metallurgical quality and set of service properties [ru

  20. Hot carrier dynamics in plasmonic transition metal nitrides

    Science.gov (United States)

    Habib, Adela; Florio, Fred; Sundararaman, Ravishankar

    2018-06-01

    Extraction of non-equilibrium hot carriers generated by plasmon decay in metallic nano-structures is an increasingly exciting prospect for utilizing plasmonic losses, but the search for optimum plasmonic materials with long-lived carriers is ongoing. Transition metal nitrides are an exciting class of new plasmonic materials with superior thermal and mechanical properties compared to conventional noble metals, but their suitability for plasmonic hot carrier applications remains unknown. Here, we present fully first principles calculations of the plasmonic response, hot carrier generation and subsequent thermalization of all group IV, V and VI transition metal nitrides, fully accounting for direct and phonon-assisted transitions as well as electron–electron and electron–phonon scattering. We find the largest frequency ranges for plasmonic response in ZrN, HfN and WN, between those of gold and silver, while we predict strongest absorption in the visible spectrum for the VN, NbN and TaN. Hot carrier generation is dominated by direct transitions for most of the relevant energy range in all these nitrides, while phonon-assisted processes dominate only below 1 eV plasmon energies primarily for the group IV nitrides. Finally, we predict the maximum hot carrier lifetimes to be around 10 fs for group IV and VI nitrides, a factor of 3–4 smaller than noble metals, due to strong electron–phonon scattering. However, we find longer carrier lifetimes for group V nitrides, comparable to silver for NbN and TaN, while exceeding 100 fs (twice that of silver) for VN, making them promising candidates for efficient hot carrier extraction.

  1. Pronounced cluster-size effects: gas-phase reactivity of bare vanadium cluster cations V(n)+ (n = 1-7) toward methanol.

    Science.gov (United States)

    Feyel, Sandra; Schröder, Detlef; Schwarz, Helmut

    2009-05-14

    Mass spectrometric experiments are used to examine the size-dependent interactions of bare vanadium cluster cations V(n)(+) (n = 1-7) with methanol. The reactivity patterns exhibit enormous size effects throughout the range of clusters investigated. For example, dehydrogenation of methanol to produce V(n)OC(+) is only brought about by clusters with n > or = 3. Atomic vanadium cation V(+) also is reactive, but instead of dehydrogenation of the alcohol, expulsions of either methane or a methyl radical take place. In marked contrast, the reaction efficiency of the dinuclear cluster V(2)(+) is extremely low. For the cluster cations V(n)(+) (n = 3-7), complete and efficient dehydrogenation of methanol to produce V(n)OC(+) and two hydrogen molecules prevails. DFT calculations shed light on the mechanism of the dehydrogenation of methanol by the smallest reactive cluster cation V(3)(+) and propose the occurrence of chemisorption concomitant with C-O bond cleavage rather than adsorption of an intact carbon monoxide molecule by the cluster.

  2. Electronic resources of the rare books and valuable editions department of the Central Scientific Library of the V.N. Karazin Kharkiv National University: open access for research

    Directory of Open Access Journals (Sweden)

    І. К. Журавльова

    2014-12-01

    Full Text Available The article describes tasks that electronic collections of rare books fulfill: broad access for readers to rare and valuable editions providing, preservation of ensuring of the original. On the example of the electronic collection of the Central Scientific Library of the V.N. Karazin Kharkiv National University – «eScriptorium: electronic archive of rare books and manuscripts for research and education» the possibility of the full-text resources of the valuable editions using is shown. The principles of creation, structure, chronological frameworks, directions of adding the documents to the archive are represented. The perspectives of the project development are outlined as well as examples of the digital libraries of the European countries and Ukraine are provided, the actual task of preserving the originals of the rare books of the country is raised, the innovative approaches to serving users with electronic resources are considered. The evidences of cooperation of the Central Scientific Library of the V.N. Karazin Kharkiv National University with the largest world digital libraries: World Digital Library and Europeana are provided.

  3. D meson nuclear modification factor and vn harmonics in PbPb collisions at 5.02 TeV with CMS

    Science.gov (United States)

    Sun, Jian; CMS Collaboration

    2017-11-01

    The measurement of heavy flavor production is a powerful tool to study the properties of the high-density QCD medium created in heavy-ion collisions as heavy quarks are sensitive to the transport properties of the medium and may interact with the QCD matter differently from light quarks. In particular, the comparison between the nuclear modification factors (RAA) of light- and heavy-flavor particles provides insights into the expected flavor dependence of in-medium parton energy loss. Furthermore, azimuthal anisotropy coefficients (vn) of heavy-flavor particles provide insights into the degree of the thermalization of the bulk medium at low pT, and unique information about the path length dependence of heavy quark energy loss at high pT. Using the large pp and PbPb samples collected at 5.02 TeV during the 2015 LHC run, high precision open charm measurements are performed with the CMS detector in a wide transverse momentum range. This allows us to set an important milestone in our understanding of the interactions between charm quarks and the medium. In this talk, the most recent results of the RAA, v2 and v3 of prompt D0 mesons in PbPb collisions at 5.02 TeV are presented and compared to the same results for charged particles (dominated by light flavor hadrons) at the same energy.

  4. D meson nuclear modification factor and $v_{n}$ harmonics in PbPb collisions at 5.02 TeV with CMS

    CERN Document Server

    Sun, Jian

    2017-01-01

    The measurement of heavy flavour production is a powerful tool to study the properties of the high-density QCD medium created in heavy-ion collisions as heavy quarks are sensitive to the transport properties of the medium and may interact with the QCD matter differently from light quarks. In particular, the comparison between the nuclear modification factors ($R_{AA}$) of light- and heavy-flavour particles provides insights into the expected flavour dependence of in-medium parton energy loss. Furthermore, azimuthal anisotropy coefficient ($v_{n}$) of heavy-flavor particles provide insights into the degree of the thermalization of the bulk medium at low $p_{T}$, and unique information about the path length dependence of heavy quark energy loss at high $p_{T}$. Using the large statistics proton-proton and PbPb samples collected at 5.02 TeV during the 2015 LHC run, high precision open charm measurements are performed with the CMS detector in a wide transverse momentum range. This allows us to set an important mi...

  5. An Integrated Architecture to Support Hastily Formed Network (HFN)

    Science.gov (United States)

    2007-12-01

    range of magnitudes. In the case of the September 11 attack, the magnitude of the infrastructure devastated resulted in an economic impact that...fielded a new Command and Control (C2) system, the Atares System (developed by Future Systems). Apart from the C2 software applications, the complete...flow • Note pad – an electronic pad for note taking. • Internet – provides internet access a. Observations on LACoS and LACoFD C2 System The Atares

  6. Pozice Omega – specifická fáze vnímání pojmu nekonečno

    Directory of Open Access Journals (Sweden)

    Jiri Cihlar

    2015-12-01

    Full Text Available Článek popisuje specifickou fázi ontogenetického vývoje porozumění nekonečnu nazývanou pozice omega, jejíž identifikace je jedním z výsledků rozsáhlého výzkumu zaměřeného na vnímání pojmu nekonečno. Prvních dvou částí výzkumu se v letech 2008 až 2011 postupně zúčastnilo celkem 1 432 českých žáků a studentů ve věku od 8 do 20 let. V článku je podrobně popsána závěrečná kvalitativní část výzkumu zaměřená na interview s vysokoškolskými studenty s cílem diagnostikovat tuto fázi v jejich pojetí nekonečna v různých kontextech. Článek popisuje možnosti identifikace pozice omega a její konsekvence pro úspěšné studium těch pojmů a idejí matematiky, které jsou spjaty s nekonečnem. Dává ji dále do souvislosti s potenciálním a aktuálním nekonečnem, vymezuje jednotlivé vývojové fáze pomocí pojmu horizont a vysvětluje možnosti vzájemného ovlivňování zmíněných vývojových fází s využitím pojmů primární a sekundární intuice.

  7. Measurement of $v_n$ - mean $p_T$ correlations in lead-lead collisions at $\\sqrt{s_{NN}} = 5.02$ TeV with the ATLAS detector.

    CERN Document Server

    The ATLAS collaboration

    2018-01-01

    The lead-lead data collected by the ATLAS detector at the LHC provide new opportunities to study dynamic properties of quark-gluon plasma. A tool to study these properties is the recently proposed modified Pearson's correlation coefficient, $\\rho$, that quantifies the correlation between the mean transverse momentum in the event, $[p_T]$, and the square of the flow harmonic magnitude, $v_n^2$. The measurement of $\\rho$ for $n$=2, 3 and 4 is performed using 22~$\\mu \\mathrm{b}^{-1}$ of minimum-bias Pb+Pb data at $\\sqrt{s_{NN}}$ = 5.02 TeV collected with the ATLAS detector at the LHC. To suppress non-flow effects, $v_n^2$ is calculated by correlating charged particles from two sub-events covering opposite pseudorapidity ranges of 0.75 $< |\\eta| <$ 2.5 while $[p_T]$ is evaluated for particles with $|\\eta|<$ 0.5. Significant (non-zero) values of $\\rho$ coefficients for all studied harmonics are obtained. The $\\rho$ coefficient as a function of centrality is observed to weakly depend on the transverse mome...

  8. Cross-sections for formation of {sup 89}Zr{sup m} through {sup 90}Zr(n,2n){sup 89}Zr{sup m} reaction over neutron energy range 13.73 MeV to 14.77 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Attar, F.M.D. [Department of Physics, University of Pune, Pune-411007 (India); Mandal, R. [Department of Physics, University of Pune, Pune-411007 (India); Indian Institute of Technology, Kharagpur (India); Dhole, S.D. [Department of Physics, University of Pune, Pune-411007 (India); Saxena, A. [Nuclear Physics Division, BARC, Mumbai (India); Ashokkumar,; Ganesan, S. [Reactor Physics Design Division, BARC, Mumbai (India); Kailas, S. [Nuclear Physics Division, BARC, Mumbai (India); Bhoraskar, V.N. [Department of Physics, University of Pune, Pune-411007 (India)], E-mail: vnb@physics.unipune.ernet.in

    2008-04-01

    The cross-sections for formation of metastable state of {sup 89}Zr ({sup 89}Zr{sup m}, 0.588 MeV, 4.16 m) through {sup 90}Zr(n,2n){sup 89}Zr{sup m} reaction induced by 13.73 MeV to 14.77 MeV neutrons were measured for the first time and also theoretically estimated using Empire-II and Talys programs. At 13.73 MeV neutron energy, the {sup 89}Zr nuclei can be excited to metastable state, {sup 89}Zr{sup m}, when the first and the second emitted neutrons have energies lower than the most probable energy {approx}0.64 MeV. The probability of exciting {sup 89}Zr nuclei to energy levels higher than 0.588 MeV and therefore of populating the metastable state through decay process increases with increasing neutron energy. The measured cross-sections vary from 41{+-}3mb to 221{+-}15mb over neutron energies 13.73 MeV to 14.77 MeV, and are in agreement with the cross-sections estimated using Empire-II code. The formation of {sup 89}Zr{sup m} is favoured when the first and the second reaction neutrons are emitted with the most probable energies rather than lower energy, except for 13.73 MeV neutrons.

  9. Determination of superlattice effect on metal–ceramic nano-structures

    Directory of Open Access Journals (Sweden)

    J.C. Caicedo

    2015-01-01

    Full Text Available Binary nitrides multilayer systems were grown on silicon (100 substrates with the aim to study the coherent assembly in HfN/VN material. Multilayers films were grown via reactive r.f. magnetron sputtering technique by systematically varying the bilayer period (Λ and the bilayer number (n while maintaining constant the total coating thickness (∼2.4 μm. The layers were characterized by high angle X-ray diffraction (HA-XRD, low angle X-ray diffraction (LA-XRD. HfN and VN layers were analyzed by X-ray photoelectron spectroscopy (XPS and electron and transmission microscopy (TEM. HA-XRD results showed preferential growth in the face-centered cubic (111 crystal structure for HfN/VN multilayer systems with the epitaxial relation (111 [100]HfN//(200 [100]VN. The maximum coherent assembly was observed with presence of satellite peaks. With this idea, ternary and binary nitrides films have been designed and deposited on Si (100 substrates with bilayer periods (Λ in a broad range, from nanometers to micrometers. The films were fabricated to study the structural evolution, coherent assembly progress and optical properties such as the critical angle, dispersion coefficient, index of refraction for HfN/VN multilayers with decreasing bilayer thickness.

  10. Evaluation of cross-section data from threshold to 40-60 MeV for specific neutron reactions important for neutron dosimetry applications. Part 1: Evaluation of the excitation functions for the 27Al(n,α)24Na, 55Mn(n,2n)54Mn, 59Co(n,p)59Fe, 59Co(n,2n)58m+gCo and 90Zr(n,2n)89m+gZr reactions

    International Nuclear Information System (INIS)

    Zolotarev, K.I.

    2009-04-01

    Evaluations of cross sections and their associated covariance matrices have been carried out for five dosimetry reactions: - excitation functions were re-evaluated for the 27 Al(n,α) 24 Na, 55 Mn(n,2n) 54 Mn and 90 Zr(n,2n) 89m+g Zr reactions over the neutron energy range from threshold to 40 MeV; - excitation functions were re-evaluated for the 59 Co(n,p) 59 Fe and 59 Co(n,2n) 58m+g Co reactions over the neutron energy range from threshold to 60 MeV. Uncertainties in the cross sections for all of those reactions were also derived in the form of relative covariance matrices. Benchmark calculations performed for 235 U thermal fission and 252 Cf spontaneous fission neutron spectra show that the integral cross sections calculated from the newly evaluated excitation functions exhibit improved agreement with related experimental data when compared with the equivalent data from the IRDF-2002 library. (author)

  11. Vnímání barev žákem s mentálním postižením Perception of colours by mentally-handicapped pupils

    Directory of Open Access Journals (Sweden)

    Olga Krejčířová

    2006-02-01

    Full Text Available Předložená stať se pokouší o využití obecných poznatků o barvách v oblasti tělesné kultury a aplikuje je na tělesnou výchovu v podmínkách speciálních škol. Vychází z předpokladu, že vzdělávání žáků s mentálním postižením by mělo probíhat za podmínek, které v nich evokují libé pocity. A k těmto podmínkám patří i barevnost. Jsou prezentovány výsledky šetření preference barev probandy s lehkým a středně těžkým mentálním postižením. Výsledky naznačují, že probandi s lehkým mentálním postižením mají tendenci citlivě vnímat barvy, a to i v abstraktní podobě. Preferují modrou, případně zelenou a červenou barvu a hůře přijímají černou a fialovou. Preference oblíbené barvy je u probandů s těžším mentálním postižením více variabilní než u probandů s lehkým mentálním postižením. The following article attempts to utilize general knowledge of colours in the sphere of physical culture and applies it to physical education in special schools. It is based on the precondition that education of mentally-handicapped pupils should proceed under conditions evoking pleasurable feelings in them. And such conditions also include colours. The article presents the results of an examination of colour preference in probands with slight to moderate mental handicaps. The results show that probands with a slight mental handicap tend to be sensitive in relation to colours, even in their abstract form. They prefer blue, respectively green and red, and they have difficulties with perception of black and violet. The favourite colour preference in probands with a more serious mental handicap is more variable than in probands with a slight mental handicap.

  12. Morphological Studies of Local Influence of Implants with Coatings Based on Superhard Compounds on Bone Tissue under Conditions of Induced Trauma

    Directory of Open Access Journals (Sweden)

    Galimzyan KABIROV

    2015-07-01

    Full Text Available In this paper we analyze the response of bone tissue to a transosseous introduction of implants made of copper (Cu, medical steel 12X18H9T, steel with nitrides of titanium and hafnium coatings (TiN + HfN, as well as steel coated with titanium and zirconium nitrides (TiN + ZrN into the diaphysis of the tibia of experimental rats. The obtained results showed that the restoration of the injured bone and bone marrow in groups with implants made of steel 12X18H9T occurred without the participation of the granulation and cartilaginous tissues, but with implants made of steel coated with titanium and hafnium nitrides (TiN + HfN, this bone recovery also took place in the early term. At the same time, in groups, where the implants were made of copper (Cu, implants were made of steel coated with titanium and zirconium nitrides (TiN + ZrN were used, such phenomena as necrosis, lysis and destruction of the bone were registered and the bone tissue repair went through formation of the cartilaginous tissue.

  13. Estimation of sensing characteristics for refractory nitrides based gain assisted core-shell plasmonic nanoparticles

    Science.gov (United States)

    Shishodia, Manmohan Singh; Pathania, Pankaj

    2018-04-01

    Refractory transition metal nitrides such as zirconium nitride (ZrN), hafnium nitride (HfN) and titanium nitride (TiN) have emerged as viable alternatives to coinage metals based plasmonic materials, e.g., gold (Au) and silver (Ag). The present work assesses the suitability of gain assisted ZrN-, HfN- and TiN-based conventional core-shell nanoparticles (CCSNPs) and multilayered core-shell nanoparticles (MCSNPs) for refractive index sensing. We report that the optical gain incorporation in the dielectric layer leads to multifold enhancement of the scattering efficiency (Qsca), substantial reduction of the spectral full width at half maximum, and a higher figure of merit (FOM). In comparison with CCSNPs, the MCSNP system exhibits superior sensing characteristics such as higher FOM, ˜ 45% reduction in the critical optical gain, response shift towards the biological window, and higher degree of tunability. Inherent biocompatibility, growth compatibility, chemical stability and flexible spectral tuning of refractory nitrides augmented by superior sensing properties in the present work may pave the way for refractory nitrides based low cost sensing.

  14. The influence of physical activity on body image in people with and without acquired mobility disability [Vliv pohybové aktivity na subjektivní vnímání těla u osob se získaným tělesným postižením a bez něj

    Directory of Open Access Journals (Sweden)

    Ziya Koruç

    2011-12-01

    Full Text Available BACKGROUND: Body image in people with physical disability is important, but it has received little attention in the research literature. OBJECTIVE: The aim of the study was to determine whether differences exist between adolescents with acquired mobility disability (AMD and those without AMD regarding body image, and whether physical activity influences these differences. METHODS: Fifty-eight adolescents, aged 16 to 18 years, participated in this study. Half the participants had some form of AMD while the other half were healthy. Body image was evaluated with the Multidimensional Body-Self Relations Questionnaire (MBSRQ before and after 6 weeks of playing darts. A two-way ANOVA was used to analyse the results. RESULTS: At the end of the study, the healthy adolescents scored significantly higher than the AMD group on the subscales of fitness perception, orientation and overall health perception. No interaction was found between disability and exercise on any subscales of the MBSRQ. CONCLUSIONS: The results of this study demonstrate that people with AMD evaluate their health and fitness levels as being lower than healthy adolescents and that they are less concerned with fitness as compared with healthy adolescents. Six weeks of playing darts as a physical activity had no effect on improving the self-perceptions of the AMD group.[VÝCHODISKA: Subjektivní vnímání těla u lidí s tělesným postižením je důležitý aspekt, v odborné literatuře mu však nebylo věnováno příliš pozornosti. CÍLE: Cílem studie bylo stanovit, zda se vyskytují rozdíly mezi adolescenty se získaným tělesným postižením (AMD a adolescenty bez AMD, co se týče subjektivního vnímání těla, a zda tyto rozdíly ovlivňuje pohybová aktivita. METODIKA: Této studie se zúčastnilo padesát osm adolescentů ve věku mezi 16 a 18 lety. Polovina účastníků měla některou z forem AMD, zatímco druhá polovina byla zdravá. Subjektivní vnímání t

  15. Hastily Formed Networks (HFN) As an Enabler for the Emergency Response Community

    Science.gov (United States)

    2012-03-01

    offers a rich set of 1 Maslow’s hierarchy of needs in which Maslow identifies the basic physiological...sources, gathering and maintaining the data needed , and completing and reviewing the collection of information. Send comments regarding this burden...not have any useful infrastructure at all. To bridge this gap in communications, a need exists for a reliable technology not dependent on the existing

  16. Core-level spectra and binding energies of transition metal nitrides by non-destructive x-ray photoelectron spectroscopy through capping layers

    International Nuclear Information System (INIS)

    Greczynski, G.; Primetzhofer, D.; Lu, J.; Hultman, L.

    2017-01-01

    Highlights: • First non-destructive measurements of XPS core level binding energies for group IVb-VIb transition metal nitrides are presented. • All films are grown under the same conditions and analyzed in the same instrument, providing a useful reference for future XPS studies. • Extracted core level BE values are more reliable than those obtained from sputter-cleaned N-deficient surfaces. • Comparison to Ar+-etched surfaces reveals that even mild etching conditions result in the formation of a nitrogen-deficient surface layer. • The N/metal concentration ratios from capped samples are found to be 25-90% higher than those from the corresponding ion-etched surfaces. - Abstract: We present the first measurements of x-ray photoelectron spectroscopy (XPS) core level binding energies (BE:s) for the widely-applicable group IVb-VIb polycrystalline transition metal nitrides (TMN’s) TiN, VN, CrN, ZrN, NbN, MoN, HfN, TaN, and WN as well as AlN and SiN, which are common components in the TMN-based alloy systems. Nitride thin film samples were grown at 400 °C by reactive dc magnetron sputtering from elemental targets in Ar/N 2 atmosphere. For XPS measurements, layers are either (i) Ar + ion-etched to remove surface oxides resulting from the air exposure during sample transfer from the growth chamber into the XPS system, or (ii) in situ capped with a few nm thick Cr or W overlayers in the deposition system prior to air-exposure and loading into the XPS instrument. Film elemental composition and phase content is thoroughly characterized with time-of-flight elastic recoil detection analysis (ToF-E ERDA), Rutherford backscattering spectrometry (RBS), and x-ray diffraction. High energy resolution core level XPS spectra acquired with monochromatic Al Kα radiation on the ISO-calibrated instrument reveal that even mild etching conditions result in the formation of a nitrogen-deficient surface layer that substantially affects the extracted binding energy values. These

  17. Core-level spectra and binding energies of transition metal nitrides by non-destructive x-ray photoelectron spectroscopy through capping layers

    Energy Technology Data Exchange (ETDEWEB)

    Greczynski, G., E-mail: grzgr@ifm.liu.se [Thin Film Physics Division, Department of Physics (IFM), Linköping University, SE-581 83 Linköping (Sweden); Primetzhofer, D. [Department of Physics and Astronomy, The Ångström Laboratory, Uppsala University, P.O. Box 516, SE-751 20 Uppsala (Sweden); Lu, J.; Hultman, L. [Thin Film Physics Division, Department of Physics (IFM), Linköping University, SE-581 83 Linköping (Sweden)

    2017-02-28

    Highlights: • First non-destructive measurements of XPS core level binding energies for group IVb-VIb transition metal nitrides are presented. • All films are grown under the same conditions and analyzed in the same instrument, providing a useful reference for future XPS studies. • Extracted core level BE values are more reliable than those obtained from sputter-cleaned N-deficient surfaces. • Comparison to Ar+-etched surfaces reveals that even mild etching conditions result in the formation of a nitrogen-deficient surface layer. • The N/metal concentration ratios from capped samples are found to be 25-90% higher than those from the corresponding ion-etched surfaces. - Abstract: We present the first measurements of x-ray photoelectron spectroscopy (XPS) core level binding energies (BE:s) for the widely-applicable group IVb-VIb polycrystalline transition metal nitrides (TMN’s) TiN, VN, CrN, ZrN, NbN, MoN, HfN, TaN, and WN as well as AlN and SiN, which are common components in the TMN-based alloy systems. Nitride thin film samples were grown at 400 °C by reactive dc magnetron sputtering from elemental targets in Ar/N{sub 2} atmosphere. For XPS measurements, layers are either (i) Ar{sup +} ion-etched to remove surface oxides resulting from the air exposure during sample transfer from the growth chamber into the XPS system, or (ii) in situ capped with a few nm thick Cr or W overlayers in the deposition system prior to air-exposure and loading into the XPS instrument. Film elemental composition and phase content is thoroughly characterized with time-of-flight elastic recoil detection analysis (ToF-E ERDA), Rutherford backscattering spectrometry (RBS), and x-ray diffraction. High energy resolution core level XPS spectra acquired with monochromatic Al Kα radiation on the ISO-calibrated instrument reveal that even mild etching conditions result in the formation of a nitrogen-deficient surface layer that substantially affects the extracted binding energy

  18. Canine distemper virus DNA vaccination of mink can overcome interference by maternal antibodies.

    Science.gov (United States)

    Jensen, Trine Hammer; Nielsen, Line; Aasted, Bent; Pertoldi, Cino; Blixenkrone-Møller, Merete

    2015-03-10

    Canine distemper virus (CDV) is highly contagious and can cause severe disease against which conventional live vaccines are ineffective in the presence of maternal antibodies. Vaccination in the presences of maternal antibodies was challenged by vaccination of 5 days old and 3 weeks old mink kits with CDV DNA vaccines. Virus neutralising (VN) antibody responses were induced in mink kits vaccinated with a plasmid encoding the haemaglutinin protein (H) of CDV (n=5, pCDV-H) or a combination of the H, fusion (F) and nucleoprotein (N) of CDV (n=5, pCDV-HFN). These DNA vaccinated kits were protected against virulent experimental infection with field strains of CDV. The pCDV-H was more efficient in inducing protective immunity in the presence of maternal antibodies compared to the pCDV-HFN. The results show that DNA vaccination with the pCDV-H or pCDV-HFN (n=4) only given once at 5 days of age induces virus specific immune response in neonatal mink and protection against virulent CDV exposure later in life. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Lattice thermal expansions of NpN, PuN and AmN

    International Nuclear Information System (INIS)

    Takano, Masahide; Akabori, Mitsuo; Arai, Yasuo; Minato, Kazuo

    2008-01-01

    Lattice parameters of NpN, PuN and AmN were measured by a high temperature X-ray diffraction method from room temperature up to 1478 K. Linear thermal expansions of these TRU nitrides were determined as a function of temperature. The average coefficients of linear thermal expansion from 293 to 1273 K were 8.8, 11.1 and 11.2 x 10 -6 K -1 for NpN, PuN and AmN, respectively. The instantaneous coefficient of thermal expansion either at 293 or at 1273 K against the reciprocal decomposition temperature under 1 atm of nitrogen showed a linear relationship for TiN, ZrN, HfN, UN, NpN and PuN. Based on this relationship, the decomposition temperature of AmN was roughly predicted to be 2700 K

  20. A Modified Nitride-Based Fuel for Long Core Life and Proliferation Resistance

    International Nuclear Information System (INIS)

    Ebbinghaus, B; Choi, J; Meier, T

    2003-01-01

    A modified nitride-based uranium fuel to support the small, secured, transportable, and autonomous reactor (SSTAR) concept is initiated at Lawrence Livermore National laboratory (LLNL). This project centers on the evaluation of modified uranium nitride fuels imbedded with other inert (e.g. ZrN), neutron-absorbing (e.g. HfN) , or breeding (e.g. ThN) nitrides to enhance the fuel properties to achieve long core life with a compact reactor design. A long-life fuel could minimize the need for on-site refueling and spent-fuel storage. As a result, it could significantly improve the proliferation resistance of the reactor/fuel systems. This paper discusses the potential benefits and detriments of modified nitride-based fuels using the criteria of compactness, long-life, proliferation resistance, fuel safety, and waste management. Benefits and detriments are then considered in recommending a select set of compositions for further study

  1. Multimodální hodnocení fyzioterapeutického účinku u pacientů s postižením horní končetiny po cévní mozkové příhodě Multimodal evaluation of the effects of physiotherapy on stroke patients with upperlimb involvement

    Directory of Open Access Journals (Sweden)

    Jaroslav Opavský

    2007-01-01

    Full Text Available Úkolem této práce bylo sestavení jednoduché testové baterie, která by citlivě registrovala změny motoriky paretické ruky a postižené horní končetiny u pacientů po cévní mozkové příhodě v chronickém stádiu. Vycházeli jsme z běžně dostupných testů (Nine hole peg test, dynamometrie apod., které jsou pro tyto účely v praxi nejvíce využívány, a sledovali jsme charakter a dynamiku jejich změn po 10 rehabilitačních procedurách. Většina výsledků u vybraných testů měla obdobnou tendenci k mírnému zlepšení, ale vzhledem k rozsahu souboru nedosáhly tyto změny hladiny statistické významnosti. Prezentované nálezy předkládáme pouze jako výsledky pilotní studie. Studie bude pokračovat a soubor bude dále rozšiřován. The aim of this paper was to compile an easy testing battery, sensitive enough to register changes in the motor task performance of the paretic hand and disabled upper limb of patients who have had a brain stroke and are in the chronic stage. We selected tests commonly used in rehabilitation to scan the characteristics and dynamics of test value changes after 10 kinesiotherapy lessons. Most of our outcome had the same trend of slight improvement, but did not reach statistical signifi cance because of the size of the group. Only our pilot outcome is presented in this paper. We are going to continue this study.

  2. Synthesis, structure, thermal, transport and magnetic properties of VN ceramics

    Czech Academy of Sciences Publication Activity Database

    Huber, Š.; Jankovský, O.; Sedmidubský, D.; Luxa, J.; Klimová, K.; Hejtmánek, Jiří; Sofer, Z.

    2016-01-01

    Roč. 42, č. 16 (2016), s. 18779-18784 ISSN 0272-8842 R&D Projects: GA ČR GA13-20507S Institutional support: RVO:68378271 Keywords : vanadium mononitride * phase transition * electronic structure * heat capacity * transport properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.986, year: 2016

  3. Právní úprava mediace v obchodně-právních sporech

    OpenAIRE

    Kerbachová, Tereza

    2014-01-01

    This Bachelor thesis on the Legal Regulation of Mediation in Commercial Disputes deals with the characteristics and use of mediation as one method of alternative dispute resolution. Commercial mediation is in its infancy in the Czech Republic. Its development was influenced mainly by the adoption of Act No. 202/2012 Coll., on Mediation and Amending Certain Acts. The first chapter comprises a general introduction on the topic and its comparison with other ADR methods. The second chapter deals ...

  4. Pressure induced B3 → B1 phase transition in ZrN

    International Nuclear Information System (INIS)

    Srivastava, Anurag; Chauhan, Mamta

    2011-01-01

    Zirconium nitride belongs to a large community of high-melting transition d-metal nitrides, which possess an unusual combination of thermo mechanical properties like an increased mechanical strength and a high melting temperature with intriguing electromagnetic and thermal emission characteristics and are of great scientific and technological interest

  5. Temperature dependence of the optical properties of ion-beam sputtered ZrN films

    Energy Technology Data Exchange (ETDEWEB)

    Larijani, M.M. [NSTRI, AEOI, Radiation Applications Research School, Karaj (Iran, Islamic Republic of); Kiani, M. [Azad University, South Tehran Branch, Department of Physics, Tehran (Iran, Islamic Republic of); Jafari-Khamse, E. [NSTRI, AEOI, Radiation Applications Research School, Karaj (Iran, Islamic Republic of); University of Kashan, Department of Physics, Kashan (Iran, Islamic Republic of); Fathollahi, V. [Nuclear Science Research School, NSTRI, Tehran (Iran, Islamic Republic of)

    2014-11-15

    The reflectivity of sputtered Zirconium nitride films on glass substrate has been investigated in the spectral energy range of 0.8-6.1 eV as a function of deposition temperature varying between 373 and 723 K. Optical constants of the prepared films have been determined using the Drude analysis. Experimental results showed strong dependency of optical properties of the films, such as optical resistivity on the substrate temperature. The temperature increase of the substrate has shown an increase in both the plasmon frequency and electron scattering time. The electrical behavior of the films showed a good agreement between their optical and electrical resistivity. (orig.)

  6. A study of the picostructure of sputtered ZrN films

    International Nuclear Information System (INIS)

    Perry, A.J.; Schaffer, J.P.; Brunner, J.; Sproul, W.D.

    1991-01-01

    Stoichiometric zirconium nitride films deposited onto cemented carbide and stainless steel substrates as a function of the applied substrate bias were studied by X-ray diffraction (XRD Bragg-Brentano goniometer) and positron annihilation spectroscopy (PAS). Microhardness and color measurements were also carried out. The results at low bias levels show that the crystal lattice has no deviant behavior in the strain distribution or lattice parameters; such differences which are observed in the latter are due to the X-ray elastic constants. Shear stresses are found on the (h00) family of planes and probably on the (hhh) family at bias levels more negative than -70 V. The microhardness and residual stress are then constant. The PAS data indicate that the vacancy defect fraction is below the limit of detection at bias levels less negative than approximately -80 V; a low concentration of vacancies exists at more negative bias values. The color of the films is not affected by the bias applied during deposition, and is only slightly affected by annealing when deposited at low bias values. In view of the change in lattice parameters on annealing, it is concluded that the results do not correspond with those expected from the simple ionic model. (orig.)

  7. Effect of alloying on elastic properties of ZrN based transition metal nitride alloys

    KAUST Repository

    Kanoun, Mohammed; Goumri-Said, Souraya

    2014-01-01

    We report the effect of composition and metal sublattice substitutional element on the structural, elastic and electronic properties of ternary transition metal nitrides Zr1-xMxN with M=Al, Ti, Hf, V, Nb, W and Mo. The analysis of the elastic constants, bulk modulus, shear modulus, Young's modulus, and Poisson's ratio provides insights regarding the mechanical behavior of Zr1-xMxN. We predict that ternary alloys are more ductile compared to their parent binary compounds. The revealed trend in the mechanical behavior might help for experimentalists on the ability of tuning the mechanical properties during the alloying process by varying the concentration of the transition metal. © 2014 Elsevier B.V.

  8. Effect of alloying on elastic properties of ZrN based transition metal nitride alloys

    KAUST Repository

    Kanoun, Mohammed

    2014-09-01

    We report the effect of composition and metal sublattice substitutional element on the structural, elastic and electronic properties of ternary transition metal nitrides Zr1-xMxN with M=Al, Ti, Hf, V, Nb, W and Mo. The analysis of the elastic constants, bulk modulus, shear modulus, Young\\'s modulus, and Poisson\\'s ratio provides insights regarding the mechanical behavior of Zr1-xMxN. We predict that ternary alloys are more ductile compared to their parent binary compounds. The revealed trend in the mechanical behavior might help for experimentalists on the ability of tuning the mechanical properties during the alloying process by varying the concentration of the transition metal. © 2014 Elsevier B.V.

  9. An Analysis of the Use of Medical Applications Required for Complex Humanitarian Disasters and Emergencies via Hastily Formed Networks (HFN) in the Field

    Science.gov (United States)

    2005-09-01

    concise, easy to use and accurate means of diagnosing commonly seen parasites of dogs and cats. $45.00 2005-01-07 DrugTrials™ Keep up with the...5mHerbal™ Provides instant access to reliable information on herbs, minerals, vitamins, amino acids, probiotics , enzymes, over-the- counter hormones

  10. EFECTO DEL ÁNGULO DE INCIDENCIA SOBRE MONOCAPAS DE HfN EXPUESTAS A FENÓMENOS DE CORROSIÓN EROSIÓN

    Directory of Open Access Journals (Sweden)

    Pablo Andrés Guzmán Durán

    2015-01-01

    Full Text Available Los recubrimientos duros son una alternativa para el mejoramiento superficial de herramientasindustriales, ya que son desarrollados con el fin de aumentar la vida de servicio del materialmediante un mejoramiento de sus características frente a mecanismos de desgaste yfenómenos corrosivos. En el presente estudio se depositaron monocapas de nitruro de hafniosobre sustratos de acero AISI 4140 mediante la técnica del magnetrón sputtering multi-blancoen r.f. (13.56 MHz. Esto se hizo con el objetivo de determinar valores estimados de la pérdidade material, el desgaste mecánico y la sinergia en los fenómenos corrosivos y erosivos con baseen la norma ASTM G119–03, que interrelaciona la corrosión con el desgaste. Las monocapasfueron evaluadas frente a fenómenos de corrosión-erosión, erosión y corrosión a dos ángulos deimpacto de 30º y 90º, en una solución compuesta por NaCl 0.5 M usando un equipo de incidenciade chorro de partícula. Se analizó el efecto del ángulo de impacto en la resistencia a la corrosiónerosión de estos recubrimientos. Mediante curvas de polarización Tafel y microscopia electrónicade barrido se realizó la evaluación electroquímica y la caracterización micro-estructural de losrecubrimientos respectivamente. Se observó un aumento en la velocidad de corrosión para lossistemas sometidos a 90° y una disminución para los sistemas a 30º.

  11. Electroreduction of N2 to ammonia at ambient conditions on mononitrides of Zr, Nb, Cr, and V – A DFT guide for experiments

    DEFF Research Database (Denmark)

    Abghoui, Younes; Garden, Anna L.; Howalt, Jakob Geelmuyden

    2016-01-01

    A rapid and facile reduction of nitrogen to achieve a sustainable and energy efficient production of ammonia is critical to its use as a hydrogen storage medium, chemical feedstock and especially for manufacturing inorganic fertilizers. For a decentralization of catalytic ammonia production, small......-scale N2 reduction devices are required that are equipped with the most stable, selective and active catalysts that operate at low temperature and ambient pressure. Here, we report the development of new and cost-efficient catalysts, transition metal nitrides, which enable electrochemical reduction...... of molecular nitrogen to ammonia in aqueous media at ambient conditions with only a low applied bias. The most promising catalysts are VN, ZrN, NbN and CrN, which are identified among a range of transition metal nitride surfaces through a comprehensive density functional theory based analysis. All four...

  12. Process control with optical emission spectroscopy in triode ion plating

    International Nuclear Information System (INIS)

    Salmenoja, K.; Korhonen, A.S.; Sulonen, M.S.

    1985-01-01

    Physical vapor deposition (PVD) techniques used to prepare, e.g., hard TiN, HfN, or ZrN coatings include a great variety of processes ranging from reactive evaporation to sputtering and ion plating. In ion plating one effective way to enhance ionization is to use a negatively biased hot filament. The use of an electron emitting filament brings an extra variable to be taken into account in developing the process control. In addition, proper control of the evaporation source is critical in ensuring reproducible results. With optical emission spectroscopy (OES) it should be possible to control the coating process more accurately. The stoichiometry and the composition of the growing coating may then be ensured effectively in subsequent runs. In this work the application of optical emission spectroscopy for process control in triode ion plating is discussed. The composition of the growing coating is determined experimentally using the relative intensities of specific emission lines. Changes in the evaporation rate and the gas flow can be seen directly from emission line intensities. Even the so-called poisoning of the evaporation source with reactive gas can be detected. Several experimental runs were carried out and afterwards the concentration profiles of the deposited coatings were checked with the nuclear resonance broadening (NRB) method. The results show the usefulness of emission spectroscopy in discharge control

  13. Dårlig søvn er en trussel mod helbredet

    DEFF Research Database (Denmark)

    Clark, Alice Jessie; Jørgensen, Thea Suldrup; Bonke, Jens

    2016-01-01

    ­red sleep. A quiet, dark and well-tempered bedroom and physical activity during the day may have a positive impact on sleep. Impaired sleep may be related to stress and con­ditions at home or at work. Psychological sleep treatment is free of adverse side effects with effects comparable to effects of medical...

  14. Kudy vede správná cesta k termojaderné fúzi?

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    -, červen (2015) Institutional support: RVO:61389021 Keywords : Tokamak * stellarator * reversed field pinch * Wendelstein * Keda Torus eXperiment KTX * ZETA * first plasma Subject RIV: BL - Plasma and Gas Discharge Physics http://www.vedaprozivot.cz/sd/novinky/hlavni-stranka/150630_termojaderna_fuze.html

  15. Freestanding mesoporous VN/CNT hybrid electrodes for flexible all-solid-state supercapacitors.

    Science.gov (United States)

    Xiao, Xu; Peng, Xiang; Jin, Huanyu; Li, Tianqi; Zhang, Chengcheng; Gao, Biao; Hu, Bin; Huo, Kaifu; Zhou, Jun

    2013-09-25

    High-performance all-solid-state supercapacitors (SCs) are fabricated based on thin, lightweight, and flexible freestanding MVNN/CNT hybrid electrodes. The device shows a high volume capacitance of 7.9 F/cm(3) , volume energy and power density of 0.54 mWh/cm(3) and 0.4 W/cm(3) at a current density of 0.025 A/cm(3) . By being highly flexible, environmentally friendly, and easily connectable in series and parallel, the all-solid-state SCs promise potential applications in portable/wearable electronics. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Mediace v právním řádu ČR

    OpenAIRE

    Březovják, Michal

    2014-01-01

    The subject-matter of the present rigorous thesis is the legal regulation of mediation in the Czech law. The thesis focuses on the legal regulation of mediation in non-criminal cases. It is based on an analysis of the effective legal regulation and its comparison with foreign legislation on mediation on the territory of the Slovak Republic. It concludes that mediation in non-criminal cases can be performed even outside the mode of basic rules contained in Act No. 202/2012 Sb. (Coll.), on medi...

  17. Hermann von Helmholtz (1821-1894) o vnímání

    Czech Academy of Sciences Publication Activity Database

    Šikl, Radovan

    2001-01-01

    Roč. 45, č. 2 (2001), s. 166-178 ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : empirism-nativism * experimmental approach to perception * Treatise on physiological optics Subject RIV: AN - Psychology Impact factor: 0.195, year: 2001

  18. Právní úprava nakládání s odpady

    OpenAIRE

    Michálková, Tereza

    2014-01-01

    The thesis deals with waste management. The aim of the thesis is to describe and evaluate present waste legislation including amendmets to several waste management institutions and comparison to waste legislation of European Union. The thesis is divided into eight chapters. The first chapter focuses on introducing into general range of waste management. The second chapter deals with sources of law, both national and international. The third chapter describes the central term of waste manageme...

  19. Právní úprava rybářství

    OpenAIRE

    Šulcová, Lenka

    2009-01-01

    RESUMÉ 96 Legal regulations of fishery Thesis RESUMÉ We have an extensive fishing law and directive in the Czech Republic and practically everything is prescribed including size limits, bag limits, periods of protection for individual species, number of rods, hooks, flies used, simply everything. There is lots of legal regulations associated with fishery. In the Czech Republic, all the rivers are state. If you like to manage a fishery, you will have to win in the intimately defined selection....

  20. Moeders in de Mainstream: een genderanalyse van het werk van het VN-Kinderrechtencomite

    NARCIS (Netherlands)

    Brink, Marjoleine van den

    2006-01-01

    The relationship between women's rights and children's rights is strong and complex. Their rights and interests are often assumed to coincide, but in practice that is not necessarily the case. Granting rights to children may be to the benefit of women. However, appeals to the rights and best

  1. Lidský kapitál a vnímaná kvalita produkce podniku

    Directory of Open Access Journals (Sweden)

    Petra Štamfestová

    2014-07-01

    Full Text Available Purpose of the article: One aim of this paper is to define the concept of human capital and quality and based on the research of foreign literature to examine the findings of empirical research on the impact of human capital on production quality. The second aim is to verify the impact of human capital on the quality of production in industrial companies in the Czech Republic. Methodology/methods: In order to determine wheather human capital influence product quality correlation analysis was used. To create indexes of human capital and quality factor analysis was used and to analyse more complex links between constructs path analysis was used. Scientific aim: This paper is aimed at revealing whether human capital can effect product quality. Findings: Analysis show that there are a positive links between human capital and product quality. The research was carried out between the four dimensions of human capital measurement and quality found a positive correlation. The closest relationship is between employee satisfaction and quality. Employee satisfaction is followed by their motivation, innovation, and at least a close relationship with quality is education of employees. Conclusions: The so-called new economy puts new demands on businesses in terms of achieving long-term performance. More and more important is management of non-financial determinants of business performance which include quality management, information technology, human capital and customer, etc. and also analysing links between each other and thereby to contribute to the development of knowledge regarding the management of non-financial determinants of business performance because these determinants are crucial in achieving long term prosperity and success.

  2. Volební preference, jak jim správně porozumět

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Tomáš; Krejčí, Jindřich; Leontiyeva, Yana

    2005-01-01

    Roč. 3, č. 2 (2005), s. 25-28 ISSN 1214-438X Institutional research plan: CEZ:AV0Z70280505 Keywords : electoral preferences * election studies * public opinion polls Subject RIV: AO - Sociology, Demography

  3. Event-plane dependent di-hadron correlations with harmonic vn subtraction in a hydrodynamic model

    Science.gov (United States)

    Castilho, Wagner M.; Qian, Wei-Liang; Hama, Yogiro; Kodama, Takeshi

    2018-02-01

    In this work, a hydrodynamic study of the di-hadron azimuthal correlations for the Au+Au collisions at 200 GeV is carried out. The correlations are evaluated using the ZYAM method for the centrality windows as well as the transverse momentum range in accordance with the existing data. Event-plane dependence of the correlation is obtained after the subtraction of contributions from the most dominant harmonic coefficients. In particular, the contribution from the triangular flow, v3, is removed from the proper correlations following the procedure implemented by the STAR collaboration. The resultant structure observed in the correlations was sometimes attributed to the mini-jet dynamics, but the present calculations show that a pure hydrodynamic model gives a reasonable agreement with the main feature of the published data. A brief discussion on the physical content of the present findings is presented.

  4. Dårlig søvn er en trussel mod helbredet

    DEFF Research Database (Denmark)

    Clark, Alice Jessie; Jørgensen, Thea Suldrup; Bonke, Jens

    2016-01-01

    Long-term sleep impairment is related to an increased risk of somatic health problems, e.g. overweight, Type 2 diabe­tes, cardiovascular disease and premature death. Avoidance of caffeine, alcohol, energy-rich or fatty foods and light from computer screens close to bedtime may counteract impai......­red sleep. A quiet, dark and well-tempered bedroom and physical activity during the day may have a positive impact on sleep. Impaired sleep may be related to stress and con­ditions at home or at work. Psychological sleep treatment is free of adverse side effects with effects comparable to effects of medical...

  5. Transplantace orgánů - etické a právní aspekty

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam

    2014-01-01

    Roč. 4, č. 1 (2014), s. 30-47 ISSN 1804-8137 Keywords : transplantation * bioethics * human dignity Subject RIV: AG - Legal Sciences http://www.ilaw.cas.cz/medlawjournal/index.php/medlawjournal/article/view/63/69

  6. ON A SOUTH AFRICAN ENGLISH VOWEL SYSTEM V.N. Webb ...

    African Journals Online (AJOL)

    the assumed prestige norms of pronunciation in the cOIlUllunity and thus represent the (ultra-) formal standard rather than the knowledge under- lying the vernacular of the community ...... error" thus seems to be very small. Figure 1 shows that these two phonemes. (symbols 1 and 2) overlap quite considerably, with lei often ...

  7. Vnímanie značky McDonald's na českom trhu

    OpenAIRE

    Harčár, Tomáš

    2015-01-01

    The bachelor thesis explores perception of the brand McDonald's on the Czech market. The objective of this thesis is to test via questionnaire an assumption, which is based on belief that customers find food sold in McDonald's restaurant unhealthy and of poor quality. The thesis contains a theoretic part which presents a basic definition linked to brand building and brand image. Those definitions are further used to explain advertising strategy of McDonald's company. Concluding chapter evalua...

  8. Dårlig søvn er en trussel mod helbredet

    DEFF Research Database (Denmark)

    Clark, Alice Jessie; Jørgensen, Thea Suldrup; Bonke, Jens

    2016-01-01

    sleep. A quiet, dark and well-tempered bedroom and physical activity during the day may have a positive impact on sleep. Impaired sleep may be related to stress and conditions at home or at work. Psychological sleep treatment is free of adverse side effects with effects comparable to effects of medical...

  9. Kritika legal orgins thesis a pojem právní kultury

    Czech Academy of Sciences Publication Activity Database

    Šejvl, Michal

    2013-01-01

    Roč. 152, č. 5 (2013), s. 425-446 ISSN 0231-6625 R&D Projects: GA ČR GAP408/12/2579 Institutional support: RVO:68378122 Keywords : legal origins * law and economics * legal culture Subject RIV: AG - Legal Sciences

  10. Strategische samenwerking van de grote mogendheden in de VN-Veiligheidsraad 1946-2000

    NARCIS (Netherlands)

    Noldus, J.C.F.

    2007-01-01

    The subject of this study is the strategic cooperation of the permanent members in the Security Council in the period 1946 2000. Because of their right of veto the cooperation of the permanent members has a significant influence on the functioning of the Council. The most important aspects of the

  11. Dårlig søvn er en trussel mod helbredet

    DEFF Research Database (Denmark)

    Clark, Alice Jessie; Jørgensen, Thea Suldrup; Bonke, Jens

    2016-01-01

    sleep. A quiet, dark and well-tempered bedroom and physical activity during the day may have a positive impact on sleep. Impaired sleep may be related to stress and conditions at home or at work. Psychological sleep treatment is free of adverse side effects with effects comparable to effects of medical......Long-term sleep impairment is related to an increased risk of somatic health problems, e.g. overweight, Type 2 diabetes, cardiovascular disease and premature death. Avoidance of caffeine, alcohol, energy-rich or fatty foods and light from computer screens close to bedtime may counteract impaired...

  12. K právní úpravě elektronického podpisu

    Czech Academy of Sciences Publication Activity Database

    Matejka, Ján; Chum, V.

    2002-01-01

    Roč. 49, č. 3 (2002), s. 27-41 ISSN 1210-6348 R&D Projects: GA ČR GA407/02/0575 Institutional research plan: CEZ:AV0Z7068917 Keywords : electronic signature * act amendment Subject RIV: AG - Legal Sciences

  13. Právní analýza registrovaného partnerství

    OpenAIRE

    Nguyen, Mai Phuong

    2017-01-01

    The subject matter of this diploma thesis is an institute of register partnership analysis effective in Czech Republic. The initial chapters define terms such as family, marriage, discrimination or process of legalisation. Those terms are subsequently confronted with the subject matter of this diploma thesis. The main part of this thesis is focused on the law analysis with its legal effects in other branches of law. The diploma thesis also includes a chapter about parental right of homosexual...

  14. Sinterability of ZrN and (Zr0.6Dy0.4)N pellets – surrogate fuel fabrication for ELECTRA

    International Nuclear Information System (INIS)

    Pukari, Merja; Takano, Masahide

    2013-01-01

    → Limited O concentration improves the achievable densities within the same temperature and time frames. → The sinterability is only affected if O solution into the lattice is complete. → O-rich phases may not be detectable with XRD only → After reaching the surface area of about 6 m 2 /g, the gain in sinterability is negligible. → Similar research is currently being conducted on (Pu,Zr)N

  15. Improved Mo-Re VPS Alloys for High-Temperature Uses

    Science.gov (United States)

    Hickman, Robert; Martin, James; McKechnie, Timothy; O'Dell, John Scott

    2011-01-01

    Dispersion-strengthened molybdenum- rhenium alloys for vacuum plasma spraying (VPS) fabrication of high-temperature-resistant components are undergoing development. In comparison with otherwise equivalent non-dispersion-strengthened Mo-Re alloys, these alloys have improved high-temperature properties. Examples of VPS-fabricated high-temperature-resistant components for which these alloys are expected to be suitable include parts of aircraft and spacecraft engines, furnaces, and nuclear power plants; wear coatings; sputtering targets; x-ray targets; heat pipes in which liquid metals are used as working fluids; and heat exchangers in general. These alloys could also be useful as coating materials in some biomedical applications. The alloys consist of 60 weight percent Mo with 40 weight percent Re made from (1) blends of elemental Mo and Re powders or (2) Re-coated Mo particles that have been subjected to a proprietary powder-alloying-and-spheroidization process. For most of the dispersion- strengthening experiments performed thus far in this development effort, 0.4 volume percent of transition-metal ceramic dispersoids were mixed into the feedstock powders. For one experiment, the proportion of dispersoid was 1 volume percent. In each case, the dispersoid consisted of either ZrN particles having sizes <45 m, ZrO2 particles having sizes of about 1 m, HfO2 particles having sizes <45 m, or HfN particles having sizes <1 m. These materials were chosen for evaluation on the basis of previously published thermodynamic stability data. For comparison, Mo-Re feedstock powders without dispersoids were also prepared.

  16. Mohou mít zvířata práva? Vývoj konceptu právní subjektivity a právní postavení zvířat

    Czech Academy of Sciences Publication Activity Database

    Müllerová, Hana

    2012-01-01

    Roč. 151, č. 10 (2012), s. 1074-1103 ISSN 0231-6625 R&D Projects: GA ČR GA407/08/1053 Institutional support: RVO:68378122 Keywords : legal personality * human rights * animal protection Subject RIV: AG - Legal Sciences

  17. Mohou mít zvířata práva? Vývoj konceptu právní subjektivity a právní postavení zvířat

    OpenAIRE

    Müllerová, H. (Hana)

    2012-01-01

    From the perspective of Theory of Law, the article critically reflects on the possibility of the concept of legal personhood of animals and animal rights as rights similar to human rights, to an increasing extent called for by animal protectors. This issue was solved by changes in the conception of legal personhood that took place in Theory of Law during the 20th century. The author tends to strengthening of the present tools of animal protection and welfare instead of widening the concept of...

  18. Podnik jako předmět obchodněprávních vztahů

    OpenAIRE

    Zajíček, Jan

    2009-01-01

    65 IX. RESUMÉ 9.1 Sales Agreement on the Enterprise This dissertation concerns the enterprise as the object of commercial law relationships. It is divided in five thematic parts /blocks (see Section 2-6). In the first part I am dealing with a legal definition of the enterprise pursuant to the Czech Commercial Code. The definition of enterprise included in the Commercial Code is construed quite broadly in order to cover all elements of the enterprise. The basis for the definition of the enterp...

  19. Nové minerály uranu popsané v nedávné minulosti

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub

    2017-01-01

    Roč. 25, č. 3 (2017), s. 261-273 ISSN 1213-0710 R&D Projects: GA MŠk LO1603 Institutional support: RVO:68378271 Keywords : uranium minerals * Red Canyon area * Blue Lizard mine Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology

  20. Proces založení a tvorby oděvní značky

    OpenAIRE

    Švach, Martin

    2015-01-01

    The diploma thesis "The Process of Establishing and Building a Fashion Brand" deals with the process of establishing a fashion brand, how to write its business plan and which me- thods and techniques are suitable to use to create a fashion brand. The first part of this thesis covers the issues of establishing small business, then it is explained the structure and utilization of business plan and at the end of the theoretical part is closely described fashion marketing, as well as marketing an...

  1. Nový regionalismus ve vnějších vztazích Brazílie

    OpenAIRE

    Chvátalová, Kristýna

    2009-01-01

    This bachelor thesis focuses on the analysis of the external relations of Brazil. I compare the states in terms of a volume of trade and preferencies. That comparison is the main objective of this thesis. I used a variety of statistics from official websites of organizations - ALADI, World Trade Organization - WTO, Conference for Reconstruction and Development - UNCTAD and the Brazilian Ministry for Development, Industry and Foreign Trade - Ministerio do Desenvolvimento, Indústria e Comércio ...

  2. Analýza vnějšího prostředí pro vybranou firmu

    OpenAIRE

    ONDOKOVÁ, Lucie

    2012-01-01

    The aim of my bachelor thesis was to appreciate the current situation and market position of the building company Milan Hodboď through analysis of external environment.For analyse of external environment I used STEP analyse and Porter´s model of five powers. STEP analyse detects effects from macroenvironment (social and cultural, technical and technological, economic, political and legislative). Porter´s model five forces studies microenvironment (new competition, customers, suppliers, substi...

  3. Ochrana proti nesprávnému postupu zadavatele veřejné zakázky

    OpenAIRE

    Dostál, Ondřej

    2012-01-01

    1 Abstract Protection against improper conduct of a contracting authority in a public tender The aim of this thesis is to analyze the system of protection against improper conduct of a contracting authority in a public tender in the Czech Republic. This is a hot topic since the public eye at present focuses on corruption in public administration and public procurement is often mentioned in this context. The work consists of four chapters. The first chapter discusses the basic principles of pu...

  4. Právní principy v odpadovém hospodářství

    OpenAIRE

    Braunová, Eva

    2010-01-01

    Summary/Key words 80 SUMMARY Waste management principles The main purpose of this thesis is to analyze practical application of legal principles in waste management. This topic was chosen based on the publication of new Waste Framework Directive which newly deals with the issue of principles in the waste management. Fundamental principles that are being introduced in the Directive are waste management hierarchy, proximity principle, self-sustainability principle, extended polluter responsibil...

  5. Vnímání cause related marketingu českým spotřebitelem

    OpenAIRE

    Kuncová, Veronika

    2011-01-01

    This diploma thesis describes Cause Related Marketing as a modern communication tool which enables to link commercial business interests to the needs of the nonprofit sector. The theoretical part presents the term Cause Related Marketing and specifies its definition, mechanisms and effects it brings to individual subjects. It also describes typical consumer attitudes to the concept and factors that influence their relationship to CRM. The effect of these factors is presented on examples of fo...

  6. Hate speech v české právní teorii a mediální praxi

    OpenAIRE

    Moravová, Veronika

    2012-01-01

    This bachelor thesis deals with the topic of "hate speech" in relation to the freedom of expression. In the first part, I went into the legislation on freedom of expression and hate speech in our legal system. I devoted a considerable part to international treaties concerning this issue that, according to the Constitution, are a part of our laws and base of the national legislation to a great extent. There are two different approaches to the freedom of expression - the American and European o...

  7. Measurement of the suppression and vn of heavy flavor muons in lead-lead collisions with the ATLAS detector

    CERN Document Server

    Hu, Qipeng; The ATLAS collaboration

    2016-01-01

    ATLAS has measured the production of heavy flavor muons in 2.76 TeV pp and Pb+Pb collisions at the LHC. The measurements are performed over the transverse momentum range 4 < pT < 14 GeV and for five Pb+Pb centrality intervals. Backgrounds arising from in-flight pion and kaon decays, hadronic showers, and mis-reconstructed muons are statistically removed using a template fitting procedure. The heavy flavor muon differential cross-sections and per-event yields are measured in pp and Pb+Pb collisions, respectively. The nuclear modification factor, RAA , is observed to be independent of pT within uncertainties and to be less than unity, which indicates suppressed production of heavy flavor muons in Pb+Pb collisions. The heavy flavor muon yield is measured as a function of the azimuthal angle difference, phi-Psi_{2}, where the experimental event plane angle, Psi_{2} is measured in forward calorimeters that cover 3.2 < |y| < 4.9. Fourier coefficients associated with the cos(2(phi-Psi_{2})) modulation, v...

  8. Rawls versus Nozick: Teorie spravedlnosti jako slušnosti, a nebo oprávnění

    OpenAIRE

    PILNÁ, Martina

    2012-01-01

    This work deals with the different concepts of justice that are presented by works of John Rawls and Robert Nozick. Seeing that they are liberal authors, the first chapter is devoted to liberalism and its forms. Rawls is presented as a supporter of modern liberalism and Nozick is presented as a representative of classical liberalism, concretely libertarianism. The second chapter discusses how both authors describe natural state. The third chapter is devoted to it how Rawls and Nozick talk abo...

  9. Wrongful life, wrongful birth žaloby - etické a právní úvahy

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam

    2013-01-01

    Roč. 3, č. 3 (2013), s. 38-57 ISSN 1804-8137 Institutional support: RVO:68378122 Keywords : wrongful life actions * wrongful birth actions * bioethics Subject RIV: AG - Legal Sciences http://www.ilaw.cas.cz/medlawjournal/index.php/medlawjournal/article/view/58

  10. Apophatic way: darkness or light? (interpretation of the apophatic way in the theology of V.N. Lossky

    Directory of Open Access Journals (Sweden)

    V. V. Limonchenko

    2015-03-01

    Full Text Available Consideration of apophatics by V. Lossky realized through the establishment of two measurements that may explicate by reference to the texts of Dionysius the Areopagite. The significance of Dionysius the Areopagite in pointing out some not having gnostic­intellectual character mode of apophatic theology. Non­intellectualistic understanding of apophaticism may disclose through the understanding of the image of the Divine Darkness. Ignorance alleged mystical theology is not a state of negative character or a simple lack of knowledge, it is obvious affinity act of aesthetic contemplation, not allowing yourself to express the statement, but supposing the real presence, indicating stepping over the edge, extasys. But the ecstatic character of apophaticism makes sense of not the ecstatic visions, images, and the need to cleanse and going beyond the usual state: apophaticism is a disposition of mind, refuses drafting concepts of God that is not possible by turning off the thought, but deepening it to the primacy of reason, pre­predicative and pre­logical, turning the idea into an existential position. In the image of the Divine Darkness, correlated to the Divine Light, easy to see antinomy, but cannot see agnosticism closeness of God. In the light of existential understanding apophaticism it can be understood as the ultimate existential exposure, when the experience of others does not guarantee the encounter with God, this is the way that can only pass on their own. There is no unauthorized individualism but there is enduring on himself, that is, both intellectually and apophaticism­dialectical procedure, and how vital existential entering into communion with God is experienced in its nature.

  11. dSDiVN: a distributed Software-Defined Networking architecture for Infrastructure-less Vehicular Networks

    OpenAIRE

    Alioua, Ahmed; Senouci, Sidi-Mohammed; Moussaoui, Samira

    2017-01-01

    In the last few years, the emerging network architecture paradigm of Software-Defined Networking (SDN), has become one of the most important technology to manage large scale networks such as Vehicular Ad-hoc Networks (VANETs). Recently, several works have shown interest in the use of SDN paradigm in VANETs. SDN brings flexibility, scalability and management facility to current VANETs. However, almost all of proposed Software-Defined VANET (SDVN) architectures are infrastructure-based. This pa...

  12. Samoregulace v reklamě vs. právní úprava reklamy v ČR

    OpenAIRE

    Slaný, Miroslav

    2011-01-01

    The aim of this thesis is to describe and explain legal and ethical regulation of advertising in the Czech Republic. It also aims to analyze relevant legislation in the Czech legal system in more detail and compare it to the means of self-regulation. We shall refer to their advantages, disadvantages and the interconnection of both systems.

  13. Formy právní ochrany počítačových programů

    OpenAIRE

    Šurina, Štefan

    2009-01-01

    ❘❡s✉♠é ✈ ❛♥❣❧✐❝❦é♠ ❥❛③②❝❡✴❆❜str❛❝t ❋♦r♠s ♦❢ ▲❡❣❛❧ Pr♦t❡❝t✐♦♥ ♦❢ ❈♦♠♣✉t❡r Pr♦❣r❛♠s ❚❤❡ ♣✉r♣♦s❡ ♦❢ t❤❡ t❤❡s✐s ✇❛s t♦ ♣r❡s❡♥t ❛ ❝♦♠♣r❡❤❡♥s✐✈❡ ♦✈❡r✈✐❡✇ ♦❢ ✈❛r✐♦✉s ♠❡t❤♦❞s ♦❢ ❝♦♠♣✉t❡r ♣r♦❣r❛♠s✬ ❧❡❣❛❧ ♣r♦t❡❝t✐♦♥✳ ❚❤♦s❡ ♠❡t❤♦❞s ✇❡r❡ r❛♥❣✐♥❣ ❢r♦♠ ❛❝❝❡♣t❡❞ t♦ ♣✉r❡❧② ❤②♣♦t❤❡t✐❝❛❧ ♦♥❡s✳ ❆❝❝♦r❞✐♥❣❧②✱ t❤❡ ♦✉t❧✐♥❡❞ ♠❡t❤♦❞♦❧✲ ♦❣② ✇❛s ❝♦♥str✉❡❞ t♦ ❝♦♠♣❧② ✇✐t❤ t❤✐s s❝❤❡♠❡✳ ❋✐rst ❢♦r♠✱ t❤❡ ❝♦♣②r✐❣❤t ♣r♦✲ t❡❝t✐♦♥ ❛s t❤❡ ♠♦st ❛❝❝❡♣t❡❞ ♦♥❡ ✇❛s t❤❡r❡❢♦r❡ ❞❡❛❧t ✇✐t❤ ♠♦st❧② ❢r♦♠ t❤❡ ♣❡rs♣❡❝t✐✈❡ ♦❢ ✐ts ♣r❛❝t✐❝❛❧ ❛♣♣❧...

  14. Vnímání reklamy na sociální síti Facebook

    OpenAIRE

    Brejcha, Jan

    2011-01-01

    This thesis is focused on advertising on social network Facebook. The aim of this thesis is to explore how Facebook users perceive different types of ads that appear on Facebook and to make comparisons in relation to advertising elsewhere on the Internet. In the first part of this thesis, different types of Internet advertising and social networks are characterized. Further there are described possible kinds of advertising on Facebook which appear on this social network and equivalents of the...

  15. Reklama a její vnímání mladými lidmi.

    OpenAIRE

    Justián, Josef

    2009-01-01

    The work is dividend into two parts, theoretical part and part of own research. The first part is dealing with the categorization of commercial communications under the conception of marketing mix. It is researching the forms and tools of those communications and is evaluating their meanings. It is also describing the meaning of advertising as a one tool of commercial communications and evaluates the pros and cons of its placement in the different types of mass media. The first part of the wo...

  16. Analýza marketingové komunikace oděvní značky Zara

    OpenAIRE

    Fialíková, Lucie

    2017-01-01

    The Bachelor thesis "The Marketing Communication Analysis of Zara Fashion Brand" Zara the position of one the fast fashion market's leaders. highlights the analysis of Zara's marketing communication strategy. The primary channels are

  17. Effects of PEGylation on biomimetic synthesis of magnetoferritin nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Caiyun, E-mail: ycy@mail.iggcas.ac.cn; Cao, Changqian, E-mail: changqiancao@mail.iggcas.ac.cn; Cai, Yao, E-mail: caiyao@mail.iggcas.ac.cn; Xu, Huangtao, E-mail: xuhuangtao@mail.iggcas.ac.cn; Zhang, Tongwei, E-mail: ztw@mail.iggcas.ac.cn; Pan, Yongxin, E-mail: yxpan@mail.iggcas.ac.cn [Institute of Geology and Geophysics, Chinese Academy of Sciences, Key Laboratory of Earth and Planetary Physics (China)

    2017-03-15

    Recent studies have demonstrated that ferrimagnetic magnetoferritin nanoparticles are a promising novel magnetic nanomaterial in biomedical applications, including biocatalysis, imaging, diagnostics, and tumor therapy. Here we investigated the PEGylation of human H-ferritin (HFn) proteins and the possible influence on biomimetic synthesis of magnetoferritin nanoparticles. The outer surface of HFn proteins was chemically modified with different PEG molecular weights (PEG10K and PEG20K) and different modification ratios (HFn subunit:PEG20K = 1:1, 1:2, 1:4). The PEGylated HFn proteins were used for biomimetic synthesis of ferrimagnetic magnetoferritin nanoparticles. We found that, compared with magnetoferritin using non-PEGylated HFn protein templates, the synthesized magnetoferritin using the PEGylated HFn protein templates possessed larger magnetite cores, higher magnetization and relaxivity values, and improved thermal stability. These results suggest that the PEGylation of H-ferritin may improve the biomineralization of magnetoferritin nanoparticles and enhance their biomedical applications.

  18. Nanomechanical properties of hafnium nitride coating

    International Nuclear Information System (INIS)

    Chen Yao; Laha, Tapas; Balani, Kantesh; Agarwal, Arvind

    2008-01-01

    Nanomechanical properties of plasma-sprayed HfN coating with and without hot isostatic pressing (HIP) treatment were evaluated using nanoindentation. For HIPed HfN coating, the elastic modulus (E) and yield strength increase whereas the hardness (H), H/E ratio and fraction of the elastic work decrease. HIPed HfN coating shows a larger pile-up around the indent as compared to as-sprayed HfN. HIPing causes densification and improvement in inter-splat bonding which subsequently lead to increase in nanomechanical properties

  19. Materials and coating technology for pyrochemical reprocessing applications

    International Nuclear Information System (INIS)

    Jayakumar, T.; Kamachi Mudali, U.

    2013-01-01

    Metallic fuelled fast breeder reactors with co-located pyrochemical reprocessing plants have been proposed as the best option in order to increase the breeding gain, reduce the doubling time of the fuel and reprocess short cooled and high burnup fuel. To establish the pyrochemical reprocessing plants with various unit operations, it is necessary to identify, develop and qualify reliable corrosion resistant materials and coatings for service in molten LiCI-KCI salt and molten uranium environment operating at 773 to 1573 K. Towards materials and coating technology development and testing for molten salt environment a high temperature corrosion testing laboratory was established and studies were initiated. Molten salt test assembly for testing materials and coatings in molten LiCI-KCI salt under controlled ultra high pure (UHP) argon environment at high temperatures has been designed, fabricated, commissioned and tests were carried out on various candidate materials and coatings. Electro-formed (EF) Ni, Ni with Ni-W coating, coatings of ZrN, TiN, HfN and Ti-Si-N on high density (HD) graphite, candidate materials like 2.25Cr-1Mo steel, 9Cr-1Mo steel, 316L stainless steel, Ni base alloys (INCONEL 600, 625 and 690), HD graphite, pyrolytic graphite (PyG), and yttria stabilized zirconia (YSZ) and alumina-40wt% titania thermal barrier coatings were tested for their suitability for molten salt applications. Corrosion studies indicated that YSZ and PyG showed superior corrosion resistance in molten LiCI-KCI salt at 873 K up to 2000 h exposure. Surface modification techniques like annealing, laser remelting and laser shock processing were pursued to consolidate the coatings and improve their high temperature performance. Coating integrity using dielectric electrochemical system and thermal cycling furnace established that, compared to plain 9Cr-1Mo steel YSZ coated 9Cr-1Mo steel performed better from 473 K to 1223 K. The presentation highlights the results of the

  20. Segregace příměsí na hranicích zrn a mezikrystalová křehkost.Významná česká stopa ve fyzice materiálů

    Czech Academy of Sciences Publication Activity Database

    Lejček, Pavel; Šob, Mojmír; Paidar, Václav

    2017-01-01

    Roč. 4, č. 67 (2017), s. 203-211 ISSN 0009-0700 R&D Projects: GA ČR GBP108/12/G043; GA ČR(CZ) GA16-24711S; GA MŠk(CZ) LQ1601 Institutional support: RVO:68378271 ; RVO:68081723 Keywords : grain boundary segregation * intercrystalline cohesion * anisotropy * enthalpy-entropy compensation effect * computer simulations Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.)

  1. ZrC zone structure and features of electronic structure of solid solutions on the base ZrC, ZrN, TiC and TiN

    International Nuclear Information System (INIS)

    Mokhracheva, L.P.; Gel'd, P.V.; Tskhaj, V.A.

    1983-01-01

    The results of ZrC zone structure calculation conducted using the strong bond method in the three-centre variant are given. Essentially higher degree of M-C chemical bond ionicity than in TiC is shown to take place for it. Solid solution formation in TiC-ZrC, TiN-ZrC and ZrC-ZrN systems differing from TiC-TiN, TiN-ZrN and TiC-TiN is stated to be followed by essential deformation of component zone structures that, obviously, should prevent formation of solid solutions without vacancies in sublatices in these systems

  2. Measurements of 14-MeV neutron cross-sections for the production of isomeric states in hafnium isotopes

    International Nuclear Information System (INIS)

    Patrick, B.H.; Sowerby, M.G.; Wilkins, C.G.; Russen, L.C.

    1990-01-01

    The cross sections for the production of isomeric states in the reactions 179 Hf(n,2n) 178m2 Hf, 180 Hf(n,2n) 179m2 Hf, 179 Hf(n,n') 179m2 Hf with 14 MeV neutrons have been measured and compared with the theoretical ones. 4 refs, 3 figs, 4 tabs

  3. Hipoterapie jako podpůrná terapie u pacientů s cévní mozkovou příhodou

    OpenAIRE

    ČERVENÁ, Kateřina

    2015-01-01

    This bachelor thesis deals with hippotherapy as supportive therapy of patients with stroke. Our starting platform is from the practical experience of therapists hippotherapy's centers Pirouette and available literature. The work is traditionally divided into theoretical and practical. The theoretical part provides an overview of current knowledge and is divided into two chapters, which dealing with the issue of stroke and hippotherapy. There are explained basic concepts necessary for insight ...

  4. Event-plane-dependent dihadron correlations with harmonic v(n) subtraction in Au plus Au collisions at v root sNN=200 GeV

    Czech Academy of Sciences Publication Activity Database

    Agakishiev, G.; Aggarwal, M. M.; Ahammed, Z.; Alakhverdyants, A. V.; Alekseev, I.; Alford, J.; Anderson, B. D.; Anson, C.; Bielčík, J.; Bielčíková, Jana; Chaloupka, Petr; Chung, Paul; Hajková, O.; Kapitán, Jan; Kushpil, Vasilij; Krus, M.; Pachr, M.; Rusňák, Jan; Šumbera, Michal; Tlustý, David

    2014-01-01

    Roč. 89, č. 4 (2014), 041901 ISSN 0556-2813 R&D Projects: GA ČR GA13-20841S Institutional support: RVO:61389005 Keywords : STAR collaboration * relativistic nuclear collisions * quark-gluon plasma Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.733, year: 2014

  5. Veřejnoprávní ochrana spotřebitele finančních služeb v České republice

    OpenAIRE

    Safín, Michal

    2013-01-01

    The thesis aims to specify means of consumer protection in financial services in the Czech legal system, to clarify their structure, assess efficiency and evaluate the extent to which consumer protection is provided. Main topic of interest is restricted within the purview of the financial ombudsman of the Czech Republic. The first chapter focuses on definition of instrument of consumer protection in financial services and their classification from a theoretical point of view. The next three c...

  6. Právní audit v oblasti mezinárodních fúzí a akvizic

    OpenAIRE

    Dendisová, Zuzana

    2013-01-01

    Diploma thesis "Due Diligence in the Field of Mergers and Acquisitions" analyses due diligence in perspective of Czech legal practice and clarifies the due diligence concept during M&A transactions. The first chapter is an introduction to due diligence . The second chapter is dedicated to international mergers and acquisitions. The third chapter explains due diligence in practice and the fourth chapter analyses benefits and risks of M&A.

  7. Concomitant caries and calculus formation from in situ dentin caries model [v1; ref status: indexed, http://f1000r.es/VnGedU

    Directory of Open Access Journals (Sweden)

    Frederico B de Sousa

    2013-01-01

    Full Text Available The aim of this study was to test the possibility of the concomitant formation of calculus deposits and caries from in situ dentin caries model for short time periods. Six volunteers wore palatal removal appliances with four polished dentin specimens protected from intra-oral mechanical forces for up to 14 days. Each volunteer applied a 50% sucrose solution (four times a day on the specimens and performed a daily mouthwash with 0.05% NaF. Samples were removed after 2, 5, 9 and 14 days in situ. Demineralization was analyzed by stereomicroscopy and SEM (secondary electrons and backscattered electrons modes and calculus was analyzed by energy dispersive spectroscopy and fluorescence spectroscopy. Seventeen samples, at least one sample from each volunteer, presented dental calculus on both carious and non-carious ones, detected in all time intervals. Ca/P ratios of dental calculus ranged from 1.1 to 1.7. Some large calculus deposits on carious surfaces were confirmed by fluorescence. In conclusion, concomitant caries and calculus formation can be found in dentin caries formed in situ. This has important repercussions on the study of surface phenomena on the interface between hard dental tissues and dental plaque.

  8. Kazuistika fyzioterapeutické péče o pacienta po cévní mozkové příhodě

    OpenAIRE

    Šťastná, Johana

    2012-01-01

    CASE STUDY OF PHYSIOTHERAPY TREATMENT OF A PATIENT AFTER STROKE Objectives: Theoretical analysis of after stroke management and elaboration of physiotherapy treatment schedule in the form of an after stroke patient case study. Methods: This work was done with patients consent within an uninterrupted practice at Central Military Hospital in Prague at the Department of Physical Medicine and Rehabilitation. The practice was held from 9th January to 3rd February. The work is divided into two main...

  9. Kauzalita jako nutný prostředek pro uchopení právní odpovědnosti?

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam; Doležal, Tomáš

    2014-01-01

    Roč. 153, č. 5 (2014), s. 353-379 ISSN 0231-6625 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : causality * tort law * legal liability Subject RIV: AG - Legal Sciences

  10. Vnímání genderových nerovností na trhu práce českou populací

    Czech Academy of Sciences Publication Activity Database

    Křížková, Alena

    2004-01-01

    Roč. 5, č. 4 (2004), s. 26-27 ISSN 1213-0028 R&D Projects: GA AV ČR IBS7028002 Institutional research plan: CEZ:AV0Z7028912 Keywords : gender pay gap * sex discrimination * gender inequalities on the labor market Subject RIV: AO - Sociology, Demography

  11. Vnímání husitství v české moderní a postmoderní společnosti

    Czech Academy of Sciences Publication Activity Database

    Čornej, Petr

    2013-01-01

    Roč. 53, č. 1 (2013), s. 25-34 ISSN 0323-0562 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:68378092 Keywords : Hussitism * Enlightment * religious reform * Czech society Subject RIV: AB - History

  12. Problematika prokazování příčinné souvislosti v medicínsko-právních sporech

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam; Doležal, Tomáš

    2013-01-01

    Roč. 152, č. 6 (2013), s. 577-588 ISSN 0231-6625 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : causal nexus * medical law * tort law Subject RIV: AG - Legal Sciences

  13. Americký trávník jako cvičiště občanské ctnosti

    Directory of Open Access Journals (Sweden)

    Jan Hlávka

    2016-06-01

    Full Text Available This article seeks to refute the thesis of contemporary environmental criticism of the aesthetic origins of American lawn culture. In contrast to the prevailing view about the aesthetic autonomy of the perfect front lawn, the author traces the history of the concept back to the eighteenth-century philosophy of internal senses as reflected in the thought of Thomas Jefferson. The author seeks to demonstrate that in Jefferson’s processual conception of civic virtue (a foundation stone of democratic society, moral sense and the sense of beauty are entangled with the workings of cognitive capacities. Thus, the architectural and landscape designs of Jefferson (as well as of those of his successors, A. J. Downing, F. L. Olmsted, and F. S. Scott perform an aesthetic, moral, educative, and, above all, political function. The ideas discovered in Jefferson’s work are followed throughout the nineteenth-century industrialization and the spread of suburban housing to the emerging of post-war residential colonies, imposing ‘lawn politics’ by means of legal and social pressures.

  14. Vnímání firmy McDonald´s obyvateli Velkého Meziříčí

    OpenAIRE

    Liedermanová, Eva

    2014-01-01

    This diploma thesis deals with our present day society which is being increasingly subjected to the "mcdonaldization" phenomenon. The main goal of this work is the analysis of the public's perception of the McDonald's corporation in Velké Meziříčí. The theoretical part of this work is aimed at defining the basic perceptions related to the McDonald's corporation and it is relationship with the public as well as it is marketing communication. In the practical part of the thesis, sociological re...

  15. Na Vinici – druhově bohatá lokalita suchých trávníků u Čelákovic

    Czech Academy of Sciences Publication Activity Database

    Petřík, Petr; Chochel, M.; Křivský, J.; Sádlo, Jiří

    2011-01-01

    Roč. 2011, č. 26 (2011), s. 163-171 ISSN 0862-2035 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : biodiversity * Cirsio-Brachypodion * nature conversation Subject RIV: EF - Botanics

  16. Odchylky od spisovné jazykové normy v současných právních textech

    Czech Academy of Sciences Publication Activity Database

    Smejkalová, Kamila; Prokšová, Hana

    2017-01-01

    Roč. 50, 7/8 (2017), s. 401-410 ISSN 0139-6005 Institutional support: RVO:68378092 Keywords : norm * codification * standard language * administrative style * orthography Subject RIV: AI - Linguistics OBOR OECD: Linguistics http://www.mvcr.cz/clanek/spravni-pravo-cislo-7-8-2017.aspx

  17. Zákaz diskriminace v pracovněprávních vztazích z důvodu pohlaví

    OpenAIRE

    Jiříček, Jan

    2017-01-01

    This thesis deals with the prohibition of discrimination in labor law relations on grounds of gender. Discrimination in labor law relations is only part of the broad issue of discrimination, but the importance of labor relations in the society makes this issue it very important. Discrimination on grounds of gender is specific in that it covers a wide range of social groups, and despite the long development and changes in society, which was achieved with great effort of many organizations and ...

  18. Postavení a činnost zpravodajských služeb v České republice (právní aspekty)

    OpenAIRE

    Bezděk, Tomáš

    2016-01-01

    Position and activities of intelligence services in the Czech Republic (legal aspects) This thesis aims for coherent description of legal aspects of the status and activities of the three intelligence services of the Czech Republic which are Security Information Service, Office for Foreign Relations and Information and Military Intelligence. The thesis is based on legislation effective on January 1, 2016 but it also reflects the historical development of the legislation in this area since ear...

  19. Postavení a činnost zpravodajských služeb v České republice (právní aspekty)

    OpenAIRE

    Šišlák, Stanislav

    2016-01-01

    Status and activities of the intelligence services in the Czech Republic (legal aspects) My master's degree thesis attempts to analyse the status and activities of the intelligence services in the Czech Republic. Nowadays the importance of the intelligence services is steadily growing worldwide because of bigger threat of terrorists' attacks and worsening security situation in certain regions in the world. Czech intelligence services must adapt to this situation and that's why I started to in...

  20. Právní režim ochrany biodiverzity mořského dna za hranicemi národní jurisdikce

    OpenAIRE

    Majovská, Barbara

    2017-01-01

    The seabed has long been an unexplored area and we still do not have all the information about its environment. In the second half of the 20th century, the development of technology allowed a better exploration of the seabed. There have been discovered seamounts, hydrothermal vents and other formations. Around these formations there are rich ecosystems that are currently threatened by mining, deep-sea fishing, bioprospecting and deep-sea tourism. Most of the seabed is beyond the area of natio...

  1. Analýza vnějšího prostředí vybraného podnikatelského subjektu

    OpenAIRE

    PLACHÁ, Veronika

    2016-01-01

    The bachelor thesis has got two parts. The first is theoretical frame work. There are the terms of the area explained, for example enterprise, business, strategy and external analysis. The practical part focuses on the analysis of a medium-sized company. Based on observations and interviews with company management, the thesis processes SWOT analysis, PESTE analysis and method of Porter´s five forces model.

  2. Automatické rozpoznávání právních termínů

    Czech Academy of Sciences Publication Activity Database

    Cvrček, František

    2007-01-01

    Roč. 146, č. 4 (2007), s. 433-443 ISSN 0231-6625 R&D Projects: GA AV ČR IAA700680502 Institutional research plan: CEZ:AV0Z70680506 Keywords : legal data base * Institute of State and Law Subject RIV: AG - Legal Sciences

  3. Právní úprava auditu v České republice a mezinárodní harmonizační procesy

    OpenAIRE

    Ciprovská, Jana

    2009-01-01

    The thesis describes law relating to auditors and audit services in the Czech republic. It consists of five chapters. The first one defines the audit, goes through its history, development, and lists the main goals it should fulfill. The second chapter deals with ethics of the audit profession. The rules are mainly covered by the ethics code which sets the basic principles all auditors are obliged to respect and follow. Various circumstances threatening these principles and settings that audi...

  4. Vnímanie privátnych značiek českým zákazníkom

    OpenAIRE

    Perončíková, Lenka

    2015-01-01

    This thesis analyses perception and knowledge of Tesco private labels by Czech customer in age of 18 to 29 years. The main method of data collection was an online questionnaire survey. The thesis begins by introducing the term of private label. Further on it offers information about origin and history of transnational company Tesco and activity of this chain store in Czech Republic. The thesis also acquaints which private labels Tesco sells in Czech market. The final practical part contains r...

  5. Vybrané právní formy podnikání zahraničního subjektu v ČR

    OpenAIRE

    Pacovský, Martin

    2012-01-01

    The work deals with the topic of entry of foreign entrepreneurs to the Czech market on the background of two different forms of business - franchising and a limited liability company. The main topic concentrates on the comparison of legislation and contractual framework of these two business forms, primarily focusing on intellectual property and the protection of intangible assets. The work presents general legal provisions related to contracts in the field of intellectual property rights, in...

  6. Antické a středověké kořeny pojmu právního státu

    Czech Academy of Sciences Publication Activity Database

    Šejvl, Michal

    2014-01-01

    Roč. 153, č. 12 (2014), s. 1077-1100 ISSN 0231-6625 R&D Projects: GA ČR GAP408/12/2579 Institutional support: RVO:68378122 Keywords : rule of law * Rechtsstaat * ancient law Subject RIV: AG - Legal Sciences

  7. Právní a sociální úprava drogových závislostí

    OpenAIRE

    Harhajová, Andrea

    2010-01-01

    Legal and social aspects of drug addiction legislation The purpose of my thesis is to analyse influence of EU policy on drug legislation, obligations of UNO conventions, drug related legislation in Czech republic, national drug policy and comparison of drug related legislation in Czech republic an Slovak republic. The reason for my research is long term interest about this issue. Drug phenomenon is insepareble to the human mankind and becomes to global problem. Illegal drugs is the third bigg...

  8. Analýza vnímání neúplných cen zájezdů v České Republice

    OpenAIRE

    Valová, Lucie

    2008-01-01

    The thesis deals with problems of price quoting of travel packages in the Czech Republic. It refers to the process of packaging in the theoretical part, as well to various ways of pricing together with calculation illustration and catalogues price strategy. Furthermore, it shows the difference between a company's and a customer's price perception and informs about the psychological price effect on the final consumer. The important part of this thesis represents the analysis of the current sit...

  9. Vnější prostředí vybraného podniku a jeho hodnocení

    OpenAIRE

    NAJMANOVÁ, Zuzana

    2009-01-01

    The intention of my report was assesment of the present situation and the market position of Iveria-tour by analyzing the outer enviroments. Based on these findings than designing optimum strategy for the company to help to maintain and improve its position on the market. Among the analysis I used is the STEP analysis, Porter model, the trend and need analysis and the last one SWOT analysis on all of which the strategy is based on.

  10. Domácí násilí - kriminologické a trestněprávní aspekty

    OpenAIRE

    Mužíková, Kateřina

    2017-01-01

    Domestic violence is an important problem in theory and in practical context. It is a serious social concern with high level of latency and this is why we still need to talk about it. An each family member, can be a victim in most of cases women are victims. This thesis also focuses on male victims of spousal violence. A violence is different for each of these groups which is described in this thesis. This thesis is divided into seven chapters. The introductory chapter is focused on the histo...

  11. "FATCA" a její promítnutí do právního řádu České republiky

    OpenAIRE

    Vardanová, Magda

    2015-01-01

    Resume in English Name of the thesis: "FATCA" and its projection into the Czech legal system Foreign Account Tax Compliance Act (alias FATCA), the law of the United States, is currently being much discussed topic not even in the Czech Republic, but within the European Union and also globally, as many developed countries are forced to implement its ideas due to their fear of possible sanctions from the USA. The purpose of this act is more efficient fight against the tax evasion of American tax...

  12. Dítě ve velkomoravských právních památkách

    Czech Academy of Sciences Publication Activity Database

    Havlíková, Lubomíra

    2012-01-01

    Roč. 5, č. 1 (2012), s. 1-10 ISSN 1337-8740 R&D Projects: GA MŠk 7AMB12SK161 Institutional support: RVO:68378017 Keywords : history * gender studies * Great Moravian law * Slavonic law * Byzantine law * child * woman * matrimony * Great Moravia * Constanrtine and Methodius Subject RIV: AB - History http://www.ukm.ff.ukf.sk/wp-content/uploads/2012/09/konstantinove-listy-2012text.pdf

  13. Finančněprávní regulace penzijních společností a penzijních fondů

    OpenAIRE

    Jahodová, Iva

    2012-01-01

    Legal regulation of pension companies and pension funds The Master's thesis concentrates on the main issues of the legal regulation of pension companies, the designated providers of pension savings and supplementary pension savings in the Czech Republic. The thesis evaluates the reform of the pension schemes constituted by Act No. 426/2011 Coll., on Pension Savings, Act No. 427/2011 Coll., on Supplementary Pension Savings, and Act No. 428/2011 Coll., amending Certain Acts in Connection with t...

  14. Trestněprávní a kriminologické aspekty trestného činu znásilnění

    OpenAIRE

    Staňková, Lenka

    2014-01-01

    (EN): Criminal Law and Criminological Aspects of the Rape Crime The rape crime is a very specific crime. Although it belongs to the most painful and traumatic crimes, the public does not often pay enough attention to it, which in practice leads to the fact that rape victims are sometimes overlooked, treated insensitively, or their trauma is often trivialized. We also cannot ignore the fact that the rape crime is accompanied by a number of prejudices, which are for many decades ingrained in ou...

  15. Komparace zdanění zisků podnikatelů podle právní formy podnikání

    OpenAIRE

    Homolková, Lenka

    2008-01-01

    This diploma Thesis was focused on comparison of profit taxation by legal form of business. Two legal forms were chosen - sole trader and limited company. The main objective was to compare the effective rate of taxation of defined incomes in the period 2003 to 2009. The maximum amount of income produced was set to 5 million CZK. A secondary goal of this work was to describe and analyze which types of income can one reach through doing business via Ltd. In the final analysis, when compared wit...

  16. Právní otázky direct marketingových sdělení v České republice

    OpenAIRE

    Demuthová, Martina

    2014-01-01

    The thesis deals with the issue of direct marketing, its instruments and related legislation. Direct marketing is a form of marketing communication which allows businesses to communicate directly with their customers. Its value in marketing is increasing, as well as spam, which is also defined in this thesis. First explained is the term direct marketing, its advantages and disadvantages, its tools and current role in the industry. Furthermore, a summary of the present legal and ethical regula...

  17. Právní postavení nezletilého v civilním soudním řízení

    OpenAIRE

    Sedláčková, Kristína

    2016-01-01

    Legal status of a minor in civil proceedings The diploma thesis describes different stages and types of civil proceedings in their relation to the legal position of a minor (person under the age of 18). Legal position of a minor is assessed mainly in relation to his mental capacity and to the procedural rights to which the minor is entitled. The thesis approaches all of the civil proceedings from the point of view of a minor and points out all proceedings in which the minor can find himself t...

  18. Právní úprava reklamy na léčivé přípravky v ČR

    OpenAIRE

    Kučerová, Jana

    2013-01-01

    Legal regulation of advertising of medicinal products in the Czech Republic Abstract This thesis deals with the advertising of medicinal products for human use and its development and legislation. The introductory part is set the objectives of this thesis and the reasons for choosing this topic. The first chapter is devoted to advertising, its legislation, the definition of advertising, history of advertising and this chapter also highlights the institution supervising advertising. The second...

  19. Veřejnoprávní regulace reklamy na humanní léčivé přípravky

    OpenAIRE

    Šildová, Alena

    2014-01-01

    This thesis deals with advertising of medicinal products for human use and its public law regulation contained especially in administrative law regulations. The thesis aims to bring information on the existing law in this area, explain particular legal institutes and propose potential amendments of the existing regulation in appropriate cases. The first chapter is devoted to definition of crucial terms of a medicinal product, advertising and public regulation, since their correct understandin...

  20. K aktuálním otázkám správní vědy

    Czech Academy of Sciences Publication Activity Database

    Grospič, Jiří

    -, č. 1 (2010), s. 23-35 ISSN 0323-0619 Institutional research plan: CEZ:AV0Z70680506 Keywords : public private partnership * administrative law * eGovernment * eGovernance Subject RIV: AG - Legal Sciences

  1. Proto-právní vztah: normativní kompas v globalizovaném světě

    Czech Academy of Sciences Publication Activity Database

    Pavlakos, George

    2016-01-01

    Roč. 155, č. 6 (2016), s. 473-488 ISSN 0231-6625 R&D Projects: GA ČR GA15-23955S Institutional support: RVO:68378122 Keywords : law and globalization * international legal obligations * enforceability Subject RIV: AG - Legal Sciences

  2. Náhrada nákladů řízení v medicínsko-právních sporech

    Czech Academy of Sciences Publication Activity Database

    Doležal, Tomáš

    2009-01-01

    Roč. 17, č. 11 (2009), s. 401-404 ISSN 1210-6410 R&D Projects: GA ČR GP407/08/P148 Institutional research plan: CEZ:AV0Z70680506 Keywords : medical law * costs of proceedings * medical-legal disputes Subject RIV: AG - Legal Sciences

  3. Právní, daňový a účetní pohled na leasing v ČR

    OpenAIRE

    Kulhánková, Hana

    2009-01-01

    This thesis deals with leasing, its division, legal, tax and accountig framework of leasing in the Czech Republic. Accounting and tax part focuses on obligations of a leasholder and a lessor. One part is dedicated to lease market in the Czech Republic and on part deals with IFRS.

  4. Změny vnímání subjektivní vertikály u pacientů po CMP

    OpenAIRE

    Kříž, Petr

    2014-01-01

    Cerebro-vascular accident often affects parts of brain responsible for spatial orientation. Optimal integration of afference from visual, somatosensory and vestibular system is necessary for maintaining balance and often in the end for the functional indepencence of the patient. Examination of subjective vertical is a sensitive signifier for spatial orientation and the ability to discern graviception. By using clinical examination of subjective visual vertical it is possible to objectify and ...

  5. České a československé oběživo v hospodářsko-právních souvislostech

    OpenAIRE

    Maránek, Pavel

    2010-01-01

    Czech and Czechoslovak Currency within Economic and Legal Context This diploma thesis is dedicated to currency throughout the whole history of Czechoslovakia. Currency and its legal definition is a very important question not only for country's economy but also for each individual in the society. Above all, the phenomenon of monetary reforms, which have been mentioned very frequently by my grand-parents within the context of monetary reform put into life in 1953, encouraged me in seeking to d...

  6. Právní úprava působení nestátních aktérů v ozbrojeném konfliktu

    OpenAIRE

    Ochmannová, Petra

    2012-01-01

    Legal regulation of activities of non-state actors in armed conflict Petra Ochmannová Dissertation thesis - ABSTRACT The increased number of armed conflicts with various forms of participation of non- state actors has recently revealed a range of possible "gaps" in legal regulation. An array of questions has thus surfaced, concerning in particular their legal status, means of conducting armed conflicts, and, in relation to these, matters of obligatoriness of the given rules and matters of the...

  7. Event-plane-dependent dihadron correlations with harmonic vn subtraction in Au + Au collisions at s NN =200 GeV

    NARCIS (Netherlands)

    Agakishiev, H.; Aggarwal, M. M.; Ahammed, Z.; Alakhverdyants, A. V.; Alekseev, I.; Alford, J.; Anderson, B. D.; Anson, C. D.; Arkhipkin, D.; Averichev, G. S.; Balewski, J.; Beavis, D. R.; Behera, N. K.; Bellwied, R.; Betancourt, M. J.; Betts, R. R.; Bhasin, A.; Bhati, A. K.; Bichsel, H.; Bielcik, J.; Bielcikova, J.; Biritz, B.; Bland, L. C.; Borowski, W.; Bouchet, J.; Braidot, E.; Brandin, A. V.; Bridgeman, A.; Brovko, S. G.; Bruna, E.; Bueltmann, S.; Bunzarov, I.; Burton, T. P.; Cai, X. Z.; Caines, H.; De La Barca Sánchez, M. Calderón; Cebra, D.; Cendejas, R.; Cervantes, M. C.; Chajecki, Z.; Chaloupka, P.; Chattopadhyay, S.; Chen, H. F.; Chen, J. H.; Chen, J. Y.; Chen, L.; Cheng, J.; Cherney, M.; Chikanian, A.; Choi, K. E.; Christie, W.; Chung, P.; Codrington, M. J M; Corliss, R.; Cramer, J. G.; Crawford, H. J.; Dash, S.; Leyva, A. Davila; De Silva, L. C.; Debbe, R. R.; Dedovich, T. G.; Derevschikov, A. A.; De Souza, R. Derradi; Didenko, L.; Djawotho, P.; Dogra, S. M.; Dong, X.; Drachenberg, J. L.; Draper, J. E.; Dunlop, J. C.; Efimov, L. G.; Elnimr, M.; Engelage, J.; Eppley, G.; Estienne, M.; Eun, L.; Evdokimov, O.; Fatemi, R.; Fedorisin, J.; Feng, A.; Fersch, R. G.; Filip, P.; Finch, E.; Fine, V.; Fisyak, Y.; Gagliardi, C. A.; Gangadharan, D. R.; Geromitsos, A.; Geurts, F.; Ghosh, P.; Gorbunov, Y. N.; Gordon, A.; Grebenyuk, O.; Grosnick, D.; Guertin, S. M.; Gupta, A.; Guryn, W.; Haag, B.; Hajkova, O.; Hamed, A.; Han, L. X.; Harris, J. W.; Hays-Wehle, J. P.; Heinz, M.; Heppelmann, S.; Hirsch, A.; Hjort, E.; Hoffmann, G. W.; Hofman, D. J.; Huang, B.; Huang, H. Z.; Humanic, T. J.; Huo, L.; Igo, G.; Jacobs, P.; Jacobs, W. W.; Jena, C.; Jin, F.; Joseph, J.; Judd, E. G.; Kabana, S.; Kang, K.; Kapitan, J.; Kauder, K.; Ke, H.; Keane, D.; Kechechyan, A.; Kettler, D.; Kikola, D. P.; Kiryluk, J.; Kisiel, A.; Kizka, V.; Knospe, A. G.; Koetke, D. D.; Kollegger, T.; Konzer, J.; Koralt, I.; Koroleva, L.; Korsch, W.; Kotchenda, L.; Kouchpil, V.; Kravtsov, P.; Krueger, K.; Krus, M.; Kumar, L.; Kurnadi, P.; Lamont, M. A C; Landgraf, J. M.; Lapointe, S.; Lauret, J.; Lebedev, A.; Lednicky, R.; Lee, J. H.; Leight, W.; Levine, M. J.; Li, C.; Li, L.; Li, N.; Li, W.; Li, X.; Li, X.; Li, Y.; Li, Z. M.; Lisa, M. A.; Liu, F.; Liu, H.; Liu, J.; Ljubicic, T.; Llope, W. J.; Longacre, R. S.; Love, W. A.; Lu, Y.; Lukashov, E. V.; Luo, X.; Ma, G. L.; Ma, Y. G.; Mahapatra, D. P.; Majka, R.; Mall, O. I.; Mangotra, L. K.; Manweiler, R.; Margetis, S.; Markert, C.; Masui, H.; Matis, H. S.; Matulenko, Yu A.; McDonald, D.; McShane, T. S.; Meschanin, A.; Milner, R.; Minaev, N. G.; Mioduszewski, S.; Mischke, A.; Mitrovski, M. K.; Mohanty, B.; Mondal, M. M.; Morozov, B.; Morozov, D. A.; Munhoz, M. G.; Naglis, M.; Nandi, B. K.; Nayak, T. K.; Netrakanti, P. K.; Nogach, L. V.; Nurushev, S. B.; Odyniec, G.; Ogawa, A.; Oh, K.; Ohlson, A.; Okorokov, V.; Oldag, E. W.; Olson, D.; Pachr, M.; Page, B. S.; Pal, S. K.; Pandit, Y.; Panebratsev, Y.; Pawlak, T.; Pei, H.; Peitzmann, T.; Perkins, C.; Peryt, W.; Phatak, S. C.; Pile, P.; Planinic, M.; Ploskon, M. A.; Pluta, J.; Plyku, D.; Poljak, N.; Poskanzer, A. M.; Potukuchi, B. V K S; Powell, C. B.; Prindle, D.; Pruthi, N. K.; Pujahari, P. R.; Putschke, J.; Qiu, H.; Raniwala, R.; Raniwala, S.; Redwine, R.; Reed, R.; Ritter, H. G.; Roberts, J. B.; Rogachevskiy, O. V.; Romero, J. L.; Rose, A.; Ruan, L.; Rusnak, J.; Sahoo, N. R.; Sakai, S.; Sakrejda, I.; Sakuma, T.; Salur, S.; Sandweiss, J.; Sangaline, E.; Sarkar, A.; Schambach, J.; Scharenberg, R. P.; Schmah, A. M.; Schmitz, N.; Schuster, T. R.; Seele, J.; Seger, J.; Selyuzhenkov, I.; Seyboth, P.; Shahaliev, E.; Shao, M.; Sharma, M.; Shi, S. S.; Shou, Q. Y.; Sichtermann, E. P.; Simon, F.; Singaraju, R. N.; Skoby, M. J.; Smirnov, N.; Spinka, H. M.; Srivastava, B.; Stanislaus, T. D S; Staszak, D.; Steadman, S. G.; Stevens, J. R.; Stock, R.; Strikhanov, M.; Stringfellow, B.; Suaide, A. A P; Suarez, M. C.; Subba, N. L.; Sumbera, M.; Sun, X. M.; Sun, Y.; Sun, Z.; Surrow, B.; Svirida, D. N.; Symons, T. J M; De Toledo, A. Szanto; Takahashi, J.; Tang, A. H.; Tang, Z.; Tarini, L. H.; Tarnowsky, T.; Thein, D.; Thomas, J. H.; Tian, J.; Timmins, A. R.; Tlusty, D.; Tokarev, M.; Tram, V. N.; Trentalange, S.; Tribble, R. E.; Tribedy, P.; Tsai, O. D.; Ullrich, T.; Underwood, D. G.; Van Buren, G.; Van Nieuwenhuizen, G.; Vanfossen, J. A.; Varma, R.; Vasconcelos, G. M S; Vasiliev, A. N.; Videbæk, F.; Viyogi, Y. P.; Vokal, S.; Wada, M.; Walker, M.; Wang, F.; Wang, G.; Wang, H.; Wang, J. S.; Wang, Q.; Wang, X. L.; Wang, Y.; Webb, G.; Webb, J. C.; Westfall, G. D.; Whitten, C.; Wieman, H.; Wissink, S. W.; Witt, R.; Witzke, W.; Wu, Y. F.; Xiao, Z.; Xie, W.; Xu, H.; Xu, N.; Xu, Q. H.; Xu, W.; Xu, Y.; Xu, Z.; Xue, L.; Yang, Y.; Yepes, P.; Yip, K.; Yoo, I. K.; Zawisza, M.; Zbroszczyk, H.; Zhan, W.; Zhang, J. B.; Zhang, S.; Zhang, W. M.; Zhang, X. P.; Zhang, Y.; Zhang, Z. P.; Zhao, J.; Zhong, C.; Zhou, W.; Zhu, X.; Zhu, Y. H.; Zoulkarneev, R.; Zoulkarneeva, Y.

    2014-01-01

    STAR measurements of dihadron azimuthal correlations (Δφ) are reported in midcentral (20-60%) Au+Au collisions at sNN=200 GeV as a function of the trigger particle's azimuthal angle relative to the event plane, φs=|φt-ψEP|. The elliptic (v2), triangular (v3), and quadratic (v4) flow harmonic

  8. Svět očima zvířat aneb jak ptáci vnímají barvy

    Czech Academy of Sciences Publication Activity Database

    Šulc, Michal; Honza, Marcel

    2014-01-01

    Roč. 62, č. 4 (2014), s. 180-183 ISSN 0044-4812 R&D Projects: GA MŠk EE2.3.35.0026 Institutional support: RVO:68081766 Keywords : Birds * Colouration Subject RIV: EG - Zoology http://ziva.avcr.cz/files/ziva/pdf/svet-ocima-zvirat-aneb-jak-ptaci-vnimaji-barvy.pdf

  9. Přesnost a rychlost ve vnímání množství u jedinců s dyskalkulií

    OpenAIRE

    Pražáková, Kateřina

    2017-01-01

    The thesis deals with the topic of dyscalculia, which is officially recognized as a learning disability. The theoretical part of the thesis is focused on the current status of knowledge about development of mathematical skills and their disorders in the context of dyscalculia. The empiric part of this thesis describes a research which compares the performances of individuals with dyscalculia and control participants on a range number and numerosity processing tasks. The main goal was to descr...

  10. Dříve vyslovená přání (advance directives). Právní a etické úvahy

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam

    2017-01-01

    Roč. 7, č. 2 (2017), s. 1-15 ISSN 1804-8137 Institutional support: RVO:68378122 Keywords : advance directives * living will * euthanasia Subject RIV: AG - Legal Sciences OBOR OECD: Law http://www.ilaw.cas.cz/medlawjournal/index.php/medlawjournal/article/view/141

  11. Sport a právo duševního vlastnictví-zejména autorskoprávní aspekty

    OpenAIRE

    Zikl, Jan

    2011-01-01

    Sports and Intellectual Property Law - Copyright Focus Intellectual property affects with bigger or lower intensity almost all areas of modern society, sports not being an exception. Inventions of new technologies allow sportsmen and sportswomen to reach better results and to compete in new sports disciplines. Impact of broadcasting rights and branding of teams and their sponsors were detrimental to financial grow of sports and allowed sports to become a quasi-religion for many people round t...

  12. Právní postavení osob pečujících o děti na trhu práce

    OpenAIRE

    Seemanová, Jana

    2017-01-01

    Legal status of persons taking care of children in the labor market This dissertation deals with the legal status of persons taking care of children with respect to their participation in the labor market. The dissertation provides a comprehensive analysis of the legal status of these persons, focusing especially on the employees' work-life balance. The dissertation deals in particular with the issues of working conditions of pregnant women, breastfeeding employees and employed mothers in the...

  13. Odstoupení od smlouvy v obchodněprávních vztazích (důsledky)

    OpenAIRE

    Vacek, Jan

    2012-01-01

    Withdrawal from contract in business relations (consequences) Summary Withdrawal from a contract i the instute available to parties that find a contract to be unsound or damaging and that seek to be released from their contractual obligations. The conditions under which a party has the right to withdraw from a contract can be set out in the contract itself, but if the contract does not make specific provision for this then a right to withdrawal may be mandated by law. Following a party's with...

  14. Úprava elektronického podpisu v právním řádu ČR

    Czech Academy of Sciences Publication Activity Database

    Matejka, Ján

    -, č. 6 (2003), s. 10 ISSN 1210-9525 R&D Projects: GA ČR GA407/02/0296; GA AV ČR IAB7068203 Institutional research plan: CEZ:AV0Z7068917 Keywords : electronic signature * codification Subject RIV: AF - Documentation, Librarianship, Information Studies

  15. Mezinárodně právní ochrana bezpečnosti civilního letectví

    OpenAIRE

    Štěpánková, Mirka

    2013-01-01

    International Protection of Civil Aviation Safety. This analysis is based on the idea that the obligation of states to protect civil aviation against acts of unlawful interference, especially terrorist attacks, has certain limits. These limits find its source in international treaties. States are not only subjects of treaties, which protect civil aviation, but also subjects of treaties, which protect individuals and there human rights. Both kind of obligation should be respected. These days w...

  16. Vnímání rodiny u žáků vybrané střední školy

    OpenAIRE

    Ledvinová, Jarmila

    2016-01-01

    This diploma thesis deals with the issues of family and its perception by secondary school students. The theoretical part concerns family from several points of view. The introductory chapter is focused on selected milestones of the development of family in general. The substance of the next chapter is the very definition of family - how it is dealt with by Czech law, sociology and psychology. Family does not always acquire the same form, therefore in this part, there is also presented an ove...

  17. Právní regulace obchodování s finančními deriváty

    OpenAIRE

    Freibergová, Tereza

    2016-01-01

    1 Abstract This thesis is focused on the financial derivatives. The main goal of this paper is to analyse legal nature of financial derivatives and to present universal definition, general characteristics or utilization of financial derivatives. The other goal of this paper is to describe the development of supervision and regulation before and after The Global Financial Crisis. The thesis is composed of three main chapters. Chapter One is focused on a definition of the financial derivatives ...

  18. Increased thyrotropin binding in hyperfunctioning thyroid nodules.

    Science.gov (United States)

    Müller-Gärtner, H W; Schneider, C; Bay, V; Tadt, A; Rehpenning, W; de Heer, K; Jessel, M

    1987-08-01

    The object of this study was to investigate TSH receptors in hyperfunctioning thyroid nodules (HFN). In HFN, obtained from seven patients, 125-I-TSH binding as determined by equilibrium binding analysis on particulate membrane preparations, was found to be significantly increased as compared with normal thyroid tissues (five patients; P less than 0.001). Scatchard analysis of TSH-binding revealed two kinds of binding sites for both normal thyroid tissue and HFN, and displayed significantly increased association constants of high- and low-affinity binding sites in HFN (Ka = 11.75 +/- 6.8 10(9) M-1, P less than 0.001 and Ka = 2.1 +/- 1.0 10(7) M-1, P less than 0.025; x +/- SEM) as compared with normal thyroid tissue (Ka = 0.25 +/- 0.06 10(9) M-1, Ka = 0.14 +/- 0.03 10(7) M-1; x +/- SEM). The capacity of the high-affinity binding sites in HFN was found to be decreased (1.8 +/- 1.1 pmol/mg protein, x +/- SEM) in comparison with normal thyroid tissue (4.26 +/- 1.27 pmol/mg protein; x +/- SEM). TSH-receptor autoradiography applied to cryostatic tissue sections confirmed increased TSH binding of the follicular epithelium in HFN. These data suggest that an increased affinity of TSH-receptor sites in HFN in iodine deficient areas may be an important event in thyroid autonomy.

  19. High hydrostatic pressure encapsulation of doxorubicin in ferritin nanocages with enhanced efficiency.

    Science.gov (United States)

    Wang, Qi; Zhang, Chun; Liu, Liping; Li, Zenglan; Guo, Fangxia; Li, Xiunan; Luo, Jian; Zhao, Dawei; Liu, Yongdong; Su, Zhiguo

    2017-07-20

    Human ferritin (HFn) nanocaging is becoming an appealing platform for anticancer drugs delivery. However, protein aggregation always occurs during the encapsulation process, resulting in low production efficiency. A new approach using high hydrostatic pressure (HHP) was explored in this study to overcome the problem of loading doxorubicin (DOX) in HFn. At the pressure of 500MPa and pH 5.5, DOX molecules were found to be encapsulated into HFn. Meanwhile, combining it with an additive of 20mM arginine completely inhibited precipitation and aggregation, resulting in highly monodispersed nanoparticles with almost 100% protein recovery. Furthermore, stepwise decompression and incubation of the complex in atmospheric pressure at pH 7.4 for another period could further increase the DOX encapsulation ratio. The HFn-DOX nanoparticles (NPs) showed similar morphology and structural features to the hollow cage and no notable drug leakage occurred for HFn-DOX NPs when stored at 4°C and pH 7.4 for two weeks. HFn-DOX NPs prepared through HHP also showed significant cytotoxicity in vitro and higher antitumor bioactivity in vivo than naked DOX. Moreover, This HHP encapsulation strategy could economize on DOX that was greatly wasted during the conventional preparation process simply through a desalting column. These results indicated that HHP could offer a feasible approach with high efficiency for the production of HFn-DOX NPs. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ry: 128 VNXXXXXXXXXXXXKALLSAEQAELVAHGIASLIDGIWLRGTLNPQGIEADKARII 183 ... V...N ... KALLSAEQAELVAHGIASLIDGIWLRGTLNPQGIEADKARII Sbjct: 121 VNERRLLSHLRRELKALLSAEQAELVAHGIASLIDGIWLRGTLNPQGIEADKARII 176

  1. Characteristics of particulate PAHs during a typical haze episode in Guangzhou, China

    Science.gov (United States)

    Tan, Jihua; Guo, Songjun; Ma, Yongliang; Duan, Jingchun; Cheng, Yuan; He, Kebin; Yang, Fumo

    2011-10-01

    The concentrations of polycyclic aromatic hydrocarbons (PAHs) in PM 2.5 and TSP were measured in Guangzhou during a typical haze episode. This episode included NH (non-haze, 3 days), HFN (haze when air masses from north and northeast, 6 days) and HFS (haze when air masses from south, 4 days). The air quality in HFN was much worse than that in NH and HFS. The total average concentrations of PAHs in PM 2.5 were 13.25 ng m -3, 59.82 ng m -3 and 13.09 ng m -3 in NH, HFN and HFS, respectively. It indicated PAH pollution had been substantially aggravated by HFN. PAHs(5 + 6) were the most abundant compounds in HFN and HFS, which accounted for 55-75% of total concentration of PAHs, while PAHs(3 + 4) were the most abundant compounds in NH, which accounted for 54-67% of total concentration of PAHs. TEF (Toxic Equivalency Factors)-adjusted concentrations of 13 particulate PAHs were very high in HFN, indicating high health risks to humans for PAH exposure in HFN. The characteristic ratios of PAHs indicated coal combustion and traffic emission were the major contributors to PAHs in HFN and HFS. The concentrations of particulate PAHs in haze episode were strongly affected by wind speed and wind direction. PAHs in NH could be from long-range transport with high north wind speed, while local emission could be the main contributor of particle-associated PAHs in HFN. The transport speed of air masses was found to play an important role on PAH concentrations.

  2. Spoluvlastnické předkupní právo v rovině právní normy a v rovině právnědogmatické jako gordický uzel zdejší civilistiky?

    Czech Academy of Sciences Publication Activity Database

    Kober, Jan

    2014-01-01

    Roč. 153, č. 10 (2014), s. 848-890 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : co-ownership * law of property * civil law – disputes of legal scholarship Subject RIV: AG - Legal Sciences

  3. Geograficko-správní staroslověnská terminologie v právních památkách 9. století a její řecké (byzantské) a latinské paralely

    Czech Academy of Sciences Publication Activity Database

    Havlíková, Lubomíra

    2009-01-01

    Roč. 5, č. 1 (2009), s. 9-20 ISSN 1803-8301 Institutional research plan: CEZ:AV0Z90920516 Keywords : history * Great Moravia * Slavonic law * Byzantine law * linguistics * terminology Subject RIV: AB - History

  4. Filosofické a právně-filosofické aspekty kauzality jako východiska pro hledání nových řešení v medicínsko-právních sporech?

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam

    2012-01-01

    Roč. 2, č. 3 (2012), s. 1-16 ISSN 1804-8137 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : causation * medical law * philosophy of law Subject RIV: AG - Legal Sciences

  5. Heavy Ion Irradiation Effects in Zirconium Nitride

    International Nuclear Information System (INIS)

    Egeland, G.W.; Bond, G.M.; Valdez, J.A.; Swadener, J.G.; McClellan, K.J.; Maloy, S.A.; Sickafus, K.E.; Oliver, B.

    2004-01-01

    Polycrystalline zirconium nitride (ZrN) samples were irradiated with He + , Kr ++ , and Xe ++ ions to high (>1.10 16 ions/cm 2 ) fluences at ∼100 K. Following ion irradiation, transmission electron microscopy (TEM) and grazing incidence X-ray diffraction (GIXRD) were used to analyze the microstructure and crystal structure of the post-irradiated material. For ion doses equivalent to approximately 200 displacements per atom (dpa), ZrN was found to resist any amorphization transformation, based on TEM observations. At very high displacement damage doses, GIXRD measurements revealed tetragonal splitting of some of the diffraction maxima (maxima which are associated with cubic ZrN prior to irradiation). In addition to TEM and GIXRD, mechanical property changes were characterized using nano-indentation. Nano-indentation revealed no change in elastic modulus of ZrN with increasing ion dose, while the hardness of the irradiated ZrN was found to increase significantly with ion dose. Finally, He + ion implanted ZrN samples were annealed to examine He gas retention properties of ZrN as a function of annealing temperature. He gas release was measured using a residual gas analysis (RGA) spectrometer. RGA measurements were performed on He-implanted ZrN samples and on ZrN samples that had also been irradiated with Xe ++ ions, in order to introduce high levels of displacive radiation damage into the matrix. He evolution studies revealed that ZrN samples with high levels of displacement damage due to Xe implantation, show a lower temperature threshold for He release than do pristine ZrN samples. (authors)

  6. National Economic Development Procedures Manual. Recreation. Volume 3. A Case Study Application of the Contingent Valuation Method for Estimating Urban Recreation Use and Benefits

    Science.gov (United States)

    1990-11-01

    rivers or lakes? YES NO YES NO Went fishing? YES NO YES NO Went skateboarding ? YES NO YES NO Visited outdoor scenic places? YES NO YES NO Used undeveloped...VN SN N SU VU Playground equipment VN SN N SU VU Concessions VN SN N SU VU Bicycle trails VN SN N SU VU Skateboard paths VN SN N SU VU Exercise/fitness

  7. Mechanical properties of soldered joints of niobium base alloys

    International Nuclear Information System (INIS)

    Grishin, V.L.

    1980-01-01

    Mechanical properties of soldered joints of niobium alloys widely distributed in industry: VN3, VN4, VN5A, VN5AE, VN5AEP etc., 0.6-1.2 mm thick are investigated. It is found out that the usage of zirconium-vanadium, titanium-tantalum solders for welding niobium base alloys permits to obtain soldered joints with satisfactory mechanical properties at elevated temperatures

  8. Ferrimagnetic ferritin cage nanoparticles used as MRI contrast agent

    Science.gov (United States)

    Cai, Y.; Cao, C.; Zhang, T.; Xu, H.; Pan, Y.

    2017-12-01

    The nano-sized ferrimagnetic ferritin cage nanoparticles are ideal materials for understanding of superparamagnetism, biomimetic synthesis of ultrafine magnetic particles and their application in biomedicine. Ferrimagnetic M-HFn nanoparticles with size of magnetite cores in a mean size ranges from 2.7 nm to 5.3 nm were synthesized through loading different amount of iron into recombinant human H chain ferritin (HFn) shells. Both the saturation magnetization (Ms) and blocking temperature (Tb) were increased with the size of ferrimagnetic cores. In essence, magnetic resonance imaging (MRI) analysis showed that the synthesized M-HFn nanoparticles (5.3 nm magnetite core) has extremely high transverse relaxivity (r2) values up to 320.9 mM-1S-1, which indicate that M-HFn nanoparticles are promising negative contrast agent in early detection of tumors. In addition, the longitudinal relaxivity (r1) (10.4 mM-1S-1) and r2/r1 ratio ( 2.2) of M-HFn nanoparticles ( 2.7 nm magnetite core in diameter) will make it a considerable potential as a positive contrast agent in MRI. This means the M-HFn nanoparticles can be used as dual functional MR contrast agent. Acute toxicity study of M-HFn in rats showed that a dosage of 20 mg Fe/kg makes no abnormalities by serum biochemical and hematological analysis as well as histopathological examination. Compared with a similar commercial contrast agent, combidex (with a clinical dosage of 2.7 mg Fe/kg), it indicates that M-HFn nanoparticle is of a relative safe ferrimagnetic nanoparticle when used in vivo.

  9. Gene : CBRC-PTRO-17-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-17-0015 16 A Pheromone receptors VN1R3_PANTR 1e-180 100% sp|Q7YRP3|VN1R3_PANTR Vomeronasa...IPHSLHIVLLSSLDVLCLGLMTLASGSMVFILHRLKQQVQHIHGTNLSPRSSPESRVTQSILVLVSTLCYFTRSPPSLHMSLFPNPSWWPLNASALITACFPTVSPFVLMSRHPRIPRLGSACCGRNPQFPKLVR ...

  10. Dicty_cDB: SHD815 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GNMIENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsr ysft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*r...LEGNMIENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsr ysft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw

  11. Dicty_cDB: CHO775 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available WMLKGRPGRCPTCK--- ---EGNMIENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsrysft*ere *k*tfhslgkr*e*itlmaw**vn*frid...sft*ere *k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly** iiqllfhik*lsnctyvim*sftw*he*iet*ylygrgt

  12. Dicty_cDB: SHB426 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KGRP--- ---IDVDIAANLKKQTESLEGNMIENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti *nqylcsrysft*ere*k*tfhslgkr*e*itlmaw**vn*frid...LTPT**r*csl*nlgrlccq*sr*ti *nqylcsrysft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticskn wlqiw*rylfc*ly**iiql

  13. Dicty_cDB: AHB310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly* *iiqllfhik*lsnctyvim*sftw*he*iet*ylygrgttsip*yks...csl*nlgrlccq*sr*ti*nqylcsrysft*er e*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwl

  14. Dicty_cDB: CHN167 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available q*sr*ti*nqylcsrysft*ere* k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly**i iqllfhik*lsnctyvim*sft...*csl*nlgrlccq*sr*ti*nqylcsrysft*ere* k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknw

  15. Dicty_cDB: CHE850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DILFNGI EYQCKGWISGFTKCDWKGDSIER--- ---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*frid...---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticskn

  16. Dicty_cDB: CHQ835 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*ry lfc*ly**iiqllfhik*lsnctyv...ti*nqylcsr ysft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*ry lfc*ly**iiqllfhik*lsnctyvim*sftw*he*

  17. Dicty_cDB: CHO739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t*ere* k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly**i iqllfhik*lsnctyvim*sftw*he*iet*ylygrgtts...YITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsrysft*ere* k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly

  18. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The change in Vmin or Vn on the donor molecule (ΔVmin(D) or ΔVn(D)) during complex formation is proportional to its electron donating ability while such a change on the acceptor molecule (ΔVmin(A) or ΔVn(A)) is proportional to its electron accepting ability. Further, the quantities ΔΔVmin = ΔVmin(D) −ΔVmin(A) and ΔΔVn ...

  19. Nutná obrana - srovnání české právní úpravy s Modelovým trestním zákoníkem USA a common law

    OpenAIRE

    Hofmanová, Štěpánka

    2017-01-01

    This thesis aims to define the differences between the concept of self-defense under the criminal law of the Czech Republic and the United States of America, to assess their practical implications and propose possible recommendations de lege ferenda for the Czech legislation. Within the United States, the thesis further distinguishes between the concept of self-defense under the common law and the so-called Model Criminal Code, which together with the common law represents one of the most imp...

  20. Vliv akumulace dusíku na vřesoviště a suché trávníky v Národním parku Podyjí

    Czech Academy of Sciences Publication Activity Database

    Záhora, J.; Chytrý, M.; Holub, Petr; Fiala, Karel; Tůma, I.; Vavříková, J.; Fabšičová, Martina; Keizer, I.; Fillipová, L.

    2016-01-01

    Roč. 50, č. 2 (2016), s. 97-107 ISSN 0044-4863 R&D Projects: GA MZe QJ1220007; GA ČR GA206/02/0581; GA ČR(CZ) GA526/06/0556 Institutional support: RVO:67179843 ; RVO:67985939 Keywords : Arrhenatherum elatius , soil, české Podyji National Park * atmospheric nitrogen deposition * Calluna vulgaris * Calamagrostis epigejos * Festuca ovina * soil * české Podyji National Park Subject RIV: DF - Soil Science; EF - Botanics (BU-J)

  1. Analýza struktury návštěvníků hudebních festivalů a návrh nového projektu

    OpenAIRE

    ŠERPÁN, Adam

    2010-01-01

    The master thesis analyzes the structure of multi-genre music festivals´ visitors and on the base of this analysis, a part of marketing mix of concrete festival is proposed to be modified. This modification is primarily focused on communication mix. Music festivals are the product of tourism. This is one of the essential ideas of this master thesis. Festival is a service - nonmaterial product, so there must be reached the maximal efectivaty of the communication with the music festival custome...

  2. Analýza vnímání guerillových a tradičních forem marketingové komunikace českými spotřebiteli

    OpenAIRE

    Pravdová, Klára

    2014-01-01

    The aim of my bachelor's thesis is to clarify the perception of guerilla marketing communications and traditional marketing communications by Czech consumers, their relation to business communications and to prove high efficiency of guerilla marketing communications. In the theoretical part of the thesis, there are presented specifics and instruments of both traditional communication mix and guerrilla marketing communications. In the practical part of the thesis, there is a quantitative resea...

  3. Dlouhodobá skupinová izolace a její vliv na zrakové vnímání: Výsledky projektu Mars-500

    Czech Academy of Sciences Publication Activity Database

    Šimeček, Michal; Šikl, Radovan

    2013-01-01

    Roč. 57, č. 4 (2013), s. 342-357 ISSN 0009-062X R&D Projects: GA ČR GA406/09/2003 Institutional support: RVO:68081740 Keywords : visual perception * depth perception * isolation * confinement Subject RIV: AN - Psychology Impact factor: 0.292, year: 2013

  4. Džin čtení : S Jiřím Trávníčkem o překračování hranic textu

    Czech Academy of Sciences Publication Activity Database

    Trávníček, Jiří

    2007-01-01

    Roč. 3, č. 48 (2007), s. 15 ISSN 1801-4542 Institutional research plan: CEZ:AV0Z90560517 Keywords : Contemporary Theory of Literature * Czech Situation Subject RIV: AJ - Letters, Mass-media, Audiovision

  5. Rozdíly v reakční rychlosti vnějších a vnitřních polařů v softbalu

    OpenAIRE

    Weissová, Adéla

    2014-01-01

    Title: Reaction rate difference between outfielders and infielders in softball Objective: The goals to compare reaction rate of outfielders and infielders in softball Hypothesis: Infielders are able to react faster than outfielders Methods: reactometer measurement, statistical methods Results: The evaluation of all measured values, we conclude that the players of infield and outfield have approximately the same values. An important outcome measure for our study was the difference between the ...

  6. Aktuální právní otázky odpovědnosti dopravce při námořní přepravě zboží

    OpenAIRE

    Blahutová, Lenka

    2010-01-01

    in English The transport sector represents about 7% of European GDP. It should be also noted that European companies own 41% of the total world fleet capacity. As it can be seen, transport itself is an important industry and a major contributor to the functioning of not only the European economy but also the international economy. The maritime transport covers 80% of all trade exchange and has become the major transport sector in international business. The Hague, Hague-Visby (together so cal...

  7. Zabezpečení v nezaměstnanosti a jeho právní úprava v ČR a ve vybraných státech

    OpenAIRE

    Ptáčková, Leona

    2011-01-01

    LEGAL REGULATIONS OF UNEMPLOYMENT BENEFITS IN CZECH REPUBLIC AND IN SELECTED COUNTRIES This graduation thesis describes and analyzes legal regulations of unemployment benefits in Czech Republic and in Sweden. Main reason why I have chosen that topic could be seen in the fact that in both countries exist two different systems. In Czech Republic we have compulsory state system of unemployment benefits but Sweden is one of four European countries where we can find so-called Ghent system. Sweden ...

  8. Nekalá soutěž se zaměřením na klamavou reklamu a její vnímání spotřebiteli

    OpenAIRE

    Bukvová, Tereza

    2015-01-01

    The bachelor thesis is dealing with unfair competition focusing primarily on false advertising and it's perception of consumers. Theoretical part is focusing on expla-nation of terms related to unfair competition, advertising and false advertising and further legal as well as extralegal protection of consumer against false advertising. In practical part, I have dealt with questionnaire survey whose purpose was to determine how consumers perceive false advertising and if they are aware how to ...

  9. Daňové aspekty nakládání s nemovitostmi v kontextu vybrané zahraniční právní úpravy

    OpenAIRE

    Břeň, Josef

    2010-01-01

    81 7. Résumé My diploma thesis should offer a relatively complex view of the subject of Taxation of real estate transactions with a focus on the comparison of the Czech tax system with Austrian tax system, which comprises of several direct and indirect taxes concerning wealth transfers and wealth itself, especially immovable property. It deals with a specific view of problems rising in accordance of Tax theory. The following article is actually based on several taxes, which exists in the Czec...

  10. Vliv vnějších faktorů na marketingovou strategii soukromé mateřské školy při jejím založení

    OpenAIRE

    Šuvarská, Klára

    2008-01-01

    This bachelor thesis addresses the impact of external factors on the marketing strategy of a private preschool at the time of its foundation. The research of the pertinent literature is marked by the theoretical appreciation of the market environment and of the factors that influence the school environment. It is also based on the current state of preschools, the influence exerted by the macro environment and the institutional environment of the school, which is closely linked to the issue an...

  11. K oprávnění svědka odepřít výpověď podle Ô 100 odstavec 2 trestního řádu [diskuse

    Czech Academy of Sciences Publication Activity Database

    Pipek, Jiří

    2002-01-01

    Roč. 49, č. 2 (2002), s. 40-45 ISSN 1210-6348 Institutional research plan: CEZ:AV0Z7068917 Keywords : testimony * refusal of testimony * Criminal Procedure : discussion Subject RIV: AG - Legal Sciences

  12. Pseudorapidity and transverse momentum dependence of flow harmonics in pPb and PbPb collisionsDifferential flow harmonics v_n in pPb and PbPb collisions

    CERN Document Server

    Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Grossmann, Johannes; Krammer, Natascha; Hrubec, Josef; Jeitler, Manfred; König, Axel; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Pree, Elias; Rabady, Dinyar; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Strauss, Josef; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Janssen, Xavier; Lauwers, Jasper; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lowette, Steven; Moortgat, Seth; Moreels, Lieselotte; Olbrechts, Annik; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Karapostoli, Georgia; Lenzi, Thomas; Luetic, Jelena; Maerschalk, Thierry; Marinov, Andrey; Randle-conde, Aidan; Seva, Tomislav; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Cimmino, Anna; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Salva Diblen, Sinem; Tytgat, Michael; Verbeke, Willem; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caudron, Adrien; De Visscher, Simon; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Jafari, Abideh; Komm, Matthias; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Quertenmont, Loic; Vidal Marono, Miguel; Wertz, Sébastien; Beliy, Nikita; Aldá Júnior, Walter Luiz; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Moon, Chang-Seong; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Misheva, Milena; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Shopova, Mariana; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Ruiz Alvarez, José David; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Carrera Jarrin, Edgar; Abdelalim, Ahmed Ali; Mahmoud, Mohammed; Mahrous, Ayman; Dewanjee, Ram Krishna; Kadastik, Mario; Perrini, Lucia; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Pekkanen, Juska; Voutilainen, Mikko; Härkönen, Jaakko; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Ghosh, Saranya; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Kucher, Inna; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Charlot, Claude; Davignon, Olivier; Granier de Cassagnac, Raphael; Jo, Mihee; Lisniak, Stanislav; Lobanov, Artur; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Regnard, Simon; Salerno, Roberto; Sirois, Yves; Stahl Leiton, Andre Govinda; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Le Bihan, Anne-Catherine; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chierici, Roberto; Contardo, Didier; Courbon, Benoit; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Schomakers, Christian; Schulz, Johannes; Verlage, Tobias; Albert, Andreas; Brodski, Michael; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hamer, Matthias; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Knutzen, Simon; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Olschewski, Mark; Padeken, Klaas; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Sonnenschein, Lars; Teyssier, Daniel; Thüer, Sebastian; Flügge, Günter; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Lingemann, Joschka; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Eren, Engin; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Harb, Ali; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Korol, Ievgen; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Leonard, Jessica; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Ntomari, Eleni; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Roland, Benoit; Savitskyi, Mykola; Saxena, Pooja; Shevchenko, Rostyslav; Spannagel, Simon; Stefaniuk, Nazar; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Bein, Samuel; Blobel, Volker; Centis Vignali, Matteo; Draeger, Arne-Rasmus; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hoffmann, Malte; Junkes, Alexandra; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Lapsien, Tobias; Marchesini, Ivan; Marconi, Daniele; Meyer, Mareike; Niedziela, Marek; Nowatschin, Dominik; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Scharf, Christian; Schleper, Peter; Schmidt, Alexander; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baur, Sebastian; Baus, Colin; Berger, Joram; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Freund, Benedikt; Friese, Raphael; Giffels, Manuel; Gilbert, Andrew; Haitz, Dominik; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Kudella, Simon; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Topsis-Giotis, Iasonas; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Csanad, Mate; Filipovic, Nicolas; Pasztor, Gabriella; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Bahinipati, Seema; Bhowmik, Sandeep; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Bhawandeep, Bhawandeep; Chawla, Ridhi; Dhingra, Nitish; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kumar, Ramandeep; Kumari, Priyanka; Mehta, Ankita; Mittal, Monika; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Chauhan, Sushil; Choudhary, Brajesh C; Garg, Rocky Bala; Keshri, Sumit; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Ramkrishna; Sharma, Varun; Bhardwaj, Rishika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukhopadhyay, Supratik; Nandan, Saswati; Purohit, Arnab; Roy, Ashim; Roy, Debarati; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Dugad, Shashikant; Mahakud, Bibhuprasad; Mitra, Soureek; Mohanty, Gagan Bihari; Parida, Bibhuti; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sarkar, Tanmay; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Caputo, Claudio; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Costa, Salvatore; Di Mattia, Alessandro; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Robutti, Enrico; Tosi, Silvano; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pauwels, Kristof; Pedrini, Daniele; Pigazzini, Simone; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Fienga, Francesco; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Gulmini, Michele; Lacaprara, Stefano; Margoni, Martino; Maron, Gaetano; Meneguzzo, Anna Teresa; Pozzobon, Nicola; Ronchese, Paolo; Rossin, Roberto; Torassa, Ezio; Ventura, Sandro; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Fallavollita, Francesco; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Bilei, Gian Mario; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Saha, Anirban; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Margaroli, Fabrizio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Traczyk, Piotr; Belforte, Stefano; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Lee, Ari; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Brochero Cifuentes, Javier Andres; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Kim, Yongsun; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Choi, Minkyoo; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Ryu, Geonmo; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Calpas, Betty; Di Francesco, Agostino; Faccioli, Pietro; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chistov, Ruslan; Philippov, Dmitry; Polikarpov, Sergey; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Ershov, Alexander; Gribushin, Andrey; Kaminskiy, Alexandre; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Skovpen, Yuri; Shtol, Dmitry; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Barrio Luna, Mar; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Moran, Dermot; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Sanchez Cruz, Sergio; Suárez Andrés, Ignacio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Curras, Esteban; Fernandez, Marcos; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bianco, Michele; Bloch, Philippe; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Castello, Roberto; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Roeck, Albert; Di Marco, Emanuele; Dobson, Marc; Dorney, Brian; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gill, Karl; Glege, Frank; Gulhan, Doga; Gundacker, Stefan; Guthoff, Moritz; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Kirschenmann, Henning; Knünz, Valentin; Kornmayer, Andreas; Kortelainen, Matti J; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Neugebauer, Hannes; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Sauvan, Jean-Baptiste; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Steggemann, Jan; Stoye, Markus; Tosi, Mia; Treille, Daniel; Triossi, Andrea; Tsirou, Andromachi; Veckalns, Viesturs; Veres, Gabor Istvan; Verweij, Marta; Wardle, Nicholas; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Bachmair, Felix; Bäni, Lukas; Berger, Pirmin; Bianchini, Lorenzo; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Klijnsma, Thomas; Lustermann, Werner; Mangano, Boris; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Quittnat, Milena; Rossini, Marco; Schönenberger, Myriam; Shchutska, Lesya; Starodumov, Andrei; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zagozdzinska, Agnieszka; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Caminada, Lea; Canelli, Maria Florencia; De Cosa, Annapaola; Donato, Silvio; Galloni, Camilla; Hinzmann, Andreas; Hreus, Tomas; Kilminster, Benjamin; Ngadiuba, Jennifer; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Seitz, Claudia; Zucchetta, Alberto; Candelise, Vieri; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Konyushikhin, Maxim; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Fiori, Francesco; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Miñano Moya, Mercedes; Paganis, Efstathios; Psallidas, Andreas; Tsai, Jui-fa; Asavapibhop, Burin; Kovitanggoon, Kittikul; Singh, Gurpreet; Srimanobhas, Norraphat; Adiguzel, Aytul; Bakirci, Mustafa Numan; Boran, Fatma; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sunar Cerci, Deniz; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Bilin, Bugra; Karapinar, Guler; Ocalan, Kadir; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Nazlim Agaras, Merve; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Grynyov, Boris; Levchuk, Leonid; Sorokin, Pavel; Aggleton, Robin; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Flacher, Henning; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Sakuma, Tai; Seif El Nasr-storey, Sarah; Smith, Dominic; Smith, Vincent J; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Calligaris, Luigi; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Baber, Mark; Bainbridge, Robert; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Di Maria, Riccardo; Dunne, Patrick; Elwood, Adam; Futyan, David; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Lane, Rebecca; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mastrolorenzo, Luca; Matsushita, Takashi; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Pesaresi, Mark; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Pastika, Nathaniel; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Avetisyan, Aram; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Cutts, David; Garabedian, Alex; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Gardner, Michael; Ko, Winston; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Smith, John; Squires, Michael; Stolp, Dustin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Heilman, Jesse; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Shrinivas, Amithabh; Si, Weinan; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Macneill, Ian; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Heller, Ryan; Incandela, Joe; Mullin, Sam Daniel; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Yoo, Jaehyeok; Anderson, Dustin; Bendavid, Joshua; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Pena, Cristian; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; Mulholland, Troy; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Magini, Nicolo; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Brinkerhoff, Andrew; Carnes, Andrew; Carver, Matthew; Curry, David; Das, Souvik; Field, Richard D; Furic, Ivan-Kresimir; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Rank, Douglas; Sperka, David; Terentyev, Nikolay; Thomas, Laurent; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Joshi, Yagya Raj; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Perry, Thomas; Prosper, Harrison; Santra, Arka; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Trauger, Hallie; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Yi, Kai; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Royon, Christophe; Sanders, Stephen; Schmitz, Erich; Stringer, Robert; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Toda, Sachiko; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hsu, Dylan; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kao, Shih-Chuan; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Alyari, Maral; Dolen, James; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wang, Ren-Jie; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Liu, Bingxuan; Luo, Wuming; Puigh, Darren; Winer, Brian L; Wulsin, Howard Wells; Benaglia, Andrea; Cooperstein, Stephane; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Lange, David; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Stickland, David; Svyatkovskiy, Alexey; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Folgueras, Santiago; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Miller, David Harry; Neumeister, Norbert; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xie, Wei; Cheng, Tongguang; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Chen, Zhenyu; Ecklund, Karl Matthew; Geurts, Frank JM; Guilbaud, Maxime; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Tu, Zhoudunming; Zabel, James; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Verzetti, Mauro; Ciesielski, Robert; Goulianos, Konstantin; Mesropian, Christina; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Foerster, Mark; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Faulkner, James; Gurpinar, Emine; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Sun, Xin; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Clarke, Christopher; Harr, Robert; Karchin, Paul Edmund; Sturdy, Jared; Zaleski, Shawn; Belknap, Donald; Buchanan, James; Caillol, Cécile; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Pierro, Giuseppe Antonio; Polese, Giovanni; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel

    2017-01-01

    Measurements of azimuthal angular correlations are presented for high-multiplicity pPb collisions at $\\sqrt{s_{\\mathrm{NN}}} = $ 5.02 TeV and peripheral PbPb collisions at $\\sqrt{s_{\\mathrm{NN}}} = $ 2.76 TeV. The data used in this work were collected with the CMS detector at the CERN LHC. Fourier coefficients as functions of transverse momentum and pseudorapidity are studied using the scalar product method, 4-, 6-, and 8-particle cumulants, and the Lee-Yang zeros technique. The influence of event plane decorrelation is evaluated using the scalar product method and found to account for most of the observed pseudorapidity dependence.

  13. Dívkou a chlapcem ve volném čase: vnímání genderu v rámci zájmových aktivit

    Directory of Open Access Journals (Sweden)

    Tomáš Kůst

    2014-12-01

    Full Text Available In this paper I would like toexplain how students of first grade (12years old and last (eighth grade (19 yearsold at one grammar school in Pilsen regionunderstand their gender in connectionwith free time activities and interests. Freetime activities and interests are importantpart of human life. It is connected with allcomponents of our life. It means we cansuppose that gender stereotypes will exist inarea of interests and free time activities too.The aim of this work was to understand andexplain how gender stereotypes are producedand repeated. I decided for mixed methodsresearch design. First of my results is that forparticipants free time and interests are notthe same thing. Second of main results is thatin area of interests and hobbies are producedand repeated gender stereotypes. However theparticipants have never said it in the interview.The positive result of this research is howgender stereotypes could be deconstructed. Itis possible thanks to personal experience withuntypical interest according to gender. Thisexperience was shared through interactionswith others and it brought positive changes ofopinions.

  14. Spotřebitelské modely v evropském a českém právu s ohledem na smluvněprávní spory

    Czech Academy of Sciences Publication Activity Database

    Simon, Rita

    2018-01-01

    Roč. 157, č. 5 (2018), s. 385-406 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : consumer concepts by CJEU * consumer in a weak position * Czech contractual case-law * unfairness test Subject RIV: AG - Legal Sciences OBOR OECD: Law

  15. Aktualizácia webovej prezentacie Banskobystrického samosprávného kraja so zamerením na podporu cestovného ruchu

    OpenAIRE

    Mallová, Barbora

    2015-01-01

    MALLOVÁ, B. Updating the municipality website of Banská Bystrica Region with a view to tourism support. Bachelor thesis. Brno: PEF MENDELU, 2014. This Bachelor thesis is focused on region website promotion on the Internet. The aim of this work is to create new suggestion of the structure of municipal website within a scope of tourism. This work include analysis of actual municipal website through the questionnaire survey, testing on users, SEO testing of website and SWOT analysis of website. ...

  16. Vliv drenážních systémů na koncentrace dusičnanů v povrchových vodách v povodí VN Švihov

    Czech Academy of Sciences Publication Activity Database

    Lexa, M.; Kvítek, T.; Hejzlar, Josef; Fučík, P.

    2006-01-01

    Roč. 56, č. 8 (2006), s. 246-250 ISSN 1211-0760 Grant - others:VÚMOP(CZ) 0002704901; NAZV MZe(CZ) QF4062, QF3301 Institutional research plan: CEZ:AV0Z60170517 Keywords : nitrate * tile drainage * stream water Subject RIV: DJ - Water Pollution ; Quality

  17. Vliv temporálních manipulací na vnímání kompetence mluvčího / Effect of Temporal Manipulations on the Perception of Speaker Competence

    Directory of Open Access Journals (Sweden)

    Zuzana Berkovcová

    2016-06-01

    Full Text Available Speech communication research based on psychological methods currently stands at the forefront of scientific interest. Speech is an integral part of the social identity of a person and has a significant impact on the perception of the speaker by his surroundings. The present study aims to chart the effect of the temporal organization of utterances on the perception of a speaker’s competence. Recordings of four Spanish native speakers were manipulated in a way which destabilized the regular temporal structure of their utterances. A perception test was administered to forty Czech listeners differing in level of proficiency with the Spanish language. The aim of the test was to reveal the listeners’ positive or negative judgments of the original (regular and manipulated (dysfluent items. The basis for the perception test was the Big Five personality traits model, with the factor evaluated being the speakers’ competence that is the ability and readiness to effectively deal with tasks. The results confirmed our main hypothesis, which assumed that both groups of listeners will, in terms of competence, evaluate the manipulated items negatively. Students of Spanish studies were more perceptive of the temporal manipulations, most likely due to their familiarity with the prosodic structure of Spanish and their understanding of the meaning of the tested utterances.

  18. Ve Velké Británii je akademické prostředí vnímáno jako poslední bašta maskulinismu. Rozhovor Marcely Linkové s Barbarou Bagilhole

    Czech Academy of Sciences Publication Activity Database

    Linková, Marcela

    2011-01-01

    Roč. 12, č. 2 (2011), s. 58-63 ISSN 1213-0028 R&D Projects: GA MŠk OK08007 Institutional research plan: CEZ:AV0Z70280505 Keywords : gender and science * research assessment * feminism Subject RIV: AO - Sociology, Demography www.genderonline.cz

  19. Komparace monetární expanze vybraných ekonomik po nedávné finanční krizi a její přesah na devizový trh

    OpenAIRE

    Holeček, Jan

    2013-01-01

    Bachelor thesis tries to analyze monetary-political measures, used by selected central banks, after recent subprime crisis and follow-up financial crisis, with emphasis on nonstandard tools of monetary easing. In relation with nonstandard tools of monetary policy it focuses on topic of currency wars, and the influence of consequences of financial crisis and reactions of economic policy over exchange rate of selected economies. As the indicator of undervaluation or overvaluation of the exchang...

  20. Právní aspekty zdanění příjmů fyzických osob provozujících sport jako své povolání

    OpenAIRE

    Štork, Robin

    2012-01-01

    The aim of my thesis is a comprehensive overview of the problem of the income taxation of professional sportsmen. Starting from a domestic perspective, this thesis begins with analysis of the domestic tax system. It explains important underlying terms such as tax, tax law, direct taxes, indirect taxes, as well e.g. tax resident and non-resident. Then the thesis deals with the main issue of the income taxation of professional sportsmen. This part of the thesis includes main topics such as dire...

  1. Dopady zbavení svéprávnosti kapitálové obchodní společnosti na právní teorii i praxi

    OpenAIRE

    Kříž, Josef

    2014-01-01

    OF DIPLOMA THESIS An impact of incapacitation of a limited company upon legal theory and practice Author: Josef Kříž Supervisor: JUDr. Petr Čech, LL.M, Ph.D. Department: Department of Commercial Law The main purpose of my thesis was to analyse the significant change in the concept of limited company, i.e. old-new concept of the members of statutory body as agents of the company. However, I conceived a thesis more generally as analysis of the question of whether the New Civil Code and the Busi...

  2. Právní možnosti zaměstnavatele k zamezení zneužívání návykových látek na pracovišti

    Czech Academy of Sciences Publication Activity Database

    Štefko, Martin

    2012-01-01

    Roč. 21, č. 6 (2012), s. 31-36 ISSN 1802-3843 Institutional support: RVO:68378122 Keywords : labour law * alcohol at the workplace * addictive substanes at the workplace Subject RIV: AG - Legal Sciences

  3. Vnější označení a sebeoznačení českých nekatolíků v 18. - 19. století

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    2002-01-01

    Roč. 10, č. 2 (2002), s. 175-196 ISSN 1210-3640 Institutional research plan: CEZ:AV0Z7028912 Keywords : Czech history * 18th and 19th centuries * Czech Protestantism Subject RIV: AO - Sociology, Demography

  4. Nové trendy finančního účetnictví podnikatelů v kontextu právních předpisů České republiky

    Directory of Open Access Journals (Sweden)

    Jana Hinke

    2015-01-01

    Full Text Available The issue of financial accounting, there is gradual harmonization across states, which stems primarily from international operations of entrepreneurs and European integration. In 2015, it was implemented through an amendment to the Accounting Act to the Czech legislation, financial accounting new European Union legislation, which will take effect from 2016 on accounting in Czech companies. The amendment of the decrees was the further modification of Czech legislation. The paper is focused on entrepreneurs, so the attention is paid primarily by the Decree no. 500/2002 Coll. This paper deals with current issues and aims to identify major changes in the financial accounting in the Czech Republic, which will be applied since 2016. In the paper are identified significant changes as the distribution of entities into four levels, the improvement of the term the fair value, the categorization of consolidation groups, the return of the single-entry bookkeeping, making the final accounts more accurate and others. Partial aim of this paper is to analyze the impact of selected changes of financial accounting to the results of selected ratios of financial analysis because these indicators are based on the accounting data. Given the tendencies of the harmonization of the accounting standards at the international level was made the further analysis of the compatibility of selected changes to the international accounting standards. The analysis was made on the evaluation of the own inventory, the billing of the changes of the inventory and activation, the cancellation of extraordinary profit and loss account, the abolition of formation expenses in the balance and on the adjustment of the definition of reserves. In all cases of the researched changes was not detected the inconsistency between the czech legislative amendments and the international accounting standards.

  5. Spotřebitelské vnímání aspektu zdraví mezi kategoriemi tavených a čerstvých sýrů

    OpenAIRE

    Volbrechtová, Michaela

    2010-01-01

    This thesis is focused on consumers' perceptions. It concentrates specifically on the perception of fresh and processed cheeses in terms of health.. The thesis deals with choice of a healthy lifestyle and how it influences consumer behavior and choice of products, which consumers use to present selected lifestyle to their surroundings The paper summarizes the theoretical knowledge of consumer's behavior, what effects it has on his behavior and how the patterns in consumer's mind are created. ...

  6. Právní ochrana loga z hlediska autorského zákona a zákona o ochranných známkách

    OpenAIRE

    Krbová, Lucie

    2012-01-01

    In this thesis I explain the problematic situation presented by the legal protection of logos in the Czech Republic. I chose this topic because logos are a daily part of everyones' lives helping us make important every day decisions. Yet logo is not a legal term and sometimes it can be difficult to define what logo actually is. This doesn't mean to say that logos do not have legal protection. It always depends on the definition of logo. Usually a logo enjoys the same rights as the brand it re...

  7. Vliv médií na vnímání vlastního těla s důrazem na problematiku estetické chirurgie

    OpenAIRE

    Vančurová, Olga

    2010-01-01

    The bachelor thesis is related to the cosmetic surgery as a trend of the modern times. The thesis consists of theoretical and practical part. The theoretical part is divided into five chapters. The first, second and third chapter deal with the explanation of the terms plastic and cosmetic surgery, history of plastic and cosmetic surgery and the chosen procedures. The fourth chapter discusses the researches carried out in the field of cosmetic surgery, the medialized of cosmetic surgery and th...

  8. Veřejné zakázky z pohledu veřejného zadavatele a jejich finančně-právní aspekty

    OpenAIRE

    Jurošková, Martina

    2012-01-01

    Law on public procurement is very interesting and dynamic part of the Czech law. It is subjected to adjustment in particular Act No. 137/2006 Coll., On Public Procurement, as amended, but is also modified by legislation of the European law. Important are decisions of the European Court of Justice. This thesis entitled "Procurement from the perspective of public authority and their financial and legal aspects" deals with public procurement in particular from the perspective of public authority...

  9. Marketingová komunikace módních značek a jejich vliv na vnímání body image spotřebitele

    OpenAIRE

    Macková, Monika

    2012-01-01

    The Master's Thesis deals with the marketing communication of fashion industry with the focus on two particular global fast fashion brands. The main goal is to identify the specifics of marketing communication strategies of fashion industry, to analyze the approach difference of the two chosen fashion brands H&M and Zara and to define their influence on consumer's body image through qualitative and quantitative research. The thesis is divided into several parts. The first chapter follows up t...

  10. Symbiotic N2 fixation by legumes growing in pots. 2. Uptake of VN-labelled NO3 , C2H2 reduction and H2 evolution by Trifolium subterraneum L. , Medicago truncatula Gaertn. and Acacia dealbata Link

    Energy Technology Data Exchange (ETDEWEB)

    Hopmans, P.; Chalk, P.M.; Douglas, L.A.

    1983-01-01

    The objectives of this study were to estimate symbiotic nitrogen fixation by two common pasture legumes, Trifolium subterraneum L. and Medicago truncatula Gaertn., and an Australian native legume, Acacia dealbata Link, growing in pots using an indirect isotopic method. This method was also used to calibrate the C2H2 reduction assay of the intact plants. In addition, hydrogen evolution was measured in an attempt to explain the variations in C2H2:N2 ratios between the species. 25 refs.; 1 figure; 4 tabs.

  11. Mineralogie jílovitých sedimentů z výplní štramberského vápence (slezská jednotka, vnější Západní Karpaty)

    Czech Academy of Sciences Publication Activity Database

    Melka, Karel; Svobodová, Marcela

    -, - (2004), s. 115-117 ISSN 0514-8057 R&D Projects: GA ČR(CZ) GA205/01/1582 Keywords : mineralogy * pelitic sediments * X-ray diffraction Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2003/zpravy-o-vyzkumech-2003-str-115-117.pdf

  12. Pracovněprávní aspekty švarcsystému se zaměřením na pojem závislá práce

    OpenAIRE

    Sedláčková, Kateřina

    2015-01-01

    The term 'Švarc system' began to appear in The Czech Republic in the late 80s and early 90s of the 20th century with the gradual thawing of the restrictions which were put on private enterprise. Owing to this development, businessmen started widely entering into contracts with the persons, with whom a labour-law employment contract according to valid standards of labour code would have been signed and these people would have become their employees. The aim for such businessmen's behaviour was...

  13. Validizace bayesovského modelu kauzálního usuzování na základě vnímané koincidence událostí

    OpenAIRE

    Stehlík, Luděk

    2017-01-01

    1 SUMMARY In general this thesis deals with the question whether or to what extent human thinking is rational in terms of the optimality of the way people achieve their goals and in terms of the consistency between people's beliefs and the structure of the world. This question is quite difficult to answer unequivocally because the answer will always depend on the nature of the particular task and the exact way in which we define rationality. Among other things, that's the reason why we can me...

  14. Věcněprávní zajištění dluhů v syndikovaném úvěrovém financování

    OpenAIRE

    Živanský, Jakub

    2015-01-01

    This thesis analyses the legal regime of in rem security interests, in particular pledges and security assignments of rights, in the context of syndicated loan finance. The thesis draws mainly from the Act No. 89/2012 Coll., the Civil Code, and the Act No. 90/2012 Coll., on Commercial Companies and Cooperatives (the Corporations Act), and related legal acts, case law and jurisprudence. In the first chapter, the author describes the main elements of a facilities agreement and the typology of l...

  15. Právní aspekty daňového plánování v oblasti přímých daní

    OpenAIRE

    Kamínková, Petra

    2018-01-01

    Title in English: Legal aspects of tax planning in the direct tax area Abstract: In 2012, the European Commission published its Recommendation on aggressive tax planning (2012/772/EU). To counteract aggressive tax planning, Member States should adopt a general anti-abuse rule (GAAR), which is drafted in the Recommendation. At that time, no one knew that GAARs would become obligatory for member states from 2019. In 2013, Organization for Economic Co-operation and Development (OECD) started the...

  16. Vlastnictví bytu a společenství vlastníků jednotek podle stávající i nově navrhované právní úpravy

    OpenAIRE

    Džuganová, Jana

    2013-01-01

    The thesis is concerned with the institute of the flat ownership and legal regulation of apartment owner's association. With respect to the extent of aforesaid theme the thesis describes only selected problems, for example the concept and the content of the flat ownership, the concept of the residential unit, the co-ownership of common parts of the residential building, the character of apartment owner's association, its legal personality, membership in apartment owner's association and its o...

  17. Oprávněnost etických nároků zaměstnance v konceptu společenské odpovědnosti firem

    OpenAIRE

    Novotný, Oldřich

    2014-01-01

    This work seeks to uphold the ethical relevance of the concept of CSR (corporate social responsibility - CSR), particularly with regard to employees as an important participant of the economic process, which the scope of the concept of CSR falls in. So first we will need to defend the importance and role of ethics in the economy in general, and then illustrate the relevance of ethical business conduct toward employees in the company's strategy, which will be based on the principle of the cate...

  18. Výhody a nevýhody podnikání v jednotlivých právních formách obchodních společností

    OpenAIRE

    Svobodová, Jindra

    2008-01-01

    The goal of this work is to provide an overview of the main advantages and disadvantages of the enterpreneurship in the individual legal forms of the companies. The attention is paid to Partnership, Limited Partnership, Limited Liability Company and Joint-Stock Company. The main intention is reached by the comparison of the fundamental characteristics of the companies which are mentioned above. Each chapter describes certain comparable factor which reveals the most important differences of ea...

  19. Čeština brněnsko-jihlavské sbírky městských právních nálezů

    Czech Academy of Sciences Publication Activity Database

    Jamborová, Martina

    2015-01-01

    Roč. 52, 1/2 (2015), s. 27-33 ISSN 1212-5326. [Výzkum historické češtiny (na základě nových materiálových bází). Praha, 20.11.2014] R&D Projects: GA ČR GAP406/10/1140 Keywords : Old Czech * Manuscript * Municipal Law * vocabulary * terms * synonyms * polysemy Subject RIV: AI - Linguistics http://jazykovednesdruzeni.cz/JA15_12.pdf

  20. Zajištění a vymáhání pohledávek z obchodně-právních vztahů

    OpenAIRE

    Geržová, Pavla

    2012-01-01

    The thesis deals with the debt security and recovery from business relations. The main purpose was to explain the issue of debts, to compare classic judicial proceedings with arbitration and to analyse particular legal cases of the company XY in terms of security and recovery. The result is the evaluation of company's legal steps and efficiency of used security instruments, the summary of advantages and disadvantages of the arbitration and the overview of the most frequent practical problems ...

  1. Plaňavské vrstvy v oblasti Štramberka (spodní křída, vnější Západní Karpaty, Česká republika)

    Czech Academy of Sciences Publication Activity Database

    Skupien, P.; Vašíček, Zdeněk; Reháková, D.; Matýsek, D.

    2012-01-01

    Roč. 97, č. 1 (2012), s. 129-151 ISSN 1211-8796 Grant - others:GA MŠk(CZ) MSM6198910019; APVV(SK) APVV-0644-10; SAV(SK) VEGA2/0068/11; APVV(SK) LPP0120-09 Institutional research plan: CEZ:AV0Z30860518 Keywords : Kotouč Formation * litostratigraphy * Outer Western Carpathians * Lower Cretaceous * Silesian unit Subject RIV: DB - Geology ; Mineralogy

  2. Vybraná soudní a správní rozhodnutí v eticky problematických případech české žurnalistiky po roce 1989

    OpenAIRE

    Resler, Jan

    2012-01-01

    The thesis deals with ethical standards in journalism from the perspective of the law and with their practical application. The text explains the basic problems of normative influence on journalism and it is focused on case interpretation. The author has chosen relevant cases of failure of the Czech media after 1989 (e.g. Rejžek vs. Vondráčková, Horký vs. Reflex or the "Kuřim case") where the breach of the law occured and a judicial or administrative decision was given. The important facts of...

  3. „Šamanská jurta“: O pojetí zdraví a nemoci u jejích návštěvníků

    Czech Academy of Sciences Publication Activity Database

    Beranská, Veronika

    2014-01-01

    Roč. 3, č. 1 (2014), s. 4-13 ISSN 1805-2886 Institutional support: RVO:68378076 Keywords : folk concepts * illness * soul * death * shamanism * Czech Republic * medical anthropology Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Právní úprava statusu osob se zvláštními potřebami v azylových směrnicích EU

    OpenAIRE

    Neumannová, Jiřina

    2011-01-01

    Legal regulation of the status of persons with special needs in the EU Asylum directives (Abstract) By the very nature of their status, applicants for international protection and recognized refugees are among the most vulnerable persons. Within this group, there is also a subgroup of persons with special problems, risks and needs that make them even more vulnerable. This subgroup of persons with special needs is provided special protection within the Common European Asylum System (CEAS). The...

  5. Přírodou inspirované polymery citlivé na vnější podněty pro dopravu léčiv

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Filippov, Sergey K.; Felklová, Veronika; Štěpánek, Petr

    2015-01-01

    Roč. 109, č. 7 (2015), s. 482-487 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GA13-08336S; GA MŠk(CZ) LH14292 Grant - others:AV ČR(CZ) M200501201 Program:M Institutional support: RVO:61389013 Keywords : stimuli-responsive polymers * pH-responsivity * redox responsivity Subject RIV: CA - Inorganic Chemistry Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/common/article-vol_109-issue_7-page_482.html

  6. Analýza vývoje vnímání národní identity německou CDU v letech 1990–2009

    Directory of Open Access Journals (Sweden)

    Michal Vít

    2014-04-01

    Full Text Available The paper aims to explain the development of the perception of national identity of the Christian Democratic Party (CDU, the strongest German political party in the past few decades. The paper focuses on election manifestos for the 1990, 1994, 1998, 2002, 2005, and 2009 elections. For this purpose, each manifesto is examined according to up to five analytical categories – such as values, nation, Europe, threats, and society. These categories explore the party’s perception in a wider context instead of focusing only on direct  references to national identity. The analysed period was divided into three phases with an emphasis on the internal crisis between the years 1998 and 2002. The crisis influenced policy priorities; therefore the perceptions of elements belonging to national identity were changed in order i to gain victory in the general elections in 2002 and 2005, and ii to reflect properly the state of German society. Therefore, significant policy shifts were made. These policy changes show how the party successfully integrated societal demands and preferences over the past decade. Thank to this, the CDU incorporated both conservative and liberal elements. This is evident in the case of incorporating liberal elements such as homosexual partnerships while, at the same time, actively stressing the importance of defending national interests.

  7. Zhodnoceni efektu fyzioterapeutických postupů u pacientů po cévní mozkové příhodě s pusher a neglect syndromem

    OpenAIRE

    Fridrichová, Iva

    2013-01-01

    TITLE Efficacy of physiotherapeutic interventions in stroke patients with pusher and neglect syndrome. OBJECTIVES The aim of the thesis is to summarise current literature concerning two peculiar phenomena following stroke - pusher syndrome and neglect. Furthermore the work focuses on evaluation of efficacy of physiotherapeutic interventions. METHODS The thesis represents a critical review of a literature and it consists of three parts. The first one summarize issues concerning the pusher synd...

  8. Zirconium nitride hard coatings

    International Nuclear Information System (INIS)

    Roman, Daiane; Amorim, Cintia Lugnani Gomes de; Soares, Gabriel Vieira; Figueroa, Carlos Alejandro; Baumvol, Israel Jacob Rabin; Basso, Rodrigo Leonardo de Oliveira

    2010-01-01

    Zirconium nitride (ZrN) nanometric films were deposited onto different substrates, in order to study the surface crystalline microstructure and also to investigate the electrochemical behavior to obtain a better composition that minimizes corrosion reactions. The coatings were produced by physical vapor deposition (PVD). The influence of the nitrogen partial pressure, deposition time and temperature over the surface properties was studied. Rutherford backscattering spectrometry (RBS), X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD), scanning electron microscopy (SEM) and corrosion experiments were performed to characterize the ZrN hard coatings. The ZrN films properties and microstructure changes according to the deposition parameters. The corrosion resistance increases with temperature used in the films deposition. Corrosion tests show that ZrN coating deposited by PVD onto titanium substrate can improve the corrosion resistance. (author)

  9. Properties of minor actinide nitrides

    International Nuclear Information System (INIS)

    Takano, Masahide; Itoh, Akinori; Akabori, Mitsuo; Arai, Yasuo; Minato, Kazuo

    2004-01-01

    The present status of the research on properties of minor actinide nitrides for the development of an advanced nuclear fuel cycle based on nitride fuel and pyrochemical reprocessing is described. Some thermal stabilities of Am-based nitrides such as AmN and (Am, Zr)N were mainly investigated. Stabilization effect of ZrN was cleary confirmed for the vaporization and hydrolytic behaviors. New experimental equipments for measuring thermal properties of minor actinide nitrides were also introduced. (author)

  10. Ceramic plasma-sprayed coating of melting crucibles for casting metal fuel slugs

    International Nuclear Information System (INIS)

    Kim, Ki Hwan; Lee, Chong Tak; Lee, Chan Bock; Fielding, R.S.; Kennedy, J.R.

    2013-01-01

    Thermal cycling and melt reaction studies of ceramic coatings plasma-sprayed on Nb substrates were carried out to evaluate the performance of barrier coatings for metallic fuel casting applications. Thermal cycling tests of the ceramic plasma-sprayed coatings to 1450 °C showed that HfN, TiC, ZrC, and Y 2 O 3 coating had good cycling characteristics with few interconnected cracks even after 20 cycles. Interaction studies by 1550 °C melt dipping tests of the plasma-sprayed coatings also indicated that HfN and Y 2 O 3 do not form significant reaction layer between U–20 wt.% Zr melt and the coating layer. Plasma-sprayed Y 2 O 3 coating exhibited the most promising characteristics among HfN, TiC, ZrC, and Y 2 O 3 coating

  11. Numerical Investigation into the Effect of Natural Fracture Density on Hydraulic Fracture Network Propagation

    Directory of Open Access Journals (Sweden)

    Zhaohui Chong

    2017-07-01

    Full Text Available Hydraulic fracturing is an important method to enhance permeability in oil and gas exploitation projects and weaken hard roofs of coal seams to reduce dynamic disasters, for example, rock burst. It is necessary to fully understand the mechanism of the initiation, propagation, and coalescence of hydraulic fracture network (HFN caused by fluid flow in rock formations. In this study, a coupled hydro-mechanical model was built based on synthetic rock mass (SRM method to investigate the effects of natural fracture (NF density on HFN propagation. Firstly, the geometrical structures of NF obtained from borehole images at the field scale were applied to the model. Secondly, the micro-parameters of the proposed model were validated against the interaction between NF and hydraulic fracture (HF in physical experiments. Finally, a series of numerical simulations were performed to study the mechanism of HFN propagation. In addition, confining pressure ratio (CPR and injection rate were also taken into consideration. The results suggested that the increase of NF density drives the growth of stimulated reservoir volume (SRV, concentration area of injection pressure (CAIP, and the number of cracks caused by NF. The number of tensile cracks caused by rock matrix decrease gradually with the increase of NF density, and the number of shear cracks caused by rock matrix are almost immune to the change of NF density. The propagation orientation of HFN and the breakdown pressure in rock formations are mainly controlled by CPR. Different injection rates would result in a relatively big difference in the gradient of injection pressure, but this difference would be gradually narrowed with the increase of NF density. Natural fracture density is the key factor that influences the percentages of different crack types in HFN, regardless of the value of CPR and injection rate. The proposed model may help predict HFN propagation and optimize fracturing treatment designs in

  12. Application of calibrations to hyperspectral images of food grains: example for wheat falling number

    Directory of Open Access Journals (Sweden)

    Nicola Caporaso

    2017-04-01

    Full Text Available The presence of a few kernels with sprouting problems in a batch of wheat can result in enzymatic activity sufficient to compromise flour functionality and bread quality. This is commonly assessed using the Hagberg Falling Number (HFN method, which is a batch analysis. Hyperspectral imaging (HSI can provide analysis at the single grain level with potential for improved performance. The present paper deals with the development and application of calibrations obtained using an HSI system working in the near infrared (NIR region (~900–2500 nm and reference measurements of HFN. A partial least squares regression calibration has been built using 425 wheat samples with a HFN range of 62–318 s, including field and laboratory pre-germinated samples placed under wet conditions. Two different approaches were tested to apply calibrations: i application of the calibration to each pixel, followed by calculation of the average of the resulting values for each object (kernel; ii calculation of the average spectrum for each object, followed by application of the calibration to the mean spectrum. The calibration performance achieved for HFN (R2 = 0.6; RMSEC ~ 50 s; RMSEP ~ 63 s compares favourably with other studies using NIR spectroscopy. Linear spectral pre-treatments lead to similar results when applying the two methods, while non-linear treatments such as standard normal variate showed obvious differences between these approaches. A classification model based on linear discriminant analysis (LDA was also applied to segregate wheat kernels into low (250 s HFN groups. LDA correctly classified 86.4% of the samples, with a classification accuracy of 97.9% when using an HFN threshold of 150 s. These results are promising in terms of wheat quality assessment using a rapid and non-destructive technique which is able to analyse wheat properties on a single-kernel basis, and to classify samples as acceptable or unacceptable for flour production.

  13. Protein Nanoscaffolds for Delivering Toxic Inorganic Cargo to Cancer Cells

    Science.gov (United States)

    Cioloboc, Daniela

    Targeted delivery of anticancer drugs or prodrugs to tumors can minimize systemic toxicity and side effects. This study develops platforms for targeted delivery of two potentially less systemically toxic prodrugs by exploiting the native and/or bioinorganic properties of two ferritins, both of which function naturally as iron storage proteins. Two delivery approaches were investigated. The first system was designed to serve as either an enhancement or alternative to traditional photodynamic therapy by generating hydroxyl radical in addition to singlet oxygen as the toxic reactive oxygen species. This system used Escherichia coli bacterioferritin (Bfr) loaded with 2,500 irons and multiple zinc-porphyrin (ZnP) photosensitizers. Ferrous iron was released by photoreduction of ferric iron stored within the Bfr protein shell. Hydroxyl radicals were generated via the Fenton reaction between hydrogen peroxide and the released ferrous iron. The outer surface of the Bfr protein shell was coated with peptides that specifically bind to a receptor known to be overexpressed in many tumor cells and tumor vasculature. The iron-loaded peptide-ZnP-Bfr was endocytosed by melanoma cells, where it showed photo-triggered release of iron and light-dependent cytotoxicity. The second system, built around human heavy chain ferritin (HFn), was loaded with arsenate as a less toxic "prodrug" and designed to release arsenic in its toxic, therapeutically effective reduced form, arsenic trioxide (ATO). The Hfn shell was coated with peptides targeting receptors that are hyperexpressed in triple negative breast cancers. The arsenate/iron-loaded-Hfn was endocytosed by a breast cancer cell line and showed cytotoxicity equivalent to that of free ATO on an arsenic basis, whereas the "empty" or iron-only loaded Hfn showed no cytotoxicity. Although HFn has previously been used to deliver organic drugs and imaging agents, these new results demonstrate that both Bfr and HFn can be manipulated to function

  14. Video Head Impulse Test for Early Diagnosis of Vestibular Neuritis Among Acute Vertigo.

    Science.gov (United States)

    Guan, Qiongfeng; Zhang, Lisan; Hong, Wenke; Yang, Yi; Chen, Zhaoying; Lu, Peilin; Zhang, Dan; Hu, Xingyue

    2017-09-01

    This study assesses the value of the video head impulse test (vHIT) for early diagnosis of vestibular neuritis (VN) among acute vertigo. Thirty-three cases of vestibular neuritis (VN), 96 patients with other acute vertigo (AV), and 50 cases of normal controls used vHIT to quantitatively test a pair of horizontal vestibulo-ocular reflection (VOR) gains, two pairs of vertical VOR gains, and the corresponding three pairs of VOR gain asymmetry. The peculiarity of VOR gains in VN and the differences between VN and other AV, normal controls by vHIT, were collected and analyzed. There were statistically significant differences in the three pairs of VOR gains asymmetry between VN and other AV, and normal controls (Pvertigo by vHIT. This study shows vHIT has advantages in the diagnosis of VN in acute vertigo with good sensitivity and specificity and indicates a widespread clinical application.

  15. Densification and Mechanical Properties of ZrN-Nb Composites

    Directory of Open Access Journals (Sweden)

    ZHANG Yan

    2018-02-01

    Full Text Available Densification of zirconium nitride (ZrN ceramics was investigated by vacuum hot pressing at temperatures range from 1500℃to 2000℃with Nb as sintering additive. Densification was enhanced with Nb addition. ZrN with 5mol% Nb addition achieved a relative density of 98.5% at 1600℃.XRD and lattice parameter measurements indicated that there were structural differences between samples sintered in different temperatures. It was likely that due to the presence of point defects by changes in stoichiometry, the kinetics of mass transport enhanced. As a result, the relative density of the zirconium nitride (ZrN ceramics have been improved, thus the fully densed ZrN ceramics can be prepared in a relative low temperature. The density, the room-temperature mechanical properties of ZrN ceramics are increased after the addition of Nb. Zirconium nitride (ZrNdoped with Nb sintered at 1600℃ are measured and obtained elasticity modulus of 238 GPa, flexural strength of 463.3 MPa, fracture toughness of 7.0 MPa·m1/2 and hardness of 10.7 GPa.

  16. Formation of zirconium nitride via mechanochemical decomposition of zircon

    International Nuclear Information System (INIS)

    Puclin, T.; Kaczmarek, W.A.

    1996-01-01

    In this paper we report some results of the mechanochemical reduction of zircon, and for the first time subsequent reaction with nitrogen to form zirconium nitride (ZrN). This process can be described by the equation: 3ZrSiO 4 + 8Al + 1.5N 2 = 4Al 2 O 3 + 3ZrN + 3Si. Milling was carried out in three steps: 1) low speed grinding of Al+ZrSiO 4 in vacuum, 2) high speed milling to effect the reduction, and 3) continued milling after the addition of nitrogen. Powders produced were examined by X-ray diffraction. The first step showed no reaction occurred during low speed grinding. The second step proved to be a slow reaction without the 'ignition' often seen in other mechanochemical reduction works. The final step was also gradual, and did not always go to full nitridation over the duration of the experiment, giving a product of composition ZrN 0.6 to ZrN l.0 . This is quite acceptable as transition metal nitrides are often non-stoichiometric. These results show that the formation of a useful hard material such as ZrN can be formed from a raw mineral by two stage mechanochemical processing. Further investigations are currently being undertaken to eliminate Fe contamination and produce pure ceramic oxide-nitride composites

  17. Vitronectin--master controller or micromanager?

    Science.gov (United States)

    Leavesley, David I; Kashyap, Abhishek S; Croll, Tristan; Sivaramakrishnan, Manaswini; Shokoohmand, Ali; Hollier, Brett G; Upton, Zee

    2013-10-01

    The concept that the mammalian glycoprotein vitronectin acts as a biological 'glue' and key controller of mammalian tissue repair and remodelling activity is emerging from nearly 50 years of experimental in vitro and in vivo data. Unexpectedly, the vitronectin-knockout (VN-KO) mouse was found to be viable and to have largely normal phenotype. However, diligent observation revealed that the VN-KO animal exhibits delayed coagulation and poor wound healing. This is interpreted to indicate that VN occupies a role in the earliest events of thrombogenesis and tissue repair. VN is the foundation upon which the thrombus grows in an organised structure. In addition to sealing the wound, the thrombus also serves to protect the underlying tissue from oxidation, is a reservoir of mitogens and tissue repair mediators, and provides a provisional scaffold for the repairing tissue. In the absence of VN (e.g., VN-KO animal), this cascade is disrupted before it begins. A wide variety of biologically active species associate with VN. Although initial studies were focused on mitogens, other classes of bioactives (e.g., glycosaminoglycans and metalloproteinases) are now also known to specifically interact with VN. Although some interactions are transient, others are long-lived and often result in multi-protein complexes. Multi-protein complexes provide several advantages: prolonging molecular interactions, sustaining local concentrations, facilitating co-stimulation of cell surface receptors and thereby enhancing cellular/biological responses. We contend that these, or equivalent, multi-protein complexes facilitate VN polyfunctionality in vivo. It is also likely that many of the species demonstrated to associate with VN in vitro, also associate with VN in vivo in similar multi-protein complexes. Thus, the predominant biological function of VN is that of a master controller of the extracellular environment; informing, and possibly instructing cells 'where' to behave, 'when' to behave

  18. Assembly of fibronectin into the extracellular matrix of early and late passage human skin fibroblasts

    International Nuclear Information System (INIS)

    Mann, D.M.

    1987-01-01

    The specific binding of soluble 125 I-human plasma fibronectin ( 125 I-HFN-P) to confluent cultures of early and late passage human skin fibroblasts was investigated. Previous studies HFN-P bound to fibroblast cell layers indicated that HNF-P was present in the cultures in two separate pools, distinguishable on the basis of their solubility in 1% deoxycholate. Examination of the kinetics of 125 I-HFN-P binding to Pool I of early and late passage cultures revealed that both cultures required 2-4 h to approach steady-state conditions. Other kinetic studies showed that the rates of low of 125 I-HFN-P from either Pool I or Pool II were similar for both cultures. Further, Scatchard analysis revealed a single class of Pool I binding sites with apparent dissociation constants (K/sub d/) of 5.3 x 10 -8 M (early passage) and 4.2 x 10 -8 M (late passage). These results indicate that early and late passage cultures of human fibroblasts exhibit differences in the number of cell surface biding sites for soluble fibronectin, and in the extent to which they incorporate soluble fibronectin into the extracellular matrix. Parameters which affect the fibronectin matrix assembly system of human skin fibroblasts were also examined. In addition, several monoclonal anti-fibronectin antibodies were characterized and developed as experimental probes for fibronectin structure and function

  19. Algal-fungal interactions in the marine ecosystem: Symbiosis to parasitism

    Digital Repository Service at National Institute of Oceanography (India)

    Raghukumar, C.

    , 2 980). Pi5 3 --The terminal portim of the green Fig. 4 - Chehwpha mdio &ET 7 days alga mrph mdb 6how-h~ hf&n iacuWon in stede sea water L totally by Podhnm EageaWkie.s 4-1. The infa ampIewz3~dectedfromAqjuna . berrcbinGoa. 372 Recent...

  20. H-Ferritin Enriches the Curcumin Uptake and Improves the Therapeutic Efficacy in Triple Negative Breast Cancer Cells.

    Science.gov (United States)

    Pandolfi, Laura; Bellini, Michela; Vanna, Renzo; Morasso, Carlo; Zago, Andrea; Carcano, Sofia; Avvakumova, Svetlana; Bertolini, Jessica Armida; Rizzuto, Maria Antonietta; Colombo, Miriam; Prosperi, Davide

    2017-10-09

    Triple negative breast cancer (TNBC) is a highly aggressive, invasive, and metastatic tumor. Although it is reported to be sensitive to cytotoxic chemotherapeutics, frequent relapse and chemoresistance often result in treatment failure. In this study, we developed a biomimetic nanodrug consisting of a self-assembling variant (HFn) of human apoferritin loaded with curcumin. HFn nanocage improved the solubility, chemical stability, and bioavailability of curcumin, allowing us to reliably carry out several experiments in the attempt to establish the potential of this molecule as a therapeutic agent and elucidate the mechanism of action in TNBC. HFn biopolymer was designed to bind selectively to the TfR1 receptor overexpressed in TNBC cells. HFn-curcumin (CFn) proved to be more effective in viability assays compared to the drug alone using MDA-MB-468 and MDA-MB-231 cell lines, representative of basal and claudin-low TNBC subtypes, respectively. Cellular uptake of CFn was demonstrated by flow cytometry and label-free confocal Raman imaging. CFn could act as a chemosensitizer enhancing the cytotoxic effect of doxorubicin by interfering with the activity of multidrug resistance transporters. In addition, CFn exhibited different cell cycle effects on these two TNBC cell lines, blocking MDA-MB-231 in G0/G1 phase, whereas MDA-MB-468 accumulated in G2/M phase. CFn was able to inhibit the Akt phosphorylation, suggesting that the effect on the proliferation and cell cycle involved the alteration of PI3K/Akt pathway.

  1. Dicty_cDB: SFD228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available invnfgsimrkvi*lskvicvt*rmkvcqlkvplekvn* slllilnihrilqmmilknslksyqklppllfqnlivnrlv...ny*tqslvvnsl*thwinvnfgsimrkvi*lskvicvt*rmkvcqlkvplekvn* slllilnihrilqmmilknslksyqklppllfqnlivnrlvsqr*TLIPTNK...rmkvcqlkvplek vn*slllilnihrilqmmilknslksyqklppllfqnlivnrlvsqr*tliptnkvlmvv lvvlinnmvvlmviknnnnkvlillilvlnlvv

  2. Vitronectin Binds to a Specific Stretch within the Head Region of Yersinia Adhesin A and Thereby Modulates Yersinia enterocolitica Host Interaction.

    Science.gov (United States)

    Mühlenkamp, Melanie C; Hallström, Teresia; Autenrieth, Ingo B; Bohn, Erwin; Linke, Dirk; Rinker, Janina; Riesbeck, Kristian; Singh, Birendra; Leo, Jack C; Hammerschmidt, Sven; Zipfel, Peter F; Schütz, Monika S

    2017-01-01

    Complement resistance is an important virulence trait of Yersinia enterocolitica (Ye). The predominant virulence factor expressed by Ye is Yersinia adhesin A (YadA), which enables bacterial attachment to host cells and extracellular matrix and additionally allows the acquisition of soluble serum factors. The serum glycoprotein vitronectin (Vn) acts as an inhibitory regulator of the terminal complement complex by inhibiting the lytic pore formation. Here, we show YadA-mediated direct interaction of Ye with Vn and investigated the role of this Vn binding during mouse infection in vivo. Using different Yersinia strains, we identified a short stretch in the YadA head domain of Ye O:9 E40, similar to the 'uptake region' of Y. pseudotuberculosis YPIII YadA, as crucial for efficient Vn binding. Using recombinant fragments of Vn, we found the C-terminal part of Vn, including heparin-binding domain 3, to be responsible for binding to YadA. Moreover, we found that Vn bound to the bacterial surface is still functionally active and thus inhibits C5b-9 formation. In a mouse infection model, we demonstrate that Vn reduces complement-mediated killing of Ye O:9 E40 and, thus, improved bacterial survival. Taken together, these findings show that YadA-mediated Vn binding influences Ye pathogenesis. © 2016 S. Karger AG, Basel.

  3. Organizational behavior of human umbilical vein endothelial cells

    Science.gov (United States)

    1982-01-01

    Culture conditions that favor rapid multiplication of human umbilical vein endothelial cells (HUV-EC) also support long-term serial propagation of the cells. This is routinely achieved when HUV-EC are grown in Medium 199 (M-199) supplemented with fetal bovine serum (FBS) and endothelial cell growth factor (ECGF), on a human fibronectin (HFN) matrix. The HUV-EC can shift from a proliferative to an organized state when the in vitro conditions are changed from those favoring low density proliferation to those supporting high density survival. When ECGF and HFN are omitted, cultures fail to achieve confluence beyond the first or second passage: the preconfluent cultures organize into tubular structures after 4-6 wk. Some tubes become grossly visible and float in the culture medium, remaining tethered to the plastic dish at either end of the tube. On an ultrastructural level, the tubes consist of cells, held together by junctional complexes, arranged so as to form a lumen. The smallest lumens are formed by one cell folding over to form a junction with itself. The cells contain Weibel-Palade bodies and factor VIII-related antigen. The lumens contain granular, fibrillar and amorphous debris. Predigesting the HFN matrix with trypsin (10 min, 37 degrees C) or plasmin significantly accelerates tube formation. Thrombin and plasminogen activator had no apparent effect. Disruption of the largest tubes with trypsin/EDTA permits the cells to revert to a proliferative state if plated on HFN, in M-199, FBS, and ECGF. These observations indicate that culture conditions that do not favor proliferation permit attainment of a state of nonterminal differentiation (organization) by the endothelial cell. Furthermore, proteolytic modification of the HFN matrix may play an important role in endothelial organization. PMID:6813338

  4. Study of the oxidation resistance of ZrxNand ZrxSi1-xN thin films deposited by reactive magnetron sputtering; Estudo da resistencia a oxidacao de filmes finos de ZrxN e ZrxSi1-xN depositados por magnetron sputtering reativo

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, D.R.; Freitas, F.G.R.; Felix, L.C.; Carvalho, R.G.; Fontes Junior, A.S.; Tentardini, E.K., E-mail: daniel.angel0275@gmail.com [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Ciencia e Engenharia de Materiais; Silva Junior, H. da [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil)

    2016-07-01

    The objective of this work is to evaluate the oxidation resistance on pure zirconium nitride thin films and with silicon addition (ZrN and ZrSiN respectively). The thin films deposition were performed using reactive magnetron sputtering. The coatings were characterized by Rutherford Backscattering Spectroscopy (RBS), grazing angle X ray diffraction (GAXRD), scanning electronic microscopy (SEM-FEG) and oxidation tests starting from 500°C to 700°C. This study evaluated thin films with silicon content up to 14,9 at.%. GAXRD results showed only ZrN characteristics peaks, which allow the inference that Si3N4 has an amorphous structure. Oxidation tests demonstrate that the film with highest silicon content shows an increase of 200°C in oxidation temperature when compared with ZrN pure thin film. (author)

  5. Calculation of electron spectra of stoichiometric and nitrogen-deficient zirconium nitrides

    International Nuclear Information System (INIS)

    Ivashchenko, V.I.; Lisenko, A.A.; Zhurakovskij, E.A.; Bekenev, V.L.

    1984-01-01

    English structure using the method of associated plane waves - linear combinations of atom orbitals - coherent potential (APW-LCAO-CP) are given. The calculation results for ZrN electron spectrum indicate availability of a Zr-N binding and a Zr-N antibonding bands. The Fermi level lies in the antibonding metal band. While deffecting from the stoichiometric content the Fermi level simultaneously with filling the metal band shifts towards the Variation of the main kinetic parameters with increasing defectiveness in nitrogen is explained by increasing the number of antibonding collectivized electrons. Application of the combined method of APW-LCAO-CP gives a rather realistic picture of interatomic interaction in ZrNsub(x)

  6. Studies of the process of an unsteady formation of hard nitride coatings in an arc plasma flow

    International Nuclear Information System (INIS)

    Zake, M.

    1996-01-01

    The kinetic studies of an unsteady formation of hard ZrN and TiN coatings on the surface of metallic (Zr, Ti) samples in an Ar-N plasma flow are carried out. The obtained result is that at the initial stage of an unsteady heating of titanium samples nitrogen atoms penetrate into metal lattice and form interstitial compounds of hard nitrogen solutions in α-phase of Ti. This process is followed by a growth of thin surface layers of titanium nitrides with subsequent changes of surface radiance of exposed samples. Unsteady formation of ZrN is a similar two-stage process which includes the ZrN film growth and formation of a α-hard solution with subsequent changes of total normal emissivity of the surface. (author). 1 ref., 1 fig

  7. The morphology and structure of PVD ZrN-Cu thin films

    International Nuclear Information System (INIS)

    Audronis, M; Jimenez, O; Leyland, A; Matthews, A

    2009-01-01

    ZrN-Cu thin films containing variable amounts of copper, namely 8, 33 and 58 at%, were produced by reactive pulsed unbalanced magnetron sputtering. Coatings were found to possess hardness values of 22.5 GPa, 9.5 GPa and 3.7 GPa, respectively. The morphology of coatings was investigated by field emission gun scanning electron microscopy and the structure (microstructure and nanostructure) was investigated by conventional (bright-field and dark-field imaging) and high-resolution transmission electron microscopy. Complementary x-ray diffraction experiments were also performed. ZrN coatings containing 8 at% of copper were found to possess a nano-columnar structure composed of ZrN columnar grains, the diameter of which was approximately 15-35 nm. The majority of the copper content was apparently dissolved within the ZrN grains, rather than existing as a separate phase. Coatings of the two other compositions were found to be composed of a mixture of mostly equiaxed ZrN and Cu nano-crystalline grains, the diameters of which were in the approximate range 5-25 nm. None of the coatings investigated in this study were found to possess the so-called 'nanocomposite' structure, which is often envisaged as crystalline nano-grains surrounded by a thin amorphous intergranular phase. Instead, coatings were found to be either single-phase ZrN (with Cu in substitutional solid solution for Zr) or a mixture of ZrN and Cu nano-grains.

  8. Strength problems and ordering of nonstoichiometric monocarbides and mononitrides of subgroup 4a i 5a transition metals

    International Nuclear Information System (INIS)

    Manukhin, A.V.; Lopatin, P.B.

    1995-01-01

    Consideration is given to graphical concentration dependences of flexural strength limit of TiC x and VC x monocarbides, ZrN x mononitride and to the relationship between these dependences and phenomena of nonmetallic vacancy ordering in mentioned compounds. The assumption about existence of the second ordered structure in TiC x titanium monocarbide and ordered structure in ZrN x zirconium mononitride (0.78...0.8 < x < 0.9...0.95) was supported. 15 refs.; 4 figs

  9. Facile synthesis and enhanced visible light photocatalytic activity of N and Zr co-doped TiO2 nanostructures from nanotubular titanic acid precursors

    Science.gov (United States)

    Zhang, Min; Yu, Xinluan; Lu, Dandan; Yang, Jianjun

    2013-12-01

    Zr/N co-doped TiO2 nanostructures were successfully synthesized using nanotubular titanic acid (NTA) as precursors by a facile wet chemical route and subsequent calcination. These Zr/N-doped TiO2 nanostructures made by NTA precursors show significantly enhanced visible light absorption and much higher photocatalytic performance than the Zr/N-doped P25 TiO2 nanoparticles. Impacts of Zr/N co-doping on the morphologies, optical properties, and photocatalytic activities of the NTA precursor-based TiO2 were thoroughly investigated. The origin of the enhanced visible light photocatalytic activity is discussed in detail.

  10. Formation of inorganic nanofibers by heat-treatment of poly(vinyl alcohol-zirconium compound hybrid nanofibers

    Directory of Open Access Journals (Sweden)

    Nakane K.

    2013-01-01

    Full Text Available Poly(vinyl alcohol-zirconium compound hybrid nanofibers (precursors were formed by electrospinning employing water as a solvent for the spinning solution. The precursors were converted into oxide (ZrO2, carbide (ZrC or nitride (ZrN nanofibers by heating them in air, Ar or N2 atmospheres. Monoclinic ZrO2 nanofibers with high-specific surface area were obtained by heat-treatment of the precursors in air. ZrC and ZrN nanofibers could be obtained below theoretical temperatures calculated from thermodynamics data.

  11. The Interfacial Thermal Conductance of Epitaxial Metal-Semiconductor Interfaces

    Science.gov (United States)

    Ye, Ning

    -silicon), interfaces with varying levels of disorder (epitaxial and non-epitaxial). The ITC values of silicides-silicon interfaces observed in this study are higher than those of other metallic interfaces to Si found in literature. Most surprisingly, it is experimentally found that ITC values are independent of interfacial quality and substrate orientation. Computationally, it is found that the non-equilibrium atomistic Green's Function technique (NEGF), which is specically designed to simulate coherent elastic phonon transport across interfaces, significantly underpredicts ITC values for CoSi2-Si interfaces, suggesting that energy transport does not occur purely by coherent transmission of phonons, even for epitaxial interfaces. In contrast, the Diffuse Mismatch Model closely mimics the experimentally observed ITC values for CoSi 2-Si, NiSi-Si and TiSi2-Si interfaces, and only slightly overestimating the same for PtSi-Si interfaces. Furthermore, the results also show that ITC is independent of degenerate doping up to doping levels of ≈1 x 1019 cm-3, indicating there is no significant direct electronic transport or transport effects which depend on long-range metal-semiconductor band alignment. Then, I study the effect of phonon band structure on ITC through measurements of epitaxial NiAl1-xGax-GaAs interfaces for varying levels of alloy composition, which independently tunes the mass of the metal's heavy atom without much affect on the lattice structure or interatomic force constants. The ITC values are found to linearly increase with increasing Ga content, consistent with the disappearance of a phonon band gap in NiAl 1-xGax films with increasing Ga content, which enhances the phonon transmission coefficients due to a better density of states overlap between the two (NiAl1-xGax, GaAs) materials. Finally, I study a unique subset of epitaxial rocksalt interfaces between the Group IV metal nitrides (TiN, ZrN, and HfN) to MgO substrates as well as ScN layers. Prior to the currrent

  12. Early life DNA vaccination with the H gene of Canine distemper virus induces robust protection against distemper

    DEFF Research Database (Denmark)

    Jensen, Trine Hammer; Nielsen, Line; Aasted, Bent

    2009-01-01

    Young mink kits (n = 8)were vaccinated withDNA plasmids encoding the viral haemagglutinin protein (H) of a vaccine strain of Canine distemper virus (CDV). Virus neutralising (VN) antibodieswere induced after 2 immunisations and after the third immunisation all kits had high VN antibody titres...

  13. Corpora and Collocations in Chinese-English Dictionaries for Chinese Users

    Science.gov (United States)

    Xia, Lixin

    2015-01-01

    The paper identifies the major problems of the Chinese-English dictionary in representing collocational information after an extensive survey of nine dictionaries popular among Chinese users. It is found that the Chinese-English dictionary only provides the collocation types of "v+n" and "v+n," but completely ignores those of…

  14. Correlation of Serum Levels of Vitronectin, Malondialdehyde and Hs-CRP With Disease Severity in Coronary Artery Disease

    Directory of Open Access Journals (Sweden)

    Alireza Yaghoubi

    2015-09-01

    Conclusion: The association and correlation between VN, MDA and hs-CRP indicate their involvement in the atherosclerosis process that may lead to progression of CAD. Also, these findings suggested that serum levels of VN, MDA and hs-CRP can help as diagnostic and monitoring markers in CAD patients and as markers of disease severity.

  15. Contribution of intracranial vertebral artery asymmetry to vestibular neuropathy.

    Science.gov (United States)

    Chuang, Y M; Chern, C M; Liao, W H; Hsu, L C; Lien, C F; Lirng, J F; Shiao, A S; Ko, J S C

    2011-07-01

    To test the hypothesis that vertebral artery hypoplasia (VAH) may affect the lateralisation of vestibular neuropathy (VN), probably through haemodynamic effect on the vestibular labyrinth. 69 patients with unilateral VN were examined with a magnetic resonance angiographic (MRA) and caloric test. 50 healthy subjects served as controls. The diagnosis of intracranial VAH was based on MRA if 40%. The authors then correlated the canal paretic side with the VAH side. MRA study revealed 29 VAH (right/left: 23/6) in VN subjects and six VAH in controls (right/left: 5/1). The RR of VAH in VN subjects compared with controls was elevated (RR=2.2; 95% CI 1.8 to 2.8). There was a high accordance rate between the side of VAH and VN. Among 29 patients with unilateral VAH, 65.5% (N=19) had an ipsilateral VN, in which left VAH showed a higher accordance rate (83.3%) than the right side (60.9%). VN subjects with vascular risk factors also had a higher VAH accordance rate (81%) than those without (25%). VAH may serve as a regional haemodynamic negative contributor and impede blood supply to the ipsilateral vestibular labyrinth, contributing to the development of VN, which could be enhanced by atherosclerotic risk factors and the left-sided location.

  16. Dicty_cDB: VHM584 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ti*nqylcsrysft*er e*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly* *iiqllfhik*lsnctyvim*sftw*he*...GRCPTCKNFDILFNGI EYQCKGWISGFTKCDWKGDSIER--- ---LEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft*er e*k...*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly* *iiqllfhik*lsnctyvim*sftw*he*iet*ylygrgttsip*yksfr

  17. Dicty_cDB: AHA817 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available igkviqlk--- ---ESLEGNMIENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*fridcla...CPTCKNFDILFNGI EYQCKGWISGFTKCDWKGDSIER--- ---ESLEGNMIENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k...*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*l y**iiqllfhik*lsnctyvim*sftw*he*iet*ylygrgttsip*yksfr

  18. Dicty_cDB: SHF645 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -KKQTESLEGNMIENQYITLKTKLTXT**r*csl*nlgrlccq*sr*ti*nqylcsry sft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncstics... EYQCKGWISGFTKCDWKGDSIERWAVQFPDDLS--- ---KKQTESLEGNMIENQYITLKTKLTXT**r*csl*nlgrlccq*sr*ti*nqylcsry sft*ere*k...*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*ryl fc*ly**iiqllfhik*lsnctyvim*sftw*he*iet*yxygrgttsip*yksfr

  19. Dicty_cDB: CHI483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lccq*sr*ti*nqylcsry sft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*ryl fc*ly**iiqllfhik*lsnctyvim*...ENQYITLKTKLTPT**r*csl*nlgrlccq*sr*ti*nqylcsry sft*ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*ryl f

  20. Dicty_cDB: SHF852 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available re*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*ry lfc*ly**iiqllfhik*lsnctyvim*sftw*he*iet*ylygrgttsip*y...sfkk*ipfnf*if--- ---LRSKLNPLEGNMIENQYITLKNQTHST**r*csl*nxgrlccq*sr*ti*nqylcsr ysft*ere*k*tfhslgkr*e*itlmaw**vn*frid

  1. Dicty_cDB: SHB222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PT**r*csl*nlgrl ccq*sr*ti*nqylcsrysft*ere*k*tfhslgkr*e*itlma***vn*fridclagik ncsticsknwlqiw*rylfc*ly**iiqllf...DIAANLKKQTESLEGNMIENQYITLKTKLTPT**r*csl*nlgrl ccq*sr*ti*nqylcsrysft*ere*k*tfhslgkr*e*itlma***vn*fridclagik n

  2. Author Affiliations

    Indian Academy of Sciences (India)

    Admin

    Figure 8. Effect of sweep on an airfoil.The free- stream velocity has a com- ponent VN normal to the leading edge and VS paral- lel to it. The component VS does not have a significant effect on the flow. The forces on the airfoil are pri- marily determined by VN. conventional subsonic airplane con¯guration. T he ¯g-.

  3. Mobility Monitor

    DEFF Research Database (Denmark)

    Schæbel, Anne-Lise; Dybbro, Karina Løvendahl; Andersen, Lisbeth Støvring

    2015-01-01

    Undersøgelse af digital monitorering af plejehjemsbeboeres vendinger under søvn på Fremtidens Plejehjem, Nørresundby......Undersøgelse af digital monitorering af plejehjemsbeboeres vendinger under søvn på Fremtidens Plejehjem, Nørresundby...

  4. Genome-wide assessment for genetic variants associated with ventricular dysfunction after primary coronary artery bypass graft surgery.

    Directory of Open Access Journals (Sweden)

    Amanda A Fox

    Full Text Available BACKGROUND: Postoperative ventricular dysfunction (VnD occurs in 9-20% of coronary artery bypass graft (CABG surgical patients and is associated with increased postoperative morbidity and mortality. Understanding genetic causes of postoperative VnD should enhance patient risk stratification and improve treatment and prevention strategies. We aimed to determine if genetic variants associate with occurrence of in-hospital VnD after CABG surgery. METHODS: A genome-wide association study identified single nucleotide polymorphisms (SNPs associated with postoperative VnD in male subjects of European ancestry undergoing isolated primary CABG surgery with cardiopulmonary bypass. VnD was defined as the need for ≥2 inotropes or mechanical ventricular support after CABG surgery. Validated SNPs were assessed further in two replication CABG cohorts and meta-analysis was performed. RESULTS: Over 100 SNPs were associated with VnD (P2.1 of developing in-hospital VnD after CABG surgery. However, three genetic loci identified by meta-analysis were more modestly associated with development of postoperative VnD. Studies of larger cohorts to assess these loci as well as to define other genetic mechanisms and related biology that link genetic variants to postoperative ventricular dysfunction are warranted.

  5. Molecular dynamics simulation of deformation twin in rocksalt vanadium nitride

    International Nuclear Information System (INIS)

    Fu, Tao; Peng, Xianghe; Zhao, Yinbo; Li, Tengfei; Li, Qibin; Wang, Zhongchang

    2016-01-01

    We perform molecular dynamics simulation of nano-indentation with a cylindrical indenter to investigate the formation mechanism of deformation twin in vanadium nitride (VN) with a rocksalt structure. We find that the deformation twins occur during the loading stage, and subsequently conduct a systematic analysis of nucleation, propagation and thickening of a deformation twin. We find that the nucleation of a partial dislocation and its propagation to form a stacking fault are premise of deformation twin formation. The sequential nucleation and propagation of partial dislocation on adjacent parallel {111} planes are found to cause the thickening of the deformation twin. Moreover, the deformation twins can exist in VN at room temperature. - Highlights: • MD simulations of indentation are performed to study the deformation twin in VN. • The deformation twins can occur in VN during the loading stage. • The nucleation, propagation and thickening of a deformation twin are analyzed. • The deformation twins can exist in VN at room temperature.

  6. Vanadium nitride as a novel thin film anode material for rechargeable lithium batteries

    International Nuclear Information System (INIS)

    Sun Qian; Fu Zhengwen

    2008-01-01

    Vanadium mononitride (VN) thin films have been successfully fabricated by magnetron sputtering. Its electrochemical behaviour with lithium was examined by galvanostatic cell cycling and cyclic voltammetry. The capacity of VN was found to be stable above 800 mAh g -1 after 50 cycles. By using ex situ X-ray diffraction, high-resolution transmission electron microscopy and selected area electron diffraction as well as in situ spectroelectrochemical measurements, the electrochemical reaction mechanism of VN with lithium was investigated. The reversible conversion reaction of VN into metal V and Li 3 N was revealed. The high reversible capacity and good stable cycle of VN thin film electrode made it a new promising lithium-ion storage material for future rechargeable lithium batteries

  7. Adheze cévních a kostních buněk na umělé materiály vyvíjené pro tkáňové inženýrství

    Czech Academy of Sciences Publication Activity Database

    Bačáková, Lucie; Nosková, Lenka; Filová, Elena; Švorčík, V.; Koutná, E.; Starý, V.; Horník, J.; Glogar, Petr

    2006-01-01

    Roč. 56, č. 2 (2006), s. 74-79 ISSN 0009-0700 R&D Projects: GA AV ČR(CZ) IAA5011301; GA MŠk(CZ) OC 527.130 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z30460519 Keywords : biomaterials * tissue engineering * physicochemical surface properties Subject RIV: EI - Biotechnology ; Bionics

  8. Původ pojmu subjektivního práva v antickém právním myšlení v kontextu uvažování o lidských právech

    Czech Academy of Sciences Publication Activity Database

    Šejvl, Michal

    2014-01-01

    Roč. 153, č. 6 (2014), s. 448-463 ISSN 0231-6625 R&D Projects: GA ČR GA13-30299S Institutional support: RVO:68378122 Keywords : concept of rights * human rights * classical antiquity Subject RIV: AG - Legal Sciences

  9. Švejk na nás něco ví : S Jiřím Trávníčkem o zániku románu, českých čtenářích a o knihách, na něž nesahá

    Czech Academy of Sciences Publication Activity Database

    Trávníček, Jiří

    2007-01-01

    Roč. 18, č. 47 (2007), s. 42-45 ISSN 0862-6545 Institutional research plan: CEZ:AV0Z90560517 Keywords : Reading Surveys (2007) * Contemporary Novel Subject RIV: AJ - Letters, Mass-media, Audiovision

  10. Výchova k hlubšímu vnímání národní identity prostřednictvím výtvarné hry (mladší školní věk)

    OpenAIRE

    MACHÁLKOVÁ, Martina

    2012-01-01

    The central theme of this thesis is national identity in art education. First of all deals with a definition of terms education, perception, school age, and of course the definitions of national identity and its related terms of identity, habits, traditions, culture and society. The thesis describe the knowledge about our nation through art education and provides ilustrative examples for working with children during the school day. This bachelor thesis server ether to highlight the issue and ...

  11. Dopady změny právní úpravy zákona o Vojenské policii při řešení mimořádných událostí v Jihočeském kraji

    OpenAIRE

    HRSTKOVÁ, Jarmila

    2017-01-01

    At the present time, a large number of entities participate in handling emergency situations both basic and other constituent parts of the Integrated Rescue System, and both legal and natural persons. The Army of the Czech Republic, an important entity falling under the other constituent parts of the Integrated Rescue System, provides much workforce and many resources for handling emergency situations. The Army of the Czech Republic includes a special police corps, the Military Police. The ta...

  12. Uplatnění PETL při řešení některých složitých kauz v oblasti příčinné souvislosti v medicínskoprávních sporech

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam; Doležal, Tomáš

    2013-01-01

    Roč. 19, 7-8 (2013), s. 242-248 ISSN 1211-4405 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : medical law * causality * medico-legal disputes Subject RIV: AG - Legal Sciences

  13. Úvahy o původu konkávních tvarů na některých lokalitách karbonských arkóz ve středních a v západních Čechách

    Czech Academy of Sciences Publication Activity Database

    Suchý, V.; Filip, Jiří

    2016-01-01

    Roč. 49, č. 1 (2016), s. 61-67 ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : hypogene speleogenesis * tafoni * arkose sandstone * brine * apatite fission track analysis * Carboniferous * Bohemian Massif, Czech Republic Subject RIV: DB - Geology ; Mineralogy

  14. Využití nové progresívní metody tlakové extrakce (ASE) při stanovení hořkých kyselin ve chmelu a chmelových granulích

    Czech Academy of Sciences Publication Activity Database

    Čulík, J.; Kellner, V.; Jurková, M.; Čejka, P.; Horák, T.; Karásek, Pavel; Varaďová-Ostrá, Elena

    2005-01-01

    Roč. 51, č. 9 (2005), s. 292 ISSN 0023-5830. [Pivovarsko-sladařské dny /21./. 06.10.2005-07.10.2005, Ústí nad Labem] R&D Projects: GA ČR GA203/05/2106 Institutional research plan: CEZ:AV0Z40310501 Keywords : accelerated solvent extraction * hop * bitter acids Subject RIV: CB - Analytical Chemistry, Separation

  15. Sanace rodiny - spolupráce odboru sociálně-právní ochrany dětí městského úřadu Náchod s nestátní neziskovou organizací Salinger o. s.

    OpenAIRE

    Kundrátová, Aneta

    2016-01-01

    Bachelor thesis deals with the support of the family and the collaboration of social workers from the Department of Social and Legal Protection of Children of the Municipal Authority in Náchod with the workers of nongovernmental organization Salinger. The first part is aimed to explain the basic concepts concerning the issue of support of the family (family, family at risk, the attitude of the state towards families, child at risk, social and legal protection of children, legislation relating...

  16. Sporné případy použití ozbrojené síly a poslední vývoj v oblasti mezinárodněprávní úpravy použití ozbrojené síly

    Czech Academy of Sciences Publication Activity Database

    Popenková, Monika

    2009-01-01

    Roč. 148, č. 3 (2009), s. 309-330 ISSN 0231-6625 R&D Projects: GA AV ČR KJB700680601 Institutional research plan: CEZ:AV0Z70680506 Keywords : public international law * Use of Armed Force Subject RIV: AG - Legal Sciences

  17. Zdanění příjmů obchodních společností a jejich společníků (srovnání právní úpravy v ČR a ve vybraných zemích EU)

    OpenAIRE

    Bobek, Pavel

    2015-01-01

    The topic of this thesis is comparison of income taxation of companies and their shareholders or partners in Czech republic and other EU countries. For purposes of this thesis Czech legislation is compared to legislation of Slovak republic and Netherlands. The aim of the thesis is to give a complex overview and comparison of different tax legislations. The reason for choosing this topic is that knowledge of tax burden in particular country is important for making a decision where to start a c...

  18. K otázkám některých základních lidských práv a svobod v souvislosti s právní ochranou biometrických údajů

    Czech Academy of Sciences Publication Activity Database

    Güttler, Vojen; Matejka, Ján

    2016-01-01

    Roč. 155, č. 12 (2016), s. 1033-1056 ISSN 0231-6625 R&D Projects: GA ČR(CZ) GA16-26910S Institutional support: RVO:68378122 Keywords : biometric data * sensitive personal data * private life Subject RIV: AG - Legal Sciences OBOR OECD: Law

  19. Binominální slovní spojení v Míšeňské právní knize a jejím českém překladu : Binominal Phrases in the Meissen Law Book and its Czech Translation: Issues of Historical Phraseology

    Directory of Open Access Journals (Sweden)

    Libuše Spáčilová

    2017-07-01

    Full Text Available The study deals with topical tasks of historical phraseology. Using a specific historical source (the Meissen Law Book written in the 14th century in German, the paper reports the results of an analysis of binominal phrases and of their equivalents in a Czech translation from the 15th century. The article also comments on the variability exhibited by binominals in the two languages, as well as on the formal structure of such important lexical means for legal documents. The conclusions also point to possible analyses of other types of phrasemes in both sources.

  20. Pohled církví a náboženských společností na morálně právní status nenarozeného lidského života

    OpenAIRE

    Vopálková, Jaroslava

    2013-01-01

    This bachelor thesis focuses on moral and legal status of unborn child from the viewpoint of the churches and other religious organisations. It is written from the perspective of biomedical ethics attached to theological ethics. The attitudes of the churches and other religious organisations in the Czech Republic are interpreted on the basis of its own research and are contrasted with other theories dealing with the moral and legal status of unborn child, human and legal standards and Czech l...

  1. Rozličné prostředky řízení proudění ve službě zvýšení výkonů větroňů - Vnitřní a vnější aerodynamika

    Czech Academy of Sciences Publication Activity Database

    Popelka, Lukáš

    2009-01-01

    Roč. 6, č. 4 (2009), s. 26-28 ISSN 1214-4975 R&D Projects: GA MŠk(CZ) 1M06031; GA ČR GA101/08/1112; GA AV ČR(CZ) IAA200760614 Institutional research plan: CEZ:AV0Z20760514 Keywords : internal and external aerodynamics * boundary Layer * blowing Subject RIV: JU - Aeronautics, Aerodynamics, Aircrafts

  2. Právní úprava zpřístupňující informace orgánů veřejné správy ČR a EU elektronickou cestou a formou open data

    Czech Academy of Sciences Publication Activity Database

    Kolman, Jiří

    2014-01-01

    Roč. 5, č. 10 (2014), s. 23-45 ISSN 1804-5383 Institutional support: RVO:67179843 Keywords : freedom of information * open data * electronic Access * Czech public service * institutions of the European union * regulation (EC) No 1049/2001 regarding public acces to EP * council and commission documents Subject RIV: AG - Legal Sciences https://journals.muni.cz/revue/issue/viewFile/245/pdf_8

  3. Segmentace českých domácností a orientační prognóza počtu domácností ve vybraných právních formách bydlení a typech zástavby do roku 2020

    Czech Academy of Sciences Publication Activity Database

    Sunega, Petr; Lux, Martin

    2010-01-01

    Roč. 46, č. 1 (2010), s. 3-41 ISSN 0038-0288 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : housing * consumption * housing classes Subject RIV: AO - Sociology, Demography Impact factor: 0.389, year: 2010 http://sreview.soc.cas.cz/uploads/3ca85b45f38a4359c344480fcb36a6a6886fa039_SUNEGALUXSc2010-1.pdf

  4. Kompenzační schémata v případě odpovědnosti zdravotnických pracovníků za chybně provedený lékařský zákrok - Lze nalézt inspirativní právní transplantát?

    Czech Academy of Sciences Publication Activity Database

    Doležal, Tomáš

    2011-01-01

    Roč. 1, č. 2 (2011), s. 54-63 ISSN 1804-8137 Institutional research plan: CEZ:AV0Z70680506 Keywords : legal transplants * no-fault compensation scheme * personal injury Subject RIV: AG - Legal Sciences http://www.ilaw.cas.cz/medlawjournal/index.php/medlawjournal/article/view/8

  5. Osobní vztah mezi zaměstnancem a zaměstnavatelem jako definiční znak pracovněprávního vztahu - stručná komparativní analýza pohledem informační společnosti

    Czech Academy of Sciences Publication Activity Database

    Matejka, Ján; Štefko, Martin

    2012-01-01

    Roč. 151, č. 8 (2012), s. 872-891 ISSN 0231-6625 R&D Projects: GA ČR GA407/09/1823 Institutional support: RVO:68378122 Keywords : labor law * private law * employer-employee relationship Subject RIV: AG - Legal Sciences

  6. Právní otázky související s problematikou translidí pod zorným úhlem rozhodnutí Velkého senátu ESLP ve věci Hämäläinen vs Finsko

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam

    2014-01-01

    Roč. 4, č. 3 (2014), s. 44-60 ISSN 1804-8137 R&D Projects: GA ČR(CZ) GA14-35646S Institutional support: RVO:68378122 Keywords : transgender * marriage * registered partnership Subject RIV: AG - Legal Sciences http://www.ilaw.cas.cz/medlawjournal/index.php/medlawjournal/article/view/82/80

  7. Zdanění příjmů obchodních společností a jejich účastníků (srovnání právní úpravy v ČR a ve vybraných státech EU - SR a PR)

    OpenAIRE

    Boháček, Pavel

    2010-01-01

    87 Resumé This diploma thesis named "Taxation of income of companies and their participants (comparison of legal regulations in the selected EU states - the Czech Republic, Slovakia and Poland)". The thesis is divided into a theoretical and practical part. Chapters 1 - 6 form the theoretical part and chapters 7 - 9 form the practical part. The theoretical part contains a definition of tax, possible division of taxes, definition of a tax system and description of the structure of tax systems i...

  8. Nastavení sociálních politik, odborný diskurs a „správná“ péče o děti – srovnání České republiky a Francie

    Czech Academy of Sciences Publication Activity Database

    Dudová, Radka; Hašková, Hana

    2011-01-01

    Roč. 5, č. 5 (2011), s. 8-14 ISSN 1802-5854 R&D Projects: GA AV ČR IAA700280901; GA ČR GAP404/10/0021 Institutional research plan: CEZ:AV0Z70280505 Keywords : institutions * childcare * discourse Subject RIV: AO - Sociology, Demography

  9. Spolupráce sester agentury domácí péče a rodinných příslušníků v péči o pacienta po cévní mozkové příhodě

    OpenAIRE

    SILOVSKÁ, Petra

    2015-01-01

    Cerebrovascular accident means acute vascular brain damage. It may have various causes. This includes either blocking of a vein with a blood clot, vasoconstriction or combination of the aforementioned causes. Frequent symptoms of CVA are paralysis, weakness, loss of sensitivity in face or on one side of a limb. Another symptom may be speech disturbance. Cerebrovascular accident may be identified as brain ischemia and hemorrhagic ictus. The thesis includes characteristics and symptoms of the a...

  10. Sourozenci onkologicky nemocných dětí: subjektivně vnímané změny v životě a kvalita jejich života 6 měsíců po stanovení diagnózy nemocnému sourozenci

    Czech Academy of Sciences Publication Activity Database

    Kárová, Š.; Blatný, Marek; Jelínek, Martin; Kepák, T.; Tóthová, K.

    2013-01-01

    Roč. 57, č. 3 (2013), s. 218-229 ISSN 0009-062X R&D Projects: GA ČR GA406/09/1255 Institutional support: RVO:68081740 Keywords : oncology disease * siblings * quality of life Subject RIV: AN - Psychology Impact factor: 0.292, year: 2013

  11. Využití Vojtovy metody a posturálního cvičení dle Čápové u pacientů po mozkově cévní příhodě

    OpenAIRE

    Podhorská, Karolína

    2007-01-01

    Tittle: Vojta method in adults patient after cerebral palsy Aim ofwork: Construct model ofeffect Vojta method in adults patient and active postural exercise of Capova a:fter cerebral palsy on the basic ofliterature and theoretic experience and examine qualitative method . Methodics Model was tested in ten adults patient a:fter cerebral palsy by means of define symptoms and value influence reflex therapy on quality patient life (SQUALA). Effect oftherapy was con:firmed by Barthel index. Analys...

  12. Česká historizující próza mezi romantismem a realismem : rekonstrukce historické právní kauzy Henyka z Valdštejna v povídce Karla Sabiny Osudná kniha)

    Czech Academy of Sciences Publication Activity Database

    Charypar, Michal

    2014-01-01

    Roč. 17, č. 1 (2014), s. 87-105 ISSN 1213-2144 Institutional support: RVO:68378068 Keywords : Czech literature * historical fiction * 19th century * Sabina, Karel * realism Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. Patentovat či nikoliv? Právní a morální dilemata spojená s komerční využitelností výstupů výzkumu na lidských embryonálních kmenových buňkách

    Czech Academy of Sciences Publication Activity Database

    Doležal, Tomáš

    2012-01-01

    Roč. 20, č. 18 (2012), s. 640-644 ISSN 1210-6410 R&D Projects: GA ČR GAP408/12/2564 Institutional support: RVO:68378122 Keywords : research involving the use of human embryo * patent s on life * stem cell patent s Subject RIV: AG - Legal Sciences

  14. K současnému stavu poznání barremsko-aptských amonitů z godulské facie slezské jednotky v Moravských Beskydech (vnější Karpaty, Česká republika)

    Czech Academy of Sciences Publication Activity Database

    Vašíček, Zdeněk

    2009-01-01

    Roč. 2, č. 1 (2009), s. 59-73 ISSN 1803-960X Institutional research plan: CEZ:AV0Z30860518 Keywords : Flysch Carpathians * Hradiště Formation * Lower Cretaceous * ammonites Subject RIV: DB - Geology ; Mineralogy

  15. Právní povaha kontrolních činností při kontrole veřejné účelové podpory poskytované na řešení projektů výzkumu, experimentálního vývoje a inovací

    Czech Academy of Sciences Publication Activity Database

    Hálová, Miloslava

    2015-01-01

    Roč. 154, č. 11 (2015), s. 895-918 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : research * development and innovations * control of targeted project support Subject RIV: AG - Legal Sciences

  16. Příspěvek k litologii křídových souvrství na profilu Bystrý potok u Trojanovic (slezská jednotka, vnější Západní Karpaty, Česká republika)

    Czech Academy of Sciences Publication Activity Database

    Boorová, D.; Jansa, L. F.; Matýsek, D.; Skupien, P.; Vašíček, Zdeněk

    2008-01-01

    Roč. 93, - (2008), s. 185-217 ISSN 1211-8796 Grant - others:GA ČR(CZ) GA205/05/0917 Program:GA Institutional research plan: CEZ:AV0Z30860518 Keywords : Silesian Unit * lithology * Lhoty - Mazák formations Subject RIV: DB - Geology ; Mineralogy

  17. Biostratigrafie spodnokřídových uloženin slezské jednotky na základě studia miospor, dinocyst a foraminifer (Vnější Západní Karpaty, Česká republika)

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Marcela; Hradecká, L.; Skupien, P.

    2010-01-01

    Roč. 2009, - (2010), s. 50-57 ISSN 0514-8057 R&D Projects: GA ČR GA205/01/1582 Institutional research plan: CEZ:AV0Z30130516 Keywords : Outer Western Carpathians * Lower Cretaceous * miospores * dinocysts * foraminifers * biostratigraphy * palaeoenvironment Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2009/2009-14.pdf

  18. Současná mezinárodněprávní úprava použití ozbrojené síly - zákaz použití síly a jeho nesporné výjimky

    Czech Academy of Sciences Publication Activity Database

    Popenková, Monika

    2008-01-01

    Roč. 147, č. 8 (2008), s. 862-898 ISSN 0231-6625 R&D Projects: GA AV ČR KJB700680601 Institutional research plan: CEZ:AV0Z70680506 Keywords : the United Nations Charter * prohibition of force application * self-defence right Subject RIV: AG - Legal Sciences

  19. Postoupení pohledávky při podnikání v českém a německém právním řádu

    OpenAIRE

    Kasl, František

    2013-01-01

    The aim of this thesis is to provide detailed analysis of selected legal aspects with practical importance of the assignment of business receivables. Particular topics are focused on problematic legal features of cession, that have so far not been sufficiently elaborated in expert literature, mainly with regards to the impacts of the recent transformation of the Czech civil law. The issues are approached as comparison between the previous law and the current law, which is in force since 1st J...

  20. Legal Rules on the Purchase Contract under the Czech new Civil Code – – Selected Problems / Právní Úprava Kupní Smlouvy Ve Světle Nového Občanského Zákoníku Čr – – Vybrané Problémy

    Directory of Open Access Journals (Sweden)

    Janků Martin

    2016-06-01

    Full Text Available The goal of the present paper is to draw attention to some key rules and principles of the purchase contract. After the specification of this contract type we will deal in more details with the defective performance and the procedure of its complaint. As suggest the first assessment and reviews of the application of new legislation in its practical use and by the case law, in the achievement of the objective desired by the NCC - to increase the transparency of the procedure of complaints - the new legislation stacked in the middle of the way. The paper compares the impact of the new the previous and the current regulations, We will use the method of functional analysis as well as the method of legal formalistic comparison. It is obvious that the new rules respect the former régime of commercial contracts. The business sphere has undoubtedly welcomed this feature of the legal regime as the merchandisers are familiar with these rules. The second issue is, however, how this modification in the general regulation meets the expectations of the to provide sufficient legal certainty in the interpretation of contractual provisions and in the access to the protection of their interests by courts in the event of disputes.

  1. Výzkum životního stylu cílové skupiny společnosti Marshal Apparel se zaměřením na vnímání trendů a módy jako prostředku sebevyjádření

    OpenAIRE

    Šlahař, Daniel

    2016-01-01

    This bachelor's thesis is aspiring to penetrate the minds of the consumers and to delineate chosen characteristics of the lifestyle of Marshal Apparel's target market. It will also focus on the preception of trends and fashion as means of self-expression. In the first section of the thesis, I will explain the basic expressions linked with fashion and lifestyle which help to further understand the given topic. In the next section, I will briefly describe the Marshal Apparel fashion label. The ...

  2. Obnova druhově bohatých xerotermních trávníků na příkladu rezervací Stráně u splavu a Stráně

    Czech Academy of Sciences Publication Activity Database

    Münzbergová, Zuzana

    2001-01-01

    Roč. 19, - (2001), s. 101-121 ISSN 1211-3603 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : restoration * rich xerophilous grasslands Subject RIV: EF - Botanics

  3. Plastic Deformation Induced by Nanoindentation Test Applied on ZrN/Si3N4 Multilayer Coatings

    Directory of Open Access Journals (Sweden)

    Zhengtao Wu

    2017-12-01

    Full Text Available ZrN/Si3N4 multilayer coating that alternates with either nanocrystalline ZrN or amorphous Si3N4 interlayers was fabricated by reactively magnetron sputtering in an Ar-N2 mixture atmosphere. The thicknesses of the nanocrystalline ZrN and the amorphous Si3N4 interlayers are ~12.5 and 2.5 nm, respectively. The ZrN/Si3N4 coating exhibits a promoted hardness of 28.6 ± 1.2 GPa when compared to the binary ZrN. Microstructure evolution just underneath the nanoindentation impression of the ZrN/Si3N4 multilayer coating has been investigated. The result indicates that both ZrN nanograin rotations and plastic flow of the Si3N4 interlayers contribute to the permanent deformation of the multilayer coating induced by the nanoindentation. In addition, the introduction of the a-Si3N4 interlayers hinders both the initiation and propagation of microcracks when the multilayer coating was applied to the scratch test. The propagation deflection of the microcracks was observed attributed to the heterogenous interface, which produces the hardness promotion of the multilayer coating eventually.

  4. Fire and explosion hazards of refractory compound powders

    International Nuclear Information System (INIS)

    Krivtsov, V.A.; Kostina, E.S.

    1978-01-01

    Data on fire and explosion hazards of refractory compound powders (HfC, ZrC,LaB 6 , ZrN, etc.) are presented. It is shown that refractory compounds can be fire- and exposion hazardous in various degrees. Qualitative and quantitative estimations of one of fire-hazard characteristics - smoldering temperature - are presented

  5. Influence of N2 partial pressure on structural and microhardness properties of TiN/ZrN multilayers deposited by Ar/N2 vacuum arc discharge

    Science.gov (United States)

    Naddaf, M.; Abdallah, B.; Ahmad, M.; A-Kharroub, M.

    2016-08-01

    The influence of N2 partial pressure on structural, mechanical and wetting properties of multilayered TiN/ZrN thin films deposited on silicon substrates by vacuum arc discharge of (N2 + Ar) gas mixtures is investigated. X-ray diffraction (XRD) results show that the average texturing coefficient of (1 1 1) orientation and the grain size of both TiN and ZrN individual layers increase with increasing the N2 partial pressure. The Rutherford back scattering (RBS) measurements and analysis reveal that incorporation of the nitrogen in the film increases with increasing the N2 partial pressure and both TiN and ZrN individual layers have a nitrogen over-stoichiometry for N2 partial pressure ⩾50%. The change in the film micro-hardness is correlated to the changes in crystallographic texture, grain size, stoichiometry and the residual stress in the film as a function of the N2 partial pressure. In particular, stoichiometry of ZrN and TiN individual is found to play the vital role in determining the multilayer hardness. The multilayer film deposited at N2 partial pressure of 25% has the best stoichiometric ratio of both TiN and ZrN layers and the highest micro-hardness of about 32 GPa. In addition, water contact angle (WCA) measurements and analysis show a decrease in the work of adhesion on increasing the N2 partial pressure.

  6. Influence of N_2 partial pressure on structural and microhardness properties of TiN/ZrN multilayers deposited by Ar/N_2 vacuum arc discharge

    International Nuclear Information System (INIS)

    Naddaf, M.; Abdallah, B.; Ahmad, M.; A-Kharroub, M.

    2016-01-01

    The influence of N_2 partial pressure on structural, mechanical and wetting properties of multilayered TiN/ZrN thin films deposited on silicon substrates by vacuum arc discharge of (N_2 + Ar) gas mixtures is investigated. X-ray diffraction (XRD) results show that the average texturing coefficient of (1 1 1) orientation and the grain size of both TiN and ZrN individual layers increase with increasing the N_2 partial pressure. The Rutherford back scattering (RBS) measurements and analysis reveal that incorporation of the nitrogen in the film increases with increasing the N_2 partial pressure and both TiN and ZrN individual layers have a nitrogen over-stoichiometry for N_2 partial pressure ⩾50%. The change in the film micro-hardness is correlated to the changes in crystallographic texture, grain size, stoichiometry and the residual stress in the film as a function of the N_2 partial pressure. In particular, stoichiometry of ZrN and TiN individual is found to play the vital role in determining the multilayer hardness. The multilayer film deposited at N_2 partial pressure of 25% has the best stoichiometric ratio of both TiN and ZrN layers and the highest micro-hardness of about 32 GPa. In addition, water contact angle (WCA) measurements and analysis show a decrease in the work of adhesion on increasing the N_2 partial pressure.

  7. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

  8. Ab Initio Predictions of Hexagonal Zr(B,C,N) Polymorphs for Coherent Interface Design

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Chongze [Univ. of Minnesota-Twin Cities, Minneapolis, MN (United States); Huang, Jingsong [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sumpter, Bobby G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Meletis, Efstathios [Univ. of Texas at Arlington, Arlington, TX (United States); Dumitrica, Traian [Univ. of Minnesota-Twin Cities, Minneapolis, MN (United States)

    2017-10-27

    Density functional theory calculations are used to explore hexagonal (HX) NiAs-like polymorphs of Zr(B,C,N) and compare with corresponding Zr(B,C,N) Hagg-like face-centered cubic rocksalt (B1) phases. While all predicted compounds are mechanically stable according to the Born-Huang criteria, only HX Zr(C,N) are found dynamically stable from ab initio molecular dynamics simulations and lattice dynamics calculations. HX ZrN emerges as a candidate structure with ground state energy, elastic constants, and extrinsic mechanical parameters comparable with those of B1 ZrN. Ab initio band structure and semi-classical Boltzmann transport calculations predict a metallic character and a monotonic increase in electrical conductivity with the number of valence electrons. Electronic structure calculations indicate that the HX phases gain their stability and mechanical attributes by Zr d- non-metal p hybridization and by broadening of Zr d bands. Furthermore, it is shown that the HX ZrN phase provides a low-energy coherent interface model for connecting B1 ZrN domains, with significant energetic advantage over an atomistic interface model derived from high resolution transmission electron microscopy images. The ab initio characterizations provided herein should aid the experimental identification of non-Hagg-like hard phases. Furthermore, the results can also enrich the variety of crystalline phases potentially available for designing coherent interfaces in superhard nanostructured materials and in materials with multilayer characteristics.

  9. Turning Failure into Success: Trials of the Heart Failure Clinical Research Network.

    Science.gov (United States)

    Joyce, Emer; Givertz, Michael M

    2016-12-01

    The Heart Failure Clinical Research Network (HFN) was established in 2008 on behalf of the NIH National Heart, Lung and Blood Institute, with the primary goal of improving outcomes in heart failure (HF) by designing and conducting high-quality concurrent clinical trials testing interventions across the spectrum of HF. Completed HFN trials have answered several important and relevant clinical questions concerning the safety and efficacy of different decongestive and adjunctive vasodilator therapies in hospitalized acute HF, phosphodiesterase-5 inhibition and nitrate therapies in HF with preserved ejection fraction, and the role of xanthine oxidase inhibition in hyperuricemic HF. These successes, independent of the "positive" or "negative" result of each individual trial, have helped to shape the current clinical care of HF patients and serve as a platform to inform future research directions and trial designs.

  10. Coated U(Mo) Fuel: As-Fabricated Microstructures

    Energy Technology Data Exchange (ETDEWEB)

    Emmanuel Perez; Dennis D. Keiser, Jr.; Ann Leenaers; Sven Van den Berghe; Tom Wiencek

    2014-04-01

    As part of the development of low-enriched uranium fuels, fuel plates have recently been tested in the BR-2 reactor as part of the SELENIUM experiment. These fuel plates contained fuel particles with either Si or ZrN thin film coating (up to 1 µm thickness) around the U-7Mo fuel particles. In order to best understand irradiation performance, it is important to determine the starting microstructure that can be observed in as-fabricated fuel plates. To this end, detailed microstructural characterization was performed on ZrN and Si-coated U-7Mo powder in samples taken from AA6061-clad fuel plates fabricated at 500°C. Of interest was the condition of the thin film coatings after fabrication at a relatively high temperature. Both scanning electron microscopy and transmission electron microscopy were employed. The ZrN thin film coating was observed to consist of columns comprised of very fine ZrN grains. Relatively large amounts of porosity could be found in some areas of the thin film, along with an enrichment of oxygen around each of the the ZrN columns. In the case of the pure Si thin film coating sample, a (U,Mo,Al,Si) interaction layer was observed around the U-7Mo particles. Apparently, the Si reacted with the U-7Mo and Al matrix during fuel plate fabrication at 500°C to form this layer. The microstructure of the formed layer is very similar to those that form in U-7Mo versus Al-Si alloy diffusion couples annealed at higher temperatures and as-fabricated U-7Mo dispersion fuel plates with Al-Si alloy matrix fabricated at 500°C.

  11. Attachment and growth of human keratinocytes in a serum-free environment.

    Science.gov (United States)

    Gilchrest, B A; Calhoun, J K; Maciag, T

    1982-08-01

    Using a serum-free system, we have investigated the influence of human fibronectin (HFN) and selected growth factors (GF) on the attachment and growth of normal human keratinocytes in vitro. Single-cell suspensions of keratinocytes from near-confluent primary plates, plated on 5-10 microgram/cm2 HFN, showed approximately 30-40% attachment after 2-24 hours of incubation at 37 degrees C, compared with 4-6% attachment on uncoated platic plates. Percentage of attached cells was independent of seed density, tissue donor age, in vitro culture age, or medium composition, while subsequent cellular proliferation was strongly dependent on these factors. Keratinocytes grown on an adequate HFN matrix in a previously described hormone-supplemented medium (Maciag et al., 1981a) achieved four to eight population doubling over 7-12 days at densities greater than or equal to 104 cell/cm2. Removal of most GF individually from the medium had little or no effect on growth, while removal of epidermal growth factor (EGF) alone reduced growth by 30-35% and removal of bovine brain extract (BE) alone reduced growth by approximately 90%. Conversely, EGF alone in basal medium supported approximately 10% control growth, BE alone supported 30-40% control growth, and the combination of EGF and BE approximately 70%. In addition to its major effect on proliferation in this system, BE was necessary to preserve normal keratinocyte morphology and protein production. These findings expand earlier observations that HFN facilitates keratinocyte attachment in vitro and that a brain-derived extract can exert a major positive influence on cultured keratinocytes.

  12. Partial recovery of respiratory function and diaphragm reinnervation following unilateral vagus nerve to phrenic nerve anastomosis in rabbits.

    Directory of Open Access Journals (Sweden)

    Junxiang Wen

    Full Text Available Respiratory dysfunction is the leading cause of mortality following upper cervical spinal cord injury (SCI. Reinnervation of the paralyzed diaphragm via an anastomosis between phrenic nerve and a donor nerve is a potential strategy to mitigate ventilatory deficits. In this study, anastomosis of vagus nerve (VN to phrenic nerve (PN in rabbits was performed to assess the potential capacity of the VN to compensate for lost PN inputs. At first, we compared spontaneous discharge pattern, nerve thickness and number of motor fibers between these nerves. The PN exhibited a highly rhythmic discharge while the VN exhibited a variable frequency discharge pattern. The rabbit VN had fewer motor axons (105.3±12.1 vs. 268.1±15.4. Nerve conduction and respiratory function were measured 20 weeks after left PN transection with or without left VN-PN anastomosis. Compared to rabbits subjected to unilateral phrenicotomy without VN-PN anastomosis, diaphragm muscle action potential (AP amplitude was improved by 292%, distal latency by 695%, peak inspiratory flow (PIF by 22.6%, peak expiratory flow (PRF by 36.4%, and tidal volume by 21.8% in the anastomosis group. However, PIF recovery was only 28.0%, PEF 28.2%, and tidal volume 31.2% of Control. Our results suggested that VN-PN anastomosis is a promising therapeutic strategy for partial restoration of diaphragm reinnervation, but further modification and improvements are necessary to realize the full potential of this technique.

  13. Vascular Neurology Nurse Practitioner Provision of Telemedicine Consultations

    Directory of Open Access Journals (Sweden)

    Bart M. Demaerschalk

    2010-01-01

    Full Text Available Objective. The objective was to define and evaluate a role for the Vascular Neurology-Nurse Practitioner (VN-NP in the delivery of telemedicine consultations in partnership with a vascular neurologist. Methods. Prospective stroke alert patients at participating hospitals underwent a two-way audio video telemedicine consultation with a VN-NP at a remotely located stroke center in partnership with a vascular neurologist. Demographic information, National Institutes of Health Stroke Scale (NIHSS scores, diagnoses, CT contraindications to thrombolysis, thrombolysis eligibility, and time interval data were collected. The inter-rater agreement between VN-NP and vascular neurologist assessments was calculated. Results. Ten patients were evaluated. Four were determined to have ischemic stroke, one had a transient ischemic attack, two had intracerebral hemorrhages, and three were stroke mimics. Overall, three patients received thrombolysis. The inter-rater agreement between VN-NP and vascular neurologist assessments were excellent, ranging from 0.9 to 1.0. The duration of VN-NP consultation was 53.2±9.0 minutes, which included the vascular neurologist supervisory evaluation time of 12.0±9.6 minutes. Conclusion. This study illustrated that a stroke center VN-NP, in partnership with a vascular neurologist, could deliver timely telemedicine consultations, accurate diagnoses, and correct treatments in acute stroke patients who presented to remotely located rural emergency departments within a hub and spoke network. VN-NPs may fulfill the role of a telestroke provider.

  14. Vascular neurology nurse practitioner provision of telemedicine consultations.

    Science.gov (United States)

    Demaerschalk, Bart M; Kiernan, Terri-Ellen J; Investigators, Starr

    2010-01-01

    Objective. The objective was to define and evaluate a role for the Vascular Neurology-Nurse Practitioner (VN-NP) in the delivery of telemedicine consultations in partnership with a vascular neurologist. Methods. Prospective stroke alert patients at participating hospitals underwent a two-way audio video telemedicine consultation with a VN-NP at a remotely located stroke center in partnership with a vascular neurologist. Demographic information, National Institutes of Health Stroke Scale (NIHSS) scores, diagnoses, CT contraindications to thrombolysis, thrombolysis eligibility, and time interval data were collected. The inter-rater agreement between VN-NP and vascular neurologist assessments was calculated. Results. Ten patients were evaluated. Four were determined to have ischemic stroke, one had a transient ischemic attack, two had intracerebral hemorrhages, and three were stroke mimics. Overall, three patients received thrombolysis. The inter-rater agreement between VN-NP and vascular neurologist assessments were excellent, ranging from 0.9 to 1.0. The duration of VN-NP consultation was 53.2 +/- 9.0 minutes, which included the vascular neurologist supervisory evaluation time of 12.0 +/- 9.6 minutes. Conclusion. This study illustrated that a stroke center VN-NP, in partnership with a vascular neurologist, could deliver timely telemedicine consultations, accurate diagnoses, and correct treatments in acute stroke patients who presented to remotely located rural emergency departments within a hub and spoke network. VN-NPs may fulfill the role of a telestroke provider.

  15. Identification and therapeutic potential of a vitronectin binding region of meningococcal msf.

    Directory of Open Access Journals (Sweden)

    Darryl J Hill

    Full Text Available The human pathogen Neisseria meningitides (Nm attains serum resistance via a number of mechanisms, one of which involves binding to the host complement regulator protein vitronectin. We have shown previously that the Meningococcal surface fibril (Msf, a trimeric autotransporter, binds to the activated form of vitronectin (aVn to increase Nm survival in human serum. In this study, we aimed to identify the aVn-binding region of Msf to assess its potential as an antigen which can elicit antibodies that block aVn binding and/or possess bactericidal properties. Using several recombinant Msf fragments spanning its surface-exposed region, the smallest aVn-binding recombinants were found to span residues 1-86 and 39-124. The use of further deletion constructs and overlapping recombinant Msf fragments suggested that a region of Msf comprising residues 39-82 may be primarily important for aVn binding and that other regions may also be involved but to a lesser extent. Molecular modelling implicated K66 and K68, conserved in all available Msf sequences, to be involved in the interaction. Recombinant fragments which bound to aVn were able to reduce the survival advantage conveyed by aVn-interaction in serum bactericidal assays. Antibodies raised against one such fragment inhibited aVn binding to Msf. In addition, the antibodies enhanced specific killing of Msf-expressing Nm in a dose-dependent manner. Overall, this study identifies an aVn-binding region of Msf, an adhesin known to impart serum resistance properties to the pathogen; and shows that this region of Msf can elicit antibodies with dual properties which reduce pathogen survival within the host and thus has potential as a vaccine antigen.

  16. Identification and therapeutic potential of a vitronectin binding region of meningococcal msf.

    Science.gov (United States)

    Hill, Darryl J; Griffiths, Natalie J; Borodina, Elena; Andreae, Clio A; Sessions, Richard B; Virji, Mumtaz

    2015-01-01

    The human pathogen Neisseria meningitides (Nm) attains serum resistance via a number of mechanisms, one of which involves binding to the host complement regulator protein vitronectin. We have shown previously that the Meningococcal surface fibril (Msf), a trimeric autotransporter, binds to the activated form of vitronectin (aVn) to increase Nm survival in human serum. In this study, we aimed to identify the aVn-binding region of Msf to assess its potential as an antigen which can elicit antibodies that block aVn binding and/or possess bactericidal properties. Using several recombinant Msf fragments spanning its surface-exposed region, the smallest aVn-binding recombinants were found to span residues 1-86 and 39-124. The use of further deletion constructs and overlapping recombinant Msf fragments suggested that a region of Msf comprising residues 39-82 may be primarily important for aVn binding and that other regions may also be involved but to a lesser extent. Molecular modelling implicated K66 and K68, conserved in all available Msf sequences, to be involved in the interaction. Recombinant fragments which bound to aVn were able to reduce the survival advantage conveyed by aVn-interaction in serum bactericidal assays. Antibodies raised against one such fragment inhibited aVn binding to Msf. In addition, the antibodies enhanced specific killing of Msf-expressing Nm in a dose-dependent manner. Overall, this study identifies an aVn-binding region of Msf, an adhesin known to impart serum resistance properties to the pathogen; and shows that this region of Msf can elicit antibodies with dual properties which reduce pathogen survival within the host and thus has potential as a vaccine antigen.

  17. Evaluation of cermet materials suitable for lithium lubricated thrust bearings for high temperature operation

    Science.gov (United States)

    Sinclair, J. H.; Hendrixson, W. H.

    1974-01-01

    Cerment materials (HfC - 10 wt% W; HfC - 10 wt% TaC - 10 wt%W; HfC - 2 wt% CbC - 8 wt% Mo;Hfn - 10 wt% W; Hfn - 10 wt% TaN - 10 wt% W; and ZrC - 17 wt% W) were evaluated for possible use as lithium-lubricated bearings in the control system of a nuclear reactor. Tests of compatibility with lithium were made in T-111 (Ta-8W-2Hf) capsules at temperatures up to 1090 C. The tendencies of HfC-TaC-W, HfC-CbC-Mo, and HfN-W to bond to themselves and to the refractory alloys T-111 and TZM when enclosed in lithium-filled capsules under a pressure of 2000 psi at 980 and 1200 C for 1933 hours were evaluated. Thermal expansion characteristics were determined for the same three materials from room temperature to 1200 C. On the basis of these tests, HfC-10 TaC-10W and HfN-10W were selected as the best and second best candidates, respectively, of the materials tested for the bearing application.

  18. Maternal perinatal diet induces developmental programming of bone architecture.

    Science.gov (United States)

    Devlin, M J; Grasemann, C; Cloutier, A M; Louis, L; Alm, C; Palmert, M R; Bouxsein, M L

    2013-04-01

    Maternal high-fat (HF) diet can alter offspring metabolism via perinatal developmental programming. This study tests the hypothesis that maternal HF diet also induces perinatal programming of offspring bone mass and strength. We compared skeletal acquisition in pups from C57Bl/6J mice fed HF or normal diet from preconception through lactation. Three-week-old male and female pups from HF (HF-N) and normal mothers (N-N) were weaned onto normal diet. Outcomes at 14 and 26 weeks of age included body mass, body composition, whole-body bone mineral content (WBBMC) via peripheral dual-energy X-ray absorptiometry, femoral cortical and trabecular architecture via microcomputed tomography, and glucose tolerance. Female HF-N had normal body mass and glucose tolerance, with lower body fat (%) but higher serum leptin at 14 weeks vs. N-N (Pbone volume fraction was 20% higher at 14 weeks in female HF-N vs. N-N (Pbone area was 6% higher at 14 weeks vs. N-N (Pbone, supporting the hypothesis that maternal diet alters postnatal skeletal homeostasis.

  19. Water in the Gas Phase.

    Science.gov (United States)

    1998-06-01

    Valentin, Ch. Claveau A.D. Bykov, N.N. Lavrentieva, VN. Saveliev , L.N. Sinitsa « THE TCPE MANY-BODY MODEL FOR WATER » 79 M. Masella and J-P. Flament...Laboratoire de Physique Moleculaire et Applications, CNRS Universite Pierre et Marie Curie, Paris, France. A.D. Bykov, N.N. Lavrentieva, V.N. Saveliev , L.N...T19 Lozada M. T4 Rothman L.S. T22 Lutz B. L. T33 Ruiz J. P24 Lynch R. P3 Sadlej A. T5 Lynden-Bell R. M. P8 Saveliev V.N. P4 Maemets V. P18 Saykally

  20. Investigation of structural transformations in the Nb-Ti-Al alloy system

    International Nuclear Information System (INIS)

    Vergasova, L.L.; Volin, Eh.M.; Chizhov, I.N.; Lokshina, A.E.

    1975-01-01

    There are given the results of investigating the effect of thermal treatment conditions upon the structure, the phase composition and the mechanical characteristic of VN7 alloy from Nb-Ti-Al system. VN7 alloy was investigated in cast, forged, pressed and rolled state to study the β-α-conversion processes at slow cooling from high temperature. It was found out that slow cooling lowers considerably the plastic characteristic and the impact ductility without changing practically the tensile strength values. Higher plastic characteristic of VN7 alloy can be obtained through hastening the cooling process of the intermediate products after annealing at 950-1050 0 C

  1. Nuclear data measurements in 3x592 GBq 241Am-Be neutron cell

    International Nuclear Information System (INIS)

    2010-01-01

    Dy and 1 79mHf radioisotopes, which were induced by 2 7Al(n, γ) 2 8Al, 5 1V(n, γ) 5 2V, 6 5Cu(n, γ) 6 6Cu, 7 6Se(n, γ) 7 7mSe, 8 5Rb(n, γ) 8 6mRb, 1 07Ag(n, γ) 1 08Ag, 1 09Ag(n, γ) 1 10Ag, 1 21Sb(n, γ) 1 22mSb, 1 60Gd(n, γ) 1 61Gd, 1 64Dy(n, γ) 1 65mDy and 1 78Hf(n, γ) 1 79mHf reactions were measured.

  2. An antioxidant nanozyme that uncovers the cytoprotective potential of vanadia nanowires

    Science.gov (United States)

    Vernekar, Amit A.; Sinha, Devanjan; Srivastava, Shubhi; Paramasivam, Prasath U.; D'Silva, Patrick; Mugesh, Govindasamy

    2014-11-01

    Nanomaterials with enzyme-like properties has attracted significant interest, although limited information is available on their biological activities in cells. Here we show that V2O5 nanowires (Vn) functionally mimic the antioxidant enzyme glutathione peroxidase by using cellular glutathione. Although bulk V2O5 is known to be toxic to the cells, the property is altered when converted into a nanomaterial form. The Vn nanozymes readily internalize into mammalian cells of multiple origin (kidney, neuronal, prostate, cervical) and exhibit robust enzyme-like activity by scavenging the reactive oxygen species when challenged against intrinsic and extrinsic oxidative stress. The Vn nanozymes fully restore the redox balance without perturbing the cellular antioxidant defense, thus providing an important cytoprotection for biomolecules against harmful oxidative damage. Based on our findings, we envision that biocompatible Vn nanowires can provide future therapeutic potential to prevent ageing, cardiac disorders and several neurological conditions, including Parkinson’s and Alzheimer’s disease.

  3. Disease: H00443 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available pes of craniosynostosis. Missense mutation of FGFR1 has been reported. Skeletal dysplasia FGFR1 [HSA:2260] [...ion) ... AUTHORS ... Shankar VN, Ajila V, Kumar G ... TITLE ... Osteoglophonic dysplasia: a case report. ... JOURNAL

  4. Low temperature plasma-enhanced atomic layer deposition of thin vanadium nitride layers for copper diffusion barriers

    Energy Technology Data Exchange (ETDEWEB)

    Rampelberg, Geert; Devloo-Casier, Kilian; Deduytsche, Davy; Detavernier, Christophe [Department of Solid State Sciences, Ghent University, Krijgslaan 281/S1, B-9000 Ghent (Belgium); Schaekers, Marc [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Blasco, Nicolas [Air Liquide Electronics US, L.P., 46401 Landing Parkway, Fremont, California 94538 (United States)

    2013-03-18

    Thin vanadium nitride (VN) layers were grown by atomic layer deposition using tetrakis(ethylmethylamino)vanadium and NH{sub 3} plasma at deposition temperatures between 70 Degree-Sign C and 150 Degree-Sign C on silicon substrates and polymer foil. X-ray photoelectron spectroscopy revealed a composition close to stoichiometric VN, while x-ray diffraction showed the {delta}-VN crystal structure. The resistivity was as low as 200 {mu}{Omega} cm for the as deposited films and further reduced to 143 {mu}{Omega} cm and 93 {mu}{Omega} cm by annealing in N{sub 2} and H{sub 2}/He/N{sub 2}, respectively. A 5 nm VN layer proved to be effective as a diffusion barrier for copper up to a temperature of 720 Degree-Sign C.

  5. Airborne activity and deposition in Debrecen caused by the Chernobyl accidental release

    Energy Technology Data Exchange (ETDEWEB)

    Kibedi, T; Kiss, A Z; Somorjai, E; Uray, I

    1986-01-01

    The effects of Chernobyl reactor accident on the isotope composition of the samples especially that of the cyclotron filter used between October 1985 and October 1986 was found to be significant. (V.N.). 1 ref.; 2 figs.; 2 tables.

  6. SwissProt search result: AK105856 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105856 001-203-H06 (Q81VN5) Glucosamine--fructose-6-phosphate aminotransferase [i...) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph GLMS_BACAN 2e-41 ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Author Affiliations. Harish Ravi1 Rajesh B Khaparde2. Department of Electrical Engineering, IIT Madras, Chennai 600036, India. Homi Bhabha Centre for Science Education, TIFR VN Purav Marg, Mankhurd, Mumbai 400088, India.

  8. Development of a Multifaceted Ovarian Cancer Therapeutic and Imaging Agent

    National Research Council Canada - National Science Library

    Markland, Francis S

    2008-01-01

    ...%. This project outlines the development of a recombinant version of a member of a class of proteins known as disintegrins as an innovative imaging and diagnostic agent for ovarian cancer (OC). Vicrostatin (VN...

  9. Impact of migration on the expression of aggression and empathy in ...

    African Journals Online (AJOL)

    Lubov Atramentova

    changes the level of public health [1]. ... 1 Address: Genetics and Cytology Department, V.N. Karazin Kharkiv National ... 2 Address: Kharkov Private Policlinic No. ..... north-eastern Italy: influence of age, gender, immigration and socioeconomic.

  10. Optimizing human semen cryopreservation by reducing test vial volume and repetitive test vial sampling

    DEFF Research Database (Denmark)

    Jensen, Christian F S; Ohl, Dana A; Parker, Walter R

    2015-01-01

    OBJECTIVE: To investigate optimal test vial (TV) volume, utility and reliability of TVs, intermediate temperature exposure (-88°C to -93°C) before cryostorage, cryostorage in nitrogen vapor (VN2) and liquid nitrogen (LN2), and long-term stability of VN2 cryostorage of human semen. DESIGN......: Prospective clinical laboratory study. SETTING: University assisted reproductive technology (ART) laboratory. PATIENT(S): A total of 594 patients undergoing semen analysis and cryopreservation. INTERVENTION(S): Semen analysis, cryopreservation with different intermediate steps and in different volumes (50......-1,000 μL), and long-term storage in LN2 or VN2. MAIN OUTCOME MEASURE(S): Optimal TV volume, prediction of cryosurvival (CS) in ART procedure vials (ARTVs) with pre-freeze semen parameters and TV CS, post-thaw motility after two- or three-step semen cryopreservation and cryostorage in VN2 and LN2. RESULT...

  11. PERSONALITY THEORY IN INTEGRATIVE PERSONALITY-ORIENTED RECONSTRUCTIVE PSYCHOTHERAPY

    Directory of Open Access Journals (Sweden)

    V I Kurpatov

    2010-01-01

    approaches. V.N. Myasishchev's theory of personality relations in association with its universality, as well as pathogenetic psychotherapy may be the basis for the integration of other methods of psychotherapy

  12. Data Visualization and Analysis Tools for the Global Precipitation Measurement (GPM) Validation Network

    Science.gov (United States)

    Morris, Kenneth R.; Schwaller, Mathew

    2010-01-01

    The Validation Network (VN) prototype for the Global Precipitation Measurement (GPM) Mission compares data from the Tropical Rainfall Measuring Mission (TRMM) satellite Precipitation Radar (PR) to similar measurements from U.S. and international operational weather radars. This prototype is a major component of the GPM Ground Validation System (GVS). The VN provides a means for the precipitation measurement community to identify and resolve significant discrepancies between the ground radar (GR) observations and similar satellite observations. The VN prototype is based on research results and computer code described by Anagnostou et al. (2001), Bolen and Chandrasekar (2000), and Liao et al. (2001), and has previously been described by Morris, et al. (2007). Morris and Schwaller (2009) describe the PR-GR volume-matching algorithm used to create the VN match-up data set used for the comparisons. This paper describes software tools that have been developed for visualization and statistical analysis of the original and volume matched PR and GR data.

  13. An In-defect complex as a possible explanation for high luminous efficacy of InGaN and AlInN based devices

    CERN Document Server

    Kessler, Patrick; Miranda, Sérgio MC; Correia, João Guilherme; Johnston, Karl; Vianden, Reiner

    2010-01-01

    The role of indium in GaN and AlN films is investigated with the method of the perturbed angular correlation (PAC). Using the PAC probe $^{111}$In in addition to indium on substitutional cation sites a large fraction of probes is found in a distinctly different microscopic environment which was attributed to the formation of an indium nitrogen-vacancy (VN) complex. The influence of an electron capture induced after ef fect is ruled out by additional measurements with the PAC probes $^{111m}$Cd and $^{117}$Cd and using GaN with different dopants. It is shown that the VN is not bound to substitutional Cd impurities suggesting that the In-VN complex formation is a particularity of In in GaN and AlN. Finally, a preliminary model is presented to explain the temperature behavior of the electric field gradient, observed in the In-VN complex measured with $^{111}$In.

  14. Pärt: Fratres / Robert Cowan

    Index Scriptorium Estoniae

    Cowan, Robert

    1995-01-01

    Uuest heliplaadist "Pärt: Fratres (seven versions). Festina Lente. Cantus in Memory of Benjamin Britten. Summa. Peter Manning (vn.), France Springuel (vc.), Mireille Gleizes (pf.), I Fiamminghi. Telare CD CD80387 (79 minutes)

  15. Clinical and microbiological characteristics of cryptococcosis in Singapore: predominance of Cryptococcus neoformans compared with Cryptococcus gattii

    Directory of Open Access Journals (Sweden)

    Monica Chan

    2014-09-01

    Conclusion: C. neoformans var. grubii, subtype VN I, was the predominant subtype in Singapore, infecting younger, mainly immunocompromised hosts with HIV. C. gattii was uncommon, causing pulmonary manifestations in older, immunocompetent patients and were RFLP type VG II.

  16. NCBI nr-aa BLAST: CBRC-RNOR-04-0246 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0246 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-125 75% ...

  17. NCBI nr-aa BLAST: CBRC-CPOR-01-1266 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1266 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 6e-64 44% ...

  18. NCBI nr-aa BLAST: CBRC-RNOR-04-0249 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0249 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-134 76% ...

  19. NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0238 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-133 80% ...

  20. NCBI nr-aa BLAST: CBRC-RNOR-04-0255 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0255 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-120 74% ...

  1. NCBI nr-aa BLAST: CBRC-RNOR-04-0243 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0243 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...

  2. NCBI nr-aa BLAST: CBRC-RNOR-04-0244 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0244 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-175 100% ...

  3. NCBI nr-aa BLAST: CBRC-OCUN-01-0923 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0923 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 8e-74 48% ...

  4. NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0259 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-126 74% ...

  5. NCBI nr-aa BLAST: CBRC-RNOR-04-0240 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0240 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...

  6. Voice parameters and videonasolaryngoscopy in children with vocal nodules: a longitudinal study, before and after voice therapy.

    Science.gov (United States)

    Valadez, Victor; Ysunza, Antonio; Ocharan-Hernandez, Esther; Garrido-Bustamante, Norma; Sanchez-Valerio, Araceli; Pamplona, Ma C

    2012-09-01

    Vocal Nodules (VN) are a functional voice disorder associated with voice misuse and abuse in children. There are few reports addressing vocal parameters in children with VN, especially after a period of vocal rehabilitation. The purpose of this study is to describe measurements of vocal parameters including Fundamental Frequency (FF), Shimmer (S), and Jitter (J), videonasolaryngoscopy examination and clinical perceptual assessment, before and after voice therapy in children with VN. Voice therapy was provided using visual support through Speech-Viewer software. Twenty patients with VN were studied. An acoustical analysis of voice was performed and compared with data from subjects from a control group matched by age and gender. Also, clinical perceptual assessment of voice and videonasolaryngoscopy were performed to all patients with VN. After a period of voice therapy, provided with visual support using Speech Viewer-III (SV-III-IBM) software, new acoustical analyses, perceptual assessments and videonasolaryngoscopies were performed. Before the onset of voice therapy, there was a significant difference (ptherapy period, a significant improvement (pvocal nodules were no longer discernible on the vocal folds in any of the cases. SV-III software seems to be a safe and reliable method for providing voice therapy in children with VN. Acoustic voice parameters, perceptual data and videonasolaryngoscopy were significantly improved after the speech therapy period was completed. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  7. Effect of the Interaction of Veratrum Nigrum with Panax Ginseng on Estrogenic Activity In Vivo and In Vitro

    Science.gov (United States)

    Xu, Ying; Ding, Jie; An, Jin-na; Qu, Ya-kun; Li, Xin; Ma, Xiao-ping; Zhang, Yi-min; Dai, Guo-jing; Lin, Na

    2016-01-01

    Panax ginseng (GS) and Veratrum nigrum (VN) are representative of incompatible pairs in “eighteen antagonistic medicaments” that have been recorded in the Chinese medicinal literature for over 2,000 years. However, evidence linking interference effects with combination use is scare. Based on the estrogen-like effect of GS described in our previous studies, we undertake a characterization of the interaction on estrogenic activity of GS and VN using in vivo models of immature and ovariectomized (OVX) mice and in vitro studies with MCF-7 cells for further mechanism. VN decreased the estrogenic efficacy of GS on promoting the development of the uterus and vagina in immature mice, and reversing the atrophy of reproductive tissues in OVX mice. VN interfered with the estrogenic efficacy of GS by decreasing the increase of the serum estradiol and the up-regulation of ERα and ERβ expressions by treatment with GS. And VN antagonized the estrogenic efficacy of GS on promoting the viability of MCF-7 cells and up-regulation of protein and gene expressions of ERs. In conclusion, this study provided evidence that GS and VN decreased effects on estrogenic activity, which might be related to regulation of estrogen secretion and ERs. PMID:27229740

  8. Measurement of the azimuthal anisotropy of charged particle production in Xe+Xe collisions at $\\sqrt{s_{\\mathrm{NN}}}$=5.44~TeV with the ATLAS detector

    CERN Document Server

    The ATLAS collaboration

    2018-01-01

    This note describes the measurement of flow harmonics $v_2$--$v_5$ in Xe+Xe collisions at $\\sqrt{s_{\\mathrm{NN}}}$=5.44~TeV performed using the ATLAS detector at the LHC. The measurements are performed using multi-particle correlations involving 2, 4 and 6 particles and the Scalar Product technique. Measurements of the centrality and $p_{\\mathrm{T}}$ dependence of the $v_n$ are presented. Comparisons of the measured $v_n$ to previous measurements for Pb+Pb collisions at $\\sqrt{s_{\\mathrm{NN}}}$=5.02~TeV are also presented. The Xe+Xe $v_n$ are observed to be larger than the Pb+Pb $v_n$ for $n$=2,3 and $4$ in the most central events, but with decreasing centrality or increasing harmonic order $n$, the Xe+Xe $v_n$ become smaller than the Pb+Pb $v_n$. The Xe+Xe and Pb+Pb comparisons are also shown as a function of the mean number of participants $\\langle N_\\text{part} \\rangle$, and the 4-particle cumulants for higher-order harmonics -- $v_3\\{4\\}$ and $v_4\\{4\\}$ -- are found to scale better with $\\langle N_\\text{p...

  9. Změny v tkáni ledviny u traumat nižších stupňů – anatomické hodnocení cévních změn a histologické hodnocení kůry a dřeně v experimentálním traumatu ledvin prasete domácího

    Czech Academy of Sciences Publication Activity Database

    Grill, R.; Záťura, F.; Tonar, Z.; Bača, V.; Kachlík, D.; Janáček, Jiří; Nedorost, L.

    2006-01-01

    Roč. 2, č. 2 (2006), s. 109-111 ISSN 1336-7579 R&D Projects: GA AV ČR(CZ) IAA100110502 Institutional research plan: CEZ:AV0Z50110509 Keywords : kidney * microcracks * stereology Subject RIV: FP - Other Medical Disciplines

  10. K některým právním aspektům vyslání příslušníků jednotky speciálních sil Armády České republiky na území Afghánistánu v rámci operace Trvalá svoboda

    Czech Academy of Sciences Publication Activity Database

    Popenková, Monika

    2006-01-01

    Roč. 145, č. 11 (2006), s. 1302-1317 ISSN 0231-6625 R&D Projects: GA AV ČR KJB700680601 Institutional research plan: CEZ:AV0Z70680506 Keywords : Army of the Czech Republic * Afghanistan Subject RIV: AG - Legal Sciences

  11. Subjektivně vnímaná kvalita života dospívajících a mladých dospělých po léčbě dětského onkologického onemocnění v dlouhodobé perspektivě: předběžné výsledky longitudinální studie QOLOP

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Jelínek, Martin; Kepák, T.

    2016-01-01

    Roč. 60, č. 1 (2016), s. 82-87 ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/11/2421 Institutional support: RVO:68081740 Keywords : childhood cancer survivors * quality of life * longitudinal study Subject RIV: AN - Psychology Impact factor: 0.242, year: 2016

  12. Oxidation of nitride films in aqueous solution: Correlation between surface analysis and electrochemical studies

    International Nuclear Information System (INIS)

    Brown, R.; Alias, M.N.

    1994-01-01

    Ac impedance and dc polarization tests of 304 stainless steels coated by cathodic arc plasma deposition (CAPD) titanium nitride and zirconium nitride were conducted in aqueous chloride solution. Cyclic polarization data suggested passive films were formed over the nitride coatings which are most likely hydrated titanium oxide and zirconium oxides. ESCA analysis of fresh samples and samples exposed during impedance tests indicated a layer rich in oxygen over the ZrN coating after exposure but not over TiN coating. Chemical shifts in the Zr 3d 5/2 core electrons indicate transformation from ZrN to its oxide; the shifts in Ti 2P 3/2 did not support the change from TiN to its oxide. The influence of these shifts on corrosion protection is documented

  13. Synthesizing (ZrAl3 + AlN)/Mg-Al composites by a 'matrix exchange' method

    Science.gov (United States)

    Gao, Tong; Li, Zengqiang; Hu, Kaiqi; Han, Mengxia; Liu, Xiangfa

    2018-06-01

    A method named 'matrix exchange' to synthesize ZrAl3 and AlN reinforced Mg-Al composite was developed in this paper. By inserting Al-10ZrN master alloy into Mg matrix and reheating the cooled ingot to 550 °C, Al and Mg atoms diffuse to the opposite side. As a result, liquid melt occurs once the interface areas reach to proper compositions. Then dissolved Al atoms react with ZrN, leading to the in-situ formation of ZrAl3 and AlN particles, while the Al matrix is finally replaced by Mg. This study provides a new insight for preparing Mg composites.

  14. Characterization of hard nitride and carbide titanium and zirconium coatings on high-speed steel cutting tool inserts

    International Nuclear Information System (INIS)

    Fenske, G.; Kaufherr, N.; Albertson, C.; Mapalo, G.; Nielsen, R.; Kaminsky, M.

    1986-01-01

    Hard nitride and carbide coatings of titanium and zirconium deposited by reactive evaporation and reactive sputtering techniques were characterized by electron microscopy and Auger spectroscopy to determine the effect of coating process on coating composition and microstructure. Analysis of the chemical composition by Auger spectroscopy revealed the coatings were of high purity with slight differences in stoichiometry depending on the coating technique. Both techniques produced coatings with a columnar microstructure. However, the reactive sputtering technique produced coarser (shorter and wider) columnar grains than the reactive evaporation technique. Furthermore, selected area diffraction analysis of reactively sputtered ZrN coatings showed a two-phased zone (hcp Zr and fcc ZrN) near the substrate/coating interface, while TiC coatings deposited by reactive sputtering and evaporation only showed a single-phase region of fcc TiC

  15. Deposition and characterization of ZrMoN thin films by reactive magnetron sputtering

    International Nuclear Information System (INIS)

    Fontes Junir, A.S.; Felix, L.C.; Oliveira, G.B. de; Fernandez, D.R.; Carvalho, R.G.; Tentardini, E.K.; Silva Junior, A.H. da

    2016-01-01

    Thin films of ZrMoN were deposited by magnetron reactive sputtering technique in order to study the molybdenum influence on the mechanical properties and oxidation resistance of these coatings. Three thin films with molybdenum concentrations from 25 to 40 at.% were selected. The displacement of characteristic peaks of ZrN where identified by GIXRD results of films with larger Mo content. This result is indicative of the Mo accommodation in the lattice structure. Hardness tests revealed favorable results with values up to 33 GPa. Oxidation tests showed that ZrN oxidized at 500 °C with a monoclinic ZrO 2 and tetragonal formation; whereas the thin films with Mo addition impeded the formation of the monoclinic ZrO 2 phase at partial oxidation. (author)

  16. Influence of N{sub 2} partial pressure on structural and microhardness properties of TiN/ZrN multilayers deposited by Ar/N{sub 2} vacuum arc discharge

    Energy Technology Data Exchange (ETDEWEB)

    Naddaf, M., E-mail: ascientific24@aec.org.sy [Department of Molecular Biology and Biotechnology, Atomic Energy Commission of Syria (AECS), P.O. Box 6091, Damascus (Syrian Arab Republic); Abdallah, B. [Department of Physics, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Ahmad, M. [IBA Laboratory, Department of Chemistry, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); A-Kharroub, M. [Department of Physics, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic)

    2016-08-15

    The influence of N{sub 2} partial pressure on structural, mechanical and wetting properties of multilayered TiN/ZrN thin films deposited on silicon substrates by vacuum arc discharge of (N{sub 2} + Ar) gas mixtures is investigated. X-ray diffraction (XRD) results show that the average texturing coefficient of (1 1 1) orientation and the grain size of both TiN and ZrN individual layers increase with increasing the N{sub 2} partial pressure. The Rutherford back scattering (RBS) measurements and analysis reveal that incorporation of the nitrogen in the film increases with increasing the N{sub 2} partial pressure and both TiN and ZrN individual layers have a nitrogen over-stoichiometry for N{sub 2} partial pressure ⩾50%. The change in the film micro-hardness is correlated to the changes in crystallographic texture, grain size, stoichiometry and the residual stress in the film as a function of the N{sub 2} partial pressure. In particular, stoichiometry of ZrN and TiN individual is found to play the vital role in determining the multilayer hardness. The multilayer film deposited at N{sub 2} partial pressure of 25% has the best stoichiometric ratio of both TiN and ZrN layers and the highest micro-hardness of about 32 GPa. In addition, water contact angle (WCA) measurements and analysis show a decrease in the work of adhesion on increasing the N{sub 2} partial pressure.

  17. Powder-XRD and (14) N magic angle-spinning solid-state NMR spectroscopy of some metal nitrides.

    Science.gov (United States)

    Kempgens, Pierre; Britton, Jonathan

    2016-05-01

    Some metal nitrides (TiN, ZrN, InN, GaN, Ca3 N2 , Mg3 N2 , and Ge3 N4 ) have been studied by powder X-ray diffraction (XRD) and (14) N magic angle-spinning (MAS) solid-state NMR spectroscopy. For Ca3 N2 , Mg3 N2 , and Ge3 N4 , no (14) N NMR signal was observed. Low speed (νr  = 2 kHz for TiN, ZrN, and GaN; νr  = 1 kHz for InN) and 'high speed' (νr  = 15 kHz for TiN; νr  = 5 kHz for ZrN; νr  = 10 kHz for InN and GaN) MAS NMR experiments were performed. For TiN, ZrN, InN, and GaN, powder-XRD was used to identify the phases present in each sample. The number of peaks observed for each sample in their (14) N MAS solid-state NMR spectrum matches perfectly well with the number of nitrogen-containing phases identified by powder-XRD. The (14) N MAS solid-state NMR spectra are symmetric and dominated by the quadrupolar interaction. The envelopes of the spinning sidebands manifold are Lorentzian, and it is concluded that there is a distribution of the quadrupolar coupling constants Qcc 's arising from structural defects in the compounds studied. Copyright © 2015 John Wiley & Sons, Ltd.

  18. The effect of helium irradiation on the thermal evolution of the microstructure of nc-ZrN

    International Nuclear Information System (INIS)

    Van Vuuren, Arno Janse; Sohatsky, Alexander; Skuratov, Vladimir; Uglov, Vladimir; Volkov, Alexey

    2016-01-01

    ZrN is a candidate material for use as inert matrix fuel host for the burn-up of plutonium and other minor actinides, waste products commonly present in spent nuclear fuel. These materials will operate within the nuclear reactor core and will therefore be subject to various types of radiation, high temperatures and a corrosive environment. Ceramics employed in the nuclear reactor environment will accumulate helium via (n, α) reactions. Nanocrystalline ZrN irradiated with 30 keV He to fluences between 10 16 and 5 x 10 16 cm -2 to simulate the effects of alpha particle irradiation. The He irradiated sam- ples were annealed at temperatures between 600 and 1000 C and were analysed using TEM and selected area diffraction. The results indicated that post irradiation heat treatment induces exfoliation at a depth that corresponds to the end-of-range of 30 keV He ions. TEM analysis of He suggests that nanocrystalline ZrN is prone to the formation of He blisters which may ultimately lead material failure. The results also suggest that the doping of nc-ZrN with He aids the transformation from a nanocrystalline to microcrystalline state during heat treatment. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  19. The effect of helium irradiation on the thermal evolution of the microstructure of nc-ZrN

    Energy Technology Data Exchange (ETDEWEB)

    Van Vuuren, Arno Janse [Centre for HRTEM, Nelson Mandela Metropolitan University, Port Elizabeth (South Africa); Sohatsky, Alexander; Skuratov, Vladimir [Flerov Laboratory for Nuclear Reaction, Joint Institute for Nuclear Research, Dubna (Russian Federation); Uglov, Vladimir [Physics Department, Belarusian State University, Minsk (Belarus); Volkov, Alexey [Nazarbayev University, Astana (Kazakhstan)

    2016-12-15

    ZrN is a candidate material for use as inert matrix fuel host for the burn-up of plutonium and other minor actinides, waste products commonly present in spent nuclear fuel. These materials will operate within the nuclear reactor core and will therefore be subject to various types of radiation, high temperatures and a corrosive environment. Ceramics employed in the nuclear reactor environment will accumulate helium via (n, α) reactions. Nanocrystalline ZrN irradiated with 30 keV He to fluences between 10{sup 16} and 5 x 10{sup 16} cm{sup -2}to simulate the effects of alpha particle irradiation. The He irradiated sam- ples were annealed at temperatures between 600 and 1000 C and were analysed using TEM and selected area diffraction. The results indicated that post irradiation heat treatment induces exfoliation at a depth that corresponds to the end-of-range of 30 keV He ions. TEM analysis of He suggests that nanocrystalline ZrN is prone to the formation of He blisters which may ultimately lead material failure. The results also suggest that the doping of nc-ZrN with He aids the transformation from a nanocrystalline to microcrystalline state during heat treatment. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. Crystallization of AlON layers and its effects on the microstructure and hardness of reactively synthesized ZrN/AlON nanomultilayers

    Energy Technology Data Exchange (ETDEWEB)

    Dong Yunshan; Yue Jianling; Liu Yan; Li Geyang [State Key Lab of Metal Matrix Composites, Shanghai Jiao Tong University, Shanghai, 200030 (China)

    2006-11-21

    By reactively sputtering Zr and Al{sub 2}O{sub 3} targets in a gaseous mixture of Ar and N{sub 2}, ZrN/AlON nanomultilayers were synthesized to study the crystallization conditions for AlON layers and how they influence the characteristics of multilayers. The composition analysis indicated that some of the oxygen atoms were replaced by nitrogen atoms in Al{sub 2}O{sub 3}, leading to the formation of aluminium oxynitride, AlON, during the procedure of the Al{sub 2}O{sub 3} target being sputtered in the gaseous mixture. Further investigations showed that when their thickness was limited to less than 1 nm, amorphous AlON layers were crystallized under the template effects of crystalline ZrN layers, and then coherent interfaces formed as a result. Correspondingly, the multilayers were remarkably strengthened with hardness approaching a maximum of 33 GPa. After the layer thickness of AlON exceeded the critical value of 1 nm, the subsequently deposited AlON grew amorphously and blocked the epitaxial growth of multilayers, accompanied by the decline of hardness. Yet, on the other hand, the integrated hardness of multilayers was not sensitive to the thickness of the ZrN template layers and its value was maintained a bit higher than 30 GPa in a wide range of ZrN layer thickness variations.

  1. Structural and mechanical properties of ZrSiN thin films prepared by reactive magnetron sputtering

    International Nuclear Information System (INIS)

    Freitas, F.G.R.; Conceicao, A.G.S.; Vitoria, E.R.; Carvalho, R.G.; Tentardini, E.K.; Hübler, R.; Soares, G.

    2014-01-01

    Zirconium silicon nitride (ZrSiN) thin films were deposited by reactive magnetron sputtering in order to verify the silicon influence on coating morphology and mechanical properties. The Si/(Zr+Si) ratio was adjusted between 0 to 14.5% just modifying the power applied on the silicon target. Only peaks associated to ZrN crystalline structure were observed in XRD analysis, since Si_3N_4 phase was amorphous. All samples have (111) preferred orientation, but there is a peak intensity reduction and a broadening increase for the sample with the highest Si/(Zr+Si) ratio (14.5%), demonstrating a considerable loss of crystallinity or grain size reduction (about 8 nm calculated by Scherrer). It was also observed that the texture coefficient for (200) increases with silicon addition. Chemical composition and thickness of the coatings were determined by RBS analysis. No significant changes in nano hardness with increasing Si content were found. The thin film morphology observed by SEM presents columnar and non columnar characteristics. The set of results suggests that Si addition is restricting the columnar growth of ZrN thin films. This conclusion is justified by the fact that Si contributes to increase the ZrN grains nucleation during the sputtering process. (author)

  2. Neurogenesis in the vomeronasal epithelium of adult garter snakes: 3. Use of 3H-thymidine autoradiography to trace the genesis and migration of bipolar neurons

    International Nuclear Information System (INIS)

    Wang, R.T.; Halpern, M.

    1988-01-01

    Use of 3H-thymidine autoradiography and unilateral vomeronasal (VN) axotomy has permitted us to demonstrate directly the existence of VN stem cells in the adult garter snake and to trace continuous bipolar neuron development and migration in the normal VN and deafferentated VN epithelium in the same animal. The vomeronasal epithelium and olfactory epithelium of adult garter snakes are both capable of incorporating 3H-thymidine. In the sensory epithelium of the vomeronasal organ, 3H-thymidine-labeled cells were initially restricted to the base of the undifferentiated cell layer in animals surviving 1 day following 3H-thymidine injection. With increasing survival time, labeled cells progressively migrated vertically within the receptor cell column toward the apex of the bipolar neuron layer. In both the normal and denervated VN epithelium, labeled cells were observed through the 56 days of postoperative survival. In the normal epithelium, labeled cells were always located within the matrix of the intact receptor cell columns. However, labeled cells of the denervated epithelium were always located at the apical front of the newly formed cell mass following depletion of the original neuronal cell population. In addition, at postoperative days 28 and 56, labeled cells of the denervated VN epithelium achieved neuronal differentiation and maturation by migrating much farther away from the base of the receptor cell column than the labeled cells on the normal, unoperated contralateral side. This study directly demonstrates that basal cells initially incorporating 3H-thymidine are indeed stem cells of the VN epithelium in adult garter snakes

  3. Neurovirulence of H5N1 infection in ferrets is mediated by multifocal replication in distinct permissive neuronal cell regions.

    Directory of Open Access Journals (Sweden)

    Jennifer R Plourde

    Full Text Available Highly pathogenic avian influenza A (HPAI, subtype H5N1, remains an emergent threat to the human population. While respiratory disease is a hallmark of influenza infection, H5N1 has a high incidence of neurological sequelae in many animal species and sporadically in humans. We elucidate the temporal/spatial infection of H5N1 in the brain of ferrets following a low dose, intranasal infection of two HPAI strains of varying neurovirulence and lethality. A/Vietnam/1203/2004 (VN1203 induced mortality in 100% of infected ferrets while A/Hong Kong/483/1997 (HK483 induced lethality in only 20% of ferrets, with death occurring significantly later following infection. Neurological signs were prominent in VN1203 infection, but not HK483, with seizures observed three days post challenge and torticollis or paresis at later time points. VN1203 and HK483 replication kinetics were similar in primary differentiated ferret nasal turbinate cells, and similar viral titers were measured in the nasal turbinates of infected ferrets. Pulmonary viral titers were not different between strains and pathological findings in the lungs were similar in severity. VN1203 replicated to high titers in the olfactory bulb, cerebral cortex, and brain stem; whereas HK483 was not recovered in these tissues. VN1203 was identified adjacent to and within the olfactory nerve tract, and multifocal infection was observed throughout the frontal cortex and cerebrum. VN1203 was also detected throughout the cerebellum, specifically in Purkinje cells and regions that coordinate voluntary movements. These findings suggest the increased lethality of VN1203 in ferrets is due to increased replication in brain regions important in higher order function and explains the neurological signs observed during H5N1 neurovirulence.

  4. Communication of nuclear data progress

    International Nuclear Information System (INIS)

    2001-01-01

    This is the 26th issue of Communication of Nuclear Data Progress (CNDP), in which the progress and achievements in nuclear data field from the last year up to now in China are carried. It includes the measurements of 71 Ga, 94 Zn, 191 Ir, 174 Hf(n, γ) and 114 Cd(n, 2n) cross sections, fission product yields of n + 235,238 U, DPA cross section calculated with UNF code, fission barrier parameter evaluation of some nuclides, production and transmission of covariance in the evaluation processing of fission yield data and transition analysis of Ne-like Ge XXIII

  5. On the effect of brazing thermal cycle on the properties of niobium and its alloys

    International Nuclear Information System (INIS)

    Grishin, V.L.; Cherkasov, A.F.

    1975-01-01

    The effect of the main parameters of the soldering thermal cycle on the properties of Nb and its alloys was studied by heating the samples under modelled conditions of soldering. The studies were made on commercial VN-niobium, alloys of the Nb-Mo-Zr system VN2A, VN2AEHM) and alloys of the Nb-Mo-Zr-C system (VN5AEH,VN5A). The degree of a preliminary plastic deformation of samples 0.3 to 0.8 mm thick made up 60 to 80%. The heating was made in vacuum (10 -4 to 5x10 -5 mm Hg) or in argon by passing the electric current across the samples. After heating a metallographic study and X-ray electron-probe analysis were made. The studies have shown that the changes in the heating rate result in a proportional change in the recrystallization initiation temperature. At a heating rate 300 deg C/s the recrystallization initiation temperature of commercial Nb is 930 to 960 deg as soon as the heating rate increases up to 900 deg/c the recrystallization initiation temperature rises up to about 1200 deg C. The heating temperature effect on the mechanical characteristics of commercial Nb and alloys VN2, VN2AEH and VN5AEH is shown. It is found that soldered joints of Nb and its alloys could be made of good quality when observing the thermal cycles ensuring the minimum softening of the base material. The main factors affecting the properties of Nb and alloy-VN2 are the heating temperature and the extent of a preliminary cold deformation. In a more deformed material the annealing results in the activation of the recrystallization processes. The production of high-strength soldered joints of commercial Nb is possible at the soldering temperature equal to 1100 deg C, but of Nb-Mo-Zr alloys-at 1200 to 1300 deg C and hold-up periods not exceeding one hour. A heterophase structure of alloys of the Nb-Mo-Zr-C system and the presence of Mo- and Zr-carbide phases in them result in a considerable hardening of the alloys and the increase in their recrystallization temperature. The usage of alloys

  6. Gibbs Measures Over Locally Tree-Like Graphs and Percolative Entropy Over Infinite Regular Trees

    Science.gov (United States)

    Austin, Tim; Podder, Moumanti

    2018-03-01

    Consider a statistical physical model on the d-regular infinite tree Td described by a set of interactions Φ . Let Gn be a sequence of finite graphs with vertex sets V_n that locally converge to Td. From Φ one can construct a sequence of corresponding models on the graphs G_n. Let μ_n be the resulting Gibbs measures. Here we assume that μ n converges to some limiting Gibbs measure μ on Td in the local weak^* sense, and study the consequences of this convergence for the specific entropies |V_n|^{-1}H(μ _n). We show that the limit supremum of |V_n|^{-1}H(μ _n) is bounded above by the percolative entropy H_{it{perc}}(μ ), a function of μ itself, and that |V_n|^{-1}H(μ _n) actually converges to H_{it{perc}}(μ ) in case Φ exhibits strong spatial mixing on T_d. When it is known to exist, the limit of |V_n|^{-1}H(μ _n) is most commonly shown to be given by the Bethe ansatz. Percolative entropy gives a different formula, and we do not know how to connect it to the Bethe ansatz directly. We discuss a few examples of well-known models for which the latter result holds in the high temperature regime.

  7. Large electron capture-cross-section of the major nonradiative recombination centers in Mg-doped GaN epilayers grown on a GaN substrate

    Science.gov (United States)

    Chichibu, S. F.; Shima, K.; Kojima, K.; Takashima, S.; Edo, M.; Ueno, K.; Ishibashi, S.; Uedono, A.

    2018-05-01

    Complementary time-resolved photoluminescence and positron annihilation measurements were carried out at room temperature on Mg-doped p-type GaN homoepitaxial films for identifying the origin and estimating the electron capture-cross-section ( σ n ) of the major nonradiative recombination centers (NRCs). To eliminate any influence by threading dislocations, free-standing GaN substrates were used. In Mg-doped p-type GaN, defect complexes composed of a Ga-vacancy (VGa) and multiple N-vacancies (VNs), namely, VGa(VN)2 [or even VGa(VN)3], are identified as the major intrinsic NRCs. Different from the case of 4H-SiC, atomic structures of intrinsic NRCs in p-type and n-type GaN are different: VGaVN divacancies are the major NRCs in n-type GaN. The σ n value approximately the middle of 10-13 cm2 is obtained for VGa(VN)n, which is larger than the hole capture-cross-section (σp = 7 × 10-14 cm2) of VGaVN in n-type GaN. Combined with larger thermal velocity of an electron, minority carrier lifetime in Mg-doped GaN becomes much shorter than that of n-type GaN.

  8. Boron effect on the microstructure of 9% Cr ferritic–martensitic steels

    International Nuclear Information System (INIS)

    Klimenkov, M.; Materna-Morris, E.; Möslang, A.

    2015-01-01

    Highlights: • Detailed TEM characterization of BN, M 23 C 6 , VN and TaC precipitates in B-alloyed EUROFER97. • Determination of B content influence on density and composition of M 23 C 6 and MX precipitates and herewith on microstructure. • α-Al 2 O 3 –BN–TaC–VN precipitation sequence of different phases during cooling was proposed. • Decreasing of thermal stability of microstructure with boron content was measured. - Abstract: The microstructure of reduces-activation 9Cr–WTaV steel alloyed with 83 and 1160 wt. ppm 10 B was detailed analysed using transmission electron microscopy. The influence of boron content on the precipitation behaviour of M 23 C 6 and MX (VN and TaC) phases and, hence, on the formation process of steel’s grain and lath structure was studied. VN precipitates, which play an important role in the stabilisation of the lath structure, exhibit most sensitive reaction on presence of boron. Their spatial density significantly reduces in the alloy with 83 ppm boron. In the steel with 1160 wt. ppm boron, no formation of VN was detected, whereas TaC particles precipitate at the lath and grain boundaries. These changes in the structure stabilisation mechanism lead to an increasing lath width and a decreasing thermal stability of laths and grains. Analytical investigations of several BN particles reveal their complex multi-phase structure and allow conclusions to be drawn with respect to their precipitation sequence

  9. MERS-CoV and H5N1 influenza virus antagonize antigen presentation by altering the epigenetic landscape

    Energy Technology Data Exchange (ETDEWEB)

    Menachery, Vineet D.; Schafer, Alexandra; Burnum-Johnson, Kristin E.; Mitchell, Hugh D.; Eisfeld-Fenney, Amie J.; Walters, Kevin B.; Nicora, Carrie D.; Purvine, Samuel O.; Casey, Cameron P.; Monroe, Matthew E.; Weitz, Karl K.; Stratton, Kelly G.; Webb-Robertson, Bobbie-Jo M.; Gralinski, Lisa; Metz, Thomas O.; Smith, Richard D.; Waters, Katrina M.; Sims, Amy C.; Kawaoka, Yoshihiro; Baric, Ralph

    2018-01-16

    Convergent evolution dictates that diverse groups of viruses will target both similar and distinct host pathways in order to manipulate the immune response and improve infection. In this study, we sought to leverage this uneven viral antagonism to identify critical host factors that govern disease outcome. Utilizing a systems based approach, we examined differential regulation of IFNγ dependent genes following infection with highly pathogenic viruses including influenza (H5N1-VN1203, H1N1-CA04) and coronaviruses (SARS-CoV, MERS-CoV). Categorizing by function, we observed down regulation of genes associated with antigen presentation following both H5N1-VN1203 and MERS-CoV infection. Further examination revealed global down regulation of antigen presentation genes and was confirmed by proteomics for both H5N1-VN1203 and MERS-CoV infection. Importantly, epigenetic analysis suggested that DNA methylation rather than histone modification plays a crucial role in MERS-CoV mediated antagonism of antigen presentation genes; in contrast, H5N1-VN1203 likely utilizes a combination of epigenetic mechanisms to target antigen presentation. Together, the results indicate a common approach utilized by H5N1-VN1203 and MERS-CoV to modulate antigen presentation and the host adaptive immune response.

  10. Porous-Shell Vanadium Nitride Nanobubbles with Ultrahigh Areal Sulfur Loading for High-Capacity and Long-Life Lithium-Sulfur Batteries.

    Science.gov (United States)

    Ma, Lianbo; Yuan, Hao; Zhang, Wenjun; Zhu, Guoyin; Wang, Yanrong; Hu, Yi; Zhao, Peiyang; Chen, Renpeng; Chen, Tao; Liu, Jie; Hu, Zheng; Jin, Zhong

    2017-12-13

    Lithium-sulfur (Li-S) batteries hold great promise for the applications of high energy density storage. However, the performances of Li-S batteries are restricted by the low electrical conductivity of sulfur and shuttle effect of intermediate polysulfides. Moreover, the areal loading weights of sulfur in previous studies are usually low (around 1-3 mg cm -2 ) and thus cannot fulfill the requirement for practical deployment. Herein, we report that porous-shell vanadium nitride nanobubbles (VN-NBs) can serve as an efficient sulfur host in Li-S batteries, exhibiting remarkable electrochemical performances even with ultrahigh areal sulfur loading weights (5.4-6.8 mg cm -2 ). The large inner space of VN-NBs can afford a high sulfur content and accommodate the volume expansion, and the high electrical conductivity of VN-NBs ensures the effective utilization and fast redox kinetics of polysulfides. Moreover, VN-NBs present strong chemical affinity/adsorption with polysulfides and thus can efficiently suppress the shuttle effect via both capillary confinement and chemical binding, and promote the fast conversion of polysulfides. Benefiting from the above merits, the Li-S batteries based on sulfur-filled VN-NBs cathodes with 5.4 mg cm -2 sulfur exhibit impressively high areal/specific capacity (5.81 mAh cm -2 ), superior rate capability (632 mAh g -1 at 5.0 C), and long cycling stability.

  11. Mesoporous coaxial titanium nitride-vanadium nitride fibers of core-shell structures for high-performance supercapacitors.

    Science.gov (United States)

    Zhou, Xinhong; Shang, Chaoqun; Gu, Lin; Dong, Shanmu; Chen, Xiao; Han, Pengxian; Li, Lanfeng; Yao, Jianhua; Liu, Zhihong; Xu, Hongxia; Zhu, Yuwei; Cui, Guanglei

    2011-08-01

    In this study, titanium nitride-vanadium nitride fibers of core-shell structures were prepared by the coaxial electrospinning, and subsequently annealed in the ammonia for supercapacitor applications. These core-shell (TiN-VN) fibers incorporated mesoporous structure into high electronic conducting transition nitride hybrids, which combined higher specific capacitance of VN and better rate capability of TiN. These hybrids exhibited higher specific capacitance (2 mV s(-1), 247.5 F g(-1)) and better rate capability (50 mV s(-1), 160.8 F g(-1)), which promise a good candidate for high-performance supercapacitors. It was also revealed by electrochemical impedance spectroscopy (EIS) and X-ray photoelectron spectroscopy (XPS) characterization that the minor capacitance fade originated from the surface oxidation of VN and TiN.

  12. NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0135 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-139 80% ...

  13. NCBI nr-aa BLAST: CBRC-STRI-01-2305 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2305 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 8e-64 55% ...

  14. NCBI nr-aa BLAST: CBRC-MMUS-06-0136 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0136 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-175 100% ...

  15. Exploring electrolyte preference of vanadium nitride supercapacitor electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Bo; Chen, Zhaohui; Lu, Gang [Department of Electrical Engineering and Automation, Luoyang Institute of Science and Technology, Luoyang 471023 (China); Wang, Tianhu [School of Electrical Information and Engineering, Jiangsu University of Technology, Changzhou 213001 (China); Ge, Yunwang, E-mail: ywgelit@126.com [Department of Electrical Engineering and Automation, Luoyang Institute of Science and Technology, Luoyang 471023 (China)

    2016-04-15

    Highlights: • Hierarchical VN nanostructures were prepared on graphite foam. • Electrolyte preference of VN supercapacitor electrodes was explored. • VN showed better capacitive property in organic and alkaline electrolytes than LiCl. - Abstract: Vanadium nitride hierarchical nanostructures were prepared through an ammonia annealing procedure utilizing vanadium pentoxide nanostructures grown on graphite foam. The electrochemical properties of hierarchical vanadium nitride was tested in aqueous and organic electrolytes. As a result, the vanadium nitride showed better capacitive energy storage property in organic and alkaline electrolytes. This work provides insight into the charge storage process of vanadium nitride and our findings can shed light on other transition metal nitride-based electrochemical energy storage systems.

  16. NCBI nr-aa BLAST: CBRC-OCUN-01-0645 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0645 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 3e-46 53% ...

  17. NCBI nr-aa BLAST: CBRC-MMUS-06-0141 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0141 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-135 78% ...

  18. NCBI nr-aa BLAST: CBRC-STRI-01-1937 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1937 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 2e-25 41% ...

  19. Development and evaluation of a blocking enzyme-linked immunosorbent assay and virus neutralization assay to detect antibodies to viral hemorrhagic septicemia virus

    Science.gov (United States)

    Wilson, Anna; Goldberg, Tony; Marcquenski, Susan; Olson, Wendy; Goetz, Frederick; Hershberger, Paul; Hart, Lucas M.; Toohey-Kurth, Kathy

    2014-01-01

    Viral hemorrhagic septicemia virus (VHSV) is a target of surveillance by many state and federal agencies in the United States. Currently, the detection of VHSV relies on virus isolation, which is lethal to fish and indicates only the current infection status. A serological method is required to ascertain prior exposure. Here, we report two serologic tests for VHSV that are nonlethal, rapid, and species independent, a virus neutralization (VN) assay and a blocking enzyme-linked immunosorbent assay (ELISA). The results show that the VN assay had a specificity of 100% and sensitivity of 42.9%; the anti-nucleocapsid-blocking ELISA detected nonneutralizing VHSV antibodies at a specificity of 88.2% and a sensitivity of 96.4%. The VN assay and ELISA are valuable tools for assessing exposure to VHSV.

  20. Nitridation of vanadium by ion beam irradiation

    International Nuclear Information System (INIS)

    Kiuchi, Masato; Chayahara, Akiyoshi; Kinomura, Atsushi; Ensinger, Wolfgang

    1994-01-01

    The nitridation of vanadium by ion beam irradiation is studied by the ion implantation method and the dynamic mixing method. The nitrogen ion implantation was carried out into deposited V(110) films. Using both methods, three phases are formed, i.e. α-V, β-V 2 N, and δ-VN. Which phases are formed is related to the implantation dose or the arrival ratio. The orientation of the VN films produced by the dynamic ion beam mixing method is (100) and that of the VN films produced by the ion implantation method is (111). The nitridation of vanadium is also discussed in comparison with that of titanium and chromium. ((orig.))

  1. Comparison of cDNA-derived protein sequences of the human fibronectin and vitronectin receptor α-subunits and platelet glycoprotein IIb

    International Nuclear Information System (INIS)

    Fitzgerald, L.A.; Poncz, M.; Steiner, B.; Rall, S.C. Jr.; Bennett, J.S.; Phillips, D.R.

    1987-01-01

    The fibronectin receptor (FnR), the vitronectin receptor (VnR), and the platelet membrane glycoprotein (GP) IIb-IIIa complex are members of a family of cell adhesion receptors, which consist of noncovalently associated α- and β-subunits. The present study was designed to compare the cDNA-derived protein sequences of the α-subunits of human FnR, VnR, and platelet GP IIb. cDNA clones for the α-subunit of the FnR (FnR/sub α/) were obtained from a human umbilical vein endothelial (HUVE) cell library by using an oligonucleotide probe designed from a peptide sequence of platelet GP IIb. cDNA clones for platelet GP IIb were isolated from a cDNA expression library of human erythroleukemia cells by using antibodies. cDNA clones of the VnR α-subunit (VnR/sub α/) were obtained from the HUVE cell library by using an oligonucleotide probe from the partial cDNA sequence for the VnR/sub α/. Translation of these sequences showed that the FNR/sub α/, the VnR/sub α/, and GP IIb are composed of disulfide-linked large (858-871 amino acids) and small (137-158 amino acids) chains that are posttranslationally processed from a single mRNA. A single hydrophobic segment located near the carboxyl terminus of each small chain appears to be a transmembrane domain. The large chains appear to be entirely extracellular, and each contains four repeated putative Ca 2+ -binding domains of about 30 amino acids that have sequence similarities to other Ca 2+ -binding proteins. The identity among the protein sequences of the three receptor α-subunits ranges from 36.1% to 44.5%, with the Ca 2+ -binding domains having the greatest homology. These proteins apparently evolved by a process of gene duplication

  2. Volumetric Nephrogram Represents Renal Function and Complements Aortic Anatomic Severity Grade in Predicting EVAR Outcomes.

    Science.gov (United States)

    Balceniuk, Mark D; Trakimas, Lauren; Aghaie, Claudia; Mix, Doran; Rasheed, Khurram; Seaman, Matthew; Ellis, Jennifer; Glocker, Roan; Doyle, Adam; Stoner, Michael C

    2018-07-01

    Chronic kidney disease (CKD) is a predictor of poor outcomes for patients undergoing endovascular aortic aneurysm repair (EVAR). Anatomic severity grade (ASG) represents a quantitative mechanism for assessing anatomical suitability for endovascular aortic repair. Anatomic severity grade has been correlated with repair outcomes and resource utilization. The purpose of this study was to identify a novel renal perfusion metric as a way to assist ASG with predicting EVAR outcomes. Retrospective review of a prospectively maintained database identified elective infrarenal aortic aneurysm repair cases. Anatomic grading was undertaken by independent reviewers. Using volumetric software, kidney volume, and a novel measure of kidney functional volume, the volumetric nephrogram (VN) was recorded. Systematic evaluation of the relationship of kidney volume and VN to CKD and ASG was undertaken using linear regression and receiver-operator statistical tools. A total of 386 cases with patient and anatomic data were identified and graded. Mean age was 72.9 ± 0.4 years. Renal volume renal volume (AUC = .628; P ≤ .0001) and VN (AUC = .628; P ≤ .0001). Regression analysis demonstrated a strong, inverse relationship between ASG and VN ( R 2 = .95). These data demonstrate that VN is a strong predictor of CKD in a large database of patients undergoing elective aneurysm repair. We demonstrate an inverse relationship between renal function and ASG that has not been previously described in the literature. Additionally, we have shown that VN complements ASG as a model of overall cardiovascular health and atherosclerotic burden. Outcomes in patients with poor renal function may be related to anatomical issues in addition to well-described systemic ramifications.

  3. Clinical assessment of diode laser-assisted endoscopic intrasphenoidal vidian neurectomy in the treatment of refractory rhinitis.

    Science.gov (United States)

    Lai, Wen-Sen; Cheng, Sheng-Yao; Lin, Yuan-Yung; Yang, Pei-Lin; Lin, Hung-Che; Cheng, Li-Hsiang; Yang, Jinn-Moon; Lee, Jih-Chin

    2017-12-01

    For chronic rhinitis that is refractory to medical therapy, surgical intervention such as endoscopic vidian neurectomy (VN) can be used to control the intractable symptoms. Lasers can contribute to minimizing the invasiveness of ENT surgery. The aim of this retrospective study is to compare in patients who underwent diode laser-assisted versus traditional VN in terms of operative time, surgical field, quality of life, and postoperative complications. All patients had refractory rhinitis with a poor treatment response to a 6-month trial of corticosteroid nasal sprays and underwent endoscopic VN between November 2006 and September 2015. They were non-randomly allocated into either a cold instrument group or a diode laser-assisted group. Vidian nerve was excised with a 940-nm continuous wave diode laser through a 600-μm silica optical fiber, utilizing a contact mode with the power set at 5 W. A visual analog scale (VAS) was used to grade the severity of the rhinitis symptoms for quality of life assessment before the surgery and 6 months after. Of the 118 patients enrolled in the study, 75 patients underwent cold instrument VN and 43 patients underwent diode laser-assisted VN. Patients in the laser-assisted group had a significantly lower surgical field score and a lower postoperative bleeding rate than those in the cold instrument group. Changes in the VAS were significant in preoperative and postoperative nasal symptoms in each group. The application of diode lasers for vidian nerve transection showed a better surgical field and a lower incidence of postoperative hemorrhage. Recent advancements in laser application and endoscopic technique has made VN safer and more effective. We recommend this surgical approach as a reliable and effective treatment for patients with refractory rhinitis.

  4. High-temperature ethanol production using thermotolerant yeast newly isolated from Greater Mekong Subregion

    Directory of Open Access Journals (Sweden)

    Atiya Techaparin

    Full Text Available Abstract The application of high-potential thermotolerant yeasts is a key factor for successful ethanol production at high temperatures. Two hundred and thirty-four yeast isolates from Greater Mekong Subregion (GMS countries, i.e., Thailand, The Lao People's Democratic Republic (Lao PDR and Vietnam were obtained. Five thermotolerant yeasts, designated Saccharomyces cerevisiae KKU-VN8, KKU-VN20, and KKU-VN27, Pichia kudriavzevii KKU-TH33 and P. kudriavzevii KKU-TH43, demonstrated high temperature and ethanol tolerance levels up to 45 °C and 13% (v/v, respectively. All five strains produced higher ethanol concentrations and exhibited greater productivities and yields than the industrial strain S. cerevisiae TISTR5606 during high-temperature fermentation at 40 °C and 43 °C. S. cerevisiae KKU-VN8 demonstrated the best performance for ethanol production from glucose at 37 °C with an ethanol concentration of 72.69 g/L, a productivity of 1.59 g/L/h and a theoretical ethanol yield of 86.27%. The optimal conditions for ethanol production of S. cerevisiae KKU-VN8 from sweet sorghum juice (SSJ at 40 °C were achieved using the Box-Behnken experimental design (BBD. The maximal ethanol concentration obtained during fermentation was 89.32 g/L, with a productivity of 2.48 g/L/h and a theoretical ethanol yield of 96.32%. Thus, the newly isolated thermotolerant S. cerevisiae KKU-VN8 exhibits a great potential for commercial-scale ethanol production in the future.

  5. Chronic exposure to low frequency noise at moderate levels causes impaired balance in mice.

    Directory of Open Access Journals (Sweden)

    Haruka Tamura

    Full Text Available We are routinely exposed to low frequency noise (LFN; below 0.5 kHz at moderate levels of 60-70 dB sound pressure level (SPL generated from various sources in occupational and daily environments. LFN has been reported to affect balance in humans. However, there is limited information about the influence of chronic exposure to LFN at moderate levels for balance. In this study, we investigated whether chronic exposure to LFN at a moderate level of 70 dB SPL affects the vestibule, which is one of the organs responsible for balance in mice. Wild-type ICR mice were exposed for 1 month to LFN (0.1 kHz and high frequency noise (HFN; 16 kHz at 70 dB SPL at a distance of approximately 10-20 cm. Behavior analyses including rotarod, beam-crossing and footprint analyses showed impairments of balance in LFN-exposed mice but not in non-exposed mice or HFN-exposed mice. Immunohistochemical analysis showed a decreased number of vestibular hair cells and increased levels of oxidative stress in LFN-exposed mice compared to those in non-exposed mice. Our results suggest that chronic exposure to LFN at moderate levels causes impaired balance involving morphological impairments of the vestibule with enhanced levels of oxidative stress. Thus, the results of this study indicate the importance of considering the risk of chronic exposure to LFN at a moderate level for imbalance.

  6. Efecto del estrés social agudo sobre impulsividad, toma de riesgos y sesgos atencionales en jóvenes con y sin historia familiar de abuso de alcohol

    Directory of Open Access Journals (Sweden)

    Angelina Pilatti

    2017-07-01

    Full Text Available Este trabajo analizó el efecto del estrés social —inducido experimentalmente— en jóvenes con historia familiar positiva (HFP o negativa (HFN de abuso de alcohol. Se midieron los niveles de cortisol en saliva, la percepción subjetiva del estado emocional y el desempeño en pruebas que miden atención hacia estímulos que señalizan al alcohol, impulsividad y conductas de riesgo. Los participantes expuestos al estrés tuvieron niveles más altos de cortisol en saliva y una percepción subjetiva de mayor malestar y de menor bienestar comparados con los controles. Los HFP reportaron un nivel significativamente menor de bienestar y de mayor malestar que sus pares HFN. No se encontraron efectos significativos de tratamiento, ni interacciones significativas entre tratamiento e historia familiar, en las pruebas de medir impulsividad, conductas riesgosas y sesgos atencionales.

  7. The clinical significance of detection to heart rate deceleration capacity and heart rate variability in patients with chronic heart failure

    Directory of Open Access Journals (Sweden)

    Jiang-rong Zhou

    2015-01-01

    Full Text Available Objective: To study the change of heart rate deceleration capacity ( DC and heart rate variability in patients with chronic heart failure (CHF and its relationship with left ventricular ejection fraction (LVEF. Methods: DC, LVEF, time and frequency domain parameters of HRV were measured in 66 patients with CHF and 34 healthy adults (control group by using 24h Holter recordings and Echocardiography. The standard deviation of normal R-R intervals( SDNN, squares of differences between adjacent NN intervals ( RMSSD,low frequency power( LFn and high frequency power( HFn and the changes of LVEF were compared between  the two groups,the relationship between DC,LVEF and HRV were studied in patients with CHF. Results: The median value of DC in the patients with CHF was significantly lower than that in control group( 3.1 ± 2.4 ms vs 7.2 ± 1.3 ms,P <0.01.Incidence of abnormal DC in the CHF group was 57.5%,which was significantly higher than that in the control group (P <0.01.The HRV index, including SDNN、RMSSD、LFn、HFn, in the CHF group was significantly lower than that in normal control group (P < 0.01. Significant positive correlation between HRV index and LVEF were confirmed (P < 0.01. Conclusions: DC and HRV index are lower in patients with CHF and have a good correlation with the left ventricular ejection fraction.

  8. High Affinity vs. Native Fibronectin in the Modulation of αvβ3 Integrin Conformational Dynamics: Insights from Computational Analyses and Implications for Molecular Design.

    Directory of Open Access Journals (Sweden)

    Antonella Paladino

    2017-01-01

    Full Text Available Understanding how binding events modulate functional motions of multidomain proteins is a major issue in chemical biology. We address several aspects of this problem by analyzing the differential dynamics of αvβ3 integrin bound to wild type (wtFN10, agonist or high affinity (hFN10, antagonist mutants of fibronectin. We compare the dynamics of complexes from large-scale domain motions to inter-residue coordinated fluctuations to characterize the distinctive traits of conformational evolution and shed light on the determinants of differential αvβ3 activation induced by different FN sequences. We propose an allosteric model for ligand-based integrin modulation: the conserved integrin binding pocket anchors the ligand, while different residues on the two FN10's act as the drivers that reorganize relevant interaction networks, guiding the shift towards inactive (hFN10-bound or active states (wtFN10-bound. We discuss the implications of results for the design of integrin inhibitors.

  9. Preparation, structure and properties of hafnium compounds in the system Hf-C-N-O

    International Nuclear Information System (INIS)

    Brundiers, G.D.

    1975-08-01

    Highly dense, homogenous and single phase hafnium carbonitride samples (with low oxygen content) were prepared in the whole concentration range of the ternary cubic carbonitrides. Stoichiometric hafnium oxicarbides were also prepared within the range of solubility. The procedure involved the hot pressing of powders of HfC, HfN, Hf, Hf-Oxide and carbon at temperatures of 3,000 0 C and pressures up to 550 kpf/cm 2 using a novel technique. Small single crystals of slightly substoichiometric HfN were also repared. The densification of the powders was studied as a function of the non-metal concentration. Carbonitrides with N/Hf ratio of 0.37 were prepared in a high temperature autoclave operating at medium pressures by the reaction of HfC with nitrogen. All the samples were characterized by density measurements, chemical, X-ray and metallographic analysis and in some cases with the aid of quantitative metallography and microprobe analysis. Typical properties investigated were lattice parameter, thermal expansion, microhardness and electrical resistivity as function of the non-metal content. For specific concentrations extreme values in the properties are attained. With the aid of the valence electron concentration (VEC) parameter, the properties can be correlated with the density of states of electrons at the Fermi level. (orig./HK) [de

  10. New lumps of Veselov-Novikov integrable nonlinear equation and new exact rational potentials of two-dimensional stationary Schroedinger equation via ∂-macron-dressing method

    International Nuclear Information System (INIS)

    Dubrovsky, V.G.; Formusatik, I.B.

    2003-01-01

    The scheme for calculating via Zakharov-Manakov ∂-macron-dressing method of new rational solutions with constant asymptotic values at infinity of the famous two-dimensional Veselov-Novikov (VN) integrable nonlinear evolution equation and new exact rational potentials of two-dimensional stationary Schroedinger (2DSchr) equation with multiple pole wave functions is developed. As examples new lumps of VN nonlinear equation and new exact rational potentials of 2DSchr equation with multiple pole of order two wave functions are calculated. Among the constructed rational solutions are as nonsingular and also singular

  11. On the Analytical and Numerical Properties of the Truncated Laplace Transform II

    Science.gov (United States)

    2015-05-29

    La,b)∗ ◦ La,b) (un)) (t) = ∫ b a 1 t+ s un(s)ds = α 2 nun (t). (32) Similarly, the left singular functions vn of La,b are eigenfunctions of the...odd in the sense that Un(s) = (−1) nUn (−s). (83) 3.5 Decay of the coefficients Since the left singular function vn (defined in (27)) is a smooth...is associated with the right singular function un via (41) and (42) and it is studied in [12]. Lemma 3.13. Suppose that un be the n+ 1-th right

  12. Kinetic parameters of nitridation of molybdenum and niobium alloys with various structure states

    International Nuclear Information System (INIS)

    Solodkin, G.A.; Bulgach, A.A.; Likhacheva, T.E.

    1985-01-01

    Effect of preliminary plastic strain under rolling on kinetic parameters of nitridation of VN-2AEh, VN-3 niobium alloys and molybdenum alloy with hafnium is investigated. Extreme character of dependence of kinetic parameters of nitridation on the degree of reduction under rolling is determined. Preliminary plastic strain at negligible reduction is shown to accelerate growth of the zone of internal nitridation and decelerates growth of the nitride zone. Nitrogen atom removal from the surface to the centre is retarded at the increase of the degree of reduction up to 50% and higher. The degree of deformations is the higher the lower nitridation temperature is

  13. Content-Aware Adaptive Compression of Satellite Imagery Using Artificial Vision

    Science.gov (United States)

    2013-09-01

    pixel samples. The S vector, once calculated, will be passed onto the SVM. Note: The LL sub-band is not part of the S vector. aVn =< LH1,LH2...LHm >,aHn...HL1,HL2...HLm >,aDn =< HH1,HH2...HHm > (3.7) S =< aV0,aH0,aD0,aV1,aH1,aD1... aVn ,aHn,aDn > (3.8) 3.3.2 Training OASIC uses a single 512× 512 pixel

  14. Model for election night forecasting applied to the 2004 South African elections

    CSIR Research Space (South Africa)

    Greben, JM

    2006-06-01

    Full Text Available ,100x P 1p vp K=∑ = (2.2) In addition to these results we know the number of registered voters vN and the actual votes )a( vN cast in each voting district (spoiled votes are not included in )a(vN ). This information can be used... and add up to one: V,1v,1 =u cv C =1c L=∑ . (2.8) Our generalisation of Bezdek’s method consists of the inclusion of the weight )a(vN in the objective function. The objective function is minimized with respect to the cluster centres cpv...

  15. Nightingale til de nattergale

    DEFF Research Database (Denmark)

    Höy, Louise Udengaard; Holm, Anna; Dreyer, Pia

    2015-01-01

    Florence Nightingale er god at have med i nattevagt på intensiv afdeling. Hendes betragtninger om søvn er anvendelige den dag i dag, når man skal pleje svært syge patienter, som ikke længere er sederede, men kun modtager opioider til tubeaccept......Florence Nightingale er god at have med i nattevagt på intensiv afdeling. Hendes betragtninger om søvn er anvendelige den dag i dag, når man skal pleje svært syge patienter, som ikke længere er sederede, men kun modtager opioider til tubeaccept...

  16. Changes in resting-state fMRI in vestibular neuritis.

    Science.gov (United States)

    Helmchen, Christoph; Ye, Zheng; Sprenger, Andreas; Münte, Thomas F

    2014-11-01

    Vestibular neuritis (VN) is a sudden peripheral unilateral vestibular failure with often persistent head movement-related dizziness and unsteadiness. Compensation of asymmetrical activity in the primary peripheral vestibular afferents is accomplished by restoration of impaired brainstem vestibulo-ocular and vestibulo-spinal reflexes, but presumably also by changing cortical vestibular tone imbalance subserving, e.g., spatial perception and orientation. The aim of this study was to elucidate (i) whether there are changes of cerebral resting-state networks with respect to functional interregional connectivity (resting-state activity) in VN patients and (ii) whether these are related to neurophysiological, perceptual and functional parameters of vestibular-induced disability. Using independent component analysis (ICA), we compared resting-state networks between 20 patients with unilateral VN and 20 age- and gender-matched healthy control subjects. Patients were examined in the acute VN stage and after 3 months. A neural network (component 50) comprising the parietal lobe, medial aspect of the superior parietal lobule, posterior cingulate cortex, middle frontal gyrus, middle temporal gyrus, parahippocampal gyrus, anterior cingulate cortex, insular cortex, caudate nucleus, thalamus and midbrain was modulated between acute VN patients and healthy controls and in patients over time. Within this network, acute VN patients showed decreased resting-state activity (ICA) in the contralateral intraparietal sulcus (IPS), in close vicinity to the supramarginal gyrus (SMG), which increased after 3 months. Resting-state activity in IPS tended to increase over 3 months in VN patients who improved with respect to functional parameters of vestibular-induced disability (VADL). Resting-state activity in the IPS was not related to perceptual (subjective visual vertical) or neurophysiological parameters of vestibular-induced disability (e.g., gain of vestibulo-ocular reflex, caloric

  17. Study air ingress into the reactor vessel using ICARE/CATHARE V2.0 in case of severe accident

    International Nuclear Information System (INIS)

    Gwenaelle Le Dantec; Fichot, F.

    2005-01-01

    Full text of publication follows: Safety analyses show that core degradation during a severe reactor accident would not be uniform. This was confirmed by TMI2 examinations. In fact, a central region of the core may overheat, melt and flow down to the lower plenum of the reactor while peripheral regions of the core would remain almost intact. Following rupture of the vessel by molten debris, air may be drawn from the containment by natural convection into the reactor coolant system, and react with the intact rods. Studying air ingress into the reactor vessel is of interest because the interaction of air with Zircaloy cladding can strongly affect the evolution of severe accident scenarios. The main effects are heat generation, increasing clad degradation, fission product release and nitriding. In case of air/steam recirculation in the vessel, significant nitriding of cladding can occur. The resulting ZrN phase is characterized by its brittleness and instability under oxidizing conditions, Oxidation of pre-existing ZrN phase layers has been observed to result in violent oxidation and heat release. Therefore, the first consequence for safety is a risk of strong deflagration in the vessel if a large number of rods on which a substantial layer of ZrN has grown are suddenly in contact with oxygen or steam. The second consequence is a late melting of core materials due to the very exothermic oxidation, leading to a late release of materials out of the reactor pressure vessel (RPV). In this paper we present an ICARE/CATHARE V2.0 calculation simulating air ingress into the vessel and in particular to describe the nitriding due to natural convection in the reactor vessel. The basic modeling and the necessary extensions of both ICARE and CATHARE are explained. The natural circulation is calculated to predict the regions of oxygen starvation where nitriding takes place. Key words: air ingress, nitriding, ICARE/CATHARE V2.0. (authors)

  18. Structural, mechanical, electrical and wetting properties of ZrNx films deposited by Ar/N2 vacuum arc discharge: Effect of nitrogen partial pressure

    Science.gov (United States)

    Abdallah, B.; Naddaf, M.; A-Kharroub, M.

    2013-03-01

    Non-stiochiometric zirconium nitride (ZrNx) thin films have been deposited on silicon substrates by vacuum arc discharge of (N2 + Ar) gas mixtures at different N2 partial pressure ratio. The microstructure, mechanical, electrical and wetting properties of these films are studied by means of X-ray diffraction (XRD), micro-Raman spectroscopy, Rutherford back scattering (RBS) technique, conventional micro-hardness testing, electrical resistivity, atomic force microscopy (AFM) and contact angle (CA) measurements. RBS results and analysis show that the (N/Zr) ratio in the film increases with increasing the N2 partial pressure. A ZrNx film with (Zr/N) ratio in the vicinity of stoichiometric ZrN is obtained at N2 partial pressure of 10%. XRD and Raman results indicate that all deposited films have strained cubic crystal phase of ZrN, regardless of the N2 partial pressure. On increasing the N2 partial pressure, the relative intensity of (1 1 1) orientation with respect to (2 0 0) orientation is seen to decrease. The effect of N2 partial pressure on micro-hardness and the resistivity of the deposited film is revealed and correlated to the alteration of grain size, crystallographic texture, stoichiometry and residual stress developed in the film. In particular, it is found that residual stress and nitrogen incorporation in the film play crucial role in the alteration of micro-hardness and resistivity respectively. In addition, CA and AFM results demonstrate that as N2 partial pressure increases, both the surface hydrophobicity and roughness of the deposited film increase, leading to a significant decrease in the film surface free energy (SFE).

  19. Thermal conductivities of (ZrxPu(1-x)/2Am(1-x)/2)N solid solutions

    International Nuclear Information System (INIS)

    Nishi, Tsuyoshi; Takano, Masahide; Akabori, Mitsuo; Arai, Yasuo

    2011-01-01

    The thermal conductivity of Zr-based transuranium (TRU) nitride solid solutions is important for designing subcritical cores in nitride-fueled ADS. Some results have been reported concerning the thermal conductivities of (Zr,Pu)N. However, there have been no experimental data on the thermal conductivities of Zr-based nitride solid solutions containing MA. In this study, the authors prepared sintered samples of (Zr x Pu (1-x)/2 Am (1-x)/2) N (x=0.0, 0.58, 0.80) solid solutions. The thermal diffusivity and heat capacity of (Zr x Pu (1-x)/2 Am (1-x)/2) N solid solutions were measured using a laser flash method and drop calorimetry, respectively. Thermal conductivities were determined from the measured thermal diffusivities, heat capacities and bulk densities over a temperature range of 473 to 1473 K. The thermal conductivities of (Zr 0.58 Pu 0.21 Am 0.21 )N and (Zr 0.80 Pu 0.10 Am 0.10 )N solid solutions were found to be higher than that of (Pu 0.5 Am 0.5 )N due to the high thermal conductivity of ZrN as the principal component, although they were lower than that of ZrN due to the impurifying effect of the transuranium elements. Thus, the thermal conductivities of (Zr x Pu (1-x)/2 Am (1-x)/2) N solid solutions increased with increasing ZrN concentration. Moreover, in order to help to promote the design study of nitride-fueled ADS, the thermal conductivity of the (Zr x Pu (1-x)/2 Am (1-x)/2) N solid solutions were fitted to an equation using the least squares method. (author)

  20. Fracture resistance of structurally compromised and normal endodontically treated teeth restored with different post systems: An in vitro study

    Directory of Open Access Journals (Sweden)

    Vajihesadat Mortazavi

    2012-01-01

    Full Text Available Background: With the aim of developing methods that could increase the fracture resistance of structurally compromised endodontically treated teeth, this study was conducted to compare the effect of three esthetic post systems on the fracture resistance and failure modes of structurally compromised and normal roots. Materials and Methods: Forty five extracted and endodontically treated maxillary central teeth were assigned to 5 experimental groups (n=9. In two groups, the post spaces were prepared with the corresponding drills of the post systems to be restored with double taper light posts (DT.Light-Post (group DT.N and zirconia posts (Cosmopost (group Zr.N. In other 3 groups thin wall canals were simulated to be restored with Double taper Light posts (DT.W, double taper Light posts and Ribbond fibers (DT+R.W and Zirconia posts (Zr.W. After access cavity restoration and thermocycling, compressive load was applied and the fracture strength values and failure modes were evaluated. Data were analyzed using two-way ANOVA, Tukey and Fisher exact tests (P<0.05. Results: The mean failure loads (N were 678.56, 638.22, 732.44, 603.44 and 573.67 for groups DT.N, Zr.N, DT.W, DT+R.W and Zr.w respectively. Group DT+R.W exhibited significantly higher resistance to fracture compared to groups Zr.N, DT.W and Zr.w (P<0.05. A significant difference was detected between groups DT.N and Zr.W (P=0.027. Zirconia posts showed significantly higher root fracture compared to fiber posts (P=0.004. Conclusion: The structurally compromised teeth restored with double taper light posts and Ribbond fibers showed the most fracture resistance and their strengths were comparable to those of normal roots restored with double taper light posts. More desirable fracture patterns were observed in teeth restored with fiber posts.

  1. COMPARATIVE ANALYSIS OF STRUCTURAL CHANGES IN U-MO DISPERSED FUEL OF FULL-SIZE FUEL ELEMENTS AND MINI-RODS IRRADIATED IN THE MIR REACTOR

    OpenAIRE

    ALEKSEY. L. IZHUTOV; VALERIY. V. IAKOVLEV; ANDREY. E. NOVOSELOV; VLADIMIR. A. STARKOV; ALEKSEY. A. SHELDYAKOV; VALERIY. YU. SHISHIN; VLADIMIR. M. KOSENKOV; ALEKSANDR. V. VATULIN; IRINA. V. DOBRIKOVA; VLADIMIR. B. SUPRUN; GENNADIY. V. KULAKOV

    2013-01-01

    The paper summarizes the irradiation test and post-irradiation examination (PIE) data for the U-Mo low-enriched fuel that was irradiated in the MIR reactor under the RERTR Program. The PIE data were analyzed for both full-size fuel rods and mini-rods with atomized powder dispersed in Al matrix as well as with additions of 2%, 5% and 13% of silicon in the matrix and ZrN protective coating on the fuel particles. The full-size fuel rods were irradiated up to an average burnup of ∼ 60%235U; th...

  2. Phase relations and conductivity of Sr-zirconates and La-zirconates

    DEFF Research Database (Denmark)

    Poulsen, F.W.; Vanderpuil, N.

    1992-01-01

    phase orthorhombic SrZrO3 and somewhat impure, tetragonal Sr2ZrO4 were observed, whereas the formation of ordered Ruddlesden-Popper phases, SrnZrn-1O3n-2, where n = 4 and 3, could not be verified. The conductivity of La2Zr2O7 was 3.7 X 10(-6) S/cm at 750-degrees-C and 3.8 x 10(-5) S/cm at 1000-degrees...

  3. Shield gas induced cracks during nanosecond-pulsed laser irradiation of Zr-based metallic glass

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Hu; Noguchi, Jun; Yan, Jiwang [Keio University, Department of Mechanical Engineering, Faculty of Science and Technology, Yokohama (Japan)

    2016-10-15

    Laser processing techniques have been given increasing attentions in the field of metallic glasses (MGs). In this work, effects of two kinds of shield gases, nitrogen and argon, on nanosecond-pulsed laser irradiation of Zr-based MG were comparatively investigated. Results showed that compared to argon gas, nitrogen gas remarkably promoted the formation of cracks during laser irradiation. Furthermore, crack formation in nitrogen gas was enhanced by increasing the peak laser power intensity or decreasing the laser scanning speed. X-ray diffraction and micro-Raman spectroscopy indicated that the reason for enhanced cracks in nitrogen gas was the formation of ZrN. (orig.)

  4. OBTENCIÓN DE PROPIEDADES MORFOLÓGICAS DE MATERIALES POR MEDIO DE PROCESAMIENTO DIGITAL DE IMÁGENES.

    Directory of Open Access Journals (Sweden)

    J. C. Riaño Rojas

    2008-01-01

    Full Text Available Digital image processing techniques have been widely used for studying morphological properties of many diferent images, such as medical, satellite and materials images. In this work the study of morphological properties of niobium nitride (NbN, tantalum nitride (TaN, zirconium nitride (ZrN and chromium nitride (CrN, employing the scanning probe microscopy (SPM in the atomic force microscopy method (AFM is present. These images were annalysed employing image processing techniques. To determine the roughness, fractal dimension (FD was used. Fractal dimension is a tool that allows to calculate the surface complexity. The number and grains size was determined by using the Hessian method.

  5. Spectroscopic analysis of Zirconium plasma in different ambient and optimizing conditions for nanoclusters formation

    International Nuclear Information System (INIS)

    Yadav, Dheerendra; Thareja, Raj K.

    2010-01-01

    The laser produced zirconium plasma has been studied by emission spectroscopy and fast photography using intensified charged coupled device at different ambient pressures of nitrogen (0.1, 1.0 and 10 mbar). Formation of zirconium clusters are arising at ambient pressure of 1.0 mbar at the plume periphery due to the chemical reactions between the plasma plume and the ambient and confirmed using optical emission spectroscopy. The optimum parameters for existence cluster formation are reported. The ZrN clusters are deposited on silicon substrate and characterized by AFM, XRD and EDAX techniques. (author)

  6. Measurement of thermal neutron capture cross section

    International Nuclear Information System (INIS)

    Huang Xiaolong; Han Xiaogang; Yu Weixiang; Lu Hanlin; Zhao Wenrong

    2001-01-01

    The thermal neutron capture cross sections of 71 Ga(n, γ) 72 Ga, 94 Zr(n, γ) 95 Zr and 191 Ir(n, γ) 192 Ir m1+g,m2 reactions were measured by using activation method and compared with other measured data. Meanwhile the half-life of 72 Ga was also measured. The samples were irradiated with the neutron in the thermal column of heavy water reactor of China Institute of Atomic Energy. The activities of the reaction products were measured by well-calibrated Ge(Li) detector

  7. Electrochemical Evaluation of Hydroxyapatite/ZrN Coated Magnesium Biodegradable Alloy in Ringer Solution as a Simulated Body Fluid

    OpenAIRE

    Seyed Rahim Kiahosseini; Abdollah Afshar; Majid Mojtahedzadeh Larijani; Mardali Yousefpour

    2015-01-01

    Magnesium alloys as biodegradable materials can be used in body as an implant materials but since they have poor corrosion resistance, it is required to decrease their corrosion rate by biocompatible coatings. In this study, hydroxyapatite (HA) coatings in the presence of an intermediate layer of ZrN as a biocompatible material, deposited on AZ91 magnesium alloy by ion beam sputtering method at 300 °C temperature and at different times 180, 240, 300, 360 and 420 min. Then changes in corrosion...

  8. Radiation Damage and Fission Product Release in Zirconium Nitride

    Energy Technology Data Exchange (ETDEWEB)

    Egeland, Gerald W. [New Mexico Inst. of Mining and Technology, Socorro, NM (United States)

    2005-08-29

    Zirconium nitride is a material of interest to the AFCI program due to some of its particular properties, such as its high melting point, strength and thermal conductivity. It is to be used as an inert matrix or diluent with a nuclear fuel based on transuranics. As such, it must sustain not only high temperatures, but also continuous irradiation from fission and decay products. This study addresses the issues of irradiation damage and fission product retention in zirconium nitride through an assessment of defects that are produced, how they react, and how predictions can be made as to the overall lifespan of the complete nuclear fuel package. Ion irradiation experiments are a standard method for producing radiation damage to a surface for observation. Cryogenic irradiations are performed to produce the maximum accumulation of defects, while elevated temperature irradiations may be used to allow defects to migrate and react to form clusters and loops. Cross-sectional transmission electron microscopy and grazing-incidence x-ray diffractometry were used in evaluating the effects that irradiation has on the crystal structure and microstructure of the material. Other techniques were employed to evaluate physical effects, such as nanoindentation and helium release measurements. Results of the irradiations showed that, at cryogenic temperatures, ZrN withstood over 200 displacements per atom without amorphization. No significant change to the lattice or microstructure was observed. At elevated temperatures, the large amount of damage showed mobility, but did not anneal significantly. Defect clustering was possibly observed, yet the size was too small to evaluate, and bubble formation was not observed. Defects, specifically nitrogen vacancies, affect the mechanical behavior of ZrN dramatically. Current and previous work on dislocations shows a distinct change in slip plane, which is evidence of the bonding characteristics. The stacking-fault energy changes dramatically with

  9. Shield gas induced cracks during nanosecond-pulsed laser irradiation of Zr-based metallic glass

    Science.gov (United States)

    Huang, Hu; Noguchi, Jun; Yan, Jiwang

    2016-10-01

    Laser processing techniques have been given increasing attentions in the field of metallic glasses (MGs). In this work, effects of two kinds of shield gases, nitrogen and argon, on nanosecond-pulsed laser irradiation of Zr-based MG were comparatively investigated. Results showed that compared to argon gas, nitrogen gas remarkably promoted the formation of cracks during laser irradiation. Furthermore, crack formation in nitrogen gas was enhanced by increasing the peak laser power intensity or decreasing the laser scanning speed. X-ray diffraction and micro-Raman spectroscopy indicated that the reason for enhanced cracks in nitrogen gas was the formation of ZrN.

  10. Possibilities of the use of ionizing radiation and the demand in irradiation facilities in food industry and agriculture

    International Nuclear Information System (INIS)

    Kiss, I.

    1978-01-01

    Among various types of food conservation irradiation needs the less energy. By the results of a twenty year research work the foods are suggested to be preserved by irradiation in the near future: red onion, spice, animal foodstuff, common mushroom, wood strawberry, poultry, meat, corn. (V.N.)

  11. Measurement of longitudinal flow decorrelations in Pb+Pb collisions at √{s_{ {NN}}}=2.76 and 5.02 TeV with the ATLAS detector

    Science.gov (United States)

    Aaboud, M.; Aad, G.; Abbott, B.; Abdinov, O.; Abeloos, B.; Abidi, S. H.; AbouZeid, O. S.; Abraham, N. L.; Abramowicz, H.; Abreu, H.; Abreu, R.; Abulaiti, Y.; Acharya, B. S.; Adachi, S.; Adamczyk, L.; Adelman, J.; Adersberger, M.; Adye, T.; Affolder, A. A.; Afik, Y.; Agatonovic-Jovin, T.; Agheorghiesei, C.; Aguilar-Saavedra, J. A.; Ahlen, S. P.; Ahmadov, F.; Aielli, G.; Akatsuka, S.; Akerstedt, H.; Åkesson, T. P. A.; Akilli, E.; Akimov, A. V.; Alberghi, G. L.; Albert, J.; Albicocco, P.; Alconada Verzini, M. J.; Alderweireldt, S. C.; Aleksa, M.; Aleksandrov, I. N.; Alexa, C.; Alexander, G.; Alexopoulos, T.; Alhroob, M.; Ali, B.; Aliev, M.; Alimonti, G.; Alison, J.; Alkire, S. P.; Allbrooke, B. M. M.; Allen, B. W.; Allport, P. P.; Aloisio, A.; Alonso, A.; Alonso, F.; Alpigiani, C.; Alshehri, A. A.; Alstaty, M. I.; Alvarez Gonzalez, B.; Álvarez Piqueras, D.; Alviggi, M. G.; Amadio, B. T.; Amaral Coutinho, Y.; Amelung, C.; Amidei, D.; Amor Dos Santos, S. P.; Amoroso, S.; Amundsen, G.; Anastopoulos, C.; Ancu, L. S.; Andari, N.; Andeen, T.; Anders, C. F.; Anders, J. K.; Anderson, K. J.; Andreazza, A.; Andrei, V.; Angelidakis, S.; Angelozzi, I.; Angerami, A.; Anisenkov, A. V.; Anjos, N.; Annovi, A.; Antel, C.; Antonelli, M.; Antonov, A.; Antrim, D. J.; Anulli, F.; Aoki, M.; Aperio Bella, L.; Arabidze, G.; Arai, Y.; Araque, J. P.; Araujo Ferraz, V.; Arce, A. T. H.; Ardell, R. E.; Arduh, F. A.; Arguin, J.-F.; Argyropoulos, S.; Arik, M.; Armbruster, A. J.; Armitage, L. J.; Arnaez, O.; Arnold, H.; Arratia, M.; Arslan, O.; Artamonov, A.; Artoni, G.; Artz, S.; Asai, S.; Asbah, N.; Ashkenazi, A.; Asquith, L.; Assamagan, K.; Astalos, R.; Atkinson, M.; Atlay, N. B.; Augsten, K.; Avolio, G.; Axen, B.; Ayoub, M. K.; Azuelos, G.; Baas, A. E.; Baca, M. J.; Bachacou, H.; Bachas, K.; Backes, M.; Bagnaia, P.; Bahmani, M.; Bahrasemani, H.; Baines, J. T.; Bajic, M.; Baker, O. K.; Bakker, P. J.; Baldin, E. M.; Balek, P.; Balli, F.; Balunas, W. K.; Banas, E.; Bandyopadhyay, A.; Banerjee, Sw.; Bannoura, A. A. E.; Barak, L.; Barberio, E. L.; Barberis, D.; Barbero, M.; Barillari, T.; Barisits, M.-S.; Barkeloo, J. T.; Barklow, T.; Barlow, N.; Barnes, S. L.; Barnett, B. M.; Barnett, R. M.; Barnovska-Blenessy, Z.; Baroncelli, A.; Barone, G.; Barr, A. J.; Barranco Navarro, L.; Barreiro, F.; Barreiro Guimarães da Costa, J.; Bartoldus, R.; Barton, A. E.; Bartos, P.; Basalaev, A.; Bassalat, A.; Bates, R. L.; Batista, S. J.; Batley, J. R.; Battaglia, M.; Bauce, M.; Bauer, F.; Bawa, H. S.; Beacham, J. B.; Beattie, M. D.; Beau, T.; Beauchemin, P. H.; Bechtle, P.; Beck, H. P.; Beck, H. C.; Becker, K.; Becker, M.; Becot, C.; Beddall, A. J.; Beddall, A.; Bednyakov, V. A.; Bedognetti, M.; Bee, C. P.; Beermann, T. A.; Begalli, M.; Begel, M.; Behr, J. K.; Bell, A. S.; Bella, G.; Bellagamba, L.; Bellerive, A.; Bellomo, M.; Belotskiy, K.; Beltramello, O.; Belyaev, N. L.; Benary, O.; Benchekroun, D.; Bender, M.; Benekos, N.; Benhammou, Y.; Benhar Noccioli, E.; Benitez, J.; Benjamin, D. P.; Benoit, M.; Bensinger, J. R.; Bentvelsen, S.; Beresford, L.; Beretta, M.; Berge, D.; Bergeaas Kuutmann, E.; Berger, N.; Bergsten, L. J.; Beringer, J.; Berlendis, S.; Bernard, N. R.; Bernardi, G.; Bernius, C.; Bernlochner, F. U.; Berry, T.; Berta, P.; Bertella, C.; Bertoli, G.; Bertram, I. A.; Bertsche, C.; Besjes, G. J.; Bessidskaia Bylund, O.; Bessner, M.; Besson, N.; Bethani, A.; Bethke, S.; Betti, A.; Bevan, A. J.; Beyer, J.; Bianchi, R. M.; Biebel, O.; Biedermann, D.; Bielski, R.; Bierwagen, K.; Biesuz, N. V.; Biglietti, M.; Billoud, T. R. V.; Bilokon, H.; Bindi, M.; Bingul, A.; Bini, C.; Biondi, S.; Bisanz, T.; Bittrich, C.; Bjergaard, D. M.; Black, J. E.; Black, K. M.; Blair, R. E.; Blazek, T.; Bloch, I.; Blocker, C.; Blue, A.; Blumenschein, U.; Blunier, S.; Bobbink, G. J.; Bobrovnikov, V. S.; Bocchetta, S. S.; Bocci, A.; Bock, C.; Boehler, M.; Boerner, D.; Bogavac, D.; Bogdanchikov, A. G.; Bohm, C.; Boisvert, V.; Bokan, P.; Bold, T.; Boldyrev, A. S.; Bolz, A. E.; Bomben, M.; Bona, M.; Boonekamp, M.; Borisov, A.; Borissov, G.; Bortfeldt, J.; Bortoletto, D.; Bortolotto, V.; Boscherini, D.; Bosman, M.; Bossio Sola, J. D.; Boudreau, J.; Bouhova-Thacker, E. V.; Boumediene, D.; Bourdarios, C.; Boutle, S. K.; Boveia, A.; Boyd, J.; Boyko, I. R.; Bozson, A. J.; Bracinik, J.; Brandt, A.; Brandt, G.; Brandt, O.; Braren, F.; Bratzler, U.; Brau, B.; Brau, J. E.; Breaden Madden, W. D.; Brendlinger, K.; Brennan, A. J.; Brenner, L.; Brenner, R.; Bressler, S.; Briglin, D. L.; Bristow, T. M.; Britton, D.; Britzger, D.; Brochu, F. M.; Brock, I.; Brock, R.; Brooijmans, G.; Brooks, T.; Brooks, W. K.; Brosamer, J.; Brost, E.; Broughton, J. H.; Bruckman de Renstrom, P. A.; Bruncko, D.; Bruni, A.; Bruni, G.; Bruni, L. S.; Bruno, S.; Brunt, BH; Bruschi, M.; Bruscino, N.; Bryant, P.; Bryngemark, L.; Buanes, T.; Buat, Q.; Buchholz, P.; Buckley, A. G.; Budagov, I. A.; Buehrer, F.; Bugge, M. K.; Bulekov, O.; Bullock, D.; Burch, T. J.; Burdin, S.; Burgard, C. D.; Burger, A. M.; Burghgrave, B.; Burka, K.; Burke, S.; Burmeister, I.; Burr, J. T. P.; Büscher, D.; Büscher, V.; Bussey, P.; Butler, J. M.; Buttar, C. M.; Butterworth, J. M.; Butti, P.; Buttinger, W.; Buzatu, A.; Buzykaev, A. R.; Cabrera Urbán, S.; Caforio, D.; Cai, H.; Cairo, V. M.; Cakir, O.; Calace, N.; Calafiura, P.; Calandri, A.; Calderini, G.; Calfayan, P.; Callea, G.; Caloba, L. P.; Calvente Lopez, S.; Calvet, D.; Calvet, S.; Calvet, T. P.; Camacho Toro, R.; Camarda, S.; Camarri, P.; Cameron, D.; Caminal Armadans, R.; Camincher, C.; Campana, S.; Campanelli, M.; Camplani, A.; Campoverde, A.; Canale, V.; Cano Bret, M.; Cantero, J.; Cao, T.; Capeans Garrido, M. D. M.; Caprini, I.; Caprini, M.; Capua, M.; Carbone, R. M.; Cardarelli, R.; Cardillo, F.; Carli, I.; Carli, T.; Carlino, G.; Carlson, B. T.; Carminati, L.; Carney, R. M. D.; Caron, S.; Carquin, E.; Carrá, S.; Carrillo-Montoya, G. D.; Casadei, D.; Casado, M. P.; Casha, A. F.; Casolino, M.; Casper, D. W.; Castelijn, R.; Castillo Gimenez, V.; Castro, N. F.; Catinaccio, A.; Catmore, J. R.; Cattai, A.; Caudron, J.; Cavaliere, V.; Cavallaro, E.; Cavalli, D.; Cavalli-Sforza, M.; Cavasinni, V.; Celebi, E.; Ceradini, F.; Cerda Alberich, L.; Cerqueira, A. S.; Cerri, A.; Cerrito, L.; Cerutti, F.; Cervelli, A.; Cetin, S. A.; Chafaq, A.; Chakraborty, D.; Chan, S. K.; Chan, W. S.; Chan, Y. L.; Chang, P.; Chapman, J. D.; Charlton, D. G.; Chau, C. C.; Chavez Barajas, C. A.; Che, S.; Cheatham, S.; Chegwidden, A.; Chekanov, S.; Chekulaev, S. V.; Chelkov, G. A.; Chelstowska, M. A.; Chen, C.; Chen, C.; Chen, H.; Chen, J.; Chen, S.; Chen, S.; Chen, X.; Chen, Y.; Cheng, H. C.; Cheng, H. J.; Cheplakov, A.; Cheremushkina, E.; Cherkaoui El Moursli, R.; Cheu, E.; Cheung, K.; Chevalier, L.; Chiarella, V.; Chiarelli, G.; Chiodini, G.; Chisholm, A. S.; Chitan, A.; Chiu, Y. H.; Chizhov, M. V.; Choi, K.; Chomont, A. R.; Chouridou, S.; Chow, Y. S.; Christodoulou, V.; Chu, M. C.; Chudoba, J.; Chuinard, A. J.; Chwastowski, J. J.; Chytka, L.; Ciftci, A. K.; Cinca, D.; Cindro, V.; Cioara, I. A.; Ciocio, A.; Cirotto, F.; Citron, Z. H.; Citterio, M.; Ciubancan, M.; Clark, A.; Clark, B. L.; Clark, M. R.; Clark, P. J.; Clarke, R. N.; Clement, C.; Coadou, Y.; Cobal, M.; Coccaro, A.; Cochran, J.; Colasurdo, L.; Cole, B.; Colijn, A. P.; Collot, J.; Colombo, T.; Conde Muiño, P.; Coniavitis, E.; Connell, S. H.; Connelly, I. A.; Constantinescu, S.; Conti, G.; Conventi, F.; Cooke, M.; Cooper-Sarkar, A. M.; Cormier, F.; Cormier, K. J. R.; Corradi, M.; Corriveau, F.; Cortes-Gonzalez, A.; Costa, G.; Costa, M. J.; Costanzo, D.; Cottin, G.; Cowan, G.; Cox, B. E.; Cranmer, K.; Crawley, S. J.; Creager, R. A.; Cree, G.; Crépé-Renaudin, S.; Crescioli, F.; Cribbs, W. A.; Cristinziani, M.; Croft, V.; Crosetti, G.; Cueto, A.; Cuhadar Donszelmann, T.; Cukierman, A. R.; Cummings, J.; Curatolo, M.; Cúth, J.; Czekierda, S.; Czodrowski, P.; D'amen, G.; D'Auria, S.; D'eramo, L.; D'Onofrio, M.; Da Cunha Sargedas De Sousa, M. J.; Da Via, C.; Dabrowski, W.; Dado, T.; Dai, T.; Dale, O.; Dallaire, F.; Dallapiccola, C.; Dam, M.; Dandoy, J. R.; Daneri, M. F.; Dang, N. P.; Daniells, A. C.; Dann, N. S.; Danninger, M.; Dano Hoffmann, M.; Dao, V.; Darbo, G.; Darmora, S.; Dassoulas, J.; Dattagupta, A.; Daubney, T.; Davey, W.; David, C.; Davidek, T.; Davis, D. R.; Davison, P.; Dawe, E.; Dawson, I.; De, K.; de Asmundis, R.; De Benedetti, A.; De Castro, S.; De Cecco, S.; De Groot, N.; de Jong, P.; De la Torre, H.; De Lorenzi, F.; De Maria, A.; De Pedis, D.; De Salvo, A.; De Sanctis, U.; De Santo, A.; De Vasconcelos Corga, K.; De Vivie De Regie, J. B.; Debbe, R.; Debenedetti, C.; Dedovich, D. V.; Dehghanian, N.; Deigaard, I.; Del Gaudio, M.; Del Peso, J.; Delgove, D.; Deliot, F.; Delitzsch, C. M.; Dell'Acqua, A.; Dell'Asta, L.; Dell'Orso, M.; Della Pietra, M.; della Volpe, D.; Delmastro, M.; Delporte, C.; Delsart, P. A.; DeMarco, D. A.; Demers, S.; Demichev, M.; Demilly, A.; Denisov, S. P.; Denysiuk, D.; Derendarz, D.; Derkaoui, J. E.; Derue, F.; Dervan, P.; Desch, K.; Deterre, C.; Dette, K.; Devesa, M. R.; Deviveiros, P. O.; Dewhurst, A.; Dhaliwal, S.; Di Bello, F. A.; Di Ciaccio, A.; Di Ciaccio, L.; Di Clemente, W. K.; Di Donato, C.; Di Girolamo, A.; Di Girolamo, B.; Di Micco, B.; Di Nardo, R.; Di Petrillo, K. F.; Di Simone, A.; Di Sipio, R.; Di Valentino, D.; Diaconu, C.; Diamond, M.; Dias, F. A.; Diaz, M. A.; Diehl, E. B.; Dietrich, J.; Díez Cornell, S.; Dimitrievska, A.; Dingfelder, J.; Dita, P.; Dita, S.; Dittus, F.; Djama, F.; Djobava, T.; Djuvsland, J. I.; do Vale, M. A. B.; Dobos, D.; Dobre, M.; Dodsworth, D.; Doglioni, C.; Dolejsi, J.; Dolezal, Z.; Donadelli, M.; Donati, S.; Dondero, P.; Donini, J.; Dopke, J.; Doria, A.; Dova, M. T.; Doyle, A. T.; Drechsler, E.; Dris, M.; Du, Y.; Duarte-Campderros, J.; Dubinin, F.; Dubreuil, A.; Duchovni, E.; Duckeck, G.; Ducourthial, A.; Ducu, O. A.; Duda, D.; Dudarev, A.; Dudder, A. Chr.; Duffield, E. M.; Duflot, L.; Dührssen, M.; Dulsen, C.; Dumancic, M.; Dumitriu, A. E.; Duncan, A. K.; Dunford, M.; Duperrin, A.; Duran Yildiz, H.; Düren, M.; Durglishvili, A.; Duschinger, D.; Dutta, B.; Duvnjak, D.; Dyndal, M.; Dziedzic, B. S.; Eckardt, C.; Ecker, K. M.; Edgar, R. C.; Eifert, T.; Eigen, G.; Einsweiler, K.; Ekelof, T.; El Kacimi, M.; El Kosseifi, R.; Ellajosyula, V.; Ellert, M.; Elles, S.; Ellinghaus, F.; Elliot, A. A.; Ellis, N.; Elmsheuser, J.; Elsing, M.; Emeliyanov, D.; Enari, Y.; Ennis, J. S.; Epland, M. B.; Erdmann, J.; Ereditato, A.; Ernst, M.; Errede, S.; Escalier, M.; Escobar, C.; Esposito, B.; Estrada Pastor, O.; Etienvre, A. I.; Etzion, E.; Evans, H.; Ezhilov, A.; Ezzi, M.; Fabbri, F.; Fabbri, L.; Fabiani, V.; Facini, G.; Fakhrutdinov, R. M.; Falciano, S.; Falla, R. J.; Faltova, J.; Fang, Y.; Fanti, M.; Farbin, A.; Farilla, A.; Farina, C.; Farina, E. M.; Farooque, T.; Farrell, S.; Farrington, S. M.; Farthouat, P.; Fassi, F.; Fassnacht, P.; Fassouliotis, D.; Faucci Giannelli, M.; Favareto, A.; Fawcett, W. J.; Fayard, L.; Fedin, O. L.; Fedorko, W.; Feigl, S.; Feligioni, L.; Feng, C.; Feng, E. J.; Fenton, M. J.; Fenyuk, A. B.; Feremenga, L.; Fernandez Martinez, P.; Ferrando, J.; Ferrari, A.; Ferrari, P.; Ferrari, R.; Ferreira de Lima, D. E.; Ferrer, A.; Ferrere, D.; Ferretti, C.; Fiedler, F.; Filipčič, A.; Filipuzzi, M.; Filthaut, F.; Fincke-Keeler, M.; Finelli, K. D.; Fiolhais, M. C. N.; Fiorini, L.; Fischer, A.; Fischer, C.; Fischer, J.; Fisher, W. C.; Flaschel, N.; Fleck, I.; Fleischmann, P.; Fletcher, R. R. M.; Flick, T.; Flierl, B. M.; Flores Castillo, L. R.; Flowerdew, M. J.; Forcolin, G. T.; Formica, A.; Förster, F. A.; Forti, A.; Foster, A. G.; Fournier, D.; Fox, H.; Fracchia, S.; Francavilla, P.; Franchini, M.; Franchino, S.; Francis, D.; Franconi, L.; Franklin, M.; Frate, M.; Fraternali, M.; Freeborn, D.; Fressard-Batraneanu, S. M.; Freund, B.; Froidevaux, D.; Frost, J. A.; Fukunaga, C.; Fusayasu, T.; Fuster, J.; Gabizon, O.; Gabrielli, A.; Gabrielli, A.; Gach, G. P.; Gadatsch, S.; Gadomski, S.; Gagliardi, G.; Gagnon, L. G.; Galea, C.; Galhardo, B.; Gallas, E. J.; Gallop, B. J.; Gallus, P.; Galster, G.; Gan, K. K.; Ganguly, S.; Gao, Y.; Gao, Y. S.; Garay Walls, F. M.; García, C.; García Navarro, J. E.; García Pascual, J. A.; Garcia-Sciveres, M.; Gardner, R. W.; Garelli, N.; Garonne, V.; Gascon Bravo, A.; Gasnikova, K.; Gatti, C.; Gaudiello, A.; Gaudio, G.; Gavrilenko, I. L.; Gay, C.; Gaycken, G.; Gazis, E. N.; Gee, C. N. P.; Geisen, J.; Geisen, M.; Geisler, M. P.; Gellerstedt, K.; Gemme, C.; Genest, M. H.; Geng, C.; Gentile, S.; Gentsos, C.; George, S.; Gerbaudo, D.; Geßner, G.; Ghasemi, S.; Ghneimat, M.; Giacobbe, B.; Giagu, S.; Giangiacomi, N.; Giannetti, P.; Gibson, S. M.; Gignac, M.; Gilchriese, M.; Gillberg, D.; Gilles, G.; Gingrich, D. M.; Giordani, M. P.; Giorgi, F. M.; Giraud, P. F.; Giromini, P.; Giugliarelli, G.; Giugni, D.; Giuli, F.; Giuliani, C.; Giulini, M.; Gjelsten, B. K.; Gkaitatzis, S.; Gkialas, I.; Gkougkousis, E. L.; Gkountoumis, P.; Gladilin, L. K.; Glasman, C.; Glatzer, J.; Glaysher, P. C. F.; Glazov, A.; Goblirsch-Kolb, M.; Godlewski, J.; Goldfarb, S.; Golling, T.; Golubkov, D.; Gomes, A.; Gonçalo, R.; Goncalves Gama, R.; Goncalves Pinto Firmino Da Costa, J.; Gonella, G.; Gonella, L.; Gongadze, A.; Gonski, J. L.; González de la Hoz, S.; Gonzalez-Sevilla, S.; Goossens, L.; Gorbounov, P. A.; Gordon, H. A.; Gorelov, I.; Gorini, B.; Gorini, E.; Gorišek, A.; Goshaw, A. T.; Gössling, C.; Gostkin, M. I.; Gottardo, C. A.; Goudet, C. R.; Goujdami, D.; Goussiou, A. G.; Govender, N.; Gozani, E.; Grabowska-Bold, I.; Gradin, P. O. J.; Gramling, J.; Gramstad, E.; Grancagnolo, S.; Gratchev, V.; Gravila, P. M.; Gray, C.; Gray, H. M.; Greenwood, Z. D.; Grefe, C.; Gregersen, K.; Gregor, I. M.; Grenier, P.; Grevtsov, K.; Griffiths, J.; Grillo, A. A.; Grimm, K.; Grinstein, S.; Gris, Ph.; Grivaz, J.-F.; Groh, S.; Gross, E.; Grosse-Knetter, J.; Grossi, G. C.; Grout, Z. J.; Grummer, A.; Guan, L.; Guan, W.; Guenther, J.; Guescini, F.; Guest, D.; Gueta, O.; Gui, B.; Guido, E.; Guillemin, T.; Guindon, S.; Gul, U.; Gumpert, C.; Guo, J.; Guo, W.; Guo, Y.; Gupta, R.; Gurbuz, S.; Gustavino, G.; Gutelman, B. J.; Gutierrez, P.; Gutierrez Ortiz, N. G.; Gutschow, C.; Guyot, C.; Guzik, M. P.; Gwenlan, C.; Gwilliam, C. B.; Haas, A.; Haber, C.; Hadavand, H. K.; Haddad, N.; Hadef, A.; Hageböck, S.; Hagihara, M.; Hakobyan, H.; Haleem, M.; Haley, J.; Halladjian, G.; Hallewell, G. D.; Hamacher, K.; Hamal, P.; Hamano, K.; Hamilton, A.; Hamity, G. N.; Hamnett, P. G.; Han, L.; Han, S.; Hanagaki, K.; Hanawa, K.; Hance, M.; Handl, D. M.; Haney, B.; Hanke, P.; Hansen, J. B.; Hansen, J. D.; Hansen, M. C.; Hansen, P. H.; Hara, K.; Hard, A. S.; Harenberg, T.; Hariri, F.; Harkusha, S.; Harrison, P. F.; Hartmann, N. M.; Hasegawa, Y.; Hasib, A.; Hassani, S.; Haug, S.; Hauser, R.; Hauswald, L.; Havener, L. B.; Havranek, M.; Hawkes, C. M.; Hawkings, R. J.; Hayakawa, D.; Hayden, D.; Hays, C. P.; Hays, J. M.; Hayward, H. S.; Haywood, S. J.; Head, S. J.; Heck, T.; Hedberg, V.; Heelan, L.; Heer, S.; Heidegger, K. K.; Heim, S.; Heim, T.; Heinemann, B.; Heinrich, J. J.; Heinrich, L.; Heinz, C.; Hejbal, J.; Helary, L.; Held, A.; Hellman, S.; Helsens, C.; Henderson, R. C. W.; Heng, Y.; Henkelmann, S.; Henriques Correia, A. M.; Henrot-Versille, S.; Herbert, G. H.; Herde, H.; Herget, V.; Hernández Jiménez, Y.; Herr, H.; Herten, G.; Hertenberger, R.; Hervas, L.; Herwig, T. C.; Hesketh, G. G.; Hessey, N. P.; Hetherly, J. W.; Higashino, S.; Higón-Rodriguez, E.; Hildebrand, K.; Hill, E.; Hill, J. C.; Hiller, K. H.; Hillier, S. J.; Hils, M.; Hinchliffe, I.; Hirose, M.; Hirschbuehl, D.; Hiti, B.; Hladik, O.; Hlaluku, D. R.; Hoad, X.; Hobbs, J.; Hod, N.; Hodgkinson, M. C.; Hodgson, P.; Hoecker, A.; Hoeferkamp, M. R.; Hoenig, F.; Hohn, D.; Holmes, T. R.; Homann, M.; Honda, S.; Honda, T.; Hong, T. M.; Hooberman, B. H.; Hopkins, W. H.; Horii, Y.; Horton, A. J.; Hostachy, J.-Y.; Hostiuc, A.; Hou, S.; Hoummada, A.; Howarth, J.; Hoya, J.; Hrabovsky, M.; Hrdinka, J.; Hristova, I.; Hrivnac, J.; Hryn'ova, T.; Hrynevich, A.; Hsu, P. J.; Hsu, S.-C.; Hu, Q.; Hu, S.; Huang, Y.; Hubacek, Z.; Hubaut, F.; Huegging, F.; Huffman, T. B.; Hughes, E. W.; Huhtinen, M.; Hunter, R. F. H.; Huo, P.; Huseynov, N.; Huston, J.; Huth, J.; Hyneman, R.; Iacobucci, G.; Iakovidis, G.; Ibragimov, I.; Iconomidou-Fayard, L.; Idrissi, Z.; Iengo, P.; Igonkina, O.; Iizawa, T.; Ikegami, Y.; Ikeno, M.; Ilchenko, Y.; Iliadis, D.; Ilic, N.; Iltzsche, F.; Introzzi, G.; Ioannou, P.; Iodice, M.; Iordanidou, K.; Ippolito, V.; Isacson, M. F.; Ishijima, N.; Ishino, M.; Ishitsuka, M.; Issever, C.; Istin, S.; Ito, F.; Iturbe Ponce, J. M.; Iuppa, R.; Iwasaki, H.; Izen, J. M.; Izzo, V.; Jabbar, S.; Jackson, P.; Jacobs, R. M.; Jain, V.; Jakobi, K. B.; Jakobs, K.; Jakobsen, S.; Jakoubek, T.; Jamin, D. O.; Jana, D. K.; Jansky, R.; Janssen, J.; Janus, M.; Janus, P. A.; Jarlskog, G.; Javadov, N.; Javůrek, T.; Javurkova, M.; Jeanneau, F.; Jeanty, L.; Jejelava, J.; Jelinskas, A.; Jenni, P.; Jeske, C.; Jézéquel, S.; Ji, H.; Jia, J.; Jiang, H.; Jiang, Y.; Jiang, Z.; Jiggins, S.; Jimenez Pena, J.; Jin, S.; Jinaru, A.; Jinnouchi, O.; Jivan, H.; Johansson, P.; Johns, K. A.; Johnson, C. A.; Johnson, W. J.; Jon-And, K.; Jones, R. W. L.; Jones, S. D.; Jones, S.; Jones, T. J.; Jongmanns, J.; Jorge, P. M.; Jovicevic, J.; Ju, X.; Juste Rozas, A.; Köhler, M. K.; Kaczmarska, A.; Kado, M.; Kagan, H.; Kagan, M.; Kahn, S. J.; Kaji, T.; Kajomovitz, E.; Kalderon, C. W.; Kaluza, A.; Kama, S.; Kamenshchikov, A.; Kanaya, N.; Kanjir, L.; Kantserov, V. A.; Kanzaki, J.; Kaplan, B.; Kaplan, L. S.; Kar, D.; Karakostas, K.; Karastathis, N.; Kareem, M. J.; Karentzos, E.; Karpov, S. N.; Karpova, Z. M.; Karthik, K.; Kartvelishvili, V.; Karyukhin, A. N.; Kasahara, K.; Kashif, L.; Kass, R. D.; Kastanas, A.; Kataoka, Y.; Kato, C.; Katre, A.; Katzy, J.; Kawade, K.; Kawagoe, K.; Kawamoto, T.; Kawamura, G.; Kay, E. F.; Kazanin, V. F.; Keeler, R.; Kehoe, R.; Keller, J. S.; Kellermann, E.; Kempster, J. J.; Kendrick, J.; Keoshkerian, H.; Kepka, O.; Kerševan, B. P.; Kersten, S.; Keyes, R. A.; Khader, M.; Khalil-zada, F.; Khanov, A.; Kharlamov, A. G.; Kharlamova, T.; Khodinov, A.; Khoo, T. J.; Khovanskiy, V.; Khramov, E.; Khubua, J.; Kido, S.; Kilby, C. R.; Kim, H. Y.; Kim, S. H.; Kim, Y. K.; Kimura, N.; Kind, O. M.; King, B. T.; Kirchmeier, D.; Kirk, J.; Kiryunin, A. E.; Kishimoto, T.; Kisielewska, D.; Kitali, V.; Kivernyk, O.; Kladiva, E.; Klapdor-Kleingrothaus, T.; Klein, M. H.; Klein, M.; Klein, U.; Kleinknecht, K.; Klimek, P.; Klimentov, A.; Klingenberg, R.; Klingl, T.; Klioutchnikova, T.; Klitzner, F. F.; Kluge, E.-E.; Kluit, P.; Kluth, S.; Kneringer, E.; Knoops, E. B. F. G.; Knue, A.; Kobayashi, A.; Kobayashi, D.; Kobayashi, T.; Kobel, M.; Kocian, M.; Kodys, P.; Koffas, T.; Koffeman, E.; Köhler, N. M.; Koi, T.; Kolb, M.; Koletsou, I.; Komar, A. A.; Kondo, T.; Kondrashova, N.; Köneke, K.; König, A. C.; Kono, T.; Konoplich, R.; Konstantinidis, N.; Konya, B.; Kopeliansky, R.; Koperny, S.; Kopp, A. K.; Korcyl, K.; Kordas, K.; Korn, A.; Korol, A. A.; Korolkov, I.; Korolkova, E. V.; Kortner, O.; Kortner, S.; Kosek, T.; Kostyukhin, V. V.; Kotwal, A.; Koulouris, A.; Kourkoumeli-Charalampidi, A.; Kourkoumelis, C.; Kourlitis, E.; Kouskoura, V.; Kowalewska, A. B.; Kowalewski, R.; Kowalski, T. Z.; Kozakai, C.; Kozanecki, W.; Kozhin, A. S.; Kramarenko, V. A.; Kramberger, G.; Krasnopevtsev, D.; Krasny, M. W.; Krasznahorkay, A.; Krauss, D.; Kremer, J. A.; Kretzschmar, J.; Kreutzfeldt, K.; Krieger, P.; Krizka, K.; Kroeninger, K.; Kroha, H.; Kroll, J.; Kroll, J.; Kroseberg, J.; Krstic, J.; Kruchonak, U.; Krüger, H.; Krumnack, N.; Kruse, M. C.; Kubota, T.; Kucuk, H.; Kuday, S.; Kuechler, J. T.; Kuehn, S.; Kugel, A.; Kuger, F.; Kuhl, T.; Kukhtin, V.; Kukla, R.; Kulchitsky, Y.; Kuleshov, S.; Kulinich, Y. P.; Kuna, M.; Kunigo, T.; Kupco, A.; Kupfer, T.; Kuprash, O.; Kurashige, H.; Kurchaninov, L. L.; Kurochkin, Y. A.; Kurth, M. G.; Kuwertz, E. S.; Kuze, M.; Kvita, J.; Kwan, T.; Kyriazopoulos, D.; La Rosa, A.; Navarro, J. L. La Rosa; La Rotonda, L.; La Ruffa, F.; Lacasta, C.; Lacava, F.; Lacey, J.; Lack, D. P. J.; Lacker, H.; Lacour, D.; Ladygin, E.; Lafaye, R.; Laforge, B.; Lagouri, T.; Lai, S.; Lammers, S.; Lampl, W.; Lançon, E.; Landgraf, U.; Landon, M. P. J.; Lanfermann, M. C.; Lang, V. S.; Lange, J. C.; Langenberg, R. J.; Lankford, A. J.; Lanni, F.; Lantzsch, K.; Lanza, A.; Lapertosa, A.; Laplace, S.; Laporte, J. F.; Lari, T.; Lasagni Manghi, F.; Lassnig, M.; Lau, T. S.; Laurelli, P.; Lavrijsen, W.; Law, A. T.; Laycock, P.; Lazovich, T.; Lazzaroni, M.; Le, B.; Le Dortz, O.; Le Guirriec, E.; Le Quilleuc, E. P.; LeBlanc, M.; LeCompte, T.; Ledroit-Guillon, F.; Lee, C. A.; Lee, G. R.; Lee, S. C.; Lee, L.; Lefebvre, B.; Lefebvre, G.; Lefebvre, M.; Legger, F.; Leggett, C.; Lehmann Miotto, G.; Lei, X.; Leight, W. A.; Leite, M. A. L.; Leitner, R.; Lellouch, D.; Lemmer, B.; Leney, K. J. C.; Lenz, T.; Lenzi, B.; Leone, R.; Leone, S.; Leonidopoulos, C.; Lerner, G.; Leroy, C.; Les, R.; Lesage, A. A. J.; Lester, C. G.; Levchenko, M.; Levêque, J.; Levin, D.; Levinson, L. J.; Levy, M.; Lewis, D.; Li, B.; Li, Changqiao; Li, H.; Li, L.; Li, Q.; Li, Q.; Li, S.; Li, X.; Li, Y.; Liang, Z.; Liberti, B.; Liblong, A.; Lie, K.; Liebal, J.; Liebig, W.; Limosani, A.; Lin, C. Y.; Lin, K.; Lin, S. C.; Lin, T. H.; Linck, R. A.; Lindquist, B. E.; Lionti, A. E.; Lipeles, E.; Lipniacka, A.; Lisovyi, M.; Liss, T. M.; Lister, A.; Litke, A. M.; Liu, B.; Liu, H.; Liu, H.; Liu, J. K. K.; Liu, J.; Liu, J. B.; Liu, K.; Liu, L.; Liu, M.; Liu, Y. L.; Liu, Y.; Livan, M.; Lleres, A.; Llorente Merino, J.; Lloyd, S. L.; Lo, C. Y.; Sterzo, F. Lo; Lobodzinska, E. M.; Loch, P.; Loebinger, F. K.; Loesle, A.; Loew, K. M.; Lohse, T.; Lohwasser, K.; Lokajicek, M.; Long, B. A.; Long, J. D.; Long, R. E.; Longo, L.; Looper, K. A.; Lopez, J. A.; Lopez Paz, I.; Lopez Solis, A.; Lorenz, J.; Lorenzo Martinez, N.; Losada, M.; Lösel, P. J.; Lou, X.; Lounis, A.; Love, J.; Love, P. A.; Lu, H.; Lu, N.; Lu, Y. J.; Lubatti, H. J.; Luci, C.; Lucotte, A.; Luedtke, C.; Luehring, F.; Lukas, W.; Luminari, L.; Lundberg, O.; Lund-Jensen, B.; Lutz, M. S.; Luzi, P. M.; Lynn, D.; Lysak, R.; Lytken, E.; Lyu, F.; Lyubushkin, V.; Ma, H.; Ma, L. L.; Ma, Y.; Maccarrone, G.; Macchiolo, A.; Macdonald, C. M.; Maček, B.; Machado Miguens, J.; Madaffari, D.; Madar, R.; Mader, W. F.; Madsen, A.; Madysa, N.; Maeda, J.; Maeland, S.; Maeno, T.; Maevskiy, A. S.; Magerl, V.; Maiani, C.; Maidantchik, C.; Maier, T.; Maio, A.; Majersky, O.; Majewski, S.; Makida, Y.; Makovec, N.; Malaescu, B.; Malecki, Pa.; Maleev, V. P.; Malek, F.; Mallik, U.; Malon, D.; Malone, C.; Maltezos, S.; Malyukov, S.; Mamuzic, J.; Mancini, G.; Mandić, I.; Maneira, J.; Manhaes de Andrade Filho, L.; Manjarres Ramos, J.; Mankinen, K. H.; Mann, A.; Manousos, A.; Mansoulie, B.; Mansour, J. D.; Mantifel, R.; Mantoani, M.; Manzoni, S.; Mapelli, L.; Marceca, G.; March, L.; Marchese, L.; Marchiori, G.; Marcisovsky, M.; Marin Tobon, C. A.; Marjanovic, M.; Marley, D. E.; Marroquim, F.; Marsden, S. P.; Marshall, Z.; Martensson, M. U. F.; Marti-Garcia, S.; Martin, C. B.; Martin, T. A.; Martin, V. J.; Martin dit Latour, B.; Martinez, M.; Martinez Outschoorn, V. I.; Martin-Haugh, S.; Martoiu, V. S.; Martyniuk, A. C.; Marzin, A.; Masetti, L.; Mashimo, T.; Mashinistov, R.; Masik, J.; Maslennikov, A. L.; Mason, L. H.; Massa, L.; Mastrandrea, P.; Mastroberardino, A.; Masubuchi, T.; Mättig, P.; Maurer, J.; Maxfield, S. J.; Maximov, D. A.; Mazini, R.; Maznas, I.; Mazza, S. M.; McFadden, N. C.; McGoldrick, G.; McKee, S. P.; McCarn, A.; McCarthy, R. L.; McCarthy, T. G.; McClymont, L. I.; McDonald, E. F.; Mcfayden, J. A.; Mchedlidze, G.; McMahon, S. J.; McNamara, P. C.; McNicol, C. J.; McPherson, R. A.; Meehan, S.; Megy, T. J.; Mehlhase, S.; Mehta, A.; Meideck, T.; Meier, K.; Meirose, B.; Melini, D.; Mellado Garcia, B. R.; Mellenthin, J. D.; Melo, M.; Meloni, F.; Melzer, A.; Menary, S. B.; Meng, L.; Meng, X. T.; Mengarelli, A.; Menke, S.; Meoni, E.; Mergelmeyer, S.; Merlassino, C.; Mermod, P.; Merola, L.; Meroni, C.; Merritt, F. S.; Messina, A.; Metcalfe, J.; Mete, A. S.; Meyer, C.; Meyer, J.-P.; Meyer, J.; Meyer Zu Theenhausen, H.; Miano, F.; Middleton, R. P.; Miglioranzi, S.; Mijović, L.; Mikenberg, G.; Mikestikova, M.; Mikuž, M.; Milesi, M.; Milic, A.; Millar, D. A.; Miller, D. W.; Mills, C.; Milov, A.; Milstead, D. A.; Minaenko, A. A.; Minami, Y.; Minashvili, I. A.; Mincer, A. I.; Mindur, B.; Mineev, M.; Minegishi, Y.; Ming, Y.; Mir, L. M.; Mirto, A.; Mistry, K. P.; Mitani, T.; Mitrevski, J.; Mitsou, V. A.; Miucci, A.; Miyagawa, P. S.; Mizukami, A.; Mjörnmark, J. U.; Mkrtchyan, T.; Mlynarikova, M.; Moa, T.; Mochizuki, K.; Mogg, P.; Mohapatra, S.; Molander, S.; Moles-Valls, R.; Mondragon, M. C.; Mönig, K.; Monk, J.; Monnier, E.; Montalbano, A.; Montejo Berlingen, J.; Monticelli, F.; Monzani, S.; Moore, R. W.; Morange, N.; Moreno, D.; Moreno Llácer, M.; Morettini, P.; Morgenstern, S.; Mori, D.; Mori, T.; Morii, M.; Morinaga, M.; Morisbak, V.; Morley, A. K.; Mornacchi, G.; Morris, J. D.; Morvaj, L.; Moschovakos, P.; Mosidze, M.; Moss, H. J.; Moss, J.; Motohashi, K.; Mount, R.; Mountricha, E.; Moyse, E. J. W.; Muanza, S.; Mueller, F.; Mueller, J.; Mueller, R. S. P.; Muenstermann, D.; Mullen, P.; Mullier, G. A.; Munoz Sanchez, F. J.; Murray, W. J.; Musheghyan, H.; Muškinja, M.; Myagkov, A. G.; Myska, M.; Nachman, B. P.; Nackenhorst, O.; Nagai, K.; Nagai, R.; Nagano, K.; Nagasaka, Y.; Nagata, K.; Nagel, M.; Nagy, E.; Nairz, A. M.; Nakahama, Y.; Nakamura, K.; Nakamura, T.; Nakano, I.; Naranjo Garcia, R. F.; Narayan, R.; Narrias Villar, D. I.; Naryshkin, I.; Naumann, T.; Navarro, G.; Nayyar, R.; Neal, H. A.; Nechaeva, P. Yu.; Neep, T. J.; Negri, A.; Negrini, M.; Nektarijevic, S.; Nellist, C.; Nelson, A.; Nelson, M. E.; Nemecek, S.; Nemethy, P.; Nessi, M.; Neubauer, M. S.; Neumann, M.; Newman, P. R.; Ng, T. Y.; Ng, Y. S.; Nguyen Manh, T.; Nickerson, R. B.; Nicolaidou, R.; Nielsen, J.; Nikiforou, N.; Nikolaenko, V.; Nikolic-Audit, I.; Nikolopoulos, K.; Nilsson, P.; Ninomiya, Y.; Nisati, A.; Nishu, N.; Nisius, R.; Nitsche, I.; Nitta, T.; Nobe, T.; Noguchi, Y.; Nomachi, M.; Nomidis, I.; Nomura, M. A.; Nooney, T.; Nordberg, M.; Norjoharuddeen, N.; Novgorodova, O.; Nozaki, M.; Nozka, L.; Ntekas, K.; Nurse, E.; Nuti, F.; O'connor, K.; O'Neil, D. C.; O'Rourke, A. A.; O'Shea, V.; Oakham, F. G.; Oberlack, H.; Obermann, T.; Ocariz, J.; Ochi, A.; Ochoa, I.; Ochoa-Ricoux, J. P.; Oda, S.; Odaka, S.; Oh, A.; Oh, S. H.; Ohm, C. C.; Ohman, H.; Oide, H.; Okawa, H.; Okumura, Y.; Okuyama, T.; Olariu, A.; Oleiro Seabra, L. F.; Olivares Pino, S. A.; Oliveira Damazio, D.; Olsson, M. J. R.; Olszewski, A.; Olszowska, J.; Onofre, A.; Onogi, K.; Onyisi, P. U. E.; Oppen, H.; Oreglia, M. J.; Oren, Y.; Orestano, D.; Orlando, N.; Orr, R. S.; Osculati, B.; Ospanov, R.; Otero y Garzon, G.; Otono, H.; Ouchrif, M.; Ould-Saada, F.; Ouraou, A.; Oussoren, K. P.; Ouyang, Q.; Owen, M.; Owen, R. E.; Ozcan, V. E.; Ozturk, N.; Pachal, K.; Pacheco Pages, A.; Pacheco Rodriguez, L.; Padilla Aranda, C.; Pagan Griso, S.; Paganini, M.; Paige, F.; Palacino, G.; Palazzo, S.; Palestini, S.; Palka, M.; Pallin, D.; St. Panagiotopoulou, E.; Panagoulias, I.; Pandini, C. E.; Panduro Vazquez, J. G.; Pani, P.; Panitkin, S.; Pantea, D.; Paolozzi, L.; Papadopoulou, Th. D.; Papageorgiou, K.; Paramonov, A.; Paredes Hernandez, D.; Parker, A. J.; Parker, M. A.; Parker, K. A.; Parodi, F.; Parsons, J. A.; Parzefall, U.; Pascuzzi, V. R.; Pasner, J. M.; Pasqualucci, E.; Passaggio, S.; Pastore, Fr.; Pataraia, S.; Pater, J. R.; Pauly, T.; Pearson, B.; Pedraza Lopez, S.; Pedro, R.; Peleganchuk, S. V.; Penc, O.; Peng, C.; Peng, H.; Penwell, J.; Peralva, B. S.; Perego, M. M.; Perepelitsa, D. V.; Peri, F.; Perini, L.; Pernegger, H.; Perrella, S.; Peschke, R.; Peshekhonov, V. D.; Peters, K.; Peters, R. F. Y.; Petersen, B. A.; Petersen, T. C.; Petit, E.; Petridis, A.; Petridou, C.; Petroff, P.; Petrolo, E.; Petrov, M.; Petrucci, F.; Pettersson, N. E.; Peyaud, A.; Pezoa, R.; Phillips, F. H.; Phillips, P. W.; Piacquadio, G.; Pianori, E.; Picazio, A.; Pickering, M. A.; Piegaia, R.; Pilcher, J. E.; Pilkington, A. D.; Pinamonti, M.; Pinfold, J. L.; Pirumov, H.; Pitt, M.; Plazak, L.; Pleier, M.-A.; Pleskot, V.; Plotnikova, E.; Pluth, D.; Podberezko, P.; Poettgen, R.; Poggi, R.; Poggioli, L.; Pogrebnyak, I.; Pohl, D.; Pokharel, I.; Polesello, G.; Poley, A.; Policicchio, A.; Polifka, R.; Polini, A.; Pollard, C. S.; Polychronakos, V.; Pommès, K.; Ponomarenko, D.; Pontecorvo, L.; Popeneciu, G. A.; Portillo Quintero, D. M.; Pospisil, S.; Potamianos, K.; Potrap, I. N.; Potter, C. J.; Potti, H.; Poulsen, T.; Poveda, J.; Pozo Astigarraga, M. E.; Pralavorio, P.; Pranko, A.; Prell, S.; Price, D.; Primavera, M.; Prince, S.; Proklova, N.; Prokofiev, K.; Prokoshin, F.; Protopopescu, S.; Proudfoot, J.; Przybycien, M.; Puri, A.; Puzo, P.; Qian, J.; Qin, G.; Qin, Y.; Quadt, A.; Queitsch-Maitland, M.; Quilty, D.; Raddum, S.; Radeka, V.; Radescu, V.; Radhakrishnan, S. K.; Radloff, P.; Rados, P.; Ragusa, F.; Rahal, G.; Raine, J. A.; Rajagopalan, S.; Rangel-Smith, C.; Rashid, T.; Raspopov, S.; Ratti, M. G.; Rauch, D. M.; Rauscher, F.; Rave, S.; Ravinovich, I.; Rawling, J. H.; Raymond, M.; Read, A. L.; Readioff, N. P.; Reale, M.; Rebuzzi, D. M.; Redelbach, A.; Redlinger, G.; Reece, R.; Reed, R. G.; Reeves, K.; Rehnisch, L.; Reichert, J.; Reiss, A.; Rembser, C.; Ren, H.; Rescigno, M.; Resconi, S.; Resseguie, E. D.; Rettie, S.; Reynolds, E.; Rezanova, O. L.; Reznicek, P.; Rezvani, R.; Richter, R.; Richter, S.; Richter-Was, E.; Ricken, O.; Ridel, M.; Rieck, P.; Riegel, C. J.; Rieger, J.; Rifki, O.; Rijssenbeek, M.; Rimoldi, A.; Rimoldi, M.; Rinaldi, L.; Ripellino, G.; Ristić, B.; Ritsch, E.; Riu, I.; Rizatdinova, F.; Rizvi, E.; Rizzi, C.; Roberts, R. T.; Robertson, S. H.; Robichaud-Veronneau, A.; Robinson, D.; Robinson, J. E. M.; Robson, A.; Rocco, E.; Roda, C.; Rodina, Y.; Rodriguez Bosca, S.; Rodriguez Perez, A.; Rodriguez Rodriguez, D.; Roe, S.; Rogan, C. S.; Røhne, O.; Roloff, J.; Romaniouk, A.; Romano, M.; Romano Saez, S. M.; Romero Adam, E.; Rompotis, N.; Ronzani, M.; Roos, L.; Rosati, S.; Rosbach, K.; Rose, P.; Rosien, N.-A.; Rossi, E.; Rossi, L. P.; Rosten, J. H. N.; Rosten, R.; Rotaru, M.; Rothberg, J.; Rousseau, D.; Rozanov, A.; Rozen, Y.; Ruan, X.; Rubbo, F.; Ruettinger, E. M.; Rühr, F.; Ruiz-Martinez, A.; Rurikova, Z.; Rusakovich, N. A.; Russell, H. L.; Rutherfoord, J. P.; Ruthmann, N.; Ryabov, Y. F.; Rybar, M.; Rybkin, G.; Ryu, S.; Ryzhov, A.; Rzehorz, G. F.; Saavedra, A. F.; Sabato, G.; Sacerdoti, S.; Sadrozinski, H. F.-W.; Sadykov, R.; Safai Tehrani, F.; Saha, P.; Sahinsoy, M.; Saimpert, M.; Saito, M.; Saito, T.; Sakamoto, H.; Sakurai, Y.; Salamanna, G.; Salazar Loyola, J. E.; Salek, D.; Sales De Bruin, P. H.; Salihagic, D.; Salnikov, A.; Salt, J.; Salvatore, D.; Salvatore, F.; Salvucci, A.; Salzburger, A.; Sammel, D.; Sampsonidis, D.; Sampsonidou, D.; Sánchez, J.; Sanchez Martinez, V.; Sanchez Pineda, A.; Sandaker, H.; Sandbach, R. L.; Sander, C. O.; Sandhoff, M.; Sandoval, C.; Sankey, D. P. C.; Sannino, M.; Sano, Y.; Sansoni, A.; Santoni, C.; Santos, H.; Santoyo Castillo, I.; Sapronov, A.; Saraiva, J. G.; Sarrazin, B.; Sasaki, O.; Sato, K.; Sauvan, E.; Savage, G.; Savard, P.; Savic, N.; Sawyer, C.; Sawyer, L.; Saxon, J.; Sbarra, C.; Sbrizzi, A.; Scanlon, T.; Scannicchio, D. A.; Schaarschmidt, J.; Schacht, P.; Schachtner, B. M.; Schaefer, D.; Schaefer, L.; Schaefer, R.; Schaeffer, J.; Schaepe, S.; Schaetzel, S.; Schäfer, U.; Schaffer, A. C.; Schaile, D.; Schamberger, R. D.; Schegelsky, V. A.; Scheirich, D.; Schernau, M.; Schiavi, C.; Schier, S.; Schildgen, L. K.; Schillo, C.; Schioppa, M.; Schlenker, S.; Schmidt-Sommerfeld, K. R.; Schmieden, K.; Schmitt, C.; Schmitt, S.; Schmitz, S.; Schnoor, U.; Schoeffel, L.; Schoening, A.; Schoenrock, B. D.; Schopf, E.; Schott, M.; Schouwenberg, J. F. P.; Schovancova, J.; Schramm, S.; Schuh, N.; Schulte, A.; Schultens, M. J.; Schultz-Coulon, H.-C.; Schulz, H.; Schumacher, M.; Schumm, B. A.; Schune, Ph.; Schwartzman, A.; Schwarz, T. A.; Schweiger, H.; Schwemling, Ph.; Schwienhorst, R.; Schwindling, J.; Sciandra, A.; Sciolla, G.; Scornajenghi, M.; Scuri, F.; Scutti, F.; Searcy, J.; Seema, P.; Seidel, S. C.; Seiden, A.; Seixas, J. M.; Sekhniaidze, G.; Sekhon, K.; Sekula, S. J.; Semprini-Cesari, N.; Senkin, S.; Serfon, C.; Serin, L.; Serkin, L.; Sessa, M.; Seuster, R.; Severini, H.; Sfiligoj, T.; Sforza, F.; Sfyrla, A.; Shabalina, E.; Shaikh, N. W.; Shan, L. Y.; Shang, R.; Shank, J. T.; Shapiro, M.; Shatalov, P. B.; Shaw, K.; Shaw, S. M.; Shcherbakova, A.; Shehu, C. Y.; Shen, Y.; Sherafati, N.; Sherman, A. D.; Sherwood, P.; Shi, L.; Shimizu, S.; Shimmin, C. O.; Shimojima, M.; Shipsey, I. P. J.; Shirabe, S.; Shiyakova, M.; Shlomi, J.; Shmeleva, A.; Shoaleh Saadi, D.; Shochet, M. J.; Shojaii, S.; Shope, D. R.; Shrestha, S.; Shulga, E.; Shupe, M. A.; Sicho, P.; Sickles, A. M.; Sidebo, P. E.; Sideras Haddad, E.; Sidiropoulou, O.; Sidoti, A.; Siegert, F.; Sijacki, Dj.; Silva, J.; Silverstein, S. B.; Simak, V.; Simic, L.; Simion, S.; Simioni, E.; Simmons, B.; Simon, M.; Sinervo, P.; Sinev, N. B.; Sioli, M.; Siragusa, G.; Siral, I.; Sivoklokov, S. Yu.; Sjölin, J.; Skinner, M. B.; Skubic, P.; Slater, M.; Slavicek, T.; Slawinska, M.; Sliwa, K.; Slovak, R.; Smakhtin, V.; Smart, B. H.; Smiesko, J.; Smirnov, N.; Smirnov, S. Yu.; Smirnov, Y.; Smirnova, L. N.; Smirnova, O.; Smith, J. W.; Smith, M. N. K.; Smith, R. W.; Smizanska, M.; Smolek, K.; Snesarev, A. A.; Snyder, I. M.; Snyder, S.; Sobie, R.; Socher, F.; Soffer, A.; Søgaard, A.; Soh, D. A.; Sokhrannyi, G.; Solans Sanchez, C. A.; Solar, M.; Soldatov, E. Yu.; Soldevila, U.; Solodkov, A. A.; Soloshenko, A.; Solovyanov, O. V.; Solovyev, V.; Sommer, P.; Son, H.; Sopczak, A.; Sosa, D.; Sotiropoulou, C. L.; Sottocornola, S.; Soualah, R.; Soukharev, A. M.; South, D.; Sowden, B. C.; Spagnolo, S.; Spalla, M.; Spangenberg, M.; Spanò, F.; Sperlich, D.; Spettel, F.; Spieker, T. M.; Spighi, R.; Spigo, G.; Spiller, L. A.; Spousta, M.; St. Denis, R. D.; Stabile, A.; Stamen, R.; Stamm, S.; Stanecka, E.; Stanek, R. W.; Stanescu, C.; Stanitzki, M. M.; Stapf, B. S.; Stapnes, S.; Starchenko, E. A.; Stark, G. H.; Stark, J.; Stark, S. H.; Staroba, P.; Starovoitov, P.; Stärz, S.; Staszewski, R.; Stegler, M.; Steinberg, P.; Stelzer, B.; Stelzer, H. J.; Stelzer-Chilton, O.; Stenzel, H.; Stevenson, T. J.; Stewart, G. A.; Stockton, M. C.; Stoebe, M.; Stoicea, G.; Stolte, P.; Stonjek, S.; Stradling, A. R.; Straessner, A.; Stramaglia, M. E.; Strandberg, J.; Strandberg, S.; Strauss, M.; Strizenec, P.; Ströhmer, R.; Strom, D. M.; Stroynowski, R.; Strubig, A.; Stucci, S. A.; Stugu, B.; Styles, N. A.; Su, D.; Su, J.; Suchek, S.; Sugaya, Y.; Suk, M.; Sulin, V. V.; Sultan, D. M. S.; Sultansoy, S.; Sumida, T.; Sun, S.; Sun, X.; Suruliz, K.; Suster, C. J. E.; Sutton, M. R.; Suzuki, S.; Svatos, M.; Swiatlowski, M.; Swift, S. P.; Sykora, I.; Sykora, T.; Ta, D.; Tackmann, K.; Taenzer, J.; Taffard, A.; Tafirout, R.; Tahirovic, E.; Taiblum, N.; Takai, H.; Takashima, R.; Takasugi, E. H.; Takeda, K.; Takeshita, T.; Takubo, Y.; Talby, M.; Talyshev, A. A.; Tanaka, J.; Tanaka, M.; Tanaka, R.; Tanaka, S.; Tanioka, R.; Tannenwald, B. B.; Tapia Araya, S.; Tapprogge, S.; Tarem, S.; Tartarelli, G. F.; Tas, P.; Tasevsky, M.; Tashiro, T.; Tassi, E.; Tavares Delgado, A.; Tayalati, Y.; Taylor, A. C.; Taylor, A. J.; Taylor, G. N.; Taylor, P. T. E.; Taylor, W.; Teixeira-Dias, P.; Temple, D.; Ten Kate, H.; Teng, P. K.; Teoh, J. J.; Tepel, F.; Terada, S.; Terashi, K.; Terron, J.; Terzo, S.; Testa, M.; Teuscher, R. J.; Thais, S. J.; Theveneaux-Pelzer, T.; Thiele, F.; Thomas, J. P.; Thomas-Wilsker, J.; Thompson, P. D.; Thompson, A. S.; Thomsen, L. A.; Thomson, E.; Tian, Y.; Tibbetts, M. J.; Ticse Torres, R. E.; Tikhomirov, V. O.; Tikhonov, Yu. A.; Timoshenko, S.; Tipton, P.; Tisserant, S.; Todome, K.; Todorova-Nova, S.; Todt, S.; Tojo, J.; Tokár, S.; Tokushuku, K.; Tolley, E.; Tomlinson, L.; Tomoto, M.; Tompkins, L.; Toms, K.; Tong, B.; Tornambe, P.; Torrence, E.; Torres, H.; Torró Pastor, E.; Toth, J.; Touchard, F.; Tovey, D. R.; Treado, C. J.; Trefzger, T.; Tresoldi, F.; Tricoli, A.; Trigger, I. M.; Trincaz-Duvoid, S.; Tripiana, M. F.; Trischuk, W.; Trocmé, B.; Trofymov, A.; Troncon, C.; Trottier-McDonald, M.; Trovatelli, M.; Truong, L.; Trzebinski, M.; Trzupek, A.; Tsang, K. W.; Tseng, J. C.-L.; Tsiareshka, P. V.; Tsipolitis, G.; Tsirintanis, N.; Tsiskaridze, S.; Tsiskaridze, V.; Tskhadadze, E. G.; Tsukerman, I. I.; Tsulaia, V.; Tsuno, S.; Tsybychev, D.; Tu, Y.; Tudorache, A.; Tudorache, V.; Tulbure, T. T.; Tuna, A. N.; Turchikhin, S.; Turgeman, D.; Turk Cakir, I.; Turra, R.; Tuts, P. M.; Ucchielli, G.; Ueda, I.; Ughetto, M.; Ukegawa, F.; Unal, G.; Undrus, A.; Unel, G.; Ungaro, F. C.; Unno, Y.; Uno, K.; Unverdorben, C.; Urban, J.; Urquijo, P.; Urrejola, P.; Usai, G.; Usui, J.; Vacavant, L.; Vacek, V.; Vachon, B.; Vadla, K. O. H.; Vaidya, A.; Valderanis, C.; Valdes Santurio, E.; Valente, M.; Valentinetti, S.; Valero, A.; Valéry, L.; Valkar, S.; Vallier, A.; Valls Ferrer, J. A.; Van Den Wollenberg, W.; van der Graaf, H.; van Gemmeren, P.; Van Nieuwkoop, J.; van Vulpen, I.; van Woerden, M. C.; Vanadia, M.; Vandelli, W.; Vaniachine, A.; Vankov, P.; Vardanyan, G.; Vari, R.; Varnes, E. W.; Varni, C.; Varol, T.; Varouchas, D.; Vartapetian, A.; Varvell, K. E.; Vasquez, J. G.; Vasquez, G. A.; Vazeille, F.; Vazquez Furelos, D.; Vazquez Schroeder, T.; Veatch, J.; Veeraraghavan, V.; Veloce, L. M.; Veloso, F.; Veneziano, S.; Ventura, A.; Venturi, M.; Venturi, N.; Venturini, A.; Vercesi, V.; Verducci, M.; Verkerke, W.; Vermeulen, A. T.; Vermeulen, J. C.; Vetterli, M. C.; Viaux Maira, N.; Viazlo, O.; Vichou, I.; Vickey, T.; Vickey Boeriu, O. E.; Viehhauser, G. H. A.; Viel, S.; Vigani, L.; Villa, M.; Villaplana Perez, M.; Vilucchi, E.; Vincter, M. G.; Vinogradov, V. B.; Vishwakarma, A.; Vittori, C.; Vivarelli, I.; Vlachos, S.; Vogel, M.; Vokac, P.; Volpi, G.; von der Schmitt, H.; von Toerne, E.; Vorobel, V.; Vorobev, K.; Vos, M.; Voss, R.; Vossebeld, J. H.; Vranjes, N.; Vranjes Milosavljevic, M.; Vrba, V.; Vreeswijk, M.; Vuillermet, R.; Vukotic, I.; Wagner, P.; Wagner, W.; Wagner-Kuhr, J.; Wahlberg, H.; Wahrmund, S.; Wakamiya, K.; Walder, J.; Walker, R.; Walkowiak, W.; Wallangen, V.; Wang, C.; Wang, C.; Wang, F.; Wang, H.; Wang, H.; Wang, J.; Wang, J.; Wang, Q.; Wang, R.-J.; Wang, R.; Wang, S. M.; Wang, T.; Wang, W.; Wang, W.; Wang, Z.; Wanotayaroj, C.; Warburton, A.; Ward, C. P.; Wardrope, D. R.; Washbrook, A.; Watkins, P. M.; Watson, A. T.; Watson, M. F.; Watts, G.; Watts, S.; Waugh, B. M.; Webb, A. F.; Webb, S.; Weber, M. S.; Weber, S. W.; Weber, S. W.; Weber, S. A.; Webster, J. S.; Weidberg, A. R.; Weinert, B.; Weingarten, J.; Weirich, M.; Weiser, C.; Weits, H.; Wells, P. S.; Wenaus, T.; Wengler, T.; Wenig, S.; Wermes, N.; Werner, M. D.; Werner, P.; Wessels, M.; Weston, T. D.; Whalen, K.; Whallon, N. L.; Wharton, A. M.; White, A. S.; White, A.; White, M. J.; White, R.; Whiteson, D.; Whitmore, B. W.; Wickens, F. J.; Wiedenmann, W.; Wielers, M.; Wiglesworth, C.; Wiik-Fuchs, L. A. M.; Wildauer, A.; Wilk, F.; Wilkens, H. G.; Williams, H. H.; Williams, S.; Willis, C.; Willocq, S.; Wilson, J. A.; Wingerter-Seez, I.; Winkels, E.; Winklmeier, F.; Winston, O. J.; Winter, B. T.; Wittgen, M.; Wobisch, M.; Wolf, A.; Wolf, T. M. H.; Wolff, R.; Wolter, M. W.; Wolters, H.; Wong, V. W. S.; Woods, N. L.; Worm, S. D.; Wosiek, B. K.; Wotschack, J.; Wozniak, K. W.; Wu, M.; Wu, S. L.; Wu, X.; Wu, Y.; Wyatt, T. R.; Wynne, B. M.; Xella, S.; Xi, Z.; Xia, L.; Xu, D.; Xu, L.; Xu, T.; Xu, W.; Yabsley, B.; Yacoob, S.; Yamaguchi, D.; Yamaguchi, Y.; Yamamoto, A.; Yamamoto, S.; Yamanaka, T.; Yamane, F.; Yamatani, M.; Yamazaki, T.; Yamazaki, Y.; Yan, Z.; Yang, H.; Yang, H.; Yang, Y.; Yang, Z.; Yao, W.-M.; Yap, Y. C.; Yasu, Y.; Yatsenko, E.; Yau Wong, K. H.; Ye, J.; Ye, S.; Yeletskikh, I.; Yigitbasi, E.; Yildirim, E.; Yorita, K.; Yoshihara, K.; Young, C.; Young, C. J. S.; Yu, J.; Yu, J.; Yuen, S. P. Y.; Yusuff, I.; Zabinski, B.; Zacharis, G.; Zaidan, R.; Zaitsev, A. M.; Zakharchuk, N.; Zalieckas, J.; Zaman, A.; Zambito, S.; Zanzi, D.; Zeitnitz, C.; Zemaityte, G.; Zemla, A.; Zeng, J. C.; Zeng, Q.; Zenin, O.; Ženiš, T.; Zerwas, D.; Zhang, D.; Zhang, D.; Zhang, F.; Zhang, G.; Zhang, H.; Zhang, J.; Zhang, L.; Zhang, L.; Zhang, M.; Zhang, P.; Zhang, R.; Zhang, R.; Zhang, X.; Zhang, Y.; Zhang, Z.; Zhao, X.; Zhao, Y.; Zhao, Z.; Zhemchugov, A.; Zhou, B.; Zhou, C.; Zhou, L.; Zhou, M.; Zhou, M.; Zhou, N.; Zhou, Y.; Zhu, C. G.; Zhu, H.; Zhu, J.; Zhu, Y.; Zhuang, X.; Zhukov, K.; Zibell, A.; Zieminska, D.; Zimine, N. I.; Zimmermann, C.; Zimmermann, S.; Zinonos, Z.; Zinser, M.; Ziolkowski, M.; Živković, L.; Zobernig, G.; Zoccoli, A.; Zou, R.; zur Nedden, M.; Zwalinski, L.

    2018-02-01

    Measurements of longitudinal flow correlations are presented for charged particles in the pseudorapidity range |η |ATLAS detector at the LHC. It is found that the correlation between the harmonic flow coefficients v_n measured in two separated η intervals does not factorise into the product of single-particle coefficients, and this breaking of factorisation, or flow decorrelation, increases linearly with the η separation between the intervals. The flow decorrelation is stronger at 2.76 TeV than at 5.02 TeV. Higher-order moments of the correlations are also measured, and the corresponding linear coefficients for the k{ {th}}-moment of the v_n are found to be proportional to k for v_3, but not for v_2. The decorrelation effect is separated into contributions from the magnitude of v_n and the event-plane orientation, each as a function of η . These two contributions are found to be comparable. The longitudinal flow correlations are also measured between v_n of different order in n. The decorrelations of v_2 and v_3 are found to be independent of each other, while the decorrelations of v_4 and v_5 are found to be driven by the nonlinear contribution from v_2^2 and v_2v_3, respectively.

  12. Acute Bilateral Superior Branch Vestibular Neuropathy

    Directory of Open Access Journals (Sweden)

    Dario A. Yacovino

    2018-05-01

    Full Text Available The rapid onset of a bilateral vestibular hypofunction (BVH is often attributed to vestibular ototoxicity. However, without any prior exposure to ototoxins, the idiopathic form of BVH is most common. Although sequential bilateral vestibular neuritis (VN is described as a cause of BVH, clinical evidence for simultaneous and acute onset bilateral VN is unknown. We describe a patient with an acute onset of severe gait ataxia and oscillopsia with features compatible with acute BVH putatively due to a bilateral VN, which we serially evaluated with clinical and laboratory vestibular function testing over the course of 1 year. Initially, bilateral superior and horizontal semicircular canals and bilateral utricles were impaired, consistent with damage to both superior branches of each vestibular nerve. Hearing was spared. Only modest results were obtained following 6 months of vestibular rehabilitation. At a 1-year follow-up, only the utricular function of one side recovered. This case is the first evidence supporting an acute presentation of bilateral VN as a cause for BVH, which would not have been observed without critical assessment of each of the 10 vestibular end organs.

  13. Demonstration of a Cylinder-Fill System Based on Solid Electrolyte Oxygen Separator (SEOS) Technology: One Year Early Field Assessment at a USAF Maintenance Facility

    Science.gov (United States)

    2011-02-01

    governed by the Nernst equation : )ln( 4 , , 2 2 cathodeO anodeO N p p F RTV = (1) Removal of the oxygen product from the anode side of the...technology requires applied voltages higher than the Nernst voltage, VN. This overpotential increases the productivity per cell. However, the increased

  14. Demonstration of a Cylinder Fill System Based on Solid Electrolyte Oxygen Separator (SEOS) Technology: Early Field Assessment at a USAF Maintenance Facility

    Science.gov (United States)

    2010-06-01

    is governed by the Nernst equation : )ln( 4 , , 2 2 cathodeO anodeO N p p F RT V  (1) Removal of the oxygen product from the anode side of the...requires applied voltages higher than the Nernst voltage, VN. This overpotential increases the productivity per cell. However, the increased

  15. FLUORIDE REMOVAL BY ADSORPTION ON THERMALLY ...

    African Journals Online (AJOL)

    Preferred Customer

    includes various countries from Africa and Asia as well as USA [1]. ... low costs make them potential candidates for the defluoridation in remote rural areas. It is ..... Chaturvedi, A.K.; Yadava, K.P.; Pathak, K.C.; Singh, V.N. Water, Air Soil Pollut.

  16. Comparison of four support-vector based function approximators

    NARCIS (Netherlands)

    de Kruif, B.J.; de Vries, Theodorus J.A.

    2004-01-01

    One of the uses of the support vector machine (SVM), as introduced in V.N. Vapnik (2000), is as a function approximator. The SVM and approximators based on it, approximate a relation in data by applying interpolation between so-called support vectors, being a limited number of samples that have been

  17. The relationship between vitronectin and hepatic insulin resistance in type 2 diabetes mellitus.

    Science.gov (United States)

    Cao, Yan; Li, Xinyu; Lu, Chong; Zhan, Xiaorong

    2018-05-18

    The World Health Organization (WHO) estimates that approximately 300 million people will suffer from diabetes mellitus by 2025. Type 2 diabetes mellitus (T2DM) is much more prevalent. T2DM comprises approximately 90% of diabetes mellitus cases, and it is caused by a combination of insulin resistance and inadequate compensatory insulin secretory response. In this study, we aimed to compare the plasma vitronectin (VN) levels between patients with T2DM and insulin resistance (IR) and healthy controls. Seventy patients with IR and 70 age- and body mass index (BMI)-matched healthy controls were included in the study. The insulin, Waist-to-Hip Ratio (WHR), C-peptide (CP) and VN levels of all participants were examined. The homeostasis model of assessment for insulin resistence index (HOMA-IR (CP)) formula was used to calculate insulin resistance. The levels of BMI, fasting plasma gluose (FPG), 2-hour postprandial glucose (2hPG), glycated hemoglobins (HbA1c), and HOMA-IR (CP) were significantly elevated in case group compared with controls. VN was found to be significantly decreased in case group. (VN Mean (Std): 8.55 (2.92) versus 12.88 (1.26) ng/mL p insulin resistance in patients with T2DM.

  18. The vagal innervation of the gut and immune homeostasis

    NARCIS (Netherlands)

    Matteoli, Gianluca; Boeckxstaens, Guy E.

    2013-01-01

    The central nervous system interacts dynamically with the immune system to modulate inflammation through humoral and neural pathways. Recently, in animal models of sepsis, the vagus nerve (VN) has been proposed to play a crucial role in the regulation of the immune response, also referred to as the

  19. Studies on the effect of a newly synthesized Schiff base compound from phenazone and vanillin on the corrosion of steel in 2M HCl

    International Nuclear Information System (INIS)

    Emreguel, Kaan C.; Hayvali, Mustafa

    2006-01-01

    The inhibiting action of a Schiff base 4-[(4-hydroxy-3-hydroxymethyl-benzylidene)-amino]-1,5-dimethyl-2-phenyl-1,2 -dihydro-pyrazol-3-one (phv), derived from 4-amino-1,5-dimethyl-2-phenyl-1,2-dihydro-pyrazol-3-one (phz) and 4-hydroxy-3-methoxy-benzaldehyde (vn), towards the corrosion behavior of steel in 2M HCl solution has been studied using weight loss, polarization and electrochemical impedance spectroscopy (EIS) techniques. Although vn and phz were found to retard the corrosion rate of steel, the compound synthesized from vn and phz was seen to retard the corrosion rate even more. At constant temperature, the corrosion rate decreases with increasing inhibitor concentration. However, at any inhibitor concentration the increase in temperature leads to an increase in the corrosion rate of steel. The activations energies, ΔE a , as well as other thermodynamic parameters (ΔG ads 0 , ΔH ads 0 ) for the inhibitor process were calculated. The inhibitor efficiencies calculated from all the applied methods were in agreement and were found to be in the order: phv>phz>vn

  20. Collaborative Research: Calibration for IMS Stations in Eastern Asia

    Science.gov (United States)

    2007-07-01

    Atomnaya Energia , Vol.87, Issue 3, 1989 (in Russian). 142 BondAr, I. Combining 1-D models for regional calibration, in Proceedings of a Workshop on IMS...Zelentsov and V.N. Mikhailov, Characteristics of 96 underground nuclear explosions at the Semipalatinsk Test Site, Atomaya Energia , (in Russian), Vol. 67

  1. Blood pressure control with selective vagal nerve stimulation and minimal side effects

    Science.gov (United States)

    Plachta, Dennis T. T.; Gierthmuehlen, Mortimer; Cota, Oscar; Espinosa, Nayeli; Boeser, Fabian; Herrera, Taliana C.; Stieglitz, Thomas; Zentner, Joseph

    2014-06-01

    Objective. Hypertension is the largest threat to patient health and a burden to health care systems. Despite various options, 30% of patients do not respond sufficiently to medical treatment. Mechanoreceptors in the aortic arch relay blood pressure (BP) levels through vagal nerve (VN) fibers to the brainstem and trigger the baroreflex, lowering the BP. Selective electrical stimulation of these nerve fibers reduced BP in rats. However, there is no technique described to localize and stimulate these fibers inside the VN without inadvertent stimulation of non-baroreceptive fibers causing side effects like bradycardia and bradypnea. Approach. We present a novel method for selective VN stimulation to reduce BP without the aforementioned side effects. Baroreceptor compound activity of rat VN (n = 5) was localized using a multichannel cuff electrode, true tripolar recording and a coherent averaging algorithm triggered by BP or electrocardiogram. Main results. Tripolar stimulation over electrodes near the barofibers reduced the BP without triggering significant bradycardia and bradypnea. The BP drop was adjusted to 60% of the initial value by varying the stimulation pulse width and duration, and lasted up to five times longer than the stimulation. Significance. The presented method is robust to impedance changes, independent of the electrode's relative position, does not compromise the nerve and can run on implantable, ultra-low power signal processors.

  2. Fulltext PDF

    Indian Academy of Sciences (India)

    2011-05-16

    May 16, 2011 ... after the Second World War, this means that such long molecules ..... Allen GE 1978 Thomas Hunt Morgan: The man and his science. (Princeton: ... Koltzoff NK and Schra-der VN 1933 Artificial control of sex in the progeny of ...

  3. 78 FR 27939 - Draft Interagency Risk Assessment-Listeria monocytogenes

    Science.gov (United States)

    2013-05-13

    ... Listeria (L.) monocytogenes contamination of certain ready-to-eat (RTE) foods, for example cheese, deli... Scott, V.N., Survey of Listeria monocytogenes in ready-to-eat foods. Journal of Food Protection, 2003... monocytogenes in ready-to-eat processed meat and poultry collected in four FoodNet states in International...

  4. High-Resolution Nuclear Magnetic Resonance Determination of Transfer RNA Tertiary Base Pairs in Solution. 2. Species Containing a Large Variable Loop

    NARCIS (Netherlands)

    HURD, RE; ROBILLARD, GT; REID, BR

    1977-01-01

    The number of base pairs in the solution structure of several class III D3VN tRNA species from E. coli has been determined by analyzing the number of low-field (-15 to -11 ppm) proton resonances in their nuclear magnetic resonance spectra at 360 MHz. Contrary to previous reports indicating the

  5. Service facilities

    International Nuclear Information System (INIS)

    Lestyan, Ernoe

    1988-01-01

    Major structural features of the supplementary buildings where among others the cloack-rooms, laundries, the dosimetric and radiochemical laboratories are situated are given. Additional buildings, not in close connection with the technology such as the central office, chemical water pretreatment, boiler, heat centre, transducer station, kitchen, canteen etc. are listed. Ground plans and photos are presented. (V.N.) 11 figs

  6. Lithiation Kinetics in High-Performance Porous Vanadium Nitride Nanosheet Anode

    International Nuclear Information System (INIS)

    Peng, Xiang; Li, Wan; Wang, Lei; Hu, Liangsheng; Jin, Weihong; Gao, Ang; Zhang, Xuming; Huo, Kaifu; Chu, Paul K.

    2016-01-01

    Vanadium nitride (VN) is promising in lithium ion battery (LIB) anode due to its high energy density, chemical stability, and corrosion resistivity. Herein, porous VN nanosheets are synthesized hydrothermally followed by an ammonia treatment. The porous nanosheets offer a large interfacial area between the electrode and electrolyte as well as short Li + diffusion path and consequently, the VN nanosheets electrode has high capacity and rate capability as an anode in LIB. The VN anode delivers a high reversible capacity of 455 mAh g −1 at a current density of 100 mA g −1 and it remains at 341 mAh g −1 when the current density is increased to 1 A g −1 . The charge transfer and Li + diffusion kinetics during the lithiation process is studied systematically. A highly stable SEI film is formed during the initial discharging-charging cycles to achieve a long cycle life and sustained capacity at a high level for 250 discharging-charging cycles without deterioration. This work demonstrates the preparation of high-performance LIB anode materials by a simple method and elucidates the lithiation kinetics.

  7. Increased gum arabic production after infestation of Acacia senegal ...

    African Journals Online (AJOL)

    Jane

    2011-07-20

    Jul 20, 2011 ... chemical properties of gum were determined for infested and control trees. A. senegal infested by A. ... also in the textile, pottery, lithography, cosmetics and ... Deforestation within the gum belt has lead to an increase in desert .... Atomic Absorption = V*N EDTA*1000/Volume of extract (mg/l). Where, V is the ...

  8. Effectiveness of Vertex Nomination via Seeded Graph Matching to Find Bijections Between Similar Networks

    Science.gov (United States)

    2018-02-01

    Information Directorate This report is published in the interest of scientific and technical information exchange, and its publication does not...the current prototype. 15. SUBJECT TERMS Vertex Nomination via Seeded Graph Matching (VN via SGM), Seeded Graph Matching (SGM), Vertex of Interest (VOI...Author’s Example ................................................................................................................. 4 4.2.2 Simple

  9. On the role of Nb in Z-phase formation in a 12% Cr steel

    DEFF Research Database (Denmark)

    Cipolla, L.; Danielsen, Hilmar Kjartansson; Di Nunzio, P.E.

    2010-01-01

    Z-phase precipitation in two model alloys, 12CrVNbN and 12CrVN, has been investigated. The alloys were aged up to 104 h and their precipitate evolution was followed by X-ray diffraction and transmission electron microscopy. The formation rate of Z-phase from vanadium-based nitrides, (V,Nb)N, in t...

  10. Engineering Design Handbook: Analysis and Design of Automotive Brake Systems.

    Science.gov (United States)

    1976-12-01

    Highway Safety Research institute, Uni- versity of Michigan, September 15, 1972. IF’vn = (I - #)WT’,Kk I1, J. E. Bernard , et al,, A Computer Based...systems involve the reduction in brake line pres- 4. E. L. Cornwell , "Automatic Load-Sensitive Air sure for a given pedal force, the pedal force/de

  11. Z Facebooku

    Czech Academy of Sciences Publication Activity Database

    Janáček, Pavel; Typlt, J.; Hájek, J.; Kůs, T.; Kuneš, A.; Zadrobílková, Z.

    2013-01-01

    Roč. 14, č. 7 (2013), s. 10-11 ISSN 1804-963X Institutional support: RVO:68378068 Keywords : Czech literature * Trávníček, Jiří * researches of reading Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Unity in variety

    Directory of Open Access Journals (Sweden)

    Anna G. Alyabyeva

    2016-08-01

    Full Text Available Review: Karelina E.K. Istoriya tuvinskoy muzyki ot padenia dinastiyi Tsin i do nashih dney (History of Tuvan music from the downfall of the Qing Dynasty till present day: research / scientific editor Doctor of Art V.N. Yunusov. Moscow: Composer publishing house, 2009. 552 p.

  13. Bibliography on Cold Regions Science and Technology. Volume 39, Part 2, 1985,

    Science.gov (United States)

    1985-12-01

    of altitudinal belts in Panties . Ukhacheva, V.N., 39-904 %99 ~713 ng 917P P a tl 84 p649 rs~39357 Power supply to the eastern section of the 8AM... girl 39-4012 (Himalaya Mts.). Zheng. B., (1984, p 9 . 4 . chi] 9 3 2 ne emfotcn~~~, %See. Drilling flaids Changsi emafrost indce bcnsrution

  14. PAC-Learning from General Examples

    DEFF Research Database (Denmark)

    Fischer, Paul; Hoeffgen, K.- U.; Lefmann, H.

    1997-01-01

    dimension of a target class with respect to a sample class, which replaces the Vapnik-Chervonenkis dimension (V.N. Vapnik and A.Y. Chervonenkis, 1971). The investigation of structural aspects of the relative dimension is followed by its applications to learning environments. It turns out that computing...

  15. Punishment of Minor Female Genital Ritual Procedures: Is the Perfect the Enemy of the Good?

    Science.gov (United States)

    Jacobs, Allan J; Arora, Kavita Shah

    2017-08-01

    Female genital alteration (FGA) is any cutting, removal or destruction of any part of the external female genitalia. Various FGA practices are common throughout the world. While most frequent in Africa and Asia, transglobal migration has brought ritual FGA to Western nations. All forms of FGA are generally considered undesirable for medical and ethical reasons when performed on minors. One ritual FGA procedure is the vulvar nick (VN). This is a small laceration to the vulva that does not cause morphological changes. Besides being performed as a primary ritual procedure it has been proposed as a substitute for more extensive forms of FGA. Measures advocated or taken to reduce the burden of FGA can be punitive or non-punitive. Even if it is unethical to perform VN, we argue that it also is unethical to attempt to suppress it through punishment. First, punishment of VN is likely to cause more harm than good overall, even to those ostensibly being protected. Second, punishment is likely to exceed legitimate retributive ends. We do not argue in favor of performing VN. Rather, we argue that non-punitive strategies such as education and harm reduction should be employed. © 2016 John Wiley & Sons Ltd.

  16. Stravinsky: Symphonies, Concertos, Ballets and other works / David S. Gutman

    Index Scriptorium Estoniae

    Gutman, David S.

    1994-01-01

    Uuest heliplaadist "Stravinsky: Symphonies, Concertos, Ballets and other works. Gabriele Schnaut (sop), Peter Svensson (ten), Franz Grundheber (bar), Günther von Kannen (bass), Jean Piat (narr), Lydia Mordkovitch (vn), Geoffrey Tozer, Boris Berman (pfs), Suisse Romande Chamber Choir, Lausanne Pro Arte Choir, Brassus Choral Society, Suisse Romande Ochestra, Neeme Järvi. Chandos CD CHAN 9240

  17. Eliciting end users requirements of a supportive system for tacit knowledge management processes in value networks : A Delphi study

    NARCIS (Netherlands)

    Bagheri, S.; Kusters, R.J.; Trienekens, J.J.M.

    2018-01-01

    Co-creation value with the aim of enhancing customer experience - through providing integrated solutions - relies on networked collaborations of multiple service providers and customers within value network (VN) settings. The customer-centric view of such collaborations highlights the importance of

  18. Transverse and longitudinal event-by-event flow fluctuations of $v_1$−$v_4$ in 5.02 TeV Pb+Pb collisions with the ATLAS detector

    CERN Document Server

    Zhou, Mingliang; The ATLAS collaboration

    2018-01-01

    Multi-particle flow correlations in Pb+Pb collisions provide unique insight into the nature of event-by-event fluctuations of the initial eccentricity as well as final state dynamics in the transverse and longitudinal directions. This talk presents a detailed study of transverse flow fluctuations using 4 and 6-particle cumulants $v_n\\{4\\}$ and $v_n\\{6\\}$ for $n=1,2,3$ and 4. This includes several new results: the first measurement of a negative dipolar flow $v_1\\{4\\}$; a high-precision measurement of $v_4\\{4\\}$, changing sign around 20-25$\\%$ centrality; observation of an intriguing sign-change pattern of $v_2\\{4\\}$ and $v_2\\{6\\}$ in ultra-central collisions; a detailed study of the cumulant ratio $v_n\\{6\\}/v_n\\{4\\}$ which shows significant deviation of $v_2$ and $v_3$ from both Bessel-Gaussian and elliptic-power distributions. The three-subevent cumulant method is used to show that these results are unlikely to be due to non-flow effects. The talk also presents a detailed study of the longitudinal dynamics o...

  19. ~nKort kroniek van die Suid-Afrikaanse Weennag

    African Journals Online (AJOL)

    Cheetahs" in. November. 1950 by K-24-lugbasis naby die. Noord-Koreaanse hoofstad van Pyongyang ont- plooi as deel van die Amerikaanse. Lugmag se. 6 002de Taktiese Ondersteuningsvleuel. Die Suid-Afrikaanse vlieeniers is onmiddellik aangewend ter ondersteuning van die aanrukkende. VN-magte, maar met die ...

  20. Vietnam as a Case Example of School-Based Mental Health Services in Low and Middle Income Countries: Efficacy and Effects of Risk Status

    Science.gov (United States)

    Dang, Hoang-Minh; Weiss, Bahr; Nguyen, Cao Minh; Tran, Nam; Pollack, Amie

    2017-01-01

    The purposes of this study were to (a) assess the efficacy of a universal classroom-based mental health and social skills program for primary school students in Vietnam, and (b) given the universal nature of the intervention, assess outcomes as a function of risk status (high versus low). RECAP-VN is a semi-structured program that provides…