Huang, Chen; Morlighem, Jean-Étienne Rl; Zhou, Hefeng; Lima, Érica P; Gomes, Paula B; Cai, Jing; Lou, Inchio; Pérez, Carlos D; Lee, Simon Ming; Rádis-Baptista, Gandhi
2016-10-05
Protopalythoa is a zoanthid that, together with thousands of predominantly marine species, such as hydra, jellyfish, and sea anemones, composes the oldest eumetazoan phylum, i.e., the Cnidaria. Some of these species, such as sea wasps and sea anemones, are highly venomous organisms that can produce deadly toxins for preying, for defense or for territorial disputes. Despite the fact that hundreds of organic and polypeptide toxins have been characterized from sea anemones and jellyfish, practically nothing is known about the toxin repertoire in zoanthids. Here, based on a transcriptome analysis of the zoanthid Protopalythoa variabilis, numerous predicted polypeptides with canonical venom protein features are identified. These polypeptides comprise putative proteins from different toxin families: neurotoxic peptides, hemostatic and hemorrhagic toxins, membrane-active (pore-forming) proteins, protease inhibitors, mixed-function venom enzymes, and venom auxiliary proteins. The synthesis and functional analysis of two of these predicted toxin products, one related to the ShK/Aurelin family and the other to a recently discovered anthozoan toxin, displayed potent in vivo neurotoxicity that impaired swimming in larval zebrafish. Altogether, the complex array of venom-related transcripts that are identified in P. variabilis, some of which are first reported in Cnidaria, provides novel insight into the toxin distribution among species and might contribute to the understanding of composition and evolution of venom polypeptides in toxiferous animals. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
International Nuclear Information System (INIS)
Wilke, Diego Veras; Jimenez, Paula Christine; Pessoa, Claudia; Moraes, Manoel Odorico de; Costa-Lotufo, Leticia Veras; Araujo, Renata Mendonca; Silva, Wildson Max Barbosa da; Silveira, Edilberto Rocha; Pessoa, Otilia Deusdenia Loiola; Braz-Filho, Raimundo; Lopes, Norberto Peporine
2009-01-01
Two lipidic α-amino acids 1a and 1b were isolated from the zoanthid Protopalythoa variabilis using a bioguided fractionation for cytotoxic activity. The structures of the metabolites were determined by spectroscopic methods, including NMR (nuclear magnetic resonance) 1 H and 13 C, IR infrared) and high resolution mass spectrometry (positive mode). The cytotoxic activity of the crude extract, as well as of the mixture of 1a and 1b were measured in vitro using the MTT assay for four human tumor cell lines. This finding has important biological and chemical implications for this type of compound. This is the first report of lipidic α-amino acids from natural sources, as well as of their cytotoxic activity. (author)
Almeida, Jose Gustavo L; Maia, Ana Isabel V; Wilke, Diego V; Silveira, Edilberto R; Braz-Filho, Raimundo; La Clair, James J; Costa-Lotufo, Leticia V; Pessoa, Otília Deusdenia L
2012-12-14
The zoanthids Palythoa caribaeorum and Protopalythoa variabilis are among the most abundant marine species along the Brazilian coast. We now report the isolation and structure elucidation of two unprecedented sulfonylated ceramides, palyosulfonoceramide A (1) and palyosulfonoceramide B (2) from specimens collected off Brazil's northeastern coast. The structures of 1 and 2 were established using a combination of NMR analyses, including: evaluation of 1H, 13C, ¹H--¹H COSY, ¹H--¹³C HSQC, ¹H--¹³C HMBC, and ¹H--¹⁵N HMBC NMR spectra, high-resolution mass spectrometry and chemical degradation. In addition, we also isolated the corresponding known ceramides, N-((2S,3R,4E,8E)-1, 3-dihydroxyoctadeca-4,8-dien-2-yl)-hexadecanamide (3) and N-((2S,3R,4E)-1,3-dihydroxy octadeca-4-en-2-yl)-hexadecanamide (4), which provided further support for the assignments of 1 and 2.
Almeida, Jose Gustavo L.; Maia, Ana Isabel V.; Wilke, Diego V.; Silveira, Edilberto R.; Braz-Filho, Raimundo; La Clair, James J.; Costa-Lotufo, Leticia V.; Pessoa, Otília Deusdenia L.
2012-01-01
The zoanthids Palythoa caribaeorum and Protopalythoa variabilis are among the most abundant marine species along the Brazilian coast. We now report the isolation and structure elucidation of two unprecedented sulfonylated ceramides, palyosulfonoceramide A (1) and palyosulfonoceramide B (2) from specimens collected off Brazil’s northeastern coast. The structures of 1 and 2 were established using a combination of NMR analyses, including: evaluation of 1H, 13C, 1H–1H COSY, 1H...
Directory of Open Access Journals (Sweden)
H. K. Boscolo
2005-02-01
Full Text Available The reproductive biology of Palythoa caribaeorum (Duchassaing & Michelotti 1860 and Protopalythoa variabilis (Duerden 1898 was studied through monthly samples from tagged colonies from June 1996 to June 1997, in São Sebastião channel, São Paulo, Brazil (45º26'W, 23º50'S. The gametogenesis was similar to that of other zoanthids as shown by histological preparations. Oocyte diameters and maturation stages of testis vesicles were evaluated on squash preparations. Both species showed sequential protogynic hermaphroditism, with high frequency of fertile polyps (83% in P. variabilis and 72% in P. caribaeorum, high frequency of colonies in female sex condition (65.3% of P. variabilis and 41.7% of P. caribaeorum, and apparently continuous gametogenesis. In P. caribaeorum, egg release was continuous and sperm release took place during half of the analyzed period. In P. variabilis, egg and sperm release occurred in April-May and February-March 1997, respectively.A biologia reprodutiva de Palythoa caribaeorum (Duchassaing & Michelotti 1860 e Protopalythoa variabilis (Duerden 1898 foi estudada por amostras mensais de colônias etiquetadas de junho de 1996 a junho de 1997, no canal de São Sebastião, São Paulo, Brasil (45º26'W, 23º50'S. A gametogênese apresentou-se semelhante à de outros zoantídeos, como evidenciado em preparações histológicas. O diâmetro dos oócitos e os estágios de maturação dos folículos testiculares foram avaliados por preparações do tipo "squash". Ambas as espécies mostraram hermafroditismo seqüencial protogínico, com alta freqüência de pólipos férteis (83% em P. variabilis e 72% em P. caribaeorum e de colônias na condição sexual feminina (65,3% para P. variabilis e 41,7% para P. caribaeorum, e, aparentemente, gametogênese contínua. Em P. caribaeorum, a liberação de oócitos foi contínua e a liberação de espermatozóides ocorreu durante metade do período analisado. Para P. variabilis, a libera
Directory of Open Access Journals (Sweden)
Otília Deusdenia L. Pessoa
2012-12-01
Full Text Available The zoanthids Palythoa caribaeorum and Protopalythoa variabilis are among the most abundant marine species along the Brazilian coast. We now report the isolation and structure elucidation of two unprecedented sulfonylated ceramides, palyosulfonoceramide A (1 and palyosulfonoceramide B (2 from specimens collected off Brazil’s northeastern coast. The structures of 1 and 2 were established using a combination of NMR analyses, including: evaluation of 1H, 13C, 1H–1H COSY, 1H–13C HSQC, 1H–13C HMBC, and 1H–15N HMBC NMR spectra, high-resolution mass spectrometry and chemical degradation. In addition, we also isolated the corresponding known ceramides, N-((2S,3R,4E,8E-1, 3-dihydroxyoctadeca-4,8-dien-2-yl-hexadecanamide (3 and N-((2S,3R,4E-1,3-dihydroxy octadeca-4-en-2-yl-hexadecanamide (4, which provided further support for the assignments of 1 and 2.
Almeida, Jose Gustavo L.; Maia, Ana Isabel V.; Wilke, Diego V.; Silveira, Edilberto R.; Braz-Filho, Raimundo; La Clair, James J.; Costa-Lotufo, Leticia V.; Pessoa, Otília Deusdenia L.
2012-01-01
The zoanthids Palythoa caribaeorum and Protopalythoa variabilis are among the most abundant marine species along the Brazilian coast. We now report the isolation and structure elucidation of two unprecedented sulfonylated ceramides, palyosulfonoceramide A (1) and palyosulfonoceramide B (2) from specimens collected off Brazil’s northeastern coast. The structures of 1 and 2 were established using a combination of NMR analyses, including: evaluation of 1H, 13C, 1H–1H COSY, 1H–13C HSQC, 1H–13C HMBC, and 1H–15N HMBC NMR spectra, high-resolution mass spectrometry and chemical degradation. In addition, we also isolated the corresponding known ceramides, N-((2S,3R,4E,8E)-1,3-dihydroxyoctadeca-4,8-dien-2-yl)-hexadecanamide (3) and N-((2S,3R,4E)-1,3-dihydroxyoctadeca-4-en-2-yl)-hexadecanamide (4), which provided further support for the assignments of 1 and 2. PMID:23242205
Boscolo, H K; Silveira, F L
2005-02-01
The reproductive biology of Palythoa caribaeorum (Duchassaing & Michelotti 1860) and Protopalythoa variabilis (Duerden 1898) was studied through monthly samples from tagged colonies from June 1996 to June 1997, in Sao Sebastiao channel, São Paulo, Brazil (45 degrees 26'W, 23 degrees 50'S). The gametogenesis was similar to that of other zoanthids as shown by histological preparations. Oocyte diameters and maturation stages of testis vesicles were evaluated on squash preparations. Both species showed sequential protogynic hermaphroditism, with high frequency of fertile polyps (83% in P. variabilis and 72% in P. caribaeorun), high frequency of colonies in female sex condition (65.3% of P variabilis and 41.7% of P caribaeorum), and apparently continuous gametogenesis. In P. caribaribaeonrum, egg release was continuous and sperm release took place during half of the analyzed period. In P. variabilis, egg and sperm release occurred in April-May and February-March 1997, respectively.
Cruz, Igor Cristino Silva; Meira, Verena Henschen; de Kikuchi, Ruy Kenji Papa; Creed, Joel Christopher
2016-04-01
Phase shift phenomena are becoming increasingly common. However, they are also opportunities to better understand how communities are structured. In Southwest Atlantic coral reefs, a shift to the zoanthid Palythoa cf. variabilis dominance has been described. To test if competition drove this process, we carried out a manipulative experiment with three coral species. To estimate the natural frequency of encounters we assess the relationship between the proportion of encounters and this zoanthids coverage. The contact causes necrosis in 78% of coral colonies (6.47 ± SD 7.92 cm(2)) in 118 days. We found a logarithmic relationship between the proportion of these encounters and the cover of P. cf. variabilis, where 5.5% coverage of this zoanthid is enough to put 50% of coral colonies in contact, increasing their partial mortality. We demonstrate that zoanthid coverage increase followed by coral mortality increase will reduce coral cover and that competition drives the phase shift process. Copyright © 2016 Elsevier Ltd. All rights reserved.
Steroids from the Brazilian Zoanthids Palythoa caribaeorum and Palythoa variabilis
Pinto, Francisco C. L.; Almeida, José Gustavo L.; Silveira, Edilberto R.; Costa, Arinice M.; Guimarães, Larissa A.; Wilke, Diego V.; Costa-Lotufo, Letícia V.; Torres, Maria da Conceição M.; Pessoa, Otília Deusdênia L.
2017-01-01
Two unreported ergostane-type sterols 24(R)-7α-hydroperoxy-ergost-5-en-3β-ol and 6β-carboxyl-24(R)-(8→6)-abeo-ergostan-3β,5β-diol, along with seven known ones were isolated from the hexane and alcohol extracts from the zoanthids Palythoa caribaeorum and Palythoa variabilis. The structures of the new compounds were determined using spectroscopic techniques, including 1D and 2D nuclear magnetic resonance (NMR), high-resolution electrospray ionization mass spectrom...
Directory of Open Access Journals (Sweden)
Emanuelle Fontenele Rabelo
2013-03-01
Full Text Available Sessile organisms that live in consolidated substrates frequently compete for space. Coral species have many strategies to face this competition, including harming their opponents or hindering their growth. In the present study, the competitive interactions between three species of zoanthids were investigated in the intertidal zone of a sandstone reef environment in northeastern Brazil. The competitive abilities of the three species were evaluated by periodic observation of the natural fringes of contact and experimental evaluation of their growth rate through removal of 100 cm² of colonies of each species. Palythoa caribaeorum and Zoanthus sociatus had similar growth rates, and both species grew faster than Protopalythoa variabilis. The recolonization strategy seems to differ among species. The contact fringes between P. caribaeorum and Z. sociatus remained unchanged over time, without any type of aggressive interaction between them, suggesting that stand-off was the strategy used by these organisms. Palythoa caribaeorum and Z. sociatus grew among the polyps of P. variabilis, often killing its colonies. The coexistence of zoanthids reveals a capacity for survival in the face of competition for limited resources such as free substrate, which led to the colonization and establishment of zoanthids in intertidal environments.A competição por espaço é comum em organismos sésseis que vivem em substrato consolidado. Os corais apresentam muitas estratégias para competição por espaço, incluindo danos ao oponente ou inibição do crescimento. No presente estudo, as interações competitivas entre três espécies de zoantídeos foram investigadas em um ambiente de recifes de arenito no nordeste brasileiro. As habilidades competitivas dos zoantídeos foram analisadas por observações periódicas das margens de contato entre as colônias em ambiente natural e avaliação experimental da taxa de crescimento, através da remoção de uma área de
DAILY BUDGETS OF PHOTOSYNTHETICALLY FIXED CARBON IN SYMBIOTIC ZOANTHIDS.
Steen, R Grant; Muscatine, L
1984-10-01
We tested the hypothesis that some zoanthids are able to meet a portion of their daily respiratory carbon requirement with photosynthetic carbon from symbiotic algal cells (= zooxanthellae). A daily budget was constructed for carbon (C) photosynthetically fixed by zooxanthellae of the Bermuda zoanthids Zoanthus sociatus and Palythoa variabilis. Zooxanthellae have an average net photosynthetic C fixation of 7.48 and 15.56 µgC·polyp -1 ·day -1 for Z. sociatus and P. variabilis respectively. The C-specific growth rate (µ c ) was 0.215·day -1 for Z. sociatus and 0.152·day -1 for P. variabilis. The specific growth rate (µ) of zooxanthellae in the zoanthids was measured to be 0.011 and 0.017·day -1 for Z. sociatus and P. variabilis zooxanthellae respectively. Z. sociatus zooxanthellae translocated 95.1% of the C assimilated in photosynthesis, while P. variabilis zooxanthellae translocated 88.8% of their fixed C. As the animal tissue of a polyp of Z. sociatus required 14.75 µgC·day -1 for respiration, and one of P. variabiis required 105.54 µgC·day -1 , the contribution of zooxanthellae to animal respiration (CZAR) was 48.2% for Z. sociatus and 13.1% for P. variabilis.
Effect of holothurian and zoanthid extracts on growth of some bacterial and diatom species
Digital Repository Service at National Institute of Oceanography (India)
Gonsalves, C.
The antifouling properties of the extracts from two zoanthids, viz. Zoanthus sp, Protopalythoa sp and one holothurian species, viz. Holothuria leucospilota occurring in the coastal waters off Goa were tested against 5 bacteria and 2 diatom species...
Directory of Open Access Journals (Sweden)
Jean-Étienne R. L. Morlighem
2018-06-01
Full Text Available Marine invertebrates, such as sponges, tunicates and cnidarians (zoantharians and scleractinian corals, form functional assemblages, known as holobionts, with numerous microbes. This type of species-specific symbiotic association can be a repository of myriad valuable low molecular weight organic compounds, bioactive peptides and enzymes. The zoantharian Protopalythoa variabilis (Cnidaria: Anthozoa is one such example of a marine holobiont that inhabits the coastal reefs of the tropical Atlantic coast and is an interesting source of secondary metabolites and biologically active polypeptides. In the present study, we analyzed the entire holo-transcriptome of P. variabilis, looking for enzyme precursors expressed in the zoantharian-microbiota assemblage that are potentially useful as industrial biocatalysts and biopharmaceuticals. In addition to hundreds of predicted enzymes that fit into the classes of hydrolases, oxidoreductases and transferases that were found, novel enzyme precursors with multiple activities in single structures and enzymes with incomplete Enzyme Commission numbers were revealed. Our results indicated the predictive expression of thirteen multifunctional enzymes and 694 enzyme sequences with partially characterized activities, distributed in 23 sub-subclasses. These predicted enzyme structures and activities can prospectively be harnessed for applications in diverse areas of industrial and pharmaceutical biotechnology.
Effects of crude oil on the feeding behaviour of the zoanthid Palythoa variabilis.
Reimer, A A
1975-01-01
Palythoa variabilis (Duerden 1898) has a well-coordinated, sterotyped feeding response similar to that described for other zoanthids. The feeding reaction can be elicited by the heterocyclic amino acid proline and by some of its analogs. The addition of an OH group (hydroxyproline) or of a glycyl group (prolylglycine) annuls the activity of the proline molecule. Substitutions (thiazolidine-4-carboxylic acid) or additions (glycylproline) to the amino group do not alter the effectivity of the activator. The size of the ring can be altered within certain limits (azetidine-2-carbocylic acid and pipecolic acid) without affecting the activity of the molecule. Feeding reactions culminating with ingestion can be elicited by Marine Diesel and Bunker-C oils. Exposure to oil affects the ability of polyps to discriminate between inert and chemically active particles for 3 to 5 days; responses to proline are not altered for at least 3 days following the exposure, but become slower and are present in fewer polyps after that period. Oil is retained in the coelenteron for several days following exposure and is periodically released in the form of timy droplets.
Sinniger, Frederic; Ocaña, Oscar V; Baco, Amy R
2013-01-01
The Hawaiian gold coral has a history of exploitation from the deep slopes and seamounts of the Hawaiian Islands as one of the precious corals commercialised in the jewellery industry. Due to its peculiar characteristic of building a scleroproteic skeleton, this zoanthid has been referred as Gerardia sp. (a junior synonym of Savalia Nardo, 1844) but never formally described or examined by taxonomists despite its commercial interest. While collection of Hawaiian gold coral is now regulated, globally seamounts habitats are increasingly threatened by a variety of anthropogenic impacts. However, impact assessment studies and conservation measures cannot be taken without consistent knowledge of the biodiversity of such environments. Recently, multiple samples of octocoral-associated zoanthids were collected from the deep slopes of the islands and seamounts of the Hawaiian Archipelago. The molecular and morphological examination of these zoanthids revealed the presence of at least five different species including the gold coral. Among these only the gold coral appeared to create its own skeleton, two other species are simply using the octocoral as substrate, and the situation is not clear for the final two species. Phylogenetically, all these species appear related to zoanthids of the genus Savalia as well as to the octocoral-associated zoanthid Corallizoanthus tsukaharai, suggesting a common ancestor to all octocoral-associated zoanthids. The diversity of zoanthids described or observed during this study is comparable to levels of diversity found in shallow water tropical coral reefs. Such unexpected species diversity is symptomatic of the lack of biological exploration and taxonomic studies of the diversity of seamount hexacorals.
Directory of Open Access Journals (Sweden)
Frederic Sinniger
Full Text Available The Hawaiian gold coral has a history of exploitation from the deep slopes and seamounts of the Hawaiian Islands as one of the precious corals commercialised in the jewellery industry. Due to its peculiar characteristic of building a scleroproteic skeleton, this zoanthid has been referred as Gerardia sp. (a junior synonym of Savalia Nardo, 1844 but never formally described or examined by taxonomists despite its commercial interest. While collection of Hawaiian gold coral is now regulated, globally seamounts habitats are increasingly threatened by a variety of anthropogenic impacts. However, impact assessment studies and conservation measures cannot be taken without consistent knowledge of the biodiversity of such environments. Recently, multiple samples of octocoral-associated zoanthids were collected from the deep slopes of the islands and seamounts of the Hawaiian Archipelago. The molecular and morphological examination of these zoanthids revealed the presence of at least five different species including the gold coral. Among these only the gold coral appeared to create its own skeleton, two other species are simply using the octocoral as substrate, and the situation is not clear for the final two species. Phylogenetically, all these species appear related to zoanthids of the genus Savalia as well as to the octocoral-associated zoanthid Corallizoanthus tsukaharai, suggesting a common ancestor to all octocoral-associated zoanthids. The diversity of zoanthids described or observed during this study is comparable to levels of diversity found in shallow water tropical coral reefs. Such unexpected species diversity is symptomatic of the lack of biological exploration and taxonomic studies of the diversity of seamount hexacorals.
Chimetto, L A; Brocchi, M; Gondo, M; Thompson, C C; Gomez-Gil, B; Thompson, F L
2009-06-01
A taxonomic survey of the vibrios associated with the Brazilian endemic coral Mussismilia hispida and the sympatric zoanthids (i.e. Palythoa caribaeorum, Palythoa variabilis and Zoanthus solanderi). Mucus of 54 cnidarian specimens collected in three different places at São Sebastião in two consecutive years (i.e. 2005 and 2006) was used for taxonomic characterization of the cnidarian microbiota. Ninety-eight of the 151 vibrio isolates fell within the vibrio core group according to partial 16S rDNA sequences. We performed the sequencing of recA and pyrH genes of all vibrio isolates. The most abundant taxa belonged to the vibrio core group (Vibrio harveyi, Vibrio rotiferianus, Vibrio campbellii and Vibrio alginolyticus), Vibrio mediterranei (=Vibrio shillonii) and Vibrio chagasii. With the exception of V. chagasii which was found only in the mucus of M. hispida, the other species appeared in different hosts with no evidence for the presence of host-specific clones or species. Using rep-PCR analysis, we observed a high genomic heterogeneity within the vibrios. Each vibrio isolate generated a different rep-PCR fingerprint pattern. There was a complete agreement between the grouping based on rep-PCR and concatenated sequences of pyrH, recA and 16S rDNA, but the pyrH gene has the highest discriminatory power for vibrio species identification. The vibrio core group is dominant in the mucus of these cnidarians. There is a tremendous diversity of vibrio lineages within the coral mucus. pyrH gene sequences permit a clear-cut identification of vibrios. The taxonomic resolution provided by pyrH (but not recA) appears to be enough for identifying species of vibrios and for disclosing putative new taxa. The vibrio core group appears to be dominant in the mucus of the Brazilian cnidarians. The overrepresentation of these vibrios may reflect as yet unknown ecological functions in the coral holobiont.
Zoanthid diversity (Anthozoa: Hexacorallia) in the Galapagos Islands: a molecular examination
Reimer, J. D.; Sinniger, F.; Hickman, C. P.
2008-09-01
Although the Galapagos are famous for their unique biodiversity, many groups of marine invertebrates from this isolated archipelago remain understudied or not investigated. One such group is the zoanthids (Order Zoantharia, =Zoanthidea, =Zoanthiniaria), anthozoans (Cnidaria) found in marine ecosystems worldwide. Zoanthid taxonomy has been in a state of disorganization and neglect due in large part to the morphological plasticity within species and questions about the accuracy of traditionally used morphological and ecological characteristics. However, recent studies utilizing molecular methodology combined with morphology have proven to be very useful in understanding zoanthid diversity. The results of a survey of zoanthids from the Galapagos and the east Pacific are reported in this study. Shallow water (zoanthid specimens were identified using the molecular markers mitochondrial 16S ribosomal DNA (mt 16S rDNA), cytochrome oxidase subunit I (COI) gene, and the internal transcribed spacer of ribosomal DNA (ITS-rDNA). From the collected specimens seven putative zoanthid species-level clades from three known genera ( Zoanthus, Palythoa, Parazoanthus) were identified at the molecular level. These identifications were further supported by morphological and ecological data. While almost all specimens belonged to known zoanthid genera, based on unique molecular and ecological data one group of specimens (designated unknown zoanthid sp. “03-103”) is potentially a novel undescribed genus. Additionally, the remaining three azooxanthellate Parazoanthus clades may also be undescribed new species, but due to the overall lack of zoanthid research and descriptions from neighboring areas (East Pacific, west coast of South America) further research is needed to clearly ascertain this. Additionally, notes on the four observed nominal azooxanthellate zoanthid species and a key to all eight nominal (seven from known genera, one from a potentially new genus) shallow water zoanthid
Epizoic zoanthids reduce pumping in two Caribbean vase sponges
Lewis, T. B.; Finelli, C. M.
2015-03-01
Sponges are common sessile benthic suspension feeders that play a critical role in carbon and nitrogen cycling within reef ecosystems via their filtration capabilities. Due to the contribution of sponges in benthic-pelagic coupling, it is critical to assess factors that may affect their role in the healthy function of coral reefs. Several factors can influence the rate at which an individual sponge pumps water, including body size, environmental conditions, mechanical blockage, and reduction of inhalant pores (ostia). Symbiotic zoanthid colonization is a common occurrence on Caribbean sponges, and the presence of zoanthids on the surface of a sponge may occlude or displace the inhalant ostia. We quantified pumping rates of the giant barrel sponge, Xestospongia muta ( N = 22 uncolonized, 37 colonized) and the common vase sponge, Niphates digitalis ( N = 21 uncolonized, 17 colonized), with and without zoanthid symbionts, Parazoanthus catenularis and Parazoanthus parasiticus, respectively. For X. muta, biovolume-normalized pumping rates of individuals colonized by zoanthids were approximately 75 % lower than those of uncolonized sponges. Moreover, colonization with zoanthids was related to a difference in morphology relative to uncolonized individuals: Colonized sponges exhibited an osculum area to biovolume ratio that was nearly 65 % less than uncolonized sponges. In contrast, the presence of zoanthids on N. digitalis resulted in only a marginal decrease in pumping rates and no detectable difference in morphology. The difference in zoanthid effects between X. muta and N. digitalis is likely due to the differences in wall thickness and architecture between the two species. The probable cause of reduced pumping in affected sponges is occupation of the sponge surface that leads to blockage or displacement of inhalant ostia. To partially test this hypothesis, zoanthid colonization on specimens of X. muta was simulated by wrapping sponges with plastic mesh of varying
The phylogenetic position of the solitary zoanthid genus Sphenopus (Cnidaria: Hexacorallia)
Reimer, J.D.; Lin, M.; Fujii, T.
2012-01-01
The zoanthid genus Sphenopus (Cnidaria: Anthozoa: Zoantharia), like many other brachycnemic zoanthids, is found in shallow subtropical and tropical waters, but is uniquely unitary (solitary, monostomatous), azooxanthellate, and free-living. With sparse knowledge of its phylogenetic position, this
Biological activities of secondary metabolites of the order Zoanthids
Zahra Aminikhoei; Zeinab Janahmadi; Iraj Nabipour
2015-01-01
The phylum Cnidaria is a large, diverse and ecologically important group of marine invertebrates, which produce powerful toxins and venoms. The number of marine natural product from cnidarians isolated from class Anthozoa. Among the Anthozoa, the order of zoanthids are sessile, clonal and mostly brightly colored invertebrate which produce high biodiversity of cytolitic, neurotoxic and cardiotoxic compounds. Zoanthids containing palytoxins are reportedly among the most toxic marine organisms k...
Genetics Home Reference: erythrokeratodermia variabilis et progressiva
... Facebook Twitter Home Health Conditions EKVP Erythrokeratodermia variabilis et progressiva Printable PDF Open All Close All Enable ... view the expand/collapse boxes. Description Erythrokeratodermia variabilis et progressiva ( EKVP ) is a skin disorder that is ...
Palytoxin found in Palythoa sp. zoanthids (Anthozoa, Hexacorallia sold in the home aquarium trade.
Directory of Open Access Journals (Sweden)
Jonathan R Deeds
2011-04-01
Full Text Available Zoanthids (Anthozoa, Hexacorallia are colonial anemones that contain one of the deadliest toxins ever discovered, palytoxin (LD(50 in mice 300 ng/kg, but it is generally believed that highly toxic species are not sold in the home aquarium trade. We previously showed that an unintentionally introduced zoanthid in a home aquarium contained high concentrations of palytoxin and was likely responsible for a severe respiratory reaction when an individual attempted to eliminate the contaminant colonies using boiling water. To assess the availability and potential exposure of palytoxin to marine aquarium hobbyists, we analyzed zoanthid samples collected from local aquarium stores for palytoxin using liquid chromatography and high resolution mass spectrometry and attempted to identify the specimens through genetic analysis of 16S and cytochrome c oxidase 1 (COI markers. We found four specimens of the same apparent species of zoanthid, that we described previously to be responsible for a severe respiratory reaction in a home aquarium, to be available in three aquarium stores in the Washington D.C. area. We found all of these specimens (n = 4 to be highly toxic with palytoxin or palytoxin-like compounds (range 0.5-3.5 mg crude toxin/g zoanthid. One of the most potent non-protein compounds ever discovered is present in dangerous quantities in a select species of zoanthid commonly sold in the home aquarium trade.
Palytoxin found in Palythoa sp. zoanthids (Anthozoa, Hexacorallia) sold in the home aquarium trade.
Deeds, Jonathan R; Handy, Sara M; White, Kevin D; Reimer, James D
2011-04-04
Zoanthids (Anthozoa, Hexacorallia) are colonial anemones that contain one of the deadliest toxins ever discovered, palytoxin (LD(50) in mice 300 ng/kg), but it is generally believed that highly toxic species are not sold in the home aquarium trade. We previously showed that an unintentionally introduced zoanthid in a home aquarium contained high concentrations of palytoxin and was likely responsible for a severe respiratory reaction when an individual attempted to eliminate the contaminant colonies using boiling water. To assess the availability and potential exposure of palytoxin to marine aquarium hobbyists, we analyzed zoanthid samples collected from local aquarium stores for palytoxin using liquid chromatography and high resolution mass spectrometry and attempted to identify the specimens through genetic analysis of 16S and cytochrome c oxidase 1 (COI) markers. We found four specimens of the same apparent species of zoanthid, that we described previously to be responsible for a severe respiratory reaction in a home aquarium, to be available in three aquarium stores in the Washington D.C. area. We found all of these specimens (n = 4) to be highly toxic with palytoxin or palytoxin-like compounds (range 0.5-3.5 mg crude toxin/g zoanthid). One of the most potent non-protein compounds ever discovered is present in dangerous quantities in a select species of zoanthid commonly sold in the home aquarium trade.
Species Diversity of Shallow Water Zoanthids (Cnidaria: Anthozoa: Hexacorallia) in Florida
Reimer, James Davis; Foord, Colin; Irei, Yuka
2012-01-01
Shallow water zooxanthellate zoanthids are a common component of the coral reef ecosystems of the Caribbean. Despite this, their species diversity remains poorly understood. In this study, collected Palythoa, Zoanthus, Isaurus, and Terrazoanthus specimens from the waters of Florida were phylogenetically examined to obtain a better understanding of zoanthid species diversity in the Caribbean. Surprisingly, the results from analyses utilizing three DNA markers (mitochondrial 16S ribosomal DNA, ...
Leal, Miguel C; Rocha, Rui J M; Anaya-Rojas, Jaime M; Cruz, Igor C S; Ferrier-Pagès, Christine
2017-06-15
Zoanthids are conspicuous and abundant members of intertidal environments, where they are exposed to large environmental fluctuations and subject to increasing loads of anthropogenic nutrients. Here we assess the trophic ecology and stoichiometric consequences of nutrient loading for symbiotic zoanthids inhabiting different intertidal habitats. More specifically, we analysed the stable isotope signature (δ 13 C and δ 15 N), elemental composition (C, N and P) and stoichiometry (C:N, C:P, N:P) of Zoanthus sociatus differently exposed to nutrification. Results suggest that autotrophy is the main feeding mode of zoanthids and that the effect water nutrient content differently affects the elemental phenotype of zoanthids depending on tidal habitat. Additionally, habitat effects on Z. sociatus P-related stoichiometric traits highlight functional differences likely associated with variation in Symbiodinium density. These findings provide an innovative approach to assess how cnidarian-dinoflagellate symbioses response to ecosystem changes in environmentally dynamic reef flats, particularly nutrient loading. Copyright © 2017 Elsevier Ltd. All rights reserved.
Necrotizing fasciitis caused by Apophysomyces variabilis in an immunocompetent patient
Directory of Open Access Journals (Sweden)
José Y. Rodríguez
2018-06-01
Full Text Available Mucormycosis caused by Apophysomyces variabilis is rarely reported in humans. A case of A. variabilis infection in an immunocompetent men after friction burns in a car accident is described. The infection presented as a rapidly progressive necrotizing infection of the skin and soft tissue, which required extensive surgical debridement and total colonic defunctioning colostomy associated with prolonged antifungal therapy. A. variabilis infection should be considered as a differential diagnosis of rapidly progressive necrotizing skin and soft tissue infections in immunocompetent individuals. Keywords: Mucormycosis, Zygomycetes, Apophysomyces variabilis, Amphotericin B
Reimer, James Davis; Nakachi, Shu; Hirose, Mamiko; Hirose, Euichi; Hashiguchi, Shinji
2010-10-01
Zoanthids comprise an order of benthic, generally colonial cnidarians, which can usually be distinguished from other hexacorallians by embedded sand and detritus in their mesoglea to help strengthen their structure. These animals are becoming increasingly important research subjects in biochemistry and other research fields. Their inclusion of both calcium and silica results in the need for both decalcification and desilification for internal morphological examinations. Since the methodology of hydrofluoric acid (HF) desilification has rarely been documented in zoanthids, histological surveys for zoanthid taxonomy have often been abandoned and their taxonomy is often problematic. Recent investigations utilizing molecular methods have brought a clearer understanding of zoanthid diversity, but standardization of HF treatments are still needed to provide a link between molecular and more traditional techniques, and to properly examine specimens for which molecular methods may not be an option (e.g., formalin-preserved specimens, etc.). Here, we use both "straight" HF and, for the first time with zoanthids, buffered HF (BHF) treatments at different treatment lengths (1-48 h) on polyps from three different species of zoanthids for histological examination. Section conditions were judged based on the presence/absence of embedded detritus, drag marks, and tissue condition. Results show that the BHF treatment resulted in slightly better tissue conditions for all specimens, and suggest that desilification works well regardless of treatment time for species with smaller (polyp diameter zoanthid specimens.
Potential of DNA sequences to identify zoanthids (Cnidaria: Zoantharia).
Sinniger, Frederic; Reimer, James D; Pawlowski, Jan
2008-12-01
The order Zoantharia is known for its chaotic taxonomy and difficult morphological identification. One method that potentially could help for examining such troublesome taxa is DNA barcoding, which identifies species using standard molecular markers. The mitochondrial cytochrome oxidase subunit I (COI) has been utilized to great success in groups such as birds and insects; however, its applicability in many other groups is controversial. Recently, some studies have suggested that barcoding is not applicable to anthozoans. Here, we examine the use of COI and mitochondrial 16S ribosomal DNA for zoanthid identification. Despite the absence of a clear barcoding gap, our results show that for most of 54 zoanthid samples, both markers could separate samples to the species, or species group, level, particularly when easily accessible ecological or distributional data were included. Additionally, we have used the short V5 region of mt 16S rDNA to identify eight old (13 to 50 years old) museum samples. We discuss advantages and disadvantages of COI and mt 16S rDNA as barcodes for Zoantharia, and recommend that either one or both of these markers be considered for zoanthid identification in the future.
Species Diversity of Shallow Water Zoanthids (Cnidaria: Anthozoa: Hexacorallia in Florida
Directory of Open Access Journals (Sweden)
James Davis Reimer
2012-01-01
Full Text Available Shallow water zooxanthellate zoanthids are a common component of the coral reef ecosystems of the Caribbean. Despite this, their species diversity remains poorly understood. In this study, collected Palythoa, Zoanthus, Isaurus, and Terrazoanthus specimens from the waters of Florida were phylogenetically examined to obtain a better understanding of zoanthid species diversity in the Caribbean. Surprisingly, the results from analyses utilizing three DNA markers (mitochondrial 16S ribosomal DNA, cytochrome oxidase subunit I, and the internal transcribed spacer of ribosomal DNA showed the presence of at least eleven species, of which up to four appear undescribed. Additionally, the presence of the genus Terrazoanthus in the Caribbean was confirmed for the first time. Attempts to match phylogenetic species or clades with original literature were hampered by vague and short original descriptions, and it is clear that for Atlantic Palythoa and Zoanthus species an in-depth and multidisciplinary investigation is needed to reconcile recent phylogenetic results such as in this study with traditional taxonomy. Furthermore, most shallow water zoanthid species from Florida were observed to have close, sister-species relationships with previously investigated species in the Pacific Ocean. These results indicate that many brachycnemic zoanthid species likely had a Caribbean-Pacific distribution until the formation of the Isthmus of Panama. However, due to inadvertent redescriptions, overall species diversity in these two common genera is likely much lower than literature indicates.
Biological activities of secondary metabolites of the order Zoanthids
Directory of Open Access Journals (Sweden)
Zahra Aminikhoei
2015-11-01
Full Text Available The phylum Cnidaria is a large, diverse and ecologically important group of marine invertebrates, which produce powerful toxins and venoms. The number of marine natural product from cnidarians isolated from class Anthozoa. Among the Anthozoa, the order of zoanthids are sessile, clonal and mostly brightly colored invertebrate which produce high biodiversity of cytolitic, neurotoxic and cardiotoxic compounds. Zoanthids containing palytoxins are reportedly among the most toxic marine organisms known. In addition, a high concentration of zoanthamine alkaloids extracted from this group.The zoanthamine alkaloids were isolated over 20 years ago, exhibit a broad range of biological activities.The best studied and most well-known biological activity of zoanthamine derivative significantly suppressed bone resorption and enhanced bone formation.
Palytoxin Found in Palythoa sp. Zoanthids (Anthozoa, Hexacorallia) Sold in the Home Aquarium Trade
Deeds, Jonathan R.; Handy, Sara M.; White, Kevin D.; Reimer, James D.
2011-01-01
Zoanthids (Anthozoa, Hexacorallia) are colonial anemones that contain one of the deadliest toxins ever discovered, palytoxin (LD(50) in mice 300 ng/kg), but it is generally believed that highly toxic species are not sold in the home aquarium trade. We previously showed that an unintentionally introduced zoanthid in a home aquarium contained high concentrations of palytoxin and was likely responsible for a severe respiratory reaction when an individual attempted to eliminate the contaminant co...
シニゲル, フレデリック; OCANA, Oscar; BACO, Amy; SINNIGER, Frederic; OCANA, Oscar; BACO, Amy
2013-01-01
The Hawaiian gold coral has a history of exploitation from the deep slopes and seamounts of the Hawaiian Islands as one of the precious corals commercialised in the jewellery industry. Due to its peculiar characteristic of building a scleroproteic skeleton, this zoanthid has been referred as Gerardia sp. (a junior synonym of Savalia Nardo, 1844) but never formally described or examined by taxonomists despite its commercial interest. While collection of Hawaiian gold coral is now regulated, gl...
Costa-Lotufo, L V; Carnevale-Neto, F; Trindade-Silva, A E; Silva, R R; Silva, G G Z; Wilke, D V; Pinto, F C L; Sahm, B D B; Jimenez, P C; Mendonça, J N; Lotufo, T M C; Pessoa, O D L; Lopes, N P
2018-02-20
Metabolomic profiles were explored to understand environmental and taxonomic influences on the metabolism of two congeneric zoanthids, Palythoa caribaeorum and P. variabilis, collected across distinct geographical ranges. Integrated mass spectrometry data suggested the major influence of geographical location on chemical divergence when compared to species differentiation.
Sun, Wei; Zhang, Fengli; He, Liming; Li, Zhiyong
2014-05-01
Diverse sessile organisms inhabit the coral reef ecosystems, including corals, sponges, and sea anemones. In the past decades, scleractinian corals (Cnidaria, Anthozoa, Scleractinia) and their associated microorganisms have attracted much attention. Zoanthids (Cnidaria, Anthozoa, Zoanthidea) are commonly found in coral reefs. However, little is known about the community structure of zoanthid-associated microbiota. In this study, the microbial community associated with the zoanthid Palythoa australiae in the South China Sea was investigated by 454 pyrosequencing. As a result, 2,353 bacterial, 583 archaeal, and 36 eukaryotic microbial ribotypes were detected, respectively. A total of 22 bacterial phyla (16 formally described phyla and six candidate phyla) were recovered. Proteobacteria was the most abundant group, followed by Chloroflexi and Actinobacteria. High-abundance Rhizobiales and diverse Chloroflexi were observed in the bacterial community. The archaeal population was composed of Crenarchaeota and Euryarchaeota, with Marine Group I as the dominant lineage. In particular, Candidatus Nitrosopumilus dominated the archaeal community. Besides bacteria and archaea, the zoanthid harbored eukaryotic microorganisms including fungi and algae though their diversity was very low. This study provided the first insights into the microbial community associated with P. australiae by 454 pyrosequencing, consequently laid a basis for the understanding of the association of P. australiae-microbes symbioses.
Reimer, J.D.; Hirose, M.; Wirtz, P.
2010-01-01
The marine invertebrate fauna of the Cape Verde Islands contains many endemic species due to their isolated location in the eastern Atlantic, yet research has not been conducted on most taxa here. One such group are the zoanthids or mat anemones, an order of benthic cnidarians (Hexacorallia: Zoantharia) common in many marine environments. In this study, the diversity of zoanthids in the Cape Verde Islands is specifically examined for the first time. Field images and sampling are combined with...
Chronic rhino-orbital mucormycosis caused by Mucor irregularis (Rhizomucor variabilis) in India
We describe a chronic case of rhino-orbital zygomycosis caused by Mucor irregularis, formerly known as Rhizomucor variabilis var. variabilis, a rare mycotic agent in humans. The infection caused progressive destruction of the nasal septum, soft and hard palate, leading to collapse of the nose bridge...
The environmental source of emerging Apophysomyces variabilis infection in India.
Prakash, Hariprasath; Ghosh, Anup Kumar; Rudramurthy, Shivaprakash Mandya; Paul, Raees Ahmad; Gupta, Sunita; Negi, Vishwanand; Chakrabarti, Arunaloke
2016-08-01
The rare mucoraceous fungus, Apophysomyces species complex ranks second after Rhizopus arrhizus causing mucormycosis in India. The source of this agent in the environment is not clearly known. We conducted an environmental study to find its presence in Indian soil. The soil samples from different geographical locations were analyzed for isolation of Mucorales. Rhizopus arrhizus (24.6%) was most commonly isolated from soil, followed by Lichtheimia spp. (23.2%), Cunninghamella spp. (21.7%), Rhizopus microsporus (14%) and Apophysomyces spp. (4.5%). The isolation of Apophysomyces species complex was significantly associated with low nitrogen content of the soil. Based on sequencing of internal transcribed spacer (ITS) and 28S (D1/D2) regions of ribosomal DNA, the Apophysomyces isolates were identified as Apophysomyces variabilis with 98 to 100% similarity to type strain A. variabilis (CBS658.93). The analysis of amplified fragment length polymorphism (AFLP) fingerprinting data demonstrated genomic diversity of A. variabilis isolates with multiple clades (similarity 40-90%). The minimum inhibitory concentrations (MIC), MIC50 and MIC90 for A. variabilis isolates were 1 and 4 μg/ml for amphotericin B, 0.25 and 0.5 μg/ml for itraconazole, 0.125 and 0.25 μg/ml for posaconazole, 0.06 and 0.12 μg/ml for terbinafine, respectively. The present study revealed abundant presence of A. variabilis in Indian soil with low nitrogen content, its genetic heterogeneity and relatively high MICs for amphotericin B. © The Author 2016. Published by Oxford University Press on behalf of The International Society for Human and Animal Mycology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Ceraul, Shane M; Dreher-Lesnick, Sheila M; Mulenga, Albert; Rahman, M Sayeedur; Azad, Abdu F
2008-11-01
Here we report the novel bacteriostatic function of a five-domain Kunitz-type serine protease inhibitor (KPI) from the tick Dermacentor variabilis. As ticks feed, they release anticoagulants, anti-inflammatory and immunosuppressive molecules that mediate the formation of the feeding lesion on the mammalian host. A number of KPIs have been isolated and characterized from tick salivary gland extracts. Interestingly, we observe little D. variabilis KPI gene expression in the salivary gland and abundant expression in the midgut. However, our demonstration of D. variabilis KPI's anticoagulant properties indicates that D. variabilis KPI may be important for blood meal digestion in the midgut. In addition to facilitating long-term attachment and blood meal acquisition, gene expression studies of Drosophila, legumes, and ticks suggest that KPIs play some role in the response to microbial infection. Similarly, in this study, we show that challenge of D. variabilis with the spotted fever group rickettsia, Rickettsia montanensis, results in sustained D. variabilis KPI gene expression in the midgut. Furthermore, our in vitro studies show that D. variabilis KPI limits rickettsial colonization of L929 cells (mouse fibroblasts), implicating D. variabilis KPI as a bacteriostatic protein, a property that may be related to D. variabilis KPI's trypsin inhibitory capability. This work suggests that anticoagulants play some role in the midgut during feeding and that D. variabilis KPI may be involved as part of the tick's defense response to rickettsiae.
Temporal variation in Zoanthids abundance at Veraval Coast, Gujarat
Pradeep C. Mankodi
2014-01-01
The corals are very important due to its vulnerability due to environmental conditions. Further, competition within benthic community especially corals and other draw significant attention of scientists in last few decades. Here in this communication we are bring information on Zoanthids distribution and dominance during last 30 years at Veraval coast. Such change detection will be useful to ecologists and coastal zone planners.
Prakash, Hariprasath; Rudramurthy, Shivaprakash Mandya; Gandham, Prasad S; Ghosh, Anup Kumar; Kumar, Milner M; Badapanda, Chandan; Chakrabarti, Arunaloke
2017-09-18
Apophysomyces species are prevalent in tropical countries and A. variabilis is the second most frequent agent causing mucormycosis in India. Among Apophysomyces species, A. elegans, A. trapeziformis and A. variabilis are commonly incriminated in human infections. The genome sequences of A. elegans and A. trapeziformis are available in public database, but not A. variabilis. We, therefore, performed the whole genome sequence of A. variabilis to explore its genomic structure and possible genes determining the virulence of the organism. The whole genome of A. variabilis NCCPF 102052 was sequenced and the genomic structure of A. variabilis was compared with already available genome structures of A. elegans, A. trapeziformis and other medically important Mucorales. The total size of genome assembly of A. variabilis was 39.38 Mb with 12,764 protein-coding genes. The transposable elements (TEs) were low in Apophysomyces genome and the retrotransposon Ty3-gypsy was the common TE. Phylogenetically, Apophysomyces species were grouped closely with Phycomyces blakesleeanus. OrthoMCL analysis revealed 3025 orthologues proteins, which were common in those three pathogenic Apophysomyces species. Expansion of multiple gene families/duplication was observed in Apophysomyces genomes. Approximately 6% of Apophysomyces genes were predicted to be associated with virulence on PHIbase analysis. The virulence determinants included the protein families of CotH proteins (invasins), proteases, iron utilisation pathways, siderophores and signal transduction pathways. Serine proteases were the major group of proteases found in all Apophysomyces genomes. The carbohydrate active enzymes (CAZymes) constitute the majority of the secretory proteins. The present study is the maiden attempt to sequence and analyze the genomic structure of A. variabilis. Together with available genome sequence of A. elegans and A. trapeziformis, the study helped to indicate the possible virulence determinants of
Energy Technology Data Exchange (ETDEWEB)
Wang, L.; Gamez, A.; Archer, H.; Abola, E.E.; Sarkissian, C.N.; Fitzpatrick, P.; Wendt, D.; Zhang, Y.; Vellard, M.; Bliesath, J.; Bell, S.; Lemont, J.; Scriver, C.R.; Stevens, R.C.
2009-05-26
We have recently observed promising success in a mouse model for treating the metabolic disorder phenylketonuria with phenylalanine ammonia lyase (PAL) from Rhodosporidium toruloides and Anabaena variabilis. Both molecules, however, required further optimization in order to overcome problems with protease susceptibility, thermal stability, and aggregation. Previously, we optimized PAL from R. toruloides, and in this case we reduced aggregation of the A. variabilis PAL by mutating two surface cysteine residues (C503 and C565) to serines. Additionally, we report the structural and biochemical characterization of the A. variabilis PAL C503S/C565S double mutant and carefully compare this molecule with the R. toruloides engineered PAL molecule. Unlike previously published PAL structures, significant electron density is observed for the two active-site loops in the A. variabilis C503S/C565S double mutant, yielding a complete view of the active site. Docking studies and N-hydroxysuccinimide-biotin binding studies support a proposed mechanism in which the amino group of the phenylalanine substrate is attacked directly by the 4-methylidene-imidazole-5-one prosthetic group. We propose a helix-to-loop conformational switch in the helices flanking the inner active-site loop that regulates accessibility of the active site. Differences in loop stability among PAL homologs may explain the observed variation in enzyme efficiency, despite the highly conserved structure of the active site. A. variabilis C503S/C565S PAL is shown to be both more thermally stable and more resistant to proteolytic cleavage than R. toruloides PAL. Additional increases in thermal stability and protease resistance upon ligand binding may be due to enhanced interactions among the residues of the active site, possibly locking the active-site structure in place and stabilizing the tetramer. Examination of the A. variabilis C503S/C565S PAL structure, combined with analysis of its physical properties, provides
Note on an invasion of intertidal zoanthid colonies by a chaetopterid ...
African Journals Online (AJOL)
At Park Rynie Beach on the KwaZulu-Natal coast, South Africa, four species of zoanthids were invaded by a sand-tube building polychaete Mesochaetopterus minutus. It is a small polychaete about 15 mm long, which occurs gregariously in dense masses of sandy tubes. M. minutus is an opportunistic species that exploits ...
Li, Yao; Zhang, Xing-wang; Fang, Yan-ming
2014-12-01
The geographical distribution of Quercus variabilis in China with its climate characteristics was analyzed based on DIVA-GIS which was also used to estimate the response of future potential distribution to global warming by Bioclim and Domain models. Analysis results showed the geographical distribution of Q. variabilis could be divided into 7 subregions: Henduan Mountains, Yunnan-Guizhou Plateau, North China, East China, Liaodong-Shandong Peninsula, Taiwan Island, and Qinling-Daba Mountains. These subregions are across 7 temperature zones, 2 moisture regions and 17 climatic subregions, including 8 climate types. The modern abundance center of Q. variabilis is Qinling, Daba and Funiu mountains. The condition of mean annual temperature 7.5-19.8 degrees C annual precipitation 471-1511 mm, is suitable for Q. variabilis. Areas under the receiver operating characteristic curve (AUC values), of Domain and Boiclim models were 0.910, 0.779; the former predicted that the potential regions of high suitability for Q. variabilis are Qinling, Daba, Funiu, Tongbai, and Dabie mountains, eastern and western Yunnan-Guizhou Plateau, hills of southern Jiangsu and Anhui, part of the mountains in North China. Global warming might lead to the shrinking in suitable region and retreating from the south for Q. variabilis.
Anticholinesterase activity of the fluorescent zoanthid pigment, parazoanthoxanthin A.
Sepcić, K; Turk, T; Macek, P
1998-06-01
A synthetic linear tetrazacyclopent(f)azulene compound, parazoanthoxanthin A (m.w. 214.2), strongly fluorescent pigment occurring in zoanthids, was characterized and assayed for anticholinesterase activity. The pigment, emitting fluorescence at lambda(em) 420 nm, was found to be a pure competitive inhibitor of cholinesterases. At pH 8.0, a Ki value of 19 and 26 microM was determined with insect recombinant, and electric eel acetylcholinesterase. Horse serum butyrylcholinesterase was less sensitive with a Ki of 70 microM.
Anti-Lymphangiogenesis Components from Zoanthid Palythoa tuberculosa
Chen, Shu-Rong; Wang, Shih-Wei; Su, Chien-Jung; Hu, Hao-Chun; Hsieh, Chi-Ting; Peng, Chia-Chi
2018-01-01
Three new compounds, tuberazines A–C (1–3), and eleven known compounds (4–14) were obtained from the ethanolic extract of Taiwanese zoanthid Palythoa tuberculosa. Compounds 1–4 are rare marine natural products with a pyrazine moiety, and compound 5 is a tricyclic tryptamine derivative isolated from nature for the first time. The structures of all isolated metabolites were determined by analyzing their IR, Mass, NMR, and UV spectrometric data. The absolute configuration of 1 was confirmed by comparing the trend of experimental electronic circular dichroism (ECD) with calculated ECD spectra. The anti-lymphangiogenic activities of new compounds were evaluated in human lymphatic endothelial cells (LECs). Of these, new compound 3 displayed the most potent anti-lymphangiogenesis property by suppressing cell growth and tube formation of LECs. PMID:29385063
Directory of Open Access Journals (Sweden)
Xiaomeng Shi
2017-12-01
Full Text Available Quercus variabilis is a tree species of ecological and economic value that is widely distributed in China. To effectively evaluate, use, and conserve resources, we applied 25 pairs of simple sequence repeat (SSR primers to study its genetic diversity and genetic structure in 19 natural forest or natural secondary forest populations of Q. variabilis (a total of 879 samples. A total of 277 alleles were detected. Overall, the average expected heterozygosity (He was 0.707 and average allelic richness (AR was 7.79. Q. variabilis manifested a loss of heterozygosity, and the mean of inbreeding coefficient (FIS was 0.044. Less differentiation among populations was observed, and the genetic differentiation coefficient (FST was 0.063. Bayesian clustering analysis indicated that the 19 studied populations could be divided into three groups based on their genetic makeup, namely, the Southwest group, Central group, and Northeastern group. The Central group, compared to the populations of the Southwest and Northeast group, showed higher genetic diversities and lower genetic differentiations. As a widely distributed species, the historical migration of Q. variabilis contributed to its genetic differentiation.
Carballeira, N M; Reyes, M
1995-11-01
A new brominated fatty acid, 6-bromo-5,9-eicosadienoic acid [1] was identified in the phospholipids (mainly phosphatidylethanolamine) of the anemone Condylactis gigantea and the zoanthid Palythoa caribaeorum. The delta 5,9 fatty acids, 5,9-octadecadienoic acid, 5,9-eicosadienoic acid, 5,9-docosadienoic acid, and 5,9-tetracosadienoic acid, were also identified in both organisms. Structural elucidation was accomplished by spectroscopic and chemical means. Our results further corroborate that delta 5,9 phospholipid fatty acids are not unique to sponges, as recognized previously, but can be found in other marine invertebrates such as anemones and zoanthids. An improved procedure for the synthesis of picolinyl esters is also described.
Prevalence of Rickettsia species in Dermacentor variabilis ticks from Ontario, Canada.
Wood, Heidi; Dillon, Liz; Patel, Samir N; Ralevski, Filip
2016-07-01
Relatively little is known about the prevalence of rickettsial species in Dermacentor ticks in eastern Canada. In this study, Dermacentor ticks from the province of Ontario, Canada, were tested for the presence of spotted fever group rickettsial (SFGR) species, Coxiella burnetii and Francisella tularensis. Rickettsia rickettsii was not detected in any ticks tested, but R. montanensis was detected at a prevalence of 2.2% in D. variabilis (17/778). Two other SFGR species, R. parkeri and Candidatus R. andeanae, were detected individually in 2 Amblyomma maculatum ticks. Rickettsia peacockii, a non-pathogenic endosymbiont, was detected in two D. andersonii ticks. Given the highly abundant nature of D. variabilis, surveillance for human pathogens in this species of tick has important public health implications, but the lack of detection of known human pathogens indicates a low risk of infection via this tick species in Ontario. However, the detection of R. parkeri in an adventive A. maculatum tick indicates that health care providers should be aware of the possibility of spotted fever rickettsioses in individuals with a history of travel outside of Ontario and symptoms compatible with a spotted fever rickettsiosis. Coxiella burnetii and Francisella tularensis, human pathogens also potentially transmitted by D. variabilis, were not detected in a subset of the ticks. Copyright © 2016 Elsevier GmbH. All rights reserved.
Manoalide-related Sesterterpene from the Marine Sponge Luffariella variabilis.
Hamada, Toshiyuki; Harada, Daisuke; Hirata, Mitsunobu; Yamashita, Keisuke; Palaniveloo, Kishneth; Okamura, Hiroaki; Iwagawa, Tetsuo; Arima, Naomichi; Iriguchi, Toshiyuki; de Voogd, Nicole J; Vairappan, Charles S
2015-06-01
A new manoalide-related sesterterpene, (4E,6E)-dehydro-25-O-methylmanoalide (1), was isolated from the organic extracts of the Bornean marine sponge Luffariella variabilis, together with the known compound (4E,6E)-dehydromanoalide (2). The structure of compound 1 was elucidated by interpretation of its spectroscopic data.
Noori Koupaei, Atoosa
2014-01-01
The order Zoantharia (Zoanthids) is one of the most neglected orders of cnidarians in the Persian Gulf. The present study aims to investigate the biodiversity of this order with morphological and molecular examination in the Persian Gulf. For this purpose, 123 colonies of zoanthids with variety of shape and colors have been collected from intertidal and shallow water zone of four islands, i. e. Hengam, Qeshm, Larak and Hormoz. After sampling, morphological characteristics of each specimen wer...
Kwiatek, M; Belter, J; Majka, M; Wiśniewska, H
2016-03-01
It has been hypothesized that the powdery mildew adult plant resistance (APR) controlled by the Pm13 gene in Aegilops longissima Schweinf. & Muschl. (S(l)S(l)) has been evolutionary transferred to Aegilops variabilis Eig. (UUSS). The molecular marker analysis and the visual evaluation of powdery mildew symptoms in Ae. variabilis and the Ae. variabilis × Secale cereale amphiploid forms (2n = 6x = 42, UUSSRR) showed the presence of product that corresponded to Pm13 marker and the lower infection level compared to susceptible model, respectively. This study also describes the transfer of Ae. variabilis Eig. (2n = 4x = 28, U(v)U(v)S(v)S(v)) chromosomes, carrying powdery mildew resistance, into triticale (× Triticosecale Wittm., 2n = 6x = 42, AABBRR) using Ae. variabilis × S. cereale amphiploid forms. The individual chromosomes of Ae. variabilis, triticale 'Lamberto' and hybrids were characterized by genomic and fluorescence in situ hybridization (GISH/FISH). The chromosome configurations of obtained hybrid forms were studied at first metaphase of meiosis of pollen mother cells (PMCs) using GISH. The statistical analysis showed that the way of S-genome chromosome pairing and transmission to subsequent hybrid generations was diploid-like and had no influence on chromosome pairing of triticale chromosomes. The cytogenetic study of hybrid forms were supported by the marker-assisted selection using Pm13 marker and visual evaluation of natural infection by Blumeria graminis, that allowed to select the addition or substitution lines of hybrids carrying chromosome 3S(v) which were tolerant to the powdery mildew infection.
Two Furanosesterterpenoids from the Sponge Luffariella variabilis
Directory of Open Access Journals (Sweden)
Peni Ahmadi
2017-08-01
Full Text Available Two new sesterterpenoids, 1 and 2, were isolated from the sponge Luffariella variabilis. Their planar structures were characterized with spectroscopic analyses. The sole chiral center of compound 1 was elucidated as 12R by comparing observed and calculated optical rotation values. The configurations of compound 2 were determined by NMR and electronic circular dichroism (ECD studies. Furthermore, compound 2 showed cytotoxicity at IC50 1.0 µM against NBT-T2 cells.
Reimer, J.D.; Hirose, M.; Wirtz, P.
2010-01-01
The marine invertebrate fauna of the Cape Verde Islands contains many endemic species due to their isolated location in the eastern Atlantic, yet research has not been conducted on most taxa here. One such group are the zoanthids or mat anemones, an order of benthic cnidarians (Hexacorallia:
Minaeva, Ekaterina; Ermilova, Elena
2017-07-01
The unicellular green alga Chlorella variabilis NC64A is an endosymbiont of the ciliate Paramecium bursaria. The host's control, including the transfer of biochemical substrates from P. bursaria to C. variabilis, is involved in symbiotic relationships. C. variabilis NC64A that had been re-infected to P. bursaria for more than 1 year and isolated from the host showed higher chlorophyll levels compared to those in free-living cells. Unlike the host, the expression of C. variabilis NC64A heat shock 70 kDa protein was independent of establishment of endosymbiosis. In symbiotic cells, the levels of PII signal transduction protein (CvPII) that coordinate the central C/N anabolic metabolism were slightly higher than those in free-living cells. Furthermore, the environmental cues (light and host food bacteria availability) affected the abundance of CvPII, suggesting that synthesis of the protein was influenced by the host. Moreover, arginine concentrations in the symbiotic algae of P. bursaria were also controlled by the host's nutritional conditions. Together, our results imply that signal substrates and/or products of metabolism in host cells might act as messengers mediating the regulation of key events in symbiont cells.
Toxic effects of carbaryl on the histology of testes of Bufotes variabilis (Anura: Bufonidae
Directory of Open Access Journals (Sweden)
Ozlem Cakici
2015-06-01
Full Text Available This study was designed to investigate histopathologic effects of carbaryl on the testes of adult toad, Bufotes variabilis. To that end, animals were exposed to carbaryl once by oral gavage (low dose: 50 µg/g, medium dose: 100 µg/g and high dose: 200 µg/g. After 96 h, toads were euthanized. In low-dose group, some seminiferous tubules lost their regular shape. Also, the enlargement of interstitial spaces among tubules and germ cell necrosis were determined. A weak hemorrhage was observed among some tubules. In medium-dose group, germ cell necrosis was detected in many seminiferous tubules. This time, a weak hemorrhage was detected within tubules. In the high dose group, an increase in the number of disorganized tubules were observed. Vacuolization and necrosis in germ cells of seminiferous tubules were frequently seen. According to these findings, carbaryl caused dose-related histopathological damage in testis of B. variabilis. Based on these findings, this study clearly shows that carbaryl affects male fertility in B. variabilis.
Abuali, Mayssa M; Posada, Roberto; Del Toro, Gustavo; Roman, Elizabeth; Ramani, Rama; Chaturvedi, Sudha; Chaturvedi, Vishnu; LaBombardi, Vincent J
2009-12-01
Rhizomucor variabilis and Hormographiella aspergillata rarely cause human infections. This report details a fatal case of a 14-year-old female with leukemia posthematopoietic cell transplant and relapse with refractory pancytopenia. The patient first developed an R. variabilis var. regularior palate infection and later developed a cutaneous H. aspergillata infection while on posaconazole and caspofungin therapy.
Directory of Open Access Journals (Sweden)
Yaoqin Xue
2014-08-01
Full Text Available Aim of study: Quercus variabilis (Chinese cork oak reproduces asexually and sexually. This study aimed to determine the status and growth of asexual and sexual recruits of Q. variabilis in different forest recovery stages.Area of study: Three selective logged stands and one unlogged stand in Q. variabilis forest, Shaanxi Province, China.Material and Methods: Origin, number, basal diameter, height and size structure of Q. variabilis shoots (height ≤200 cm were investigated in the plots of 5, 10, and 20-years post-logging stands and unlogged stand. Effects of recovery stage on the density and growth of the three original recruits (stump sprouts, stem base sprouts and true seedlings were analysis by One-way ANOVA.Main results: Sprouts dominated logged stands, whereas true seedlings dominated unlogged stand, stem base sprouts only existed in 20-years post-logging and unlogged stands. Stump sprout density and sprout number per stump both declined with extended post-logging time. True seedlings density increased from 7 to 20 shoots/100 m2 as the postlogging time extended, and peaked in unlogged stand (94 shoots/100 m2. An ongoing size structure was observed in true seedlings in all stands. Stump sprouts were taller and greater than true seedlings.Research highlights: Stump sprouts contributed more to Q. variabilis forest recovery in the early stage after disturbance. The contribution of true seedlings was limited in the same stage, but they were beneficial for population long-term development. Stem base sprouts were most likely to be a survival strategy rather than a reproductive strategy.Key words: asexual reproduction; true seedling; post-logging time; Chinese cork oak.
Abuali, Mayssa M.; Posada, Roberto; Del Toro, Gustavo; Roman, Elizabeth; Ramani, Rama; Chaturvedi, Sudha; Chaturvedi, Vishnu; LaBombardi, Vincent J.
2009-01-01
Rhizomucor variabilis and Hormographiella aspergillata rarely cause human infections. This report details a fatal case of a 14-year-old female with leukemia posthematopoietic cell transplant and relapse with refractory pancytopenia. The patient first developed an R. variabilis var. regularior palate infection and later developed a cutaneous H. aspergillata infection while on posaconazole and caspofungin therapy. PMID:19846651
Abuali, Mayssa M.; Posada, Roberto; Del Toro, Gustavo; Roman, Elizabeth; Ramani, Rama; Chaturvedi, Sudha; Chaturvedi, Vishnu; LaBombardi, Vincent J.
2009-01-01
Rhizomucor variabilis and Hormographiella aspergillata rarely cause human infections. This report details a fatal case of a 14-year-old female with leukemia posthematopoietic cell transplant and relapse with refractory pancytopenia. The patient first developed an R. variabilis var. regularior palate infection and later developed a cutaneous H. aspergillata infection while on posaconazole and caspofungin therapy.
Transfer of stripe rust resistance from Aegilops variabilis to bread ...
African Journals Online (AJOL)
In terms of area, the bread wheat producing regions of China comprise the largest area in the world that is constantly threatened by stripe rust epidemics. Consequently, it is important to exploit new adultplant resistance genes in breeding. This study reports the transfer of stripe rust resistance from Aegilops variabilis to ...
Liao, Qiwen; Li, Shengnan; Siu, Shirley Weng In; Yang, Binrui; Huang, Chen; Chan, Judy Yuet-Wa; Morlighem, Jean-Étienne R L; Wong, Clarence Tsun Ting; Rádis-Baptista, Gandhi; Lee, Simon Ming-Yuen
2018-02-02
Palythoa caribaeorum (class Anthozoa) is a zoanthid that together jellyfishes, hydra, and sea anemones, which are venomous and predatory, belongs to the Phyllum Cnidaria. The distinguished feature in these marine animals is the cnidocytes in the body tissues, responsible for toxin production and injection that are used majorly for prey capture and defense. With exception for other anthozoans, the toxin cocktails of zoanthids have been scarcely studied and are poorly known. Here, on the basis of the analysis of P. caribaeorum transcriptome, numerous predicted venom-featured polypeptides were identified including allergens, neurotoxins, membrane-active, and Kunitz-like peptides (PcKuz). The three predicted PcKuz isotoxins (1-3) were selected for functional studies. Through computational processing comprising structural phylogenetic analysis, molecular docking, and dynamics simulation, PcKuz3 was shown to be a potential voltage gated potassium-channel inhibitor. PcKuz3 fitted well as new functional Kunitz-type toxins with strong antilocomotor activity as in vivo assessed in zebrafish larvae, with weak inhibitory effect toward proteases, as evaluated in vitro. Notably, PcKuz3 can suppress, at low concentration, the 6-OHDA-induced neurotoxicity on the locomotive behavior of zebrafish, which indicated PcKuz3 may have a neuroprotective effect. Taken together, PcKuz3 figures as a novel neurotoxin structure, which differs from known homologous peptides expressed in sea anemone. Moreover, the novel PcKuz3 provides an insightful hint for biodrug development for prospective neurodegenerative disease treatment.
Joseph, Sneha; Poriya, Paresh; Kundu, Rahul
2016-11-01
The present study reports the phylogenetic relationship of six zoanthid species belonging to three genera, Isaurus, Palythoa, and Zoanthus identified using systematic computational analysis of mtDNA gene sequences. All six species are first recorded from the coasts of Kathiawar Peninsula, India. Genus: Isaurus is represented by Isaurus tuberculatus, genus Zoanthus is represented by Zoanthus kuroshio and Zoanthus sansibaricus, while genus Palythoa is represented by Palythoa tuberculosa, P. sp. JVK-2006 and Palythoa heliodiscus. Results of the present study revealed that among the various species observed along the coastline, a minimum of 99% sequence divergence and a maximum of 96% sequence divergence were seen. An interspecific divergence of 1-4% and negligible intraspecific divergence was observed. These results not only highlighted the efficiency of the COI gene region in species identification but also demonstrated the genetic variability of zoanthids along the Saurashtra coastline of the west coast of India.
Directory of Open Access Journals (Sweden)
Simone Mousinho Freire
Full Text Available Abstract Chapiniella variabilis (Chapin, 1924, a strongylid nematode, was collected parasitizing the large intestine of the tortoises Chelonoidis carbonarius (Spix, 1824 (Cc and C. denticulatus (Linnaeus, 1766 (Cd in the Zoobotanical Park of the municipality of Teresina, state of Piauí, Brazil. The taxonomic identification was based on morphological and morphometric features, using bright-field and scanning electron microscopy. The present study adds new observations on the morphology, mainly relating to the mouth papillae, external and internal leaf-crown elements, excretory pore, deirids and male and female posterior end. The parasitic indices of prevalence (P, mean intensity (MI, mean abundance (MA and range of infection (RI of C. variabilis in these two tortoise species were: P = 100%, MI = 833.3, MA = 833.3, RI = 500-1,500 (Cc; P = 100%, MI = 472.2, MA = 472.2, RI = 333-500 (Cd. This record expands occurrences of C. variabilis to a new host, C. carbonarius, and to another state in Brazil, in the Neotropical region of South America. Adjustment to host management with the aim of improving hygiene and health conditions is suggested.
Directory of Open Access Journals (Sweden)
Jing-Pin Lei
Full Text Available Forest tree species distributed across a wide range of geographical areas are subjected to differential climatic and edaphic conditions and long-term selection, leading to genotypes with morphological and physiological adaptation to the local environment. To test the ability of species to cope with changing environmental conditions, we studied the ecophysiological features of Quercus variabilis using seedlings grown in geographically widely isolated populations (Exp. I, in situ and in a common garden (Exp. II, ex situ using seedlings originating from those populations. We found that Q. variabilis plants grown in different locations along a south-north gradient had different levels of nutrients (N, P, K and carbon-physiological performance (photosynthesis, non-structural carbohydrates, such as soluble sugars and starch, and that these physiological differences were not correlated with local soil properties. These geographic variations of plant physiology disappeared when plants from different locations were grown in the same environment. Our results indicate that the physiological performance of Q. variabilis plants is mainly determined by the climatic variations across latitude rather than by their soils or by genetic differentiation. The adaptive ability of Q. variabilis found in the present study suggests that this species has the potential to cope, at least to some extent, with changing environmental conditions.
Zoanthid mucus as new source of useful biologically active proteins.
Guarnieri, Míriam Camargo; de Albuquerque Modesto, Jeanne Claíne; Pérez, Carlos Daniel; Ottaiano, Tatiana Fontes; Ferreira, Rodrigo da Silva; Batista, Fabrício Pereira; de Brito, Marlon Vilela; Campos, Ikaro Henrique Mendes Pinto; Oliva, Maria Luiza Vilela
2018-03-01
Palythoa caribaeorum is a very common colonial zoanthid in the coastal reefs of Brazil. It is known for its massive production of mucus, which is traditionally used in folk medicine by fishermen in northeastern Brazil. This study identified biologically active compounds in P. caribaerum mucus. Crude mucus was collected during low tides by the manual scraping of colonies; samples were maintained in an ice bath, homogenized, and centrifuged at 16,000 g for 1 h at 4 °C; the supernatant (mucus) was kept at -80 °C until use. The enzymatic (proteolytic and phospholipase A 2 ), inhibitory (metallo, cysteine and serine proteases), and hemagglutinating (human erythrocyte) activities were determined. The results showed high levels of cysteine and metallo proteases, intermediate levels of phosholipase A 2 , low levels of trypsin, and no elastase and chymotrypsin like activities. The mucus showed potent inhibitory activity on snake venom metalloproteases and cysteine proteinase papain. In addition, it showed agglutinating activity towards O + , B + , and A + erythrocyte types. The hemostatic results showed that the mucus prolongs the aPTT and PT, and strongly inhibited platelet aggregation induced by arachidonic acid, collagen, epinephrine, ADP, and thrombin. The antimicrobial activity was tested on 15 strains of bacteria and fungi through the radial diffusion assay in agar, and no activity was observed. Compounds in P. caribaeorum mucus were analyzed for the first time in this study, and our results show potential pharmacological activities in these compounds, which are relevant for use in physiopathological investigations. However, the demonstration of these activities indicates caution in the use of crude mucus in folk medicine. Furthermore, the present or absent activities identified in this mucus suggest that the studied P. caribaeorum colonies were in thermal stress conditions at the time of sample collection; these conditions may precede the bleaching
Chen, Dongmei; Zhang, Xianxian; Kang, Hongzhang; Sun, Xiao; Yin, Shan; Du, Hongmei; Yamanaka, Norikazu; Gapare, Washington; Wu, Harry X.; Liu, Chunjiang
2012-01-01
The biogeographical relationships between far-separated populations, in particular, those in the mainland and islands, remain unclear for widespread species in eastern Asia where the current distribution of plants was greatly influenced by the Quaternary climate. Deciduous Oriental oak (Quercus variabilis) is one of the most widely distributed species in eastern Asia. In this study, leaf material of 528 Q. variabilis trees from 50 populations across the whole distribution (Mainland China, Kor...
International Nuclear Information System (INIS)
Biedlingmaier, S.; Schmidt, A.
1987-01-01
Growth of several cyanobacteria was examined on ethane sulfonate and taurine as only sulfur source. Comparing two strains with differential utilization of sulfonic acids (Anabaena variabilis and Synechococcus 6301) demonstrated that actual growth was coupled to the presence of an active sulfonate transport system due to species specific properties and nutritional conditions. Sulfonate uptake in Anabaena variabilis was characterized by a pH optimum of 6.5, a structural specificity for sulfonates, missing Na + dependence, and phosphate stimulation. Radiolabeled ethane sulfonate and taurine was metabolized to products of normal sulfur metabolism. Also considerable amounts of 35 S-labeled volatiles (mercaptanes and sulfide) could be detected, suggesting a degradation mechanism via reduction to mercaptanes and cleavage of the C-S bond. (orig.)
Directory of Open Access Journals (Sweden)
Dongmei Chen
Full Text Available The biogeographical relationships between far-separated populations, in particular, those in the mainland and islands, remain unclear for widespread species in eastern Asia where the current distribution of plants was greatly influenced by the Quaternary climate. Deciduous Oriental oak (Quercus variabilis is one of the most widely distributed species in eastern Asia. In this study, leaf material of 528 Q. variabilis trees from 50 populations across the whole distribution (Mainland China, Korea Peninsular as well as Japan, Zhoushan and Taiwan Islands was collected, and three cpDNA intergenic spacer fragments were sequenced using universal primers. A total of 26 haplotypes were detected, and it showed a weak phylogeographical structure in eastern Asia populations at species level, however, in the central-eastern region of Mainland China, the populations had more haplotypes than those in other regions, with a significant phylogeographical structure (N(ST= 0.751> G(ST= 0.690, P<0.05. Q. variabilis displayed high interpopulation and low intrapopulation genetic diversity across the distribution range. Both unimodal mismatch distribution and significant negative Fu's F(S indicated a demographic expansion of Q. variabilis populations in East Asia. A fossil calibrated phylogenetic tree showed a rapid speciation during Pleistocene, with a population augment occurred in Middle Pleistocene. Both diversity patterns and ecological niche modelling indicated there could be multiple glacial refugia and possible bottleneck or founder effects occurred in the southern Japan. We dated major spatial expansion of Q. variabilis population in eastern Asia to the last glacial cycle(s, a period with sea-level fluctuations and land bridges in East China Sea as possible dispersal corridors. This study showed that geographical heterogeneity combined with climate and sea-level changes have shaped the genetic structure of this wide-ranging tree species in East Asia.
Comparative vertical transmission of Rickettsia by Dermacentor variabilis and Amblyomma maculatum.
Harris, Emma K; Verhoeve, Victoria I; Banajee, Kaikhushroo H; Macaluso, Jacqueline A; Azad, Abdu F; Macaluso, Kevin R
2017-06-01
The geographical overlap of multiple Rickettsia and tick species coincides with the molecular detection of a variety of rickettsial agents in what may be novel tick hosts. However, little is known concerning transmissibility of rickettsial species by various tick hosts. To examine the vertical transmission potential between select tick and rickettsial species, two sympatric species of ticks, Dermacentor variabilis and Amblyomma maculatum, were exposed to five different rickettsial species, including Rickettsia rickettsii, Rickettsia parkeri, Rickettsia montanensis, Rickettsia amblyommatis, or flea-borne Rickettsia felis. Fitness-related metrics including engorgement weight, egg production index, nutrient index, and egg hatch percentage were then assessed. Subsamples of egg clutches and unfed larvae, nymphs, and adults for each cohort were assessed for transovarial and transstadial transmission of rickettsiae by qPCR. Rickettsial exposure had a minimal fitness effect in D. variabilis and transovarial transmission was observed for all groups except R. rickettsii. In contrast, rickettsial exposure negatively influenced A. maculatum fitness and transovarial transmission of rickettsiae was demonstrated only for R. amblyommatis- and R. parkeri-exposed ticks. Sustained maintenance of rickettsiae via transstadial transmission was diminished from F 1 larvae to F 1 adults in both tick species. The findings of this study suggest transovarial transmission specificity may not be tick species dependent, and sustained vertical transmission is not common. Copyright © 2017 The Authors. Published by Elsevier GmbH.. All rights reserved.
Four new species and one new genus of zoanthids (Cnidaria, Hexacorallia from the Galapagos Islands
Directory of Open Access Journals (Sweden)
James Reimer
2010-04-01
Full Text Available Recent research has confirmed the presence of several species of undescribed macrocnemic zoanthids (Cnidaria: Hexacorallia: Zoantharia: Macrocnemina in the Galapagos. In this study four new species, including two belonging to a new genus, are described. Two species, Terrazoanthus onoi sp. n. and Terrazoanthus sinnigeri sp. n., both belong within the recently erected family Hydrozoanthidae to the new genus Terrazoanthus, which can be distinguished from the type genus Hydrozoanthus by being attached to abiotic substrate as opposed to hydrozoans for Hydrozoanthus. Each new species of zoanthid can be clearly distinguished by a number of characters. Antipathozoanthus hickmani sp. n. is distinguished by its exclusive association with the antipatharian Antipathes galapagensis, and has approximately 40 tentacles. Parazoanthus darwini sp. n. is distinguished by its frequent association with sponges, with approximately 24–30 tentacles and polyps embedded in a well-developed coenenchyme. T. onoi sp. n. is distinguished by its bright red oral disk color, 32–40 tentacles, and has only basitrichs and mastigophores present in the pharynx. T. sinnigeri sp. n. is distinguished by usually occurring on the underside of rubble and rocks on sandy bottoms, showing 30–36 tentacles, and numerous nematocyst types in the pharynx. The two Terrazoanthus species, although divergent in both morphology and ecology, are apparently very closely related, with identical mitochondrial 16S ribosomal DNA and cytochrome oxidase subunit I sequences. These two species can be molecularly distinguished by their subtly different yet distinct sequences of internal transcribed spacer of ribosomal DNA (ITS-rDNA.
Aggressive cutaneous zygomycosis caused by Apophysomyces variabilis in an immunocompetent child
Directory of Open Access Journals (Sweden)
Ibrahim A. Al-Zaydani
2015-12-01
Full Text Available A zygomycetous fungus was observed in a biopsy of a 9-year-old male. The patient was presented with severe cutaneous lesions subsequent to a traumatic car accident. Following fungal detection, antifungal treatment was prescribed but condition deteriorated rapidly and above knee amputation was done as lifesaving and to control fungal infection. Analysis of the 28 S rRNA gene (accession KT149770 aligned the isolate with members of the genus Apophysomyces and the pathogen was identified as Apophysomces variabilis.
Zemtsova, Galina E; Killmaster, Lindsay F; Montgomery, Merrill; Schumacher, Lauren; Burrows, Matt; Levin, Michael L
2016-02-01
Ticks of the genus Dermacentor are known vectors of rickettsial pathogens in both the Old World and New World. In North America, Dermacentor variabilis and D. andersoni are vectors of Rickettsia rickettsii, while in Europe, D. marginatus and D. reticulatus transmit R. slovaca and R. raoultii, respectively. Neither the presence of R. slovaca in the Americas nor the ability of American tick species to maintain this pathogen have been reported. Here we describe detection of Rickettsia genetically identical to R. slovaca in D. variabilis, its molecular characterization, assessment of pathogenicity to guinea pigs, and vector competence of D. variabilis ticks. Ticks from a laboratory colony of D. variabilis, established from wild ticks and maintained on naïve NZW rabbits, tested positive for spotted fever group (SFG) Rickettsia by PCR. Analysis of 17 kDa gltA, rpoB, ompA, ompB, and sca4 genes revealed 100% identity to R. slovaca sequences available in the GenBank. New Zealand white rabbits fed upon by infected ticks seroconverted to SFG Rickettsia. Guinea pigs inoculated with the Rickettsia culture or infested by the infected ticks developed antibodies to SFG Rickettsia. The intensity of clinical signs and immune response were dependent on dose and route of infection. The identified Rickettsia was detected in all life stages of D. variabilis ticks, confirming transstadial and transovarial transmission. Thirty-six percent of uninfected larvae co-fed with infected nymphs on guinea pigs were PCR-positive and able to pass rickettsia to at least 11.7% of molted nymphs. To our knowledge, this is a first report of identification of a European pathogen R. slovaca or a highly similar agent in the American dog tick, D. variabilis. Considering pathogenicity of R. slovaca in humans, further laboratory and field studies are warranted to assess the relevance of the above findings to the public health and epidemiology of SFG rickettsioses in the United States.
Nonrandom distribution of vector ticks (Dermacentor variabilis infected by Francisella tularensis.
Directory of Open Access Journals (Sweden)
Heidi K Goethert
2009-02-01
Full Text Available The island of Martha's Vineyard, Massachusetts, is the site of a sustained outbreak of tularemia due to Francisella tularensis tularensis. Dog ticks, Dermacentor variabilis, appear to be critical in the perpetuation of the agent there. Tularemia has long been characterized as an agent of natural focality, stably persisting in characteristic sites of transmission, but this suggestion has never been rigorously tested. Accordingly, we sought to identify a natural focus of transmission of the agent of tularemia by mapping the distribution of PCR-positive ticks. From 2004 to 2007, questing D. variabilis were collected from 85 individual waypoints along a 1.5 km transect in a field site on Martha's Vineyard. The positions of PCR-positive ticks were then mapped using ArcGIS. Cluster analysis identified an area approximately 290 meters in diameter, 9 waypoints, that was significantly more likely to yield PCR-positive ticks (relative risk 3.3, P = 0.001 than the rest of the field site. Genotyping of F. tularensis using variable number tandem repeat (VNTR analysis on PCR-positive ticks yielded 13 different haplotypes, the vast majority of which was one dominant haplotype. Positive ticks collected in the cluster were 3.4 times (relative risk = 3.4, P<0.0001 more likely to have an uncommon haplotype than those collected elsewhere from the transect. We conclude that we have identified a microfocus where the agent of tularemia stably perpetuates and that this area is where genetic diversity is generated.
Anti-Dengue Virus Constituents from Formosan Zoanthid Palythoa mutuki
Lee, Jin-Ching; Chang, Fang-Rong; Chen, Shu-Rong; Wu, Yu-Hsuan; Hu, Hao-Chun; Wu, Yang-Chang; Backlund, Anders; Cheng, Yuan-Bin
2016-01-01
A new marine ecdysteroid with an α-hydroxy group attaching at C-4 instead of attaching at C-2 and C-3, named palythone A (1), together with eight known compounds (2–9) were obtained from the ethanolic extract of the Formosan zoanthid Palythoa mutuki. The structures of those compounds were mainly determined by NMR spectroscopic data analyses. The absolute configuration of 1 was further confirmed by comparing experimental and calculated circular dichroism (CD) spectra. Anti-dengue virus 2 activity and cytotoxicity of five isolated compounds were evaluated using virus infectious system and [3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium, inner salt (MTS) assays, respectively. As a result, peridinin (9) exhibited strong antiviral activity (IC50 = 4.50 ± 0.46 μg/mL), which is better than that of the positive control, 2′CMC. It is the first carotene-like substance possessing anti-dengue virus activity. In addition, the structural diversity and bioactivity of the isolates were compared by using a ChemGPS–NP computational analysis. The ChemGPS–NP data suggested natural products with anti-dengue virus activity locate closely in the chemical space. PMID:27517937
Lyons, E M; Thiel, T
1995-01-01
Anabaena variabilis ATCC 29413 is a heterotrophic, nitrogen-fixing cyanobacterium containing both a Mo-dependent nitrogenase encoded by the nif genes and V-dependent nitrogenase encoded by the vnf genes. The nifB, nifS, and nifU genes of A. variabilis were cloned, mapped, and partially sequenced. The fdxN gene was between nifB and nifS. Growth and acetylene reduction assays using wild-type and mutant strains indicated that the nifB product (NifB) was required for nitrogen fixation not only by...
Jin, Yulan; Wang, Yurong; Xiao, Lin; Lin, Xiukun
2016-05-01
A crude protease produced from Planomicrobium sp. L-2 is described, and its effectiveness as an additive in liquid detergent evaluated. We isolate the protease-producing Planomicrobium sp. L-2 from the gastrointestinal tract of Octopus variabilis. At least three caseinolytic protease clear bands were observed in zymogram analysis. The crude alkaline protease was highly tolerant of a pH range from 7.0 to 9.0, and temperatures to 50°C after incubation for 1 h. Proteolytic enzymes were stable towards three surfactants (5% Tween 80, 1% Triton X-100 and 0.05% SDS) and an oxidizing agent (1% hydrogen peroxide), in addition to being highly stable and compatible with popular commercial laundry powered detergent brands available in China. Our study demonstrates the potential these proteases have for development into novel classes of detergent additive. This study also suggests that the gastrointestinal tract of Octopus variabilis may be a rich source of commercially valuable strains of enzyme.
The essential oil nootkatone has shown acaricidal activity on ticks. The toxicity of nootkatone was determined in laboratory assays using a vial coating technique against unfed nymphs of four Ixodid ticks: Amblyomma americanum L., Dermacentor variabilis (Say), Ixodes scapularis Say, and Rhipicepha...
DEFF Research Database (Denmark)
Plantard, Laure; Huber, Marcel; Macari, Francoise
2003-01-01
Connexins are homologous four-transmembrane-domain proteins and major components of gap junctions. We recently identified mutations in either GJB3 or GJB4 genes, encoding respectively connexin 31 (Cx31) or 30.3 (Cx30.3), as causally involved in erythrokeratodermia variabilis (EKV), a mostly autos...
Xue, Ying; Ren, Yiping; Meng, Wenrong; Li, Long; Mao, Xia; Han, Dongyan; Ma, Qiuyun
2013-09-01
Cephalopods play key roles in global marine ecosystems as both predators and preys. Regressive estimation of original size and weight of cephalopod from beak measurements is a powerful tool of interrogating the feeding ecology of predators at higher trophic levels. In this study, regressive relationships among beak measurements and body length and weight were determined for an octopus species ( Octopus variabilis), an important endemic cephalopod species in the northwest Pacific Ocean. A total of 193 individuals (63 males and 130 females) were collected at a monthly interval from Jiaozhou Bay, China. Regressive relationships among 6 beak measurements (upper hood length, UHL; upper crest length, UCL; lower hood length, LHL; lower crest length, LCL; and upper and lower beak weights) and mantle length (ML), total length (TL) and body weight (W) were determined. Results showed that the relationships between beak size and TL and beak size and ML were linearly regressive, while those between beak size and W fitted a power function model. LHL and UCL were the most useful measurements for estimating the size and biomass of O. variabilis. The relationships among beak measurements and body length (either ML or TL) were not significantly different between two sexes; while those among several beak measurements (UHL, LHL and LBW) and body weight (W) were sexually different. Since male individuals of this species have a slightly greater body weight distribution than female individuals, the body weight was not an appropriate measurement for estimating size and biomass, especially when the sex of individuals in the stomachs of predators was unknown. These relationships provided essential information for future use in size and biomass estimation of O. variabilis, as well as the estimation of predator/prey size ratios in the diet of top predators.
DEFF Research Database (Denmark)
Ma, L.X.; Hass, M.A.S.; Vierick, N.
2003-01-01
The dynamics of the backbone of the electron-transfer protein plastocyanin from the cyanobacterium Anabaena variabilis were determined from the N-15 and C-13(alpha) R-1 and R-2) relaxation rates and steady-state [H-1]-N-15 and [H-1]-C-13 nuclear Overhauser effects (NOEs) using the model...
Nozue, Shuho; Katayama, Mitsunori; Terazima, Masahide; Kumazaki, Shigeichi
2017-09-01
Heterocyst is a nitrogen-fixing cell differentiated from a cell for oxygen-evolving photosynthesis (vegetative cell) in some filamentous cyanobacteria when fixed nitrogen (e.g., ammonia and nitrate) is limited. Heterocysts appear at multiple separated positions in a single filament with an interval of 10-20 cells in some genera (including Anabaena variabilis). In other genera, a single heterocyst appears only at the basal terminal in a filament (including Rivularia M-261). Such morphological diversity may necessitate different properties of heterocysts. However, possible differences in heterocysts have largely remained unexplored due to the minority of heterocysts among major vegetative cells. Here, we have applied spectroscopic microscopy to Rivularia and A. variabilis to analyze their thylakoid membranes in individual cells. Absorption and fluorescence spectral imaging enabled us to estimate concentrations and interconnections of key photosynthetic components like photosystem I (PSI), photosystem II (PSII) and subunits of light-harvesting phycobilisome including phycocyanin (PC). The concentration of PC in heterocysts of Rivularia is far higher than that of A. variabilis. Fluorescence quantum yield of PC in Rivularia heterocysts was found to be virtually the same as those in its vegetative cells, while fluorescence quantum yield of PC in A. variabilis heterocysts was enhanced in comparison with its vegetative cells. PSI concentration in the thylakoid membranes of heterocysts seems to remain nearly the same as those of the vegetative cells in both the species. The average stoichiometric ratio between PSI monomer and PC hexamer in Rivularia heterocysts is estimated to be about 1:1. Copyright © 2017 Elsevier B.V. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Vohník, Martin; Mrnka, Libor; Lukešová, Tereza; Bruzone, M. C.; Kohout, Petr; Fehrer, Judith
2013-01-01
Roč. 6, č. 4 (2013), s. 281-292 ISSN 1754-5048 R&D Projects: GA ČR GP206/09/P340 Institutional support: RVO:67985939 Keywords : ectomycorrhiza * endophytes * Meliniomyces variabilis Subject RIV: EF - Botanics Impact factor: 2.992, year: 2013
Kang, Hongzhang; Sun, Xiao; Yin, Shan; Du, Hongmei; Yamanaka, Norikazu; Gapare, Washington; Wu, Harry X.; Liu, Chunjiang
2012-01-01
The biogeographical relationships between far-separated populations, in particular, those in the mainland and islands, remain unclear for widespread species in eastern Asia where the current distribution of plants was greatly influenced by the Quaternary climate. Deciduous Oriental oak (Quercus variabilis) is one of the most widely distributed species in eastern Asia. In this study, leaf material of 528 Q. variabilis trees from 50 populations across the whole distribution (Mainland China, Korea Peninsular as well as Japan, Zhoushan and Taiwan Islands) was collected, and three cpDNA intergenic spacer fragments were sequenced using universal primers. A total of 26 haplotypes were detected, and it showed a weak phylogeographical structure in eastern Asia populations at species level, however, in the central-eastern region of Mainland China, the populations had more haplotypes than those in other regions, with a significant phylogeographical structure (N ST = 0.751> G ST = 0.690, Ptree showed a rapid speciation during Pleistocene, with a population augment occurred in Middle Pleistocene. Both diversity patterns and ecological niche modelling indicated there could be multiple glacial refugia and possible bottleneck or founder effects occurred in the southern Japan. We dated major spatial expansion of Q. variabilis population in eastern Asia to the last glacial cycle(s), a period with sea-level fluctuations and land bridges in East China Sea as possible dispersal corridors. This study showed that geographical heterogeneity combined with climate and sea-level changes have shaped the genetic structure of this wide-ranging tree species in East Asia. PMID:23115642
Chimetto, Luciane A; Cleenwerck, Ilse; Alves, Nelson; Silva, Bruno Sergio; Brocchi, Marcelo; Willems, Anne; De Vos, Paul; Thompson, Fabiano L
2011-02-01
Eight Vibrio isolates originating from the marine corals Mussismilia hispida and Phyllogorgia dilatata and the zoanthids Palythoa caribaeorum and Palythoa variabilis in Brazil and the Pacific white shrimp (Litopenaeus vannamei) in Ecuador were studied by means of a polyphasic approach. The novel isolates formed a tight monophyletic group in the genus Vibrio and were closely related to species of the Vibrio harveyi group, to which they showed more than 99 % 16S rRNA gene sequence similarity. Analysis based on concatenated sequences of the following seven genes, 16S rRNA, gyrB, recA, rpoA, topA, pyrH and mreB (5633 bp in length), showed clear separation between the isolates and species of the V. harveyi group. Amplified fragment length polymorphism (AFLP) analysis, performed previously, revealed that a representative isolate of this group, LMG 20370, was clearly separate from known Vibrio species (it belonged to the so-called AFLP cluster A31). DNA-DNA hybridization (DDH) experiments with representative isolates and type strains of the V. harveyi species group revealed high DDH between the novel isolates (more than 74 %) and less than 70 % DDH towards type strains of related Vibrio species, proving the novel species status of the isolates. Phenotypically, the novel species belongs to the arginine dihydrolase (A)-negative, lysine decarboxylase (L)-positive and ornithine decarboxylase (O)-positive (A-/L+/O+) cluster reported previously. Most species of the V. harveyi group (i.e. Vibrio rotiferianus, V. harveyi, V. parahaemolyticus and V. alginolyticus) also belong to this A-/L+/O+ cluster. However, several phenotypic features can be used for the identification of the novel species. In contrast to its closest phylogenetic neighbours, the novel species exhibits esterase (C4) and N-acetyl-β-glucosaminidase activities, but it does not produce acetoin, does not use citrate, α-ketoglutaric acid or propionic acid and does not ferment melibiose. The novel species can
Qiaoyu Sun; R. Kasten Dumroese; Yong Liu
2018-01-01
Container volume and irrigation management affect seedling growth in the nursery and field. We evaluated the effects of container volumes (D40, 656 ml; D60, 983 ml) and subirrigation schedules (85%, 75%, 65%, and 55% of 100% total substrate moisture content, TSMC) on seedling growth in a greenhouse and outplanting performance of Chinese cork oak (Quercus variabilis...
Shibata, Aika; Takahashi, Fumio; Kasahara, Masahiro; Imamura, Nobutaka
2016-11-01
The endosymbiotic green algae of Paramecium bursaria are known to release a photosynthate to the host cells. The endosymbiont Chlorella variabilis F36-ZK isolated in Japan releases maltose under acidic conditions, and such release requires both light and low pH. However, whether photosynthate release is due to light sensing by photoreceptors or is merely a consequence of active photosynthesis is unclear. Herein, we studied the effect of light on maltose release from C. variabilis F36-ZK; we measured maltose release using a combination of 1-phenyl-3-methyl-5-pyrazolone derivative and 14 C-tracer methods. Blue (450nm) or red (around 600nm) light was most effective to stimulate maltose release. This suggests that the photosynthetic pathway probably participates in maltose release, because the effective wavelength corresponds to the absorption spectrum of chlorophyll. Furthermore, maltose release was slightly affected by addition of a photosynthetic inhibitor, 3-(3,4-dichlorophenyl)-1,1-dimethylurea, but was abolished by another inhibitor of photosynthesis, 2,5-dibromo-6-isopropyl-3-methyl-1,4-benzoquinone, suggesting that electron flow through photosystem I may be more involved in maltose release. Interestingly, starving F36-ZK cells cultured under prolonged dark conditions did not release maltose but retained their photosynthetic capacity. Our results thus show that maltose release is regulated by light and cellular conditions in endosymbiotic Chlorella. Copyright © 2016. Published by Elsevier GmbH.
Kinaro, Zachary Omambia; Xue, Liangyi; Volatiana, Josies Ancella
2016-07-01
The Cichlid fishes have played an important role in evolutionary biology, population studies and aquaculture industry with East African species representing a model suited for studying adaptive radiation and speciation for cichlid genome projects in which closely related genomes are fast emerging presenting questions on phenotype-genotype relations. The complete mitochondrial genomes presented here are for two closely related but eco-morphologically distinct Lake Victoria basin cichlids, Oreochromis variabilis, an endangered native species and Tilapia zilli, an invasive species, both of which are important economic fishes in local areas. The complete mitochondrial genomes determined for O. variabilis and T. zilli are 16 626 and 16,619 bp, respectively. Both the mitogenomes contain 13 protein-coding genes, 22 tRNAs, 2 rRNAs and a non-coding control region, which are typical of vertebrate mitogenomes. Phylogenetic analyses of the two species revealed that though both lie within family Cichlidae, they are remotely related.
Molecular cloning of a recA-like gene from the cyanobacterium Anabaena variabilis
International Nuclear Information System (INIS)
Owttrim, G.W.; Coleman, J.R.
1987-01-01
A recA-like gene isolated from the cyanobacterium Anabaena variabilis was cloned and partially characterized. When introduced into Escherichia coli recA mutants, the 7.5-kilobase-pair plasmid-borne DNA insert restored resistance to methyl methanesulfonate and UV irradiation, as well as recombination proficiency when measured by Hfr-mediated conjugation. The cyanobacterial recA gene restored spontaneous but not mitomycin C-induced prophage production. Restriction analysis and subcloning yielded a 1.5-kilobase-pair Sau3A fragment which also restored methylmethane sulfonate resistance and coded for a 38- to 40-kilodalton polypeptide when expressed in an in vitro transcription-translation system
Institute of Scientific and Technical Information of China (English)
王佩舒; 刘琳奇; 陈景玲; 樊巍
2017-01-01
利用分期播种的试验方法,在人工气候箱和苗圃地两种环境下,采取人工模拟环境和自然环境分别测试栓皮栎出苗期土壤温度及出苗率.依据积温学说进行数据处理,确定了栓皮栎的活动温度和出苗所需的活动积温.结果表明:1)在人工环境中,当设定环境温度为6℃时,栓皮栎种子未发芽;当环境温度提升至8℃时,种子零星发芽;当设定环境温度为10℃与12℃时,其出苗率接近80%,因此确定栓皮栎的活动温度为10℃.2)在人工环境中,出苗率为60%与80%的积温相差较小,平均出苗积温为1000℃·d;在自然环境中,由于受环境影响栓皮栎幼苗出苗整齐性较差,因此以出苗率为60%对应的活动积温1300℃·d作为栓皮栎幼苗出苗活动积温.%In this paper,the soil temperature and emergence rate of Quercus variabilis is observed,by using the method of sowing in different stages. We designed different experiment in artificial climate chamber and natural environment. Based on accumulated theory,we ascertained the active temperature and emergence accumulated temperature of Q. variabilis. The results show as follows. 1)In the artificial environment,when the ambient temperature is 6℃,the seeds of Q. variabilis are not germinated;when the ambient temperature is raised to 8℃,the seeds sprout;when the ambient temperature is 10℃and 12℃,the emergence rate is close to 80%,so the activity of Q. variabilis was determined to be 10℃. 2)In the artificial environment,the emergence rate of 60%and 80%of the accumulated temperature difference is small,the average seedling accumulated temperature is 1000℃· day. While in the natural environment,due to the environmental impact of Q. variabilis seedling emergence uniformity is poor,the emergence rate 60%of the corresponding activity accumulated temperature 1300℃· day could be used as Q. variabilis seedling activity accumulated temperature.
Digestion of bacteria by Nais variabilis (Oligochaeta) as established by autoradiography
International Nuclear Information System (INIS)
Harper, R.M.; Fry, J.C.; Learner, M.A.
1981-01-01
Serratia marcescens grown on different tritiated substrates was fed to Nais variabilis for 40 min, 4 h, and 17 h periods. The substrates were glucose, thymidine and glycerol which labelled mainly low molecular compounds, DNA, and lipids respectively. The worms incorporated radioactive label into their tissues within 40 min of feeding on the labelled bacteria. Incorporation of label where low molecular weight compounds were labelled could be due to absorption of dissolved bacterial secretions through the gut or body wall. However, DNA is a macromolecule not secreted by bacteria, consequently the label within this molecule could only accumulate in worm tissue after digestion, absorption and assimilation. No definite pattern of uptake or translocation along the worm was conclusively established but there was some indication that uptake was greatest in the anterior region of the intestine. Bacterial lipids were digested more slowly than the other materials labelled. (author)
Flor-Weiler, Lina B; Behle, Robert W; Stafford, Kirby C
2011-03-01
Toxicity of nootkatone was determined in laboratory assays against unfed nymphs of Amblyomma americanum L., Dermacentor variabilis (Say), Ixodes scapularis Say, and Rhipicephalus sanguineus Latreille. We determined the 50% lethal concentration (LC50) and 90% lethal concentration (LC90) of nootkatone by recording tick mortality 24 h after exposure in treated glass vials. Nymphs were susceptible to nootkatone with LC50 values of 0.352, 0.233, 0.169, and 0.197 microg/cm2, and LC90 values of 1.001, 0.644, 0.549, and 0.485 microg/cm2 for A. americanum, D. variabilis, I. scapularis, and R. sanguineus, respectively. The LC50 value for R. sanquineus was not significantly different from D. variabilis or I. scapularis. Other LC50 comparisons were significantly different. The LC90 for A. americanum was higher when compared with the three other tick species, which were not significantly different. Because nootkatone is volatile, we measured the amount of nootkatone recovered from duplicate-treated vials before tick exposure and from vials after tick exposure. Nootkatone recovered from vials before exposure ranged from 82 to 112% of the expected amounts. The nootkatone recovered after the 24-h exposure period ranged from 89% from vials coated with higher concentrations of nootkatone, down to 29% from vials coated with low nootkatone concentrations. Determination of the nootkatone residue after vial coating demonstrated loss of the active compound while verifying the levels of tick exposure. Toxicity of low concentrations of nootkatone to the active questing stage of ticks reported in this study provides a reference point for future formulation research to exploit nootkatone as a safe and environment-friendly tick control.
Cheng, Yu-Shen; Labavitch, John; VanderGheynst, Jean S
2015-05-01
Microalgae have been proposed as a potential feedstock for biofuel production; however, cell disruption is usually required for collection and utilization of cytoplasmic polysaccharides and lipids. Virus infection might be one approach to disrupt the cell wall. The concentration of yeast extract and presence of KNO3 in algae cultivation media were investigated to observe their effects on Chlorella variabilis NC64A physiology and composition and the subsequent effect on production of Chlorella virus and disruption of infected cells. Cytoplasmic starch accumulation increased from 5% to approximately 35% of the total dry weight when yeast extract decreased from 1 to 0.25 g L(-1). When cells were cultured with the lowest nitrogen levels, the total polysaccharide accounted for more than 50% of the cell wall, which was 1.7 times higher than the content in cells cultured with the highest nitrogen levels. The C/N ratio of the algal biomass decreased by a factor of approximately 2 when yeast extract increased from 0.25 to 1 g L(-1). After virus infection, cells with a low C/N ratio produced a 7.6 times higher burst size than cells with a high C/N ratio, suggesting that the nitrogen content in C. variabilis has a large influence on viral production and cell lysis. The results have implications on management of nitrogen for both the synthesis of products from algae and product recovery via viral lysis.
INFLUENCE OF HIGH LIGHT INTENSITY ON THE CELLS OF CYANOBACTERIA ANABAENA VARIABILIS SP. ATCC 29413
Directory of Open Access Journals (Sweden)
OPRIŞ SANDA
2012-12-01
Full Text Available In this article is presented the result of research regardind the effect of high light intensity on the cells of Anabaena variabilis sp. ATCC 29413, the main objective is to study the adaptation of photosynthetic apparatus to light stress. Samples were analyzed in the present of herbicide diuron (DCMU which blocks electron flow from photosystem II and without diuron. During treatment maximum fluorescence and photosystems efficiency are significantly reduced, reaching very low values compared with the blank, as a result of photoinhibition installation. Also by this treatment is shown the importance of the mechanisms by which cells detect the presence of light stress and react accordingly.
Brodelius, P; Nilsson, K; Mosbach, K
1981-12-01
Whole cells ofTrigonopsis variabilis were immobilized by entrapment in Ca(2+)-alginate and used for the production of α-keto acids from the corresponding D-amino acids. The D-amino acid oxidase within the immobilized cells has a broad substrate specificity. Hydrogen peroxide formed in the enzymatic reaction was efficiently hydrolyzed by manganese oxide co-immobilized with the cells. The amino acid oxidase activity was assayed with a new method based on reversed-phase HPLC. Oxygen requirements, bead size, concentration of cells in the beads, flow rate, and other factors were investigated in a " trickle-bed " reactor.
Directory of Open Access Journals (Sweden)
JANINE F. SILVA
2015-06-01
Full Text Available In Brazilian reefs, zoanthids, especially Palythoa caribaeorum are fundamental for structuring the local benthic community. The objective of this study was to determine the growth rate of P. caribaeorum, and to assess the influence of the site (different beaches, season (dry and wet, location (intertidal or infralittoral zones, and human pressure associated with tourism. For one year we monitored the cover of P. caribaeorum in transects and focused on 20 colonies. We cut off a square (100 cm2 from the central part of the colony and monitored the bare area for four months in each season. The average growth rates varied from 0.015 and 0.021 cm.day-1. The rate was homogeneous in all localities, and there was no influence from colony site, location, or touristic visitation, showing that the growth velocity may be an intrinsic characteristic of the species, with a strong genetic component. The growth rate of P. caribaeorum differed among months, and peaked in the first month after injury. The average cover varied from 6.2 to 22.9% and was lower on the reef visited by tourists. The present study corroborates the hypothesis that P. caribaeorum is important for coastal reef dynamics due to its fast and continuous growth.
Silva, Janine F; Gomes, Paula B; Santana, Erika C; Silva, João M; Lima, Érica P; Santos, Andre M M; Pérez, Carlos D
2015-01-01
In Brazilian reefs, zoanthids, especially Palythoa caribaeorum are fundamental for structuring the local benthic community. The objective of this study was to determine the growth rate of P. caribaeorum, and to assess the influence of the site (different beaches), season (dry and wet), location (intertidal or infralittoral zones), and human pressure associated with tourism. For one year we monitored the cover of P. caribaeorum in transects and focused on 20 colonies. We cut off a square (100 cm2) from the central part of the colony and monitored the bare area for four months in each season. The average growth rates varied from 0.015 and 0.021 cm.day(-1). The rate was homogeneous in all localities, and there was no influence from colony site, location, or touristic visitation, showing that the growth velocity may be an intrinsic characteristic of the species, with a strong genetic component. The growth rate of P. caribaeorum differed among months, and peaked in the first month after injury. The average cover varied from 6.2 to 22.9% and was lower on the reef visited by tourists. The present study corroborates the hypothesis that P. caribaeorum is important for coastal reef dynamics due to its fast and continuous growth.
International Nuclear Information System (INIS)
Knoche, Krysti L.; Aoyama, Erika; Hasan, Kamrul; Minteer, Shelley D.
2017-01-01
Current ammonia production methods are costly and environmentally detrimental. Biological nitrogen fixation has implications for low cost, environmentally friendly ammonia production. It has been shown that electrochemical stimulation increases the ammonia output of the cyanobacteria SA-1 mutant of Anabaena variabilis, but the mechanism of bioelectrocatalysis has been unknown. Here, the mechanism of electrostimulated biological ammonia production is investigated by immobilization of the cyanobacteria with polyvinylamine on indium tin oxide (ITO) coated polyethylene. Cyclic voltammetry is performed in the absence and presence of various substrates and with nitrogenase repressed and nitrogenase derepressed cells to study mechanism, and cyclic voltammetry and UV–vis spectroscopy are used to identify redox moieties in the spent electrolyte. A bioelectrocatalytic signal is observed for nitrogenase derepressed A. variabilis SA-1 in the presence of N_2 and light. Results indicate that the redox protein ferredoxin mediates electron transfer between nitrogenase and the electrode to stimulate ammonia production.
Francuski, Lj.; Vujic, A.; Kovacevic, A.; Ludoski, J.; Milankov, V.
2009-01-01
The present study investigates phenotypic differentiation patterns among four species of the Cheilosia variabilis group (Diptera, Syrphidae) using a landmark-based geometric morphometric approach. Herein, wing geometric morphometrics established species boundaries that confirm C. melanopa and C.
International Nuclear Information System (INIS)
Singh, Devendra; Singal, S.K.; Garg, M.O.; Maiti, Pratyush; Mishra, Sandhya; Ghosh, Pushpito K.
2015-01-01
Highlights: • B100 biodiesels from Jatropha (BJ) and marine microalga (BA) compared. • 17% lower NOx and 6% lower specific fuel consumption of BA over BJ. • Brake specific fuel consumption (BSFC) highest in urban mode in all cases. • NOx, HC and CO highest in rural-, motorway-and urban modes, respectively. • Microalga Chlorella variabilis is a promising feedstock for renewable fuels. - Abstract: Biodiesel is a renewable alternative to petro-diesel used in compression ignition (CI) engine. Two B100 biodiesel samples were prepared by patented routes from the lipids extracted from marine microalga Chlorella variabilis (BA) cultivated in salt pans and wasteland-compatible Jatropha curcas (BJ). The fuels complied with ASTM D-6751 and European Standard EN-14214 specifications. Standard Petro-diesel served as a control. Transient performance and emission characteristics of a heavy duty diesel engine fuelled with these B100 fuels (BJ and BA) were studied over European Transient Cycle. Test results showed that both B100 biodiesels outperformed petro-diesel in terms of particulate matter (PM), carbon monoxide (CO) and hydrocarbon (HC) emissions, with slight penalty on NOx emissions. Among the two biodiesels, merits of BA were established over BJ in terms of nitrogen oxides (NOx) emissions and specific fuel consumption. Mode-wise transient emission analysis revealed that NOx was highest in rural mode, CO was highest in urban and HC was highest in motorway mode for all fuels. BA may be considered as a promising alternative fuel for diesel engine which can be produced sustainably through cultivation of the marine microalga in coastal locations using seawater as culture medium, obviating thereby concerns around land use competition for food and fuel.
Directory of Open Access Journals (Sweden)
Y. Kodama
2016-01-01
Full Text Available Chlorella variabilis strain NC64A is an intracellular photobiont of the ciliate Paramecium bursaria. NC64A was isolated from P. bursaria nearly 50 years ago and was thereafter cultivated outside the host. This study was undertaken to detect changes in its infectivity to P. bursaria and its auxotrophy for growth outside the host induced during long-term cultivation. NC64A can grow in Modified Bold's Basal Medium but not in C medium, whereas another symbiotic Chlorella variabilis strain, 1N, that was recently isolated from the host grew in C medium but not in Modified Bold's Basal Medium. With regards infectivity, NC64A in the logarithmic phase of growth showed low infectivity to alga-removed P. bursaria cells, whereas those in the early stationary phase showed high infectivity of about 30%. Those in the decay phase of growth showed no infectivity. Results show that NC64A has infectivity, but the infection rate depends on their culture age in the growth curve. Furthermore, NC64A that had been re-infected to P. bursaria for more than one year and isolated from the host showed a nearly 100% infection rate, which indicates that NC64A can recover its infectivity by re-infection to P. bursaria.
Cruz, Igor C.S.
2018-01-01
Palythoa caribaeorum is a zoanthid often dominant in shallow rocky environments along the west coast of the Atlantic Ocean, from the tropics to the subtropics. This species has high environmental tolerance and is a good space competitor in reef environments. Considering current and future scenarios in the global climate regime, this study aimed to model and analyze the distribution of P. caribaeorum, generating maps of potential distribution for the present and the year 2100. The distribution was modeled using maximum entropy (Maxent) based on 327 occurrence sites retrieved from the literature. Calcite concentration, maximum chlorophyll-a concentration, salinity, pH, and temperature range yielded a model with the smallest Akaike information criterion (2649.8), and were used in the present and future distribution model. Data from the HadGEM2-ES climate model were used to generate the projections for the year 2100. The present distribution of P. caribaeorum shows that parts of the Brazilian coast, Caribbean Sea, and Florida are suitable regions for the species, as they are characterized by high salinity and pH and small temperature variation. An expansion of the species’ distribution was forecast northward under mild climate scenarios, while a decrease of suitable areas was forecast in the south. In the climate scenario with the most intense changes, P. caribaeorum would lose one-half of its suitable habitats, including the northernmost and southernmost areas of its distribution. The Caribbean Sea and northeastern Brazil, as well as other places under the influence of coastal upwellings, may serve as potential havens for this species. PMID:29785350
Durante, Leonardo M; Cruz, Igor C S; Lotufo, Tito M C
2018-01-01
Palythoa caribaeorum is a zoanthid often dominant in shallow rocky environments along the west coast of the Atlantic Ocean, from the tropics to the subtropics. This species has high environmental tolerance and is a good space competitor in reef environments. Considering current and future scenarios in the global climate regime, this study aimed to model and analyze the distribution of P. caribaeorum , generating maps of potential distribution for the present and the year 2100. The distribution was modeled using maximum entropy (Maxent) based on 327 occurrence sites retrieved from the literature. Calcite concentration, maximum chlorophyll- a concentration, salinity, pH, and temperature range yielded a model with the smallest Akaike information criterion (2649.8), and were used in the present and future distribution model. Data from the HadGEM2-ES climate model were used to generate the projections for the year 2100. The present distribution of P. caribaeorum shows that parts of the Brazilian coast, Caribbean Sea, and Florida are suitable regions for the species, as they are characterized by high salinity and pH and small temperature variation. An expansion of the species' distribution was forecast northward under mild climate scenarios, while a decrease of suitable areas was forecast in the south. In the climate scenario with the most intense changes, P. caribaeorum would lose one-half of its suitable habitats, including the northernmost and southernmost areas of its distribution. The Caribbean Sea and northeastern Brazil, as well as other places under the influence of coastal upwellings, may serve as potential havens for this species.
Sameroff, Stephen; Tagliafierro, Teresa; Jain, Komal; Williams, Simon H.; Cucura, D. Moses; Rochlin, Ilia; Monzon, Javier; Carpi, Giovanna; Tufts, Danielle; Diuk-Wasser, Maria; Brinkerhoff, Jory; Lipkin, W. Ian
2018-01-01
ABSTRACT Ticks carry a wide range of known human and animal pathogens and are postulated to carry others with the potential to cause disease. Here we report a discovery effort wherein unbiased high-throughput sequencing was used to characterize the virome of 2,021 ticks, including Ixodes scapularis (n = 1,138), Amblyomma americanum (n = 720), and Dermacentor variabilis (n = 163), collected in New York, Connecticut, and Virginia in 2015 and 2016. We identified 33 viruses, including 24 putative novel viral species. The most frequently detected viruses were phylogenetically related to members of the Bunyaviridae and Rhabdoviridae families, as well as the recently proposed Chuviridae. Our work expands our understanding of tick viromes and underscores the high viral diversity that is present in ticks. IMPORTANCE The incidence of tick-borne disease is increasing, driven by rapid geographical expansion of ticks and the discovery of new tick-associated pathogens. The examination of the tick microbiome is essential in order to understand the relationship between microbes and their tick hosts and to facilitate the identification of new tick-borne pathogens. Genomic analyses using unbiased high-throughput sequencing platforms have proven valuable for investigations of tick bacterial diversity, but the examination of tick viromes has historically not been well explored. By performing a comprehensive virome analysis of the three primary tick species associated with human disease in the United States, we gained substantial insight into tick virome diversity and can begin to assess a potential role of these viruses in the tick life cycle. PMID:29564401
Onishi, Aya; Aikawa, Shimpei; Kondo, Akihiko; Akimoto, Seiji
2017-09-01
Nitrogen is among the most important nutritious elements for photosynthetic organisms such as plants, algae, and cyanobacteria. Therefore, nitrogen depletion severely compromises the growth, development, and photosynthesis of these organisms. To preserve their integrity under nitrogen-depleted conditions, filamentous nitrogen-fixing cyanobacteria reduce atmospheric nitrogen to ammonia, and self-adapt by regulating their light-harvesting and excitation energy-transfer processes. To investigate the changes in the primary processes of photosynthesis, we measured the steady-state absorption and fluorescence spectra and time-resolved fluorescence spectra (TRFS) of whole filaments of the nitrogen-fixing cyanobacterium Anabaena variabilis at 77 K. The filaments were grown in standard and nitrogen-free media for 6 months. The TRFS were measured with a picosecond time-correlated single photon counting system. Despite the phycobilisome degradation, the energy-transfer paths within phycobilisome and from phycobilisome to both photosystems were maintained. However, the energy transfer from photosystem II to photosystem I was suppressed and a specific red chlorophyll band appeared under the nitrogen-depleted condition.
Directory of Open Access Journals (Sweden)
Baoming Du
2015-06-01
Full Text Available The concentration of the carbon-13 isotope (leaf δ13C in leaves is negatively correlated with the mean annual precipitation (MAP atlarge geographical scales. In this paper, we explain the spatial pattern of leaf δ13C variation for deciduous oriental oak (Quercus variabilis Bl. across temperate and subtropical biomes and its sensitivity to climate factors such as MAP. There was a 6‰ variation in the leaf δ13C values of oak with a significant positive correlation with latitude and negative correlations with the mean annual temperature (MAT and MAP. There was no correlation between leaf δ13C and altitude or longitude. Stepwise multiple regression analyses showed that leaf δ13C decreased 0.3‰ per 100 mm increase in MAP. MAP alone could account for 68% of the observed variation in leaf δ13C. These results can be used to improve predictions for plant responses to climate change and particularly lower rainfall.
Energy Technology Data Exchange (ETDEWEB)
Blanc, Guillaume; Duncan, Garry A.; Agarakova, Irina; Borodovsky, Mark; Gurnon, James; Kuo, Alan; Lindquist, Erika; Lucas, Susan; Pangailinan, Jasmyn; Polle, Juergen; Salamov, Asaf; Terry, Astrid; Yamada, Takashi; Dunigan, David D.; Grigoriev, Igor V.; Claverie, Jean-Michel; Etten, James L. Van
2010-05-06
Chlorella variabilis NC64A, a unicellular photosynthetic green alga (Trebouxiophyceae), is an intracellular photobiont of Paramecium bursaria and a model system for studying virus/algal interactions. We sequenced its 46-Mb nuclear genome, revealing an expansion of protein families that could have participated in adaptation to symbiosis. NC64A exhibits variations in GC content across its genome that correlate with global expression level, average intron size, and codon usage bias. Although Chlorella species have been assumed to be asexual and nonmotile, the NC64A genome encodes all the known meiosis-specific proteins and a subset of proteins found in flagella. We hypothesize that Chlorella might have retained a flagella-derived structure that could be involved in sexual reproduction. Furthermore, a survey of phytohormone pathways in chlorophyte algae identified algal orthologs of Arabidopsis thaliana genes involved in hormone biosynthesis and signaling, suggesting that these functions were established prior to the evolution of land plants. We show that the ability of Chlorella to produce chitinous cell walls likely resulted from the capture of metabolic genes by horizontal gene transfer from algal viruses, prokaryotes, or fungi. Analysis of the NC64A genome substantially advances our understanding of the green lineage evolution, including the genomic interplay with viruses and symbiosis between eukaryotes.
Atkinson, Samuel F; Sarkar, Sahotra; Aviña, Aldo; Schuermann, Jim A; Williamson, Phillip
2012-11-01
The spatial distribution of Dermacentor variabilis, the most commonly identified vector of the bacterium Rickettsia rickettsii which causes Rocky Mountain spotted fever (RMSF) in humans, and the spatial distribution of RMSF, have not been previously studied in the south central United States of America, particularly in Texas. From an epidemiological perspective, one would tend to hypothesise that there would be a high degree of spatial concordance between the habitat suitability for the tick and the incidence of the disease. Both maximum-entropy modelling of the tick's habitat suitability and spatially adaptive filters modelling of the human incidence of RMSF disease provide reliable portrayals of the spatial distributions of these phenomenons. Even though rates of human cases of RMSF in Texas and rates of Dermacentor ticks infected with Rickettsia bacteria are both relatively low in Texas, the best data currently available allows a preliminary indication that the assumption of high levels of spatial concordance would not be correct in Texas (Kappa coefficient of agreement = 0.17). It will take substantially more data to provide conclusive findings, and to understand the results reported here, but this study provides an approach to begin understanding the discrepancy.
Directory of Open Access Journals (Sweden)
Samuel F. Atkinson
2012-11-01
Full Text Available The spatial distribution of Dermacentor variabilis, the most commonly identified vector of the bacterium Rickettsia rickettsii which causes Rocky Mountain spotted fever (RMSF in humans, and the spatial distribution of RMSF, have not been previously studied in the south central United States of America, particularly in Texas. From an epidemiological perspective, one would tend to hypothesise that there would be a high degree of spatial concordance between the habitat suitability for the tick and the incidence of the disease. Both maximum-entropy modelling of the tick’s habitat suitability and spatially adaptive filters modelling of the human incidence of RMSF disease provide reliable portrayals of the spatial distributions of these phenomenons. Even though rates of human cases of RMSF in Texas and rates of Dermacentor ticks infected with Rickettsia bacteria are both relatively low in Texas, the best data currently available allows a preliminary indication that the assumption of high levels of spatial concordance would not be correct in Texas (Kappa coefficient of agreement = 0.17. It will take substantially more data to provide conclusive findings, and to understand the results reported here, but this study provides an approach to begin understanding the discrepancy.
Huang, Chen; Morlighem, Jean-Étienne R L; Cai, Jing; Liao, Qiwen; Perez, Carlos Daniel; Gomes, Paula Braga; Guo, Min; Rádis-Baptista, Gandhi; Lee, Simon Ming-Yuen
2017-07-13
Long non-coding RNAs (lncRNAs) have been shown to play regulatory roles in a diverse range of biological processes and are associated with the outcomes of various diseases. The majority of studies about lncRNAs focus on model organisms, with lessened investigation in non-model organisms to date. Herein, we have undertaken an investigation on lncRNA in two zoanthids (cnidarian): Protolpalythoa varibilis and Palythoa caribaeorum. A total of 11,206 and 13,240 lncRNAs were detected in P. variabilis and P. caribaeorum transcriptome, respectively. Comparison using NONCODE database indicated that the majority of these lncRNAs is taxonomically species-restricted with no identifiable orthologs. Even so, we found cases in which short regions of P. caribaeorum's lncRNAs were similar to vertebrate species' lncRNAs, and could be associated with lncRNA conserved regulatory functions. Consequently, some high-confidence lncRNA-mRNA interactions were predicted based on such conserved regions, therefore revealing possible involvement of lncRNAs in posttranscriptional processing and regulation in anthozoans. Moreover, investigation of differentially expressed lncRNAs, in healthy colonies and colonial individuals undergoing natural bleaching, indicated that some up-regulated lncRNAs in P. caribaeorum could posttranscriptionally regulate the mRNAs encoding proteins of Ras-mediated signal transduction pathway and components of innate immune-system, which could contribute to the molecular response of coral bleaching.
Sur trois zoanthaires nouveaux pour Tuléar, Madagascar
Herberts, C.
1976-01-01
Description of three Zoanthids new to the Tulear region (S.W. Madagascar): a macrocnemic species, Epizoanthus cf. minutus Duerden, 1898, and two brachycnemic species, Zoanthus pacificus Walsh & Bowers, 1971, and Z. vietnamensis Pax, 1957. These new records bring the number of zoanthids known from
Correlation of Coral Bleaching Events and Remotely-Sensed Sea Surface Temperatures
1994-05-19
water column. Diving on the reefs, they found significant tracts of bleached corals, zoanthids , gorgonians, and sea anemones (Bunckley-Williams and... zoanthids between May and July 1988 on shallow lagoonal reefs and rim margin reefs was the first indication of any sort of bleaching event at Bermuda
Marine Biotoxins: Laboratory Culture and Molecular Structure
1988-10-11
has been known for several years. has so far been isolated from toxic zoanthid corals. Palv~tha sp. Preliminary evidence suggests that the producer of...epiphyte of the zoanthid coral has not been realized. C. Purpose of Present Work The purposes of this work are the successful culture of G_. toxicus
Directory of Open Access Journals (Sweden)
Janet M Rowe
Full Text Available The PBCV-1/Chlorella variabilis NC64A system is a model for studies on interactions between viruses and algae. Here we present the first global analyses of algal host transcripts during the early stages of infection, prior to virus replication. During the course of the experiment stretching over 1 hour, about a third of the host genes displayed significant changes in normalized mRNA abundance that either increased or decreased compared to uninfected levels. The population of genes with significant transcriptional changes gradually increased until stabilizing at 40 minutes post infection. Functional categories including cytoplasmic ribosomal proteins, jasmonic acid biosynthesis and anaphase promoting complex/cyclosomes had a significant excess in upregulated genes, whereas spliceosomal snRNP complexes and the shikimate pathway had significantly more down-regulated genes, suggesting that these pathways were activated or shut-down in response to the virus infection. Lastly, we examined the expression of C. varibilis RNA polymerase subunits, as PBCV-1 transcription depends on host RNA polymerases. Two subunits were up-regulated, RPB10 and RPC34, suggesting that they may function to support virus transcription. These results highlight genes and pathways, as well as overall trends, for further refinement of our understanding of the changes that take place during the early stages of viral infection.
Reimer, J. D.; Nonaka, M.; Sinniger, F.; Iwase, F.
2008-12-01
The Order Zoantharia has long been taxonomically neglected primarily due to difficulty in examining the internal morphology of sand-encrusted zoanthids. However, recent work using molecular markers has shown an unexpectedly high diversity of previously “hidden” taxa (families and genera) within Zoantharia (=Zoanthidea, Zoanthiniaria). In this study, unidentified sediment-encrusting zoanthid specimens ( n = 8) were collected from living Japanese Red Coral Paracorallium japonicum (Family Coralliidae) during precious coral harvesting by Remotely Operated Vehicle (ROV) and manned submersible (February 2004-January 2006) at depths of 194-250 m at six locations between Ishigaki-jima Island and Kikai-jima Island, southern Japan. DNA sequences (mitochondrial 16S ribosomal DNA [mt 16S rDNA], cytochrome oxidase subunit I [COI], nuclear internal transcribed spacer of ribosomal DNA [ITS-rDNA]) unambiguously place these specimens in a previously undescribed, new monophyletic lineage within the family Parazoanthidae. Corallizoanthus tsukaharai, gen. n. et sp. n. is the first reported zoanthid species associated with the family Coralliidae and unlike other described gorgonian-associated zoanthids ( Savalia spp .) does not secrete its own hard axis. Morphologically, C. tsukaharai sp. n. is characterized by generally unitary polyps and bright yellow external coloration.
Lazcano-Pérez, Fernando; Castro, Héctor; Arenas, Isabel; García, David E; González-Muñoz, Ricardo; Arreguín-Espinosa, Roberto
2016-05-05
The Zoanthids are an order of cnidarians whose venoms and toxins have been poorly studied. Palythoa caribaeorum is a zoanthid commonly found around the Mexican coastline. In this study, we tested the activity of P. caribaeorum venom on voltage-gated sodium channel (NaV1.7), voltage-gated calcium channel (CaV2.2), the A-type transient outward (IA) and delayed rectifier (IDR) currents of KV channels of the superior cervical ganglion (SCG) neurons of the rat. These results showed that the venom reversibly delays the inactivation process of voltage-gated sodium channels and inhibits voltage-gated calcium and potassium channels in this mammalian model. The compounds responsible for these effects seem to be low molecular weight peptides. Together, these results provide evidence for the potential use of zoanthids as a novel source of cnidarian toxins active on voltage-gated ion channels.
Directory of Open Access Journals (Sweden)
Fernando Lazcano-Pérez
2016-05-01
Full Text Available The Zoanthids are an order of cnidarians whose venoms and toxins have been poorly studied. Palythoa caribaeorum is a zoanthid commonly found around the Mexican coastline. In this study, we tested the activity of P. caribaeorum venom on voltage-gated sodium channel (NaV1.7, voltage-gated calcium channel (CaV2.2, the A-type transient outward (IA and delayed rectifier (IDR currents of KV channels of the superior cervical ganglion (SCG neurons of the rat. These results showed that the venom reversibly delays the inactivation process of voltage-gated sodium channels and inhibits voltage-gated calcium and potassium channels in this mammalian model. The compounds responsible for these effects seem to be low molecular weight peptides. Together, these results provide evidence for the potential use of zoanthids as a novel source of cnidarian toxins active on voltage-gated ion channels.
Taxonomy and epidemiology Mucor irregularis, agent of chronic cutaneous mucormycosis
Lu, X.L.; Najafzadeh, M.J.; Dolatabadi, S.; Ran, Y.P.; Gerrits van den Ende, A.H.G.; Shen, Y.N.; Li, C.Y.; Xi, L.Y.; Hao, F.; Zhang, Q.Q.; Li, R.Y.; Hu, Z.M.; Lu, G.; Wang, J.J.; Drogari-Apiranthitou, M.; Klaassen, C.; Meis, J.F.; Hagen, F.; Liu, W.D.; de Hoog, G.S.
2013-01-01
Mucormycosis usually presents as a progressive infection with significant angio-invasion. Mucormycosis due to Mucor irregularis (formerly Rhizomucor variabilis var. variabilis), however, is exceptional in causing chronic cutaneous infection in immunocompetent humans, ultimately leading to severe
Taxonomy and epidemiology of Mucor irregularis, agent of chronic cutaneous mucormycosis
Lu, X.-L.; Najafzadeh, M.J.; Dolatabadi, S.; Ran, Y.-P.; Shen, Y.-N.; Li, C.-Y.; Xi, L.-Y.; Hao, F.; Zhang, Q.-Q.; Li, R.-Y.; Hu, Z.-M.; Lu, G.-X.; Wang, J.-J.; Drogari-Apiranthitou, M.; Klaassen, C.; Meis, J.F.; Hagen, F.; Liu, W.-D.; Hoog, de G.S.
2013-01-01
Mucormycosis usually presents as a progressive infection with significant angio-invasion. Mucormycosis due to Mucor irregularis (formerly Rhizomucor variabilis var. variabilis), however, is exceptional in causing chronic cutaneous infection in immunocompetent humans, ultimately leading to severe
Directory of Open Access Journals (Sweden)
Minghui Zheng
Full Text Available One of the reasons for the progressive yield decline observed in cereals production is the rapid build-up of populations of the cereal cyst nematode (CCN, Heterodera avenae. These nematodes secrete so-call effectors into their host plant to suppress the plant defense responses, alter plant signaling pathways and then induce the formation of syncytium after infection. However, little is known about its molecular mechanism and parasitism during incompatible infection. To gain insight into its repertoire of parasitism genes, we investigated the transcriptome of the early parasitic second-stage (30 hours, 3 days and 9 days post infection juveniles of the CCN as well as the CCN infected tissue of the host Aegilops variabilis by Illumina sequencing. Among all assembled unigenes, 681 putative genes of parasitic nematode were found, in which 56 putative effectors were identified, including novel pioneer genes and genes corresponding to previously reported effectors. All the 681 CCN unigenes were mapped to 229 GO terms and 200 KEGG pathways, including growth, development and several stimulus-related signaling pathways. Sixteen clusters were involved in the CCN unigene expression atlas at the early stages during infection process, and three of which were significantly gene-enriched. Besides, the protein-protein interaction network analysis revealed 35 node unigenes which may play an important role in the plant-CCN interaction. Moreover, in a comparison of differentially expressed genes between the pre-parasitic juveniles and the early parasitic juveniles, we found that hydrolase activity was up-regulated in pre J2s whereas binding activity was upregulated in infective J2s. RT-qPCR analysis on some selected genes showed detectable expression, indicating possible secretion of the proteins and putative role in infection. This study provided better insights into the incompatible interaction between H. avenae and the host plant Ae. varabilis. Moreover, RNAi
Heterothallic mating in Mucor irregularis and first isolate of the species outside of Asia
This study reports on the discovery of heterothallic mating in Mucor irregularis (formerly Rhizomucor variabilis var. variabilis) and it extends the range of this species from Asia to the United States. We report on a case of primary cutaneous mucormycosis, involving the forearms of a cotton farmer ...
ORGANIZATION OF THE nif GENES OF THE NONHETEROCYSTOUS CYANOBACTERIUM TRICHODESMIUM SP. IMS101.
Dominic, Benny; Zani, Sabino; Chen, Yi-Bu; Mellon, Mark T; Zehr, Jonathan P
2000-08-26
An approximately 16-kb fragment of the Trichodesmium sp. IMS101 (a nonheterocystous filamentous cyanobacterium) "conventional"nif gene cluster was cloned and sequenced. The gene organization of the Trichodesmium and Anabaena variabilis vegetative (nif 2) nitrogenase gene clusters spanning the region from nif B to nif W are similar except for the absence of two open reading frames (ORF3 and ORF1) in Trichodesmium. The Trichodesmium nif EN genes encode a fused Nif EN polypeptide that does not appear to be processed into individual Nif E and Nif N polypeptides. Fused nif EN genes were previously found in the A. variabilis nif 2 genes, but we have found that fused nif EN genes are widespread in the nonheterocystous cyanobacteria. Although the gene organization of the nonheterocystous filamentous Trichodesmium nif gene cluster is very similar to that of the A. variabilis vegetative nif 2 gene cluster, phylogenetic analysis of nif sequences do not support close relatedness of Trichodesmium and A. variabilis vegetative (nif 2) nitrogenase genes.
Habitat preference of Zoantharia genera depends on host sponge morphology
Directory of Open Access Journals (Sweden)
Alberto Acosta
2010-08-01
Full Text Available Studies about sponge-zoanthid symbioses have been focused on understanding the specificity of the association, rather thantesting what are the characteristics that make the host suitable to be colonized. For the first time it is investigated whether the ZoanthariaParazoanthus and Epizoanthus preference is related to the host sponge morphology (shape and mechanical resistance. Materials andmethods. Sponges were categorized according to their shape and mechanical resistance. The presence/absence of zoanthids was recordedin 1,068 sponges at San Andres Island, and their habitat preference was evaluated using indices and confidence intervals. Results. 85Parazoanthus colonies (78% of the total associations and 24 Epizoanthus colonies (22% were associated to sponges (10.2% in total.Parazoanthus uses branched and compressible sponges although prefers encrusting and fragile sponges, while Epizoanthus showes theopposite pattern, it can inhabit encrusting and fragile sponges but prefers branched and compressible sponges. Conclusion. These resultsindicated that sponge morphology is an important trait in zoanthid habitat selection. On the other hand, the similarity in the habitat used byzoanthids suggests the possibility of inter-generic competition if common resources are limited in time and space, while the differentialhabitat preference allows the competitive coexistence of both genera.
Studies on the origin and distribution of palytoxin in a Caribbean coral reef.
Gleibs, S; Mebs, D; Werding, B
1995-11-01
In coral reefs of the Caribbean Sea (Colombia) palytoxin (PTX) has been detected in zoanthid species of the genera Palythoa and Zoanthus by assaying the delayed haemolysis in human erythrocytes produced by aqueous extracts, which is inhibited by ouabain pretreatment, and by HPLC. The toxin content of the polyps and colonies is highly variable and is not correlated with their reproductive cycle or with the amount of symbiotic algae. Sequestration of PTX has been observed in crustaceans (Platypodiella sp.) living in close association with Palythoa colonies and in polychaete worms (Hermodice carunculata) feeding on the zoanthids. Resistance of marine animals to the toxin may enable it to enter food chains.
Pagani, Danielle M; Heidrich, Daiane; Paulino, Gustavo V B; de Oliveira Alves, Karine; Dalbem, Paula T; de Oliveira, Caroline F; Andrade, Zélia M M; Silva, Carolini; Correia, Monica D; Scroferneker, Maria Lúcia; Valente, Patricia; Landell, Melissa Fontes
2016-12-01
Candida is a common fungus with the capacity to cause infections in humans. However, most studies have concentrated on clinical isolates and little is known about the identity, ecology and drug resistance of free living species/strains. Here, we isolate eight strains of Candida haemulonii and four strains of Cutaneotrichosporon dermatis from three marine cnidarian zoanthids species (Palythoa caribaeorum, Palythoa variabilis and Zoanthus sociatus) collected from Brazilian coral reefs. Strains were identified by sequencing of the D1/D2 domain LSU rDNA and ITS region. We tested these environmental isolates for their capacity to grow in media with increasing concentration of NaCl, capacity to grow in different temperatures, enzymatic activity and antifungal susceptibility. For C. haemulonii, all strains strongly produced gelatinase, esterase and albuminase and were either able to express lipase, phospholipase and keratinase, but not express urease and DNase. The strains were able to grow at 37 °C, but not at 39 °C, and except for LMS 40, all of them could grow in a 10 % NaCl medium. All isolates were resistant to all antifungals tested, with exception for ketoconazole and tioconazole (MIC = 2 µg/mL). For C. dermatis, all strains could grow at 39 °C and could not express phospholipase, keratinase or gelatinase. However, all were capable of expressing urease, lipase and esterase. Three out of four strains could grow in a 10 % NaCl medium, but none grew in a 30 % NaCl medium. The strains showed high values of minimal inhibitory concentration. LMPV 90 was resistant to tioconazole, terbinafine, fluconazole and posaconazole, and LMS 38 was resistant to all antifungal agents tested. We discuss the characterization of C. haemulonii and C. dermatis as a possible emerging pathogen due to its animal-related enzymatic arsenal and antifungal resistance.
Chimetto Tonon, Luciane A; Silva, Bruno Sergio de O; Moreira, Ana Paula B; Valle, Cecilia; Alves, Nelson; Cavalcanti, Giselle; Garcia, Gizele; Lopes, Rubens M; Francini-Filho, Ronaldo B; de Moura, Rodrigo L; Thompson, Cristiane C; Thompson, Fabiano L
2015-01-01
We analyzed the diversity and population structure of the 775 Vibrio isolates from different locations of the southwestern Atlantic Ocean (SAO), including St. Peter and St. Paul Archipelago (SPSPA), Abrolhos Bank (AB) and the St. Sebastian region (SS), between 2005 and 2010. In this study, 195 novel isolates, obtained from seawater and major benthic organisms (rhodoliths and corals), were compared with a collection of 580 isolates previously characterized (available at www.taxvibrio.lncc.br). The isolates were distributed in 8 major habitat spectra according to AdaptML analysis on the basis of pyrH phylogenetic reconstruction and ecological information, such as isolation source (i.e., corals: Madracis decactis, Mussismilia braziliensis, M. hispida, Phyllogorgia dilatata, Scolymia wellsi; zoanthids: Palythoa caribaeorum, P. variabilis and Zoanthus solanderi; fireworm: Hermodice carunculata; rhodolith; water and sediment) and sampling site regions (SPSPA, AB and SS). Ecologically distinct groups were discerned through AdaptML, which finds phylogenetic groups that are significantly different in their spectra of habitat preferences. Some habitat spectra suggested ecological specialization, with habitat spectra 2, 3, and 4 corresponding to specialization on SPSPA, AB, and SS, respectively. This match between habitat and location may reflect a minor exchange of Vibrio populations between geographically isolated benthic systems. Moreover, we found several widespread Vibrio species predominantly from water column, and different populations of a single Vibrio species from H. carunculata in ecologically distinct groups (H-1 and H-8 respectively). On the other hand, AdaptML detected phylogenetic groups that are found in both the benthos and in open water. The ecological grouping observed suggests dispersal and connectivity between the benthic and pelagic systems in AB. This study is a first attempt to characterize the biogeographic distribution of vibrios in both seawater and
Dholakiya, Riddhi N; Kumar, Raghawendra; Mishra, Avinash; Mody, Kalpana H; Jha, Bhavanath
2017-01-01
Bacterial secondary metabolites possess a wide range of biologically active compounds including antibacterial and antioxidants. In this study, a Gram-positive novel marine Actinobacteria was isolated from sea sediment which showed 84% 16S rRNA gene sequence (KT588655) similarity with Streptomyces variabilis (EU841661) and designated as Streptomyces variabilis RD-5. The genus Streptomyces is considered as a promising source of bioactive secondary metabolites. The isolated novel bacterial strain was characterized by antibacterial characteristics and antioxidant activities. The BIOLOG based analysis suggested that S. variabilis RD-5 utilized a wide range of substrates compared to the reference strain. The result is further supported by statistical analysis such as AWCD (average well color development), heat-map and PCA (principal component analysis). The whole cell fatty acid profiling showed the dominance of iso/anteiso branched C15-C17 long chain fatty acids. The identified strain S. variabilis RD-5 exhibited a broad spectrum of antibacterial activities for the Gram-negative bacteria ( Escherichia coli NCIM 2065, Shigella boydii NCIM, Klebsiella pneumoniae, Enterobacter cloacae, Pseudomonas sp. NCIM 2200 and Salmonella enteritidis NCIM), and Gram-positive bacteria ( Bacillus subtilis NCIM 2920 and Staphylococcus aureus MTCC 96). Extract of S. variabilis strain RD-5 showed 82.86 and 89% of 2,2-diphenyl-1-picrylhydrazyl (DPPH) free radical scavenging and metal chelating activity, respectively, at 5.0 mg/mL. While H 2 O 2 scavenging activity was 74.5% at 0.05 mg/mL concentration. Furthermore, polyketide synthases (PKSs types I and II), an enzyme complex that produces polyketides, the encoding gene(s) detected in the strain RD-5 which may probably involve for the synthesis of antibacterial compound(s). In conclusion, a novel bacterial strain of Actinobacteria , isolated from the unexplored sea sediment of Alang, Gulf of Khambhat (Gujarat), India showed promising
Directory of Open Access Journals (Sweden)
Riddhi N. Dholakiya
2017-12-01
Full Text Available Bacterial secondary metabolites possess a wide range of biologically active compounds including antibacterial and antioxidants. In this study, a Gram-positive novel marine Actinobacteria was isolated from sea sediment which showed 84% 16S rRNA gene sequence (KT588655 similarity with Streptomyces variabilis (EU841661 and designated as Streptomyces variabilis RD-5. The genus Streptomyces is considered as a promising source of bioactive secondary metabolites. The isolated novel bacterial strain was characterized by antibacterial characteristics and antioxidant activities. The BIOLOG based analysis suggested that S. variabilis RD-5 utilized a wide range of substrates compared to the reference strain. The result is further supported by statistical analysis such as AWCD (average well color development, heat-map and PCA (principal component analysis. The whole cell fatty acid profiling showed the dominance of iso/anteiso branched C15–C17 long chain fatty acids. The identified strain S. variabilis RD-5 exhibited a broad spectrum of antibacterial activities for the Gram-negative bacteria (Escherichia coli NCIM 2065, Shigella boydii NCIM, Klebsiella pneumoniae, Enterobacter cloacae, Pseudomonas sp. NCIM 2200 and Salmonella enteritidis NCIM, and Gram-positive bacteria (Bacillus subtilis NCIM 2920 and Staphylococcus aureus MTCC 96. Extract of S. variabilis strain RD-5 showed 82.86 and 89% of 2,2-diphenyl-1-picrylhydrazyl (DPPH free radical scavenging and metal chelating activity, respectively, at 5.0 mg/mL. While H2O2 scavenging activity was 74.5% at 0.05 mg/mL concentration. Furthermore, polyketide synthases (PKSs types I and II, an enzyme complex that produces polyketides, the encoding gene(s detected in the strain RD-5 which may probably involve for the synthesis of antibacterial compound(s. In conclusion, a novel bacterial strain of Actinobacteria, isolated from the unexplored sea sediment of Alang, Gulf of Khambhat (Gujarat, India showed promising
Dholakiya, Riddhi N.; Kumar, Raghawendra; Mishra, Avinash; Mody, Kalpana H.; Jha, Bhavanath
2017-01-01
Bacterial secondary metabolites possess a wide range of biologically active compounds including antibacterial and antioxidants. In this study, a Gram-positive novel marine Actinobacteria was isolated from sea sediment which showed 84% 16S rRNA gene sequence (KT588655) similarity with Streptomyces variabilis (EU841661) and designated as Streptomyces variabilis RD-5. The genus Streptomyces is considered as a promising source of bioactive secondary metabolites. The isolated novel bacterial strain was characterized by antibacterial characteristics and antioxidant activities. The BIOLOG based analysis suggested that S. variabilis RD-5 utilized a wide range of substrates compared to the reference strain. The result is further supported by statistical analysis such as AWCD (average well color development), heat-map and PCA (principal component analysis). The whole cell fatty acid profiling showed the dominance of iso/anteiso branched C15–C17 long chain fatty acids. The identified strain S. variabilis RD-5 exhibited a broad spectrum of antibacterial activities for the Gram-negative bacteria (Escherichia coli NCIM 2065, Shigella boydii NCIM, Klebsiella pneumoniae, Enterobacter cloacae, Pseudomonas sp. NCIM 2200 and Salmonella enteritidis NCIM), and Gram-positive bacteria (Bacillus subtilis NCIM 2920 and Staphylococcus aureus MTCC 96). Extract of S. variabilis strain RD-5 showed 82.86 and 89% of 2,2-diphenyl-1-picrylhydrazyl (DPPH) free radical scavenging and metal chelating activity, respectively, at 5.0 mg/mL. While H2O2 scavenging activity was 74.5% at 0.05 mg/mL concentration. Furthermore, polyketide synthases (PKSs types I and II), an enzyme complex that produces polyketides, the encoding gene(s) detected in the strain RD-5 which may probably involve for the synthesis of antibacterial compound(s). In conclusion, a novel bacterial strain of Actinobacteria, isolated from the unexplored sea sediment of Alang, Gulf of Khambhat (Gujarat), India showed promising
Sea anemone Radianthus macrodactylus--a new source of palytoxin.
Mahnir, V M; Kozlovskaya, E P; Kalinovsky, A I
1992-11-01
A very potent non-protein toxin was isolated from the sea anemone Radianthus macrodactylus with the use of chromatography on polytetrafluoroethylene, CM-Sephadex C-25 and by cation and anion exchange HPLC. The toxin was identified as palytoxin by u.v.-, i.r.- and 500 MHz 1H NMR spectroscopy. Its LD50 was 0.74 +/- 0.29 micrograms/kg by i.v. injection into mice. So far, palytoxin has been associated with zoanthids only. The toxin caused the loss of haemoglobin from erythrocytes but only in about 2 hr after the beginning of incubation, which is characteristic for palytoxin from zoanthids. Sea anemone palytoxin was divided into major and minor components by HPLC. The latter proved to be a product of degradation of palytoxin.
Perez, Rebeca; Forchhammer, Karl; Salerno, Graciela; Maldener, Iris
2016-02-01
Akinetes are resting spore-like cells formed by some heterocyst-forming filamentous cyanobacteria for surviving long periods of unfavourable conditions. We studied the development of akinetes in two model strains of cyanobacterial cell differentiation, the planktonic freshwater Anabaena variabilis ATCC 29413 and the terrestrial or symbiotic Nostoc punctiforme ATCC 29133, in response to low light and phosphate starvation. The best trigger of akinete differentiation of Anabaena variabilis was low light; that of N. punctiforme was phosphate starvation. Light and electron microscopy revealed that akinetes of both species differed from vegetative cells by their larger size, different cell morphology and large number of intracellular granules. Anabaena variabilis akinetes had a multilayer envelope; those of N. punctiforme had a simpler envelope. During akinete development of Anabaena variabilis, the amount of the storage compounds cyanophycin and glycogen increased transiently, whereas in N. punctiforme, cyanophycin and lipid droplets increased transiently. Photosynthesis and respiration decreased during akinete differentiation in both species, and remained at a low level in mature akinetes. The clear differences in the metabolic and morphological adaptations of akinetes of the two species could be related to their different lifestyles. The results pave the way for genetic and functional studies of akinete differentiation in these species.
Yabsley, Michael J; Nims, Todd N; Savage, Mason Y; Durden, Lance A
2009-10-01
Ticks were collected from 38 black bears (Ursus americanus floridanus) from northwestern Florida (n = 18) from 2003 to 2005 and southern Georgia (n = 20) in 2006. Five species (Amblyomma americanum, A. maculatum, Dermacentor variabilis, Ixodes scapularis, and I. affinis) were collected from Florida bears, and 4 species (A. americanum, A. maculatum, D. variabilis, I. scapularis) were collected from bears in Georgia. Ixodes scapularis was the most frequently collected tick, followed by D. variabilis, A. americanum, A. maculatum, and I. affinis. The collection of I. affinis from a Florida bear represents a new host record. A subset of ticks was screened for pathogens and putative symbionts by polymerase chain reaction (PCR). The zoonotic tick-borne pathogens Ehrlichia chaffeensis and Rickettsia parkeri were detected in 1 of 23 (4.3%) A. americanum and 1 of 12 (8.3%) A. maculatum, respectively. The putative zoonotic pathogen "Rickettsia amblyommii" was detected in 4 (17.4%) A. americanum and 1 (8.3%) A. maculatum. Other putative symbiotic rickettsiae detected included R. bellii and R. montanensis in D. variabilis, a Rickettsia cooleyi-like sp. and Rickettsia sp. Is-1 in I. scapularis, and Rickettsia TR39-like sp. in I. scapularis and A. americanum. All ticks were PCR-negative for Anaplasma phagocytophilum, Panola Mountain Ehrlichia sp., E. ewingii, Francisella tularensis, and Borrelia spp.
Dangerous reef aquaristics: Palytoxin of a brown encrusting anemone causes toxic corneal reactions.
Ruiz, Yasmin; Fuchs, Joan; Beuschel, Ralf; Tschopp, Markus; Goldblum, David
2015-11-01
Although frequently observed in domestic saltwater aquariums, literature on exposure to palytoxin (PTX) of encrusting anemones (Zoanthidea) kept in aquariums is rare. Handling these animals for propagation purposes or during cleaning work can lead to dermal, ocular or respiratory contact with the PTX generated by some Zoanthids. The present study describes a case of ocular exposure to liquid from a Zoanthid, which led to corneal ulcers. The patient also suffered from systemic symptoms of dyspnea and shivering and a suspected rhabdomyolysis, which required monitoring in the Intensive Care Unit. After symptomatic treatment provided insufficient results, the corneal ulcers improved with an amniotic membrane transplantation. A review of the literature regarding ocular exposures to this diverse order of Hexacorallia reveals that severe and systemic symptoms can develop with minimal contact. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Mariluza A. Granja e Barros
2002-01-01
Full Text Available Foram investigados a floração sincrônica e os sistemas reprodutivos de Kielmeyera abdita Saddi, K. coriacea Mart.,K. speciosa St. Hil. e K. variabilis Mart., que são espécies de cerrado e ocorrem freqüentemente na Fazenda Água Limpa da Universidade de Brasília, Brasília (DF. As quatro espécies de Kielmeyerasão simpátricas e o período de floração se extende por dois ou tres meses. K. abdita, K. coriacea eK. variabilis,florescem em sincronia durante o período seco (agosto - dezembro e K speciosa floresce isoladamente durante o período chuvoso (fevereriro - maio. A floração convergente dessa três espécies, sugere que as mesmas estão envolvidas em um processo de mutualismo floral, no qual atraem grande número de polinizadores, incrementando os níveis de polinização cruzada. Todas as espécies têm morfologia floral similar, com corolas abertas de cor albo-rósea (K. abdita, K. coriacea, K. speciosa ou alva (K. variabilis, contrastando com estames em pincel, de cor amarelo - forte, que apresentam glândulas apicais produtoras de perfume doce peculiar a Kielmeyera. A presença de andromonoecia é marcante exceto em K. speciosa. As flores apresentam síndrome de entomofilia, sendo visitadas por 21 espécies de abelhas, porém só as abelhas fêmeas Xylocopa hirsutissima Maidl e X. frontalis (Olivier, foram consideradas polinizadores efetivos, devido à alta freqüência e eficiência na coleta de pólen. Com relação aos sistemas reprodutivos, foi constatado que as espécies de Kielmeyera são xenogâmicas e auto-incompatíveis. Os tubos polínicos resultantes de autopolinização foram bloqueados no ovário, sugerindo auto-incompatibilidade de ação tardia. A percentagem de frutos resultantes de polinização cruzada ( K.abdita 33%, K. coriacea 48,5%, K.speciosa 41,5% e K.variabilis 36,5% foi maior que a de polinização natural (K.abdita 13,3%, K. coriacea 30%, K.speciosa 23% e K.variabilis 30%. Isto sugere que apesar da
Directory of Open Access Journals (Sweden)
Luciane A. Chimetto Tonon
2015-02-01
Full Text Available We analyzed the diversity and population structure of the 775 Vibrio isolates from different locations of the southwestern Atlantic Ocean (SAO, including St. Peter and St. Paul Archipelago (SPSPA, Abrolhos Bank (AB and the St. Sebastian region (SS, between 2005 and 2010. In this study, 195 novel isolates, obtained from seawater and major benthic organisms (rhodoliths and corals, were compared with a collection of 580 isolates previously characterized (available at www.taxvibrio.lncc.br. The isolates were distributed in 8 major habitat spectra according to AdaptML analysis on the basis of pyrH phylogenetic reconstruction and ecological information, such as isolation source (i.e., corals: Madracis decactis, Mussismilia braziliensis, M. hispida, Phyllogorgia dilatata, Scolymia wellsi; zoanthids: Palythoa caribaeorum, P. variabilis and Zoanthus solanderi; fireworm: Hermodice carunculata; rhodolith; water and sediment and sampling site regions (SPSPA, AB and SS. Ecologically distinct groups were discerned through AdaptML, which finds phylogenetic groups that are significantly different in their spectra of habitat preferences. Some habitat spectra suggested ecological specialization, with habitat spectra 2, 3, and 4 corresponding to specialization on SPSPA, AB, and SS, respectively. This match between habitat and location may reflect a minor exchange of Vibrio populations between geographically isolated benthic systems. Moreover, we found several widespread Vibrio species predominantly from water column, and different populations of a single Vibrio species from H. carunculata in ecologically distinct groups (H-1 and H-8 respectively. On the other hand, AdaptML detected phylogenetic groups that are found in both the benthos and in open water. The ecological grouping observed suggests dispersal and connectivity between the benthic and pelagic systems in AB. This study is a first attempt to characterize the biogeographic distribution of vibrios in both
Occurrence and sequestration of toxins in food chains.
Mebs, D
1998-11-01
Animals may acquire toxicity by absorbing toxic compounds from their food, e.g. from plants or other animals. Sequestration and accumulation of toxins may provide protection from predators, which learn to avoid this prey because of unpleasant experiences such as bitter taste. This is a common phenomenon in marine as well as in terrestrial ecosystems. Moreover, toxins may enter food chains where they accumulate reaching high, often lethal concentrations. Palytoxin which had been primarily detected in marine zoanthids (Palythoa sp.), occurs also in a wide range of other animals, e.g. in sponges, corals, shellfish, polychaetes and crustaceans, but also in fish, which feed on crustaceans and zoanthids as well. These animals exhibit a high resistance to the toxin's action. The mechanisms which protect the Na+, K+-ATPase of their cell membranes, the primary target of palytoxin, is unknown. Sequestration of the toxin by other animals may cause health problems due to food poisoning.
Singh, Surendra; Datta, Pallavi
2006-01-01
Periodic applications of heavy dosages of herbicides in modern rice-agriculture are a necessary evil for obtaining high crop productivity. Such herbicides are not only detrimental to weeds but biofertilizer strains of diazotrophic cyanobacteria also. It is therefore, essential to screen and select such biofertilizer strains of diazotrophic cyanobacteria exhibiting natural tolerance to common rice-field herbicides that can be further improved by mutational techniques to make biofertilizer technology a viable one. Therefore, efforts have been made to screen five dominant diazotrophic cyanobacterial forms e.g. filamentous heterocystous Nostoc punctiforme , Nostoc calcicola , Anabaena variabilis and unicellular Gloeocapsa sp. and Aphanocapsa sp. along with standard laboratory strain Nostoc muscorum ISU against increasing concentrations (0-100 mg l(-1) of four commercial grade common rice-field herbicides i.e. Arozin, Butachlor, Alachlor and 2,4-D under diazotrophic growth conditions. The lethal and IGC(50) concentrations for all four herbicides tested were found highest for A. variabilis as compared to other test cyanobacteria. The lowest reduction in chlorophyll a content, photosynthetic oxygen evolution, and N(2)-fixation was found in A. variabilis as compared to other rice field isolates and standard laboratory strain N. muscorum ISU. On the basis of prolong survival potential and lowest reductions in vital metabolic activities tested at IGC(50) concentration of four herbicides, it is concluded that A. variabilis is the most potent and promising cyanobacterial isolate as compared with other forms. This could be further improved by mutational techniques for exploitation as most potential and viable biofertilizer strain.
Kakumanu, Madhavi L.; Ponnusamy, Loganathan; Sutton, Haley T.; Meshnick, Steven R.; Nicholson, William L.
2016-01-01
A novel nested PCR assay was developed to detect Rickettsia spp. in ticks and tissue samples from humans and laboratory animals. Primers were designed for the nested run to amplify a variable region of the 23S-5S intergenic spacer (IGS) of Rickettsia spp. The newly designed primers were evaluated using genomic DNA from 11 Rickettsia species belonging to the spotted fever, typhus, and ancestral groups and, in parallel, compared to other Rickettsia-specific PCR targets (ompA, gltA, and the 17-kDa protein gene). The new 23S-5S IGS nested PCR assay amplified all 11 Rickettsia spp., but the assays employing other PCR targets did not. The novel nested assay was sensitive enough to detect one copy of a cloned 23S-5S IGS fragment from “Candidatus Rickettsia amblyommii.” Subsequently, the detection efficiency of the 23S-5S IGS nested assay was compared to those of the other three assays using genomic DNA extracted from 40 adult Dermacentor variabilis ticks. The nested 23S-5S IGS assay detected Rickettsia DNA in 45% of the ticks, while the amplification rates of the other three assays ranged between 5 and 20%. The novel PCR assay was validated using clinical samples from humans and laboratory animals that were known to be infected with pathogenic species of Rickettsia. The nested 23S-5S IGS PCR assay was coupled with reverse line blot hybridization with species-specific probes for high-throughput detection and simultaneous identification of the species of Rickettsia in the ticks. “Candidatus Rickettsia amblyommii,” R. montanensis, R. felis, and R. bellii were frequently identified species, along with some potentially novel Rickettsia strains that were closely related to R. bellii and R. conorii. PMID:26818674
Oleic acid biosynthesis in cyanobacteria
International Nuclear Information System (INIS)
VanDusen, W.J.; Jaworski, J.G.
1986-01-01
The biosynthesis of fatty acids in cyanobacteria is very similar to the well characterized system found in green plants. However, the initial desaturation of stearic acid in cyanobacteria appears to represent a significant departure from plant systems in which stearoyl-ACP is the exclusive substrate for desaturation. In Anabaena variabilis, the substrate appears to be monoglucosyldiacylglycerol, a lipid not found in plants. The authors examined five different cyanobacteria to determine if the pathway in A. variabilis was generally present in other cyanobacteria. The cyanobacteria studied were A. variabilis, Chlorogloeopsis sp., Schizothrix calcicola, Anacystis marina, and Anacystis nidulans. Each were grown in liquid culture, harvested, and examined for stearoyl-ACP desaturase activity or incubated with 14 CO 2 . None of the cyanobacteria contained any stearoyl-ACP desaturase activity in whole homogenates or 105,000g supernatants. All were capable of incorporating 14 CO 2 into monoglucosyldiacylglycerol and results from incubations of 20 min, 1 hr, 1 hr + 10 hr chase were consistent with monoglucosyldiacylglycerol serving as precursor for monogalctosyldiacylglycerol. Thus, initial evidence is consistent with oleic acid biosynthesis occurring by desaturation of stearoyl-monoglucosyldiacylglycerol in all cyanobacteria
Choi, Young-Joon; Danielsen, Solveig; Lübeck, Mette; Hong, Seung-Beom; Delhey, Rolf; Shin, Hyeon-Dong
2010-05-01
Downy mildew is an economically important and widespread disease in quinoa (Chenopodium quinoa) growing areas. Although in many studies Peronospora farinosa is most commonly regarded as the causal agent of the disease, identification and classification of the pathogen remain still uncertain due to its taxonomic confusion. Thirty-six Peronospora isolates from quinoa with different geographic origins including Argentina, Bolivia, Denmark, Ecuador, and Peru were morphologically and molecularly compared with Peronospora species from other Chenopodium species. The morphology of three herbarium specimens was similar to that of P. variabilis, which originated from C. album, characterized by flexuous to curved ultimate branchlets and pedicellated conidia. Phylogenetic analysis based on ITS rDNA sequences also placed the quinoa pathogen within the same clade as P. variabilis. Within the ITS rDNA sequences of the quinoa pathogens, two base substitutions were found, which separated the majority of the Danish isolates from isolates from South America, but no sequence difference was found among the isolates from different cultivars of quinoa. The present results indicate that the pathogen responsible for the quinoa downy mildew is identical to Peronospora variabilis and that it should not be lumped with P. farinosa as claimed previously by most studies.
At Park Rynie Beach (31°19´S, 30°44´E), KwaZulu- Natal, South ...
African Journals Online (AJOL)
and invasion of zoanthid colonies by a tube-dwelling polychaete were observed in some areas of the inter- tidal zone. Dense clusters of the tubes were visible protruding from among the ... chaetes were conducted during spring low tide to quantify the degree of .... BECKLEY 1994 — Two Oceans. A Guide to the Marine.
Browse Title Index - African Journals Online
African Journals Online (AJOL)
Items 601 - 650 of 1038 ... Vol 24 (2002), Note on an invasion of intertidal zoanthid colonies by a chaetopterid polychaete at Park Rynie Beach, KwaZulu-Natal, South Africa, Abstract PDF. R Biseswas, GK Moodley, AD Naidoo. Vol 38, No 4 (2016), Nutrient limitation in two marine diatoms inhibits release of bromoform, Abstract.
Midgley, David J; Sutcliffe, Brodie; Greenfield, Paul; Tran-Dinh, Nai
2018-05-01
This study describes a novel ericoid mycorrhizal fungus (ErMF), Gamarada debralockiae Midgley and Tran-Dinh gen. nov. sp. nov. Additionally, catabolism was explored from a genomic perspective. The nuclear and mitochondrial genomes of G. debralockiae were sequenced. Morphological characteristics were assessed on various media. Catabolic genes of G. debralockiae were explored using SignalP and dbCAN. Phylogenetic comparisons were undertaken using Phylogeny.fr. The 58.5-Mbp draft genome of G. debralockiae contained 17,075 putative genes. The complete mitochondrial genome was 28,168 bp in length. In culture, G. debralockiae produces slow-growing non-sporulating colonies. Gamarada debralockiae has many putative secreted catabolic enzymes. Phylogeny indicated G. debralockiae was distinct from known ascomycetous ErMF: Pezoloma ericae, Meliniomyces spp., Oidiodendron spp., and Cairneyella variabilis. It is closely related to many undescribed plant root-associated fungi and its nearest described relative is Hyphodiscus brevicollaris. Gamarada debralockiae has been recovered from virtually all Australian ericoid mycorrhizal studies and biogeographic data suggests the taxon is widespread in Australia. Gamarada debralockiae has similar catabolic potential to C. variabilis and co-occurs with C. variabilis at Australian sites. Plants that host multiple ErMF may benefit from subtle differences in catabolism that improve access to nitrogen and phosphorus from within recalcitrant organic matter.
Gates, R. D.; Muscatine, L.
1992-09-01
Three maceration methods are described for the isolation of single endoderm cells from marine cnidarians. Two are enzymatic treatments suitable for fleshy anthozoans such as sea anemones and zoanthids. The third employs calcium free sea water and is suitable for stony corals. The viability and morphology of the endoderm cells is described using fluorogenic dyes and scanning and transmission electron microscopy.
Lifescience Database Archive (English)
Full Text Available nherited disorder characterized by multiorgan dysfunction. AS shares several features with the common metabolic syndrome, namely obes...ity, hyperinsulinemia, and hypertriglyceridemia. A wide range of clinical variabili
Two new species of Neozoanthus (Cnidaria, Hexacorallia, Zoantharia from the Pacific
Directory of Open Access Journals (Sweden)
James Reimer
2012-11-01
Full Text Available The zoanthid genus Neozoanthus was originally described in 1972 from a single species in Madagascar. This monotypic genus was placed within its own family, Neozoanthidae, given its unusual characters of only partial sand encrustation, and an endodermal sphincter muscle combined with a brachycnemic mesenterial arrangement. Recently, undescribed specimens of Neozoanthus were discovered thousands of kilometers away in both Australia and Japan. While the phylogenetic and evolutionary aspects of Neozoanthus spp. are now somewhat well understood, the new specimens remained undescribed. Here we describe the specimens as two new species, N. uchina sp. n. from the Middle Ryukyu Islands of southern Japan, and N. caleyi sp. n. from the waters around Heron Island, on the Great Barrier Reef in Australia. Both species can be distinguished from each other and the type species, N. tulearensis, by their distributions, oral disk colors, and average numbers of tentacles. Additionally, each species appears to have subtle differences in their cnidae. The division of Japanese and Australian specimens into two species is strongly supported by recently reported phylogenetic data. The discovery and description of these two species highlights how little is known of zoanthid species diversity in the Indo-Pacific.
Hart, Kristen M.; Sartain-Iverson, Autumn R.; Hillis-Starr, Zandy; Phillips, Brendalee; Mayor, Philippe A.; Roberson, Kimberly; Pemberton, Roy A.; Allen, Jason B.; Lundgren, Ian; Musick, Susanna
2013-01-01
Surveys of juvenile hawksbills around Buck Island Reef National Monument, US Virgin Islands from 1994 to 1999 revealed distributional patterns and resulted in a total of 75 individual hawksbill captures from all years; turtles ranged from 23.2 to 77.7 cm curved carapace length (CCL; mean 42.1 ± 12.3 cm SD). Juveniles concentrated where Zoanthid cover was highest. Length of time between recaptures, or presumed minimum site residency, ranged from 59 to 1,396 days (mean 620.8 ± 402.4 days SD). Growth rates for 23 juveniles ranged from 0.0 to 9.5 cm year−1 (mean 4.1 ± 2.4 cm year−1SD). Annual mean growth rates were non-monotonic, with the largest mean growth rate occurring in the 30–39 cm CCL size class. Gastric lavages indicated that Zoanthids were the primary food source for hawksbills. These results contribute to our understanding of juvenile hawksbill ecology and serve as a baseline for future studies or inventories of hawksbills in the Caribbean.
Two new species of Neozoanthus (Cnidaria, Hexacorallia, Zoantharia) from the Pacific
Reimer, James Davis; Irei, Yuka; Fujii, Takuma
2012-01-01
Abstract The zoanthid genus Neozoanthus was originally described in 1972 from a single species in Madagascar. This monotypic genus was placed within its own family, Neozoanthidae, given its unusual characters of only partial sand encrustation, and an endodermal sphincter muscle combined with a brachycnemic mesenterial arrangement. Recently, undescribed specimens of Neozoanthus were discovered thousands of kilometers away in both Australia and Japan. While the phylogenetic and evolutionary aspects of Neozoanthus spp. are now somewhat well understood, the new specimens remained undescribed. Here we describe the specimens as two new species, Neozoanthus uchina sp. n. from the Middle Ryukyu Islands of southern Japan, and Neozoanthus caleyi sp. n. from the waters around Heron Island, on the Great Barrier Reef in Australia. Both species can be distinguished from each other and the type species, Neozoanthus tulearensis, by their distributions, oral disk colors, and average numbers of tentacles. Additionally, each species appears to have subtle differences in their cnidae. The division of Japanese and Australian specimens into two species is strongly supported by recently reported phylogenetic data. The discovery and description of these two species highlights how little is known of zoanthid species diversity in the Indo-Pacific. PMID:23275752
Carballeira, N M; Emiliano, A; Sostre, A; Restituyo, J A; González, I M; Colón, G M; Tosteson, C G; Tosteson, T R
1998-06-01
The fatty acid composition of a Pseudomonas sp. (Alteromonas) and its host, the dinoflagellate Ostreopsis lenticularis, vectors in ciguatera fish poisoning, has been studied. The major fatty acids in O. lenticularis were 16:0, 20:5n-3, and 22:6n-3, but 18:2n-6, 18:3n-3, and 18:n-3 were also identified. In contrast to other dinoflagellates, 1 8:5n-3 was not detected in O. lenticularis. Even-chain fatty acids such as 9-16:1, 11-18:1, and 13-20:1 predominated in the Pseudomonas sp. from O. lenticularis, but 1 6-20% of (E)-11-methyl-12-octadecenoic acid was also identified. The chirality of the latter was confirmed by total synthesis (28% overall yield) starting from oxacyclotridecan-2-one. The fatty acid compositions of two other Pseudomonas species, from the palytoxin-producing zoanthids Palythoa mamillosa and P. caribdea, were also studied and were similar to that of the Pseudomonas sp. from O. lenticularis. The possibility of using some of these fatty acids as chemotaxonomic lipids in identifying marine animals that consume toxic dinoflagellates or zoanthids is discussed.
Effect of Cyanobacteria Isolates on Rice Seeds Germination in Saline Soil
Directory of Open Access Journals (Sweden)
Mostafa M. El -Sheekh
2018-03-01
Full Text Available Cyanobacteria are prokaryotic photosynthetic communities which are used in biofertilization of many plants especially rice plant. Cyanobacteria play a vital role to increase the plant's ability for salinity tolerance. Salinity is a worldwide problem which affects the growth and productivity of crops. In this work three cyanobacteria strains (Nostoc calcicola, Anabaena variabilis, and Nostoc linkia were isolated from saline soil at Kafr El-Sheikh Governorate; North Egypt. The propagated cyanobacteria strains were used to withstand salinity of the soil and increase rice plant growth (Giza 178. The length of roots and shoot seedlings was measured for seven and forty days of cultivation, respectively. The results of this investigation showed that the inoculation with Nostoc calcicola, Anabaena variabilis, and Nostoc linkia increased root length by 27.0, 4.0, 3.0 % and 39, 20, 19 % in EC5 and 10 (ds/m, respectively. Similarly, they increased shoot length by 121, 70, 55 %, 116, 88, 82 % in EC5 and 10 (ds/m, respectively. In EC15and more concentrations, control rice plants could not grow while those to which cyanobacteria were inoculated could withstand only EC15 but not other elevated concentrations. These results encourage using Nostoc calcicola,Anabaena variabilis, and Nostoc linkia as biofertilizer for rice plant in the saline soil for increasing growth and decrease soil electrical conductivity.
Nuijten, M.B.; Deserno, Marie K.; Cramer, A.O.J.; Costantini, Giulio; Borsboom, Denny
2016-01-01
I disturbi mentali sono stati tradizionalmente concepiti come variabili latenti, che hanno un impatto sulla sintomatologia osservabile. Approcci alternativi proposti più recentemente invece concepiscono i disturbi mentali come sistemi di sintomi che si rinforzano vicendevolmente. Tali approcci
Nezha, a novel active miniature inverted-repeat transposable element in cyanobacteria
International Nuclear Information System (INIS)
Zhou Fengfeng; Tran Thao; Xu Ying
2008-01-01
Miniature inverted-repeat transposable elements (MITEs) were first identified in plants and exerted extensive proliferations throughout eukaryotic and archaeal genomes. But very few MITEs have been characterized in bacteria. We identified a novel MITE, called Nezha, in cyanobacteria Anabaena variabilis ATCC 29413 and Nostoc sp. PCC 7120. Nezha, like most previously known MITEs in other organisms, is small in size, non-coding, carrying TIR and DR signals, and of potential to form a stable RNA secondary structure, and it tends to insert into A+T-rich regions. Recent transpositions of Nezha were observed in A. variabilis ATCC 29413 and Nostoc sp. PCC 7120, respectively. Nezha might have proliferated recently with aid from the transposase encoded by ISNpu3-like elements. A possible horizontal transfer event of Nezha from cyanobacteria to Polaromonas JS666 is also observed
Italian energy scenarios comparative evaluations; Scenari energetici italiani a confronto
Energy Technology Data Exchange (ETDEWEB)
Contaldi, Mario [Agenzia per la Protezione dell' Ambiente e per i Servizi Tecnici-APAT, Roma (Italy)
2005-09-15
This paper reviews some representative scenarios of the evolution of the Italian primary energy consumption, updated recently. After an overview of the main macroeconomics assumptions the scenario results are cross checked at sectorial level, with a brief discussion of the underlining data and energy intensity trends. The emissions of CO{sub 2}, SO{sub 2} and NO{sub x} resulting from the considered scenarios are also reported and discussed. [Italian] Questo articolo riporta alcuni dei piu rappresentativi ed aggiornati scenari di evoluzione dei consumi energetici primari italiani. Dopo un esame delle principali variabili macroeconomiche i risultati degli scenari sono esaminati a livello di settore, con una breve discussione delle principali variabili utilizzate. Infine sono state anche esaminate le emissioni di CO{sub 2}, SO{sub 2} e NO{sub x} risultanti dai diversi scenari e le possibili conseguenze sul piano normativo.
GenBank blastx search result: AK103983 [KOME
Lifescience Database Archive (English)
Full Text Available AK103983 001-017-F09 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (
GenBank blastx search result: AK058791 [KOME
Lifescience Database Archive (English)
Full Text Available AK058791 001-002-F06 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (
GenBank blastx search result: AK060074 [KOME
Lifescience Database Archive (English)
Full Text Available AK060074 006-306-B05 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (
GenBank blastx search result: AK059171 [KOME
Lifescience Database Archive (English)
Full Text Available AK059171 001-023-F01 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (
GenBank blastx search result: AK062234 [KOME
Lifescience Database Archive (English)
Full Text Available AK062234 001-047-D11 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (
Collodion baby: A report of 4 cases
African Journals Online (AJOL)
owner
2012-12-28
Dec 28, 2012 ... Netherton, Kid and Bid as well as erythrokeratoderma variabilis of Mendes da Costa ... the third consecutive child of the mother with similar presentation at birth. ... Blood culture results are negative. By the 10th day there was ...
Directory of Open Access Journals (Sweden)
M. Bello
2003-10-01
Full Text Available In un'area di studio nell'Appennino abruzzese (ampia circa 250 km² sono state campionate variabili ambientali relative alla vegetazione, topografia, e presenza antropica in 2110 plot distribuiti lungo transetti da 1 km in 72 celle (1 km² selezionate casualmente dal reticolato geografico UTM. Utilizzando tematismi digitali sono state calcolate, tramite GIS, altre variabili ambientali relative alle stesse categorie. Le variabili sono state combinate in 14 indici (V1-14 utilizzati per calcolare un indice di idoneità ambientale relativo ai plot e alle celle campionate. Sono stati elaborati: A- un indice complessivo di idoneità (HSItotale e, B- 2 indici di idoneità relativi alla disponibilità di risorse trofiche e alla presenza umana (HSIcibo e HSIuomo, rispettivamente. Il valore medio di HSIcibo è stato pari a 0,23, in relazione ai valori medi degli indici di idoneità per la disponibilità di invertebrati (0,01, ghiande (0,004 e alla copertura percentuale di arbusti (0,06. Il valore medio di HSIuomo è risultato maggiore (0,32, soprattutto in relazione all'indice relativo alle variabili pendenza (0,69 e distanza dagli insediamenti umani (0,60. L'indice complessivo medio HSItotale è stato pari a 0,27. Il modello è stato validato comparando, per ogni cella, il valore dei tre indici con l'abbondanza relativa dell'orso bruno stimata lungo percorsi campione dal 1993 al 1998. Gli indici HSItotale e HSIuomo sono risultati significativamente e direttamente correlati con l'abbondanza relativa dell'orso (0,40 >rs< 0,44; p< 0,001; n= 72, mentre la frequentazione dell'orso non è risultata correlata significativamente all'indice HSIcibo (rs= 0,06; p> 0,5; n= 72. Questi dati preliminari, che saranno integrati dai risultati di ulteriori campionamenti in corso, indicano chiaramente che l
Amblyomma cajennense is an intrastadial biological vector of Theileria equi.
Scoles, Glen A; Ueti, Massaro W
2013-10-23
The apicomplexan hemoprotozoan parasite Theileria equi is one of the etiologic agents causing equine piroplasmosis, a disease of equines that is endemic throughout large parts of the world. Before 2009 the United States had been considered to be free of this parasite. Occasional cases had occurred but there was no evidence for endemic vector-borne transmission in the U.S. until a 2009 outbreak in Texas in which Dermacentor variabilis and Amblyomma cajennense were implicated as vectors. Although D. variabilis has previously been shown to be a competent laboratory vector, studies suggested A. cajennense was not a competent transstadial vector, even though the presence of this tick species on horses in South American is epidemiologicaly correlated with higher a prevalence of infection. In this study we tested the transstadial and intrastadial vector competence of D. variabilis and A. cajennense for T. equi. A tick passaged T. equi strain from the Texas outbreak and ticks colonized from engorged females collected off horses on the outbreak ranch in Texas were used for these studies. Nymph or adult ticks were fed on infected horses and transmission fed on naïve horses. Infections were tracked with PCR and serology, dissected tick tissues were tested with PCR. A. cajennense transmitted T. equi intrastadially when adult ticks acquired infection by feeding on an infected horse, and transmitted to a naïve host on subsequent reattachment and feeding. D. variabilis failed to transmit in the same experiment. Transstadial transmission was not successful for either tick species. PCR on DNA isolated from eggs of females that had fed on an infected horse suggests that there is no transovarial passage of this parasite by either tick species. This work confirms that ticks from the Texas population of A. cajennense are competent intrastadial vectors of T. equi. We propose that the most likely natural mode of transmission for this parasite/vector combination in the Texas outbreak
Characteristics and dyes biodegradation potential of crude lignolytic ...
African Journals Online (AJOL)
Lignocellulosic enzymes from Crepidotus variabilis collected from mangrove forests of coastal Tanzania were investigated by using standard methods, and their ability to degrade aromatic compounds were elucidated. The fungal crude enzyme filtrates had maximum laccase (Lac), lignin peroxidase (LiP) and manganese ...
The effect of leaf litter cover on surface runoff and soil erosion in Northern China.
Li, Xiang; Niu, Jianzhi; Xie, Baoyuan
2014-01-01
The role of leaf litter in hydrological processes and soil erosion of forest ecosystems is poorly understood. A field experiment was conducted under simulated rainfall in runoff plots with a slope of 10%. Two common types of litter in North China (from Quercus variabilis, representing broadleaf litter, and Pinus tabulaeformis, representing needle leaf litter), four amounts of litter, and five rainfall intensities were tested. Results revealed that the litter reduced runoff and delayed the beginning of runoff, but significantly reduced soil loss (prunoff yield was 29.5% and 31.3% less than bare-soil plot, and for Q. variabilis and P. tabulaeformis, respectively, and average sediment yield was 85.1% and 79.9% lower. Rainfall intensity significantly affected runoff (R = 0.99, prunoff reduction by litter decreased considerably. Runoff yield and the runoff coefficient increased dramatically by 72.9 and 5.4 times, respectively. The period of time before runoff appeared decreased approximately 96.7% when rainfall intensity increased from 5.7 to 75.6 mm h-1. Broadleaf and needle leaf litter showed similarly relevant effects on runoff and soil erosion control, since no significant differences (p≤0.05) were observed in runoff and sediment variables between two litter-covered plots. In contrast, litter mass was probably not a main factor in determining runoff and sediment because a significant correlation was found only with sediment in Q. variabilis litter plot. Finally, runoff yield was significantly correlated (prunoff and erosion processes was crucial, and both rainfall intensity and litter characteristics had an impact on these processes.
The Effect of Leaf Litter Cover on Surface Runoff and Soil Erosion in Northern China
Li, Xiang; Niu, Jianzhi; Xie, Baoyuan
2014-01-01
The role of leaf litter in hydrological processes and soil erosion of forest ecosystems is poorly understood. A field experiment was conducted under simulated rainfall in runoff plots with a slope of 10%. Two common types of litter in North China (from Quercus variabilis, representing broadleaf litter, and Pinus tabulaeformis, representing needle leaf litter), four amounts of litter, and five rainfall intensities were tested. Results revealed that the litter reduced runoff and delayed the beginning of runoff, but significantly reduced soil loss (prunoff yield was 29.5% and 31.3% less than bare-soil plot, and for Q. variabilis and P. tabulaeformis, respectively, and average sediment yield was 85.1% and 79.9% lower. Rainfall intensity significantly affected runoff (R = 0.99, prunoff reduction by litter decreased considerably. Runoff yield and the runoff coefficient increased dramatically by 72.9 and 5.4 times, respectively. The period of time before runoff appeared decreased approximately 96.7% when rainfall intensity increased from 5.7 to 75.6 mm h−1. Broadleaf and needle leaf litter showed similarly relevant effects on runoff and soil erosion control, since no significant differences (p≤0.05) were observed in runoff and sediment variables between two litter-covered plots. In contrast, litter mass was probably not a main factor in determining runoff and sediment because a significant correlation was found only with sediment in Q. variabilis litter plot. Finally, runoff yield was significantly correlated (prunoff and erosion processes was crucial, and both rainfall intensity and litter characteristics had an impact on these processes. PMID:25232858
Endocrine-disrupting chemicals and public health protection
DEFF Research Database (Denmark)
Zoeller, R Thomas; Brown, T R; Doan, L L
2012-01-01
An endocrine-disrupting chemical (EDC) is an exogenous chemical, or mixture of chemicals, that can interfere with any aspect of hormone action. The potential for deleterious effects of EDC must be considered relative to the regulation of hormone synthesis, secretion, and actions and the variabili...
Effects of enhances ultra violet irradiation on photosynthesis in ...
African Journals Online (AJOL)
Effects of enhances ultra violet irradiation on photosynthesis in anabaena variabilis and phormidium uncinatum. VA Donkor. Abstract. No Abstract. Journal of the Ghana Association Vol. 2 (3) 1999: pp.16-23. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.
2010-04-01
... dogs and cats. Treatment and control of sarcoptic mange (Sarcoptes scabiei) and control of tick (Dermacentor variabilis) infestations in dogs. Treatment and control of intestinal hookworm (Ancylostoma tubaeforme) and roundworm (Toxocara cati) infections in cats. For dogs 6 weeks of age and older, and cats 8...
Sub-cellular damage by copper in the cnidarian Zoanthus robustus.
Grant, A; Trompf, K; Seung, D; Nivison-Smith, L; Bowcock, H; Kresse, H; Holmes, S; Radford, J; Morrow, P
2010-09-01
Sessile organisms may experience chronic exposure to copper that is released into the marine environment from antifoulants and stormwater runoff. We have identified the site of damage caused by copper to the symbiotic cnidarian, Zoanthus robustus (Anthozoa, Hexacorallia). External changes to the zoanthids were apparent when compared with controls. The normally flexible bodies contracted and became rigid. Histological examination of the zoanthid tissue revealed that copper had caused sub-cellular changes to proteins within the extracellular matrix (ECM) of the tubular body. Collagen in the ECM and the internal septa increased in thickness to five and seven times that of controls respectively. The epithelium, which stained for elastin, was also twice as thick and tough to cut, but exposure to copper did not change the total amount of desmosine which is found only in elastin. We conclude that copper stimulated collagen synthesis in the ECM and also caused cross-linking of existing proteins. However, there was no expulsion of the symbiotic algae (Symbiodinium sp.) and no effect on algal pigments or respiration (44, 66 and 110 microg Cu L(-1)). A decrease in net photosynthesis was observed only at the highest copper concentration (156 microg Cu L(-1)). These results show that cnidarians may be more susceptible to damage by copper than their symbiotic algae. Copyright (c) 2010 Elsevier Inc. All rights reserved.
Epizoanthus spp. associations revealed using DNA markers: a case study from Kochi, Japan.
Reimer, James Davis; Hirose, Mamiko; Nishisaka, Taiki; Sinniger, Frederic; Itani, Gyo
2010-09-01
Zoanthids (Cnidaria, Hexacorallia) of the genus Epizoanthus are often found in association with other marine invertebrates, including gastropods and hermit crabs. However, little information exists on the specificity and nature of these associations due to a lack of investigation into Epizoanthus species diversity, and the taxonomy of Epizoanthus is therefore confused. In this study, analyses of morphological data (tentacle number, polyp size, etc) and molecular data (mitochondrial cytochrome oxidase subunit 1 = COI, 16S ribosomal DNA = 16S rDNA) were used to examine Epizoanthus specimens from Tosa Bay, Kochi, Japan. The Epizoanthus specimens were found on both live gastropods (Gemmula unedo) and hermit crabs (Paguristes palythophilus) inhabiting G. unedo and G. cosmoi shells. While morphological analyses did not show clear differences between examined specimens, both COI and mt 16S rDNA clearly divided the specimens into two groups, one associated only with hermit crabs (= Epizoanthus sp. C), and another associated only with living gastropods (= Epizoanthus sp. S). Unexpectedly, DNA sequences from both groups did not match with two previously reported Epizoanthus species from Japan (E. indicus, E. ramosus), indicating they both may be undescribed species. These results highlight the utility of DNA "barcoding" of unknown zoanthids, and will provide a foundation for re-examinations of Epizoanthus species diversity and specificity, which will be critical in understanding the evolution of these unique marine invertebrates.
Antibiotic activity of two Anabaena species against four fish ...
African Journals Online (AJOL)
STORAGESEVER
2008-08-04
Aug 4, 2008 ... New antibiotics with high activity and without side effects for human and for .... doses, and n = the total number of used mice. Statistical .... extract of Anabaena variabilis on mice. Dose (mg/kg) ... Tetranychidae). International Conference for Development and the .... Elsevier Scientific, New York. 26. JE Grady,.
Agroecological niches and thrips (Thysanoptera: Thripidae) dynamics
Michael E. Irwin
1991-01-01
In 1975, Illinois experienced an exceptionally mild winter, followed by a warm spring. This sequence of climatic events resulted in a massive outbreak of the soybean thrips, Sericothrips variabilis (Beach), along with large numbers of the flower thrips, Frankliniella tritici (Fitch). The outbreak covered an area of over 600...
Photobacterium jeanii sp. nov., isolated from corals and zoanthids.
Chimetto, Luciane A; Cleenwerck, Ilse; Thompson, Cristiane C; Brocchi, Marcelo; Willems, Anne; De Vos, Paul; Thompson, Fabiano L
2010-12-01
Four novel isolates (R-40508(T), R-40507, R-40903 and R-21419) were obtained from different cnidarian species (Phyllogorgia dilatata, Merulina ampliata and Palythoa caribaeorum) from different places in Brazil and Australia. The novel isolates formed a tight phylogenetic group based on 16S rRNA, recA, topA, ftsZ, mreB and rpoA gene sequences. Their closest phylogenetic neighbours were the type strains of Photobacterium leiognathi, P. rosenbergii and P. halotolerans, sharing 97.1-97.5 % 16S rRNA gene sequence similarity. DNA-DNA hybridization between a representative strain (R-40508(T)) and the type strains of these Photobacterium species revealed less than 20 % relatedness, showing that the new isolates belong to a novel species. Several phenotypic features allow the differentiation of the novel species from its closest phylogenetic neighbours. It has gelatinase and lipase activity and can utilize melibiose, but it cannot grow on 6 % NaCl. In addition, the novel species has the fatty acid iso-C(16 : 0), but lacks the fatty acids C(17 : 0), C(17 : 0) cyclo, iso-C(17 : 0), C(17 : 1)ω8c and iso-C(17 : 1)ω9c. The name Photobacterium jeanii sp. nov. is proposed for this species, with the type strain R-40508(T) (=LMG 25436(T) =CAIM 1817(T)). The G+C content of the type strain is 45.5mol%.
Modello predittivo di idoneità ambientale per il cervo nell'Appennino centrale
Directory of Open Access Journals (Sweden)
G. Opramolla
2003-10-01
Full Text Available In un?area di studio ampia ca. 250 km², situata tra il Parco Nazionale d?Abruzzo e quello della Majella, è stata studiata la densità del cervo in 84 unità di campionamento (ampiezza = 1 km² selezionate in maniera sistematica partendo dal reticolato geografico UTM. In ogni unità di campionamento sono stati individuati tre transetti paralleli orientati da Est a Ovest (lunghezza= 1 km/transetto e 33 plot circolari, ogni 100 m lungo i transetti. La presenza del cervo è stata rilevata tramite segni di presenza e avvistamenti. Sono stati effettuati tre campionamenti: giugno ? agosto 1999, settembre-ottobre 1999 e maggio - luglio 2000. Il cervo è risultato essere presente in 39 unità di campionamento e assente in 35. Sono state calcolate dalla cartografia numerica tramite GIS 69 variabili ambientali. La relazione tra variabili ambientali e presenza/assenza del cervo è stata analizzata con l?analisi della varianza univariata (anova e con l?analisi di regressione logistica dicotomica (rld. Sono state riscontrate differenze significative (anova tra le aree in cui è stata riscontrata la presenza del cervo ed aree in cui il cervo è risultato assente per le variabili relative alle attività antropiche, superficie delle radure, quota, esposizione, estensione delle colture, estensione e struttura del bosco e presenza di pecore al pascolo. Il modello di regressione logistica ha selezionato solo 3 variabili: superficie del bosco di latifoglie, indice medio della forma dei poligoni di bosco, superficie delle aree esposte a sud-ovest. Il modello spiega il 76% della varianza della variabile indipendente, e tutti i coefficienti di regressione sono correlati significativemente e positivamente alla probabilità di presenza del cervo. Il modello ha classificato correttamente il 91% dei casi in cui il cervo è risultato assente e il 92% dei casi in cui è risultato presente (percentuale media di classificazione= 91,9%. L?importanza del bosco nel condizionare
Studies of the reproductive biology of deep-sea megabenthos
International Nuclear Information System (INIS)
Tyler, P.A.
1987-07-01
The final report describes the general biology and ecology of the 15 holothurians, 3 asteroids, 2 zoanthids and 1 crustacea species studied in Reports I-XIII, the sampling methods used and the station data. A summary of the histological, histochemical and biochemical results for the species examined is given. The data suggest that the reproductive processes in the deep-sea species examined are highly unlikely to be part of a pathway for the transfer of radionuclides from the deep-sea back to man. (author)
Palytoxin: a new marine toxin from a coelenterate.
Moore, R E; Scheuer, P J
1971-04-30
Palytoxin has been isolated from the zoanthids "limu-make-o-Hana" (Tentatively identified as Palythoa sp.) as a noncrystalline, chromatographically pure entity. Apart from polypeptide and protein toxins, it is the most highly toxic substance known, with a lethal dose (LD(59)) in mice of 0.15 microgram per kilogram by intravenous injection. Unlike the potent toxins batrachotoxin, saxitoxin, and tetrodotoxin which have molecular weights of 500 or less, palytoxin has an estimated molecular weight of 3300 and contains no repetitive amino acid or sugar units.
Czech Academy of Sciences Publication Activity Database
Rudenko, Natalia; Golovchenko, Maryna; Clark, K.; Oliver, J.; Grubhoffer, Libor
2016-01-01
Roč. 5, MAY 25 (2016), č. článku e48. ISSN 2222-1751 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : lyme disease spirochete * Dermacentor variabilis * Ixodes scapularis * Ixodidae * Acari * strain Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 5.605, year: 2016
Medical Surveillance Monthly Report. Volume 19, Number 5
2012-05-01
Intervertebral disc disorders DDD-related ICD-9-CM codes 723.0 Spinal stenosis , cervical 724.00, 724.01, 724.02, 724.09 Spinal stenosis ,other 723.1...4,6,7 Tick vectors of Rocky Mountain Spotted Fever (RMSF) and other diseases Dermacentor variabilis, the American dog tick or wood tick, is found in
Coastal nutrification and coral health at Porto Seguro reefs, Brazil
Costa, O.; Attrill, M.; Nimmo, M.
2003-04-01
Human activities have substantially increased the natural flux of nutrients to coastal systems worldwide. In Brazilian reefs, all major stresses (sedimentation, overfishing, tourism-related activities and nutrification) are human induced. To assess nutrification levels in Brazilian coastal reefs, measurements of the distribution patterns of nutrients and chlorophyll concentrations were conducted in three nearshore and offshore reefs with distinct nutrient inputs along the south coast of Bahia State. Seawater and porewater samples were analysed for soluble reactive phosphorus, total oxidised nitrogen and reactive silica. Benthic surveys were performed at all sites to investigate the relationships between benthic community composition and nutrient and chlorophyll concentrations. Sampling was undertaken in dry and rainy seasons. Results of both seawater and porewater nutrient measurements revealed the occurrence of consistent spatial and temporal patterns. An inshore-offshore gradient reflects the occurrence of land-based point sources, with significant amount of nutrients being delivered by human activities on the coast (untreated sewage and groundwater seepage). Another spatial gradient is related to distance from a localized source of pollution (an urban settlement without sewerage treatment) with two nearshore reefs presenting distinct nutrient and chlorophyll concentrations. Seasonal variations suggest that submarine groundwater discharge (SGD) is the primary source of nutrients for the coastal reefs during rainy season. The data also suggests that the SGD effect is not restricted to nearshore reefs, and may be an important factor controlling the differences between landward and seaward sides on the offshore reef. Benthic community assessment revealed that turf alga is the dominant group in all studied reefs and that zoanthids are the organisms most adapted to take advantage of nutrient increase in coastal areas. At nearshore reefs, there was a negative
Santos, Gleice S.; Burgos, Douglas C.; Lira, Simone M. A.; Schwamborn, Ralf
2015-10-01
Tropical reefs are used for intensive tourism in various parts of the world. However, few studies have investigated the effect of regular trampling on these fragile ecosystems. The aim of this study was to assess the effect of different conservation strategies (open access, partial protection, and total long-term closure) on intertidal reef tops in Porto de Galinhas and Tamandaré, Pernambuco State, Brazil. Analysis of the macrobenthic community was performed with photo transects and image analysis (CPCe). Twenty-seven transects were surveyed from January to August 2012, in intensively impacted (I) open-access sites, in partially protected (P) sites with occasional, illegal trampling, and in a permanently closed (C) site. In I sites, total live cover was half the cover found in adjacent P sites. The area of bare rock averaged 53.6 and 25.0 % in I and P sites, respectively. In the C site, the area of bare rock was only 19.8 %. In I and P sites, macroalgae ( Palisada perforata) were dominating, while in the C site, the zoanthid Zoanthus sociatus was most abundant. Shell-bearing vermetids ( Petaloconchus varians) and bivalves ( Isognomon bicolor) were more abundant at the C site, being possible bioindicators for areas with zero or little trampling. Twelve years of total closure produced near-pristine communities in the C site, dominated by zoanthids and fragile mollusks. This study showed that trampling has severe and long-lasting consequences for the structure of these ecosystems.
The effect of leaf litter cover on surface runoff and soil erosion in Northern China.
Directory of Open Access Journals (Sweden)
Xiang Li
Full Text Available The role of leaf litter in hydrological processes and soil erosion of forest ecosystems is poorly understood. A field experiment was conducted under simulated rainfall in runoff plots with a slope of 10%. Two common types of litter in North China (from Quercus variabilis, representing broadleaf litter, and Pinus tabulaeformis, representing needle leaf litter, four amounts of litter, and five rainfall intensities were tested. Results revealed that the litter reduced runoff and delayed the beginning of runoff, but significantly reduced soil loss (p<0.05. Average runoff yield was 29.5% and 31.3% less than bare-soil plot, and for Q. variabilis and P. tabulaeformis, respectively, and average sediment yield was 85.1% and 79.9% lower. Rainfall intensity significantly affected runoff (R = 0.99, p<0.05, and the efficiency in runoff reduction by litter decreased considerably. Runoff yield and the runoff coefficient increased dramatically by 72.9 and 5.4 times, respectively. The period of time before runoff appeared decreased approximately 96.7% when rainfall intensity increased from 5.7 to 75.6 mm h-1. Broadleaf and needle leaf litter showed similarly relevant effects on runoff and soil erosion control, since no significant differences (p≤0.05 were observed in runoff and sediment variables between two litter-covered plots. In contrast, litter mass was probably not a main factor in determining runoff and sediment because a significant correlation was found only with sediment in Q. variabilis litter plot. Finally, runoff yield was significantly correlated (p<0.05 with sediment yield. These results suggest that the protective role of leaf litter in runoff and erosion processes was crucial, and both rainfall intensity and litter characteristics had an impact on these processes.
Trout Fryxell, Rebecca T; Hendricks, Brain M; Pompo, Kimberly; Mays, Sarah E; Paulsen, Dave J; Operario, Darwin J; Houston, Allan E
2017-08-01
Ehrlichiosis and rickettsiosis are two common bacterial tick-borne diseases in the southeastern United States. Ehrlichiosis is caused by ehrlichiae transmitted by Amblyomma americanum and rickettsiosis is caused by rickettsiae transmitted by Amblyomma maculatum and Dermacentor variabilis. These ticks are common and have overlapping distributions in the region. The objective of this study was to identify Anaplasma, Ehrlichia, and Rickettsia species associated with questing ticks in a Rocky Mountain spotted fever (RMSF) hotspot, and identify habitats, time periods, and collection methods for collecting questing-infected ticks. Using vegetation drags and CO 2 -baited traps, ticks were collected six times (May-September 2012) from 100 sites (upland deciduous, bottomland deciduous, grassland, and coniferous habitats) in western Tennessee. Adult collections were screened for Anaplasma and Ehrlichia (simultaneous polymerase chain reaction [PCR]) and Rickettsia using genus-specific PCRs, and resulting positive amplicons were sequenced. Anaplasma and Ehrlichia were only identified within A. americanum (Ehrlichia ewingii, Ehrlichia chaffeensis, Panola Mountain Ehrlichia, and Anaplasma odocoilei sp. nov.); more Ehrlichia-infected A. americanum were collected at the end of June regardless of habitat and collection method. Rickettsia was identified in three tick species; "Candidatus Rickettsia amblyommii" from A. americanum, R. parkeri and R. andeanae from A. maculatum, and R. montanensis ( = montana) from D. variabilis. Overall, significantly more Rickettsia-infected ticks were identified as A. americanum and A. maculatum compared to D. variabilis; more infected-ticks were collected from sites May-July and with dragging. In this study, we report in the Tennessee RMSF hotspot the following: (1) Anaplasma and Ehrlichia are only found in A. americanum, (2) each tick species has its own Rickettsia species, (3) a majority of questing-infected ticks are collected May-July, (4) A
Directory of Open Access Journals (Sweden)
Kasahara Masahiro
2010-09-01
Full Text Available Abstract Background We performed an environmental study of viruses infecting the symbiotic single-celled algae of Paramecium bursaria (Paramecium bursaria Chlorella virus, PBCV in Lake Biwa, the largest lake in Japan. The viruses detected were all Chlorella variabilis virus (CvV = NC64A virus. One of them, designated CvV-BW1, was subjected to further characterization. Results CvV-BW1 formed small plaques and had a linear DNA genome of 370 kb, as judged by pulsed-field gel electrophoresis. Restriction analysis indicated that CvV-BW1 DNA belongs to group H, one of the most resistant groups among CvV DNAs. Based on a phylogenetic tree constructed using the dnapol gene, CvV was classified into two clades, A and B. CvV-BW1 belonged to clade B, in contrast to all previously identified virus strains of group H that belonged to clade A. Conclusions We conclude that CvV-BW1 composes a distinct species within C. variabilis virus.
Structure of plastocyanin from the cyanobacterium Anabaena variabilis
DEFF Research Database (Denmark)
Schmidt, Lars; Christensen, Hans Erik Mølager; Harris, Pernille
2006-01-01
with cell dimensions a = 67.85 Å, b = 45.81 Å and c = 63.41 Å. The structure of the oxidised protein was solved to a resolution of 1.6 Å using plastocyanin from Phormidium laminosum as search model. Two molecules were found in the asymmetric unit. The electrostatic surface of the basic protein showed...... a large population of positively charged residues in the northern site, whereas the eastern site lacked the two strongly negatively charged patches. The copper ion was found to be relatively mobile and two distinct conformations of His61....
Sbrana, Francesco
1951-01-01
Calcolo integrale delle funzioni di una variabile ; serie di funzioni di una variabile reale o complessa ; proprietà notevoli delle curve piane e sghembe ; ancora sulla intregazione delle funzioni di una variabile ; derivate e differenziali delle funzioni di più variabili ; integrali curvilinei, e di campo ; equazioni differenziali ordinarie ; cenni sulle equazioni alle derivate parziali ; cenni sulle serie di funzioni ortogonali.
Patocka, Jiří; Gupta, Ramesh C; Wu, Qing-hua; Kuca, Kamil
2015-10-01
This review briefly describes the origin, chemistry, molecular mechanism of action, pharmacology, toxicology, and ecotoxicology of palytoxin and its analogues. Palytoxin and its analogues are produced by marine dinoflagellates. Palytoxin is also produced by Zoanthids (i.e. Palythoa), and Cyanobacteria (Trichodesmium). Palytoxin is a very large, non-proteinaceous molecule with a complex chemical structure having both lipophilic and hydrophilic moieties. Palytoxin is one of the most potent marine toxins with an LD50 of 150 ng/kg body weight in mice exposed intravenously. Pharmacological and electrophysiological studies have demonstrated that palytoxin acts as a hemolysin and alters the function of excitable cells through multiple mechanisms of action. Palytoxin selectively binds to Na(+)/K(+)-ATPase with a Kd of 20 pM and transforms the pump into a channel permeable to monovalent cations with a single-channel conductance of 10 pS. This mechanism of action could have multiple effects on cells. Evaluation of palytoxin toxicity using various animal models revealed that palytoxin is an extremely potent neurotoxin following an intravenous, intraperitoneal, intramuscular, subcutaneous or intratracheal route of exposure. Palytoxin also causes non-lethal, yet serious toxic effects following dermal or ocular exposure. Most incidents of palytoxin poisoning have manifested after oral intake of contaminated seafood. Poisonings in humans have also been noted after inhalation, cutaneous/systemic exposures with direct contact of aerosolized seawater during Ostreopsis blooms and/or through maintaining aquaria containing Cnidarian zoanthids. Palytoxin has a strong potential for toxicity in humans and animals, and currently this toxin is of great concern worldwide.
Los patelogastrópodos intermareales de Chile y Perú Intertidal limpets of Chile and Peru
Directory of Open Access Journals (Sweden)
CARMEN ESPOZ
2004-06-01
Full Text Available En este estudio se entrega un sistema de clasificación que refleja las relaciones de parentesco, inferidas a partir del análisis de la región 16S de ADN mitocondrial, de los patelogastrópodos que habitan en la zona intermareal a lo largo de la costa rocosa de Chile y Perú. Además, se incluye el análisis comparativo de estos patelogastrópodos en relación con la estructura, la morfología y los patrones de color de la concha, los dientes de la rádula y la anatomía corporal. Adicionalmente, se entrega información respecto de la distribución y ecología para todos los miembros de este grupo. Los resultados muestran que la fauna Lottiidae de Chile y Perú consiste en al menos nueve especies de patelogastrópodos intermareales. Esto es, ocho especies de patelogastrópodos agrupadas dentro del clado monofilético Scurria (S. variabilis, S. zebrina, S. viridula, S. plana, S. scurra, S. araucana, S. ceciliana y una especie no determinada y un "taxón problemático" asignado preliminarmente dentro del género Lottia (Lottia orbignyi. El grupo está presente entre los 5º S y 54º S, registrándose en los niveles intermareales superior, medio e inferior, desde zonas expuestas a protegidas del oleaje. A nivel intraespecífico, los resultados nos permiten proponer la sinonimia de S. parasitica con S. variabilis, y de S. ceciliana con S. boehmita. Según esto, S. variabilis presentaría al menos tres ecofenotipos: (1 en sustratos rocosos a lo largo de todo su rango geográfico, (2 sobre las conchas de Fissurella crassa y F. limbata principalmente en Chile centro-sur y (3 sobre las placas del chitón Enoplochiton niger en el norte de Chile y sur del Perú. Por su parte, S. ceciliana es una especie de patelogastrópodo que presenta un patrón morfológico y de coloración de la concha altamente variable. En general, la alta variabilidad del patrón de color y morfología de la concha sitúa a estos patelogastrópodos entre los más complejos y
Villar, Rosa M; Gil-Longo, José; Daranas, Antonio H; Souto, María L; Fernández, José J; Peixinho, Solange; Barral, Miguel A; Santafé, Gilmar; Rodríguez, Jaime; Jiménez, Carlos
2003-05-15
Ten zoanthamine-type alkaloids from two marine zoanthids belonging to the Zoanthus genus (Zoanthus nymphaeus and Zoanthus sp.) along with one semisynthetic derivative were evaluated for their antiplatelet activities on human platelet aggregation induced by several stimulating agents. 11-Hydroxyzoanthamine (11) and a synthetic derivative of norzoanthamine (16) showed strong inhibition against thrombin-, collagen- and arachidonic acid-induced aggregation, zoanthenol (15) displayed a selective inhibitory activity induced by collagen, while zoanthaminone (10) behaved as a potent aggregant agent. These evaluations allowed us to deduce several structure-activity relationships and suggest some mechanisms of action for this type of compounds.
Directory of Open Access Journals (Sweden)
Miguel A. Monné
2004-12-01
Full Text Available Novas sinonímias propostas: Strangalia flavocincta (Thomson, 1860 = Ophistomis tristis Melzer, 1922 syn. nov. = O. latifasciata Melzer, 1926 syn. nov.; Strangalia succincta (Redtenbacher, 1867 = O. auriflua Redtenbacher, 1867 syn. nov.; Strangalia melanura (Redtenbacher, 1867 = Euryptera dimidiata Redtenbacher, 1867 syn. nov.; Strangalia lyrata (Redtenbacher, 1867 = Ophistomis discophora Redtenbacher, 1867 syn. nov.; Strangalia fulvicornis (Bates, 1872 = Ophistomis variabilis Melzer, 1926 syn. nov. = O. flavovittata Melzer, 1926 syn. nov.; Strangalia melanophthisis (Berg, 1889 reval. = Euryptera melanura var. nigripennis Melzer, 1930 syn. nov.; Anastrangalia sanguinolenta (Linnaeus, 1761 (espécie introduzida na Argentina = Leptura bonaeriensis Burmeister, 1865 syn. nov.New synonyms proposed: Strangalia flavocincta (Thomson, 1860 = Ophistomis tristis Melzer, 1922 syn. nov. = O. latifasciata Melzer, 1926 syn. nov.; Strangalia succincta (Redtenbacher, 1867 = O. auriflua Redtenbacher, 1867 syn. nov.; Strangalia melanura (Redtenbacher, 1867 = Euryptera dimidiata Redtenbacher, 1867 syn. nov.; Strangalia lyrata (Redtenbacher, 1867 = Ophistomis discophora Redtenbacher, 1867 syn. nov.; Strangalia fulvicornis (Bates, 1872 = Ophistomis variabilis Melzer, 1926 syn. nov. = O. flavovittata Melzer, 1926 syn. nov.; Strangalia melanophthisis (Berg, 1889 reval. = Euryptera melanura var. nigripennis Melzer, 1930 syn. nov.; Anastrangalia sanguinolenta (Linnaeus, 1761 (species introduced in Argentina = Leptura bonaeriensis Burmeister, 1865 syn. nov.
Including Effects of Water Stress on Dead Organic Matter Decay to a Forest Carbon Model
Kim, H.; Lee, J.; Han, S. H.; Kim, S.; Son, Y.
2017-12-01
Decay of dead organic matter is a key process of carbon (C) cycling in forest ecosystems. The change in decay rate depends on temperature sensitivity and moisture conditions. The Forest Biomass and Dead organic matter Carbon (FBDC) model includes a decay sub-model considering temperature sensitivity, yet does not consider moisture conditions as drivers of the decay rate change. This study aimed to improve the FBDC model by including a water stress function to the decay sub-model. Also, soil C sequestration under climate change with the FBDC model including the water stress function was simulated. The water stress functions were determined with data from decomposition study on Quercus variabilis forests and Pinus densiflora forests of Korea, and adjustment parameters of the functions were determined for both species. The water stress functions were based on the ratio of precipitation to potential evapotranspiration. Including the water stress function increased the explained variances of the decay rate by 19% for the Q. variabilis forests and 7% for the P. densiflora forests, respectively. The increase of the explained variances resulted from large difference in temperature range and precipitation range across the decomposition study plots. During the period of experiment, the mean annual temperature range was less than 3°C, while the annual precipitation ranged from 720mm to 1466mm. Application of the water stress functions to the FBDC model constrained increasing trend of temperature sensitivity under climate change, and thus increased the model-estimated soil C sequestration (Mg C ha-1) by 6.6 for the Q. variabilis forests and by 3.1 for the P. densiflora forests, respectively. The addition of water stress functions increased reliability of the decay rate estimation and could contribute to reducing the bias in estimating soil C sequestration under varying moisture condition. Acknowledgement: This study was supported by Korea Forest Service (2017044B10-1719-BB01)
Zhao, Na; Meng, Ping; He, Yabing; Yu, Xinxiao
2017-07-01
In the context of global warming attributable to the increasing levels of CO2, severe drought may be more frequent in areas that already experience chronic water shortages (semiarid areas). This necessitates research on the interactions between increased levels of CO2 and drought and their effect on plant photosynthesis. It is commonly reported that 13C fractionation occurs as CO2 gas diffuses from the atmosphere to the substomatal cavity. Few researchers have investigated 13C fractionation at the site of carboxylation to cytoplasm before sugars are exported outward from the leaf. This process typically progresses in response to variations in environmental conditions (i.e., CO2 concentrations and water stress), including in their interaction. Therefore, saplings of two typical plant species (Platycladus orientalis and Quercus variabilis) from semiarid areas of northern China were selected and cultivated in growth chambers with orthogonal treatments (four CO2 concentration ([CO2]) × five soil volumetric water content (SWC)). The δ13C of water-soluble compounds extracted from leaves of saplings was determined for an assessment of instantaneous water use efficiency (WUEcp) after cultivation. Instantaneous water use efficiency derived from gas-exchange measurements (WUEge) was integrated to estimate differences in δ13C signal variation before leaf-level translocation of primary assimilates. The WUEge values in P. orientalis and Q. variabilis both decreased with increased soil moisture at 35-80 % of field capacity (FC) and increased with elevated [CO2] by increasing photosynthetic capacity and reducing transpiration. Instantaneous water use efficiency (iWUE) according to environmental changes differed between the two species. The WUEge in P. orientalis was significantly greater than that in Q. variabilis, while an opposite tendency was observed when comparing WUEcp between the two species. Total 13C fractionation at the site of carboxylation to cytoplasm before sugar
Aura-biomes are present in the water layer above coral reef benthic macro-organisms
Directory of Open Access Journals (Sweden)
Kevin Walsh
2017-08-01
Full Text Available As coral reef habitats decline worldwide, some reefs are transitioning from coral- to algal-dominated benthos with the exact cause for this shift remaining elusive. Increases in the abundance of microbes in the water column has been correlated with an increase in coral disease and reduction in coral cover. Here we investigated how multiple reef organisms influence microbial communities in the surrounding water column. Our study consisted of a field assessment of microbial communities above replicate patches dominated by a single macro-organism. Metagenomes were constructed from 20 L of water above distinct macro-organisms, including (1 the coral Mussismilia braziliensis, (2 fleshy macroalgae (Stypopodium, Dictota and Canistrocarpus, (3 turf algae, and (4 the zoanthid Palythoa caribaeorum and were compared to the water microbes collected 3 m above the reef. Microbial genera and functional potential were annotated using MG-RAST and showed that the dominant benthic macro-organisms influence the taxa and functions of microbes in the water column surrounding them, developing a specific “aura-biome”. The coral aura-biome reflected the open water column, and was associated with Synechococcus and functions suggesting oligotrophic growth, while the fleshy macroalgae aura-biome was associated with Ruegeria, Pseudomonas, and microbial functions suggesting low oxygen conditions. The turf algae aura-biome was associated with Vibrio, Flavobacterium, and functions suggesting pathogenic activity, while zoanthids were associated with Alteromonas and functions suggesting a stressful environment. Because each benthic organism has a distinct aura-biome, a change in benthic cover will change the microbial community of the water, which may lead to either the stimulation or suppression of the recruitment of benthic organisms.
Aura-biomes are present in the water layer above coral reef benthic macro-organisms.
Walsh, Kevin; Haggerty, J Matthew; Doane, Michael P; Hansen, John J; Morris, Megan M; Moreira, Ana Paula B; de Oliveira, Louisi; Leomil, Luciana; Garcia, Gizele D; Thompson, Fabiano; Dinsdale, Elizabeth A
2017-01-01
As coral reef habitats decline worldwide, some reefs are transitioning from coral- to algal-dominated benthos with the exact cause for this shift remaining elusive. Increases in the abundance of microbes in the water column has been correlated with an increase in coral disease and reduction in coral cover. Here we investigated how multiple reef organisms influence microbial communities in the surrounding water column. Our study consisted of a field assessment of microbial communities above replicate patches dominated by a single macro-organism. Metagenomes were constructed from 20 L of water above distinct macro-organisms, including (1) the coral Mussismilia braziliensis , (2) fleshy macroalgae ( Stypopodium , Dictota and Canistrocarpus ), (3) turf algae, and (4) the zoanthid Palythoa caribaeorum and were compared to the water microbes collected 3 m above the reef. Microbial genera and functional potential were annotated using MG-RAST and showed that the dominant benthic macro-organisms influence the taxa and functions of microbes in the water column surrounding them, developing a specific "aura-biome". The coral aura-biome reflected the open water column, and was associated with Synechococcus and functions suggesting oligotrophic growth, while the fleshy macroalgae aura-biome was associated with Ruegeria , Pseudomonas, and microbial functions suggesting low oxygen conditions. The turf algae aura-biome was associated with Vibrio, Flavobacterium, and functions suggesting pathogenic activity, while zoanthids were associated with Alteromonas and functions suggesting a stressful environment. Because each benthic organism has a distinct aura-biome, a change in benthic cover will change the microbial community of the water, which may lead to either the stimulation or suppression of the recruitment of benthic organisms.
Environmental impact of electric car production shifts
Gregori, Tullio
2015-01-01
In questo lavoro viene affrontato il tema dell’impatto ambientale di una riduzione della produzione di automobili con motore a combustione interna (ICV) a vantaggio dei veicoli con batteria elettrica (BEV). Questa cambiamento tecnologico è analizzato mediante l’approccio Input Output, che viene esteso alle variabili ambientali. Si tratta di un modello lineare che permette di valutare gli effetti di uno spostamento della produzione di automobili con combustione interna ...
Bucci, Tommaso
2010-01-01
I pazienti sottoposti a resezione oncologica per patologia neoplastica del cavo orale, subiscono interventi chirurgici molto spesso mutilanti che, nonostante la ricostruzione del difetto osseo e dei tessuti molli, determinano una alterazione della normale anatomia della cavitá orale, una alterazione dei normali movimenti della lingua e della mandibola, un deficit della sensibilitá propriocettiva della mucosa orale. Tutte queste variabili determinano una impossibilitá da parte del pazie...
Directory of Open Access Journals (Sweden)
Irina Tatiana Morales Castaño
2010-01-01
Full Text Available Se revisaron cinco colecciones entomológicas de Colombia y se registra por primera vez para el país Brachymetra shawi Hungerford & Matsuda 1938, especie que había sido reportada para Guyana, Guyana Francesa, Surinam, Brasil y Bolivia y Potamobates variabilis Hungerford 1957, registrada solamente para el Perú; asimismo se amplía la distribución departamental para 14 especies de la familia Gerridae.
Glycolipid biosynthesis in cyanobacteria
International Nuclear Information System (INIS)
Van Dusen, W.J.; Jaworski, J.G.
1987-01-01
The biosynthesis of monogalactosyldiacyl-glycerol (MGDG) was studied in five different cyanobacteria. Previous work has shown Anabaena variabilis to synthesize both MGDG and monoglucosyl-diacylglycerol (MG1cDG) with MG1cDG being the precursor of MGDG. They have examined four other cyanobacteria to determine if a similar relationship exists. The cyanobacteria studied were Anabaena variabilis, Chlorogloeopsis sp., Schizothrix calcicola, Anacystis nidulans, and Anacystis marina. Each were grown in liquid culture and lipids were labeled with 14 C]CO 2 for 20 min., 1.0 hr, 1.0 hr + 10 hr chase. Glycolipids were analyzed by initial separation of MGDG and MG1cDG by TLC followed by further analysis by HPLC. Complete separation of molecular species was obtained isocratically on an ODS column. All of the cyanobacteria labeled 16-C and 18-C fatty acids except for A. marina which labeled only 14-C and 16-C fatty acids. Desaturation of the fatty acids could be observed in the 1.0 hr and chase experiments. All were capable of labeling both MG1cDG and MGDG with the precursor-product relationship being observed. There does not appear to be a direct relationship between the epimerization of the sugar moiety and fatty acid desaturation
Afonina, Ekaterina Yu; Tashlykova, Natalya A
2018-02-01
The plankton community of sixteen saline lakes located on Onon-Torey plain (Northeastern Mongolia) during the filling phase and the raising of the water level was investigated in July 2011. Thirty-five taxa of phytoplankton and thirty-one species of zooplankton were found. For phytoplankton, blue-green algae ( Merismopedia elegans , Anabaenopsis elenkinii , Arthrospora fusiformis , Spirulina major , Lyngbya sp., Oscillatoria sp.) and green algae ( Monoraphidium minutum , Tetrastrum komarekii , Ankyra ocellata , Oocystis sp.) were dominant. For zooplankton, Filinia longiseta, Brachionus plicatilis , B. variabilis , Hexarthra mira (Rotifera), Daphnia magna , Moina brachiata , M. mongolica (Cladocera), Arctodiaptomus bacillifer , Mixodiaptomus incrassatus , Metadiaptomus asiaticus (Copepoda) dominated. Mineralization, active hydrogen ratio, dissolved oxygen and water temperature were the main factors influencing the diversity, structure and distribution of plankton organisms in the steppe lakes during low water level. The RDA analysis for phytoplankton and zooplankton from different lakes was carried out for selected two groups which included lakes and a subset related species. The first group is of oligohaline and mesohaline lakes in which mostly green algae, rotifers and copepods inhabit. The second group is of mesohaline and polyhaline lakes with mainly blue-green algae , some crustaceans and rotifers inhabiting. High abundance and biomass of Spirulina major , Oscillatoria sp. and Brachionus variabilis were observed in lakes with high mineralization, pH and temperature.
Wang, Xiao-Fei; Liu, Jian-Feng; Gao, Wen-Qiang; Deng, Yun-Peng; Ni, Yan-Yan; Xiao, Yi-Hua; Kang, Feng-Feng; Wang, Qi; Lei, Jing-Pin; Jiang, Ze-Ping
2016-06-01
Knowledge of latitudinal patterns in plant defense and herbivory is crucial for understanding the mechanisms that govern ecosystem functioning and for predicting their responses to climate change. Using a widely distributed species in East Asia, Quercus variabilis, we aim to reveal defense patterns of trees with respect to ontogeny along latitudinal gradients. Six leaf chemical (total phenolics and total condensed tannin concentrations) and physical (cellulose, hemicellulose, lignin and dry mass concentration) defensive traits as well as leaf herbivory (% leaf area loss) were investigated in natural Chinese cork oak (Q. variabilis) forests across two ontogenetic stages (juvenile and mature trees) along a ~14°-latitudinal gradient. Our results showed that juveniles had higher herbivory values and a higher concentration of leaf chemical defense substances compared with mature trees across the latitudinal gradient. In addition, chemical defense and herbivory in both ontogenetic stages decreased with increasing latitude, which supports the latitudinal herbivory-defense hypothesis and optimal defense theory. The identified trade-offs between chemical and physical defense were primarily determined by environmental variation associated with the latitudinal gradient, with the climatic factors (annual precipitation, minimum temperature of the coldest month) largely contributing to the latitudinal defense pattern in both juvenile and mature oak trees.
Miller, Karen J.; Gunasekera, Rasanthi M.
2017-04-01
Ecological processes in the deep sea are poorly understood due to the logistical constraints of sampling thousands of metres below the ocean’s surface and remote from most land masses. Under such circumstances, genetic data provides unparalleled insight into biological and ecological relationships. We use microsatellite DNA to compare the population structure, reproductive mode and dispersal capacity in two deep sea corals from seamounts in the Southern Ocean. The solitary coral Desmophyllum dianthus has widespread dispersal consistent with its global distribution and resilience to disturbance. In contrast, for the matrix-forming colonial coral Solenosmilia variabilis asexual reproduction is important and the dispersal of sexually produced larvae is negligible, resulting in isolated populations. Interestingly, despite the recognised impacts of fishing on seamount communities, genetic diversity on fished and unfished seamounts was similar for both species, suggesting that evolutionary resilience remains despite reductions in biomass. Our results provide empirical evidence that a group of seamounts can function either as isolated islands or stepping stones for dispersal for different taxa. Furthermore different strategies will be required to protect the two sympatric corals and consequently the recently declared marine reserves in this region may function as a network for D. dianthus, but not for S. variabilis.
Un indice per lo sviluppo sostenibile (An Index for Sustainable Development
Directory of Open Access Journals (Sweden)
Enrico Casadio Tarabusi
2012-04-01
Full Text Available As a possible improvement to the United Nations' Human Development Index (HDI, we propose including in the set of individual variables some of an environmental or social nature. Thus, by rescaling all the variables non-linearly it is possible to mitigate the effect of outliers and synthesize by principal components, or alternatively by a different averaging method that takes sustainability into account and penalizes unbalances among different aspects of development. Both methods are easy to implement and calibrate. The ensuing effect on the ranking of world countries is compared to the HDI ranking. Come possibile miglioramento dell'Indice di Sviluppo Umano (ISU elaborato dall'Organizzazione delle Nazioni Unite proponiamo di includere nell'insieme di variabili individuali alcune di natura ambientale o sociale, di riscalare opportunamente tutte le variabili non linearmente in modo da mitigare l'effetto deglioutliers, e di sintetizzare mediante le componenti principali, oppure attraverso un diverso metodo di media che, tenendo conto della sostenibilità, penalizza gli squilibri tra diversi aspetti dello sviluppo. Entrambi i metodi sono facili da implementare e da calibrare. Il loro effetto sulla graduatoria dei paesi mondiali viene raffrontata con quella dell'ISU. JEL Codes: I31, O47Keywords: Development, Human Development, Indice
Conti, Franco
1993-01-01
Rispetto ai tradizionali volumi di analisi matematica, il testo ha la caratteristica di dedicare ampio spazio alle applicazioni della materia ai problemi concreti soprattutto in riferimento alla chimica, biologia e fisica. Gli argomenti abbracciano una gamma più vasta di quelli tradizionalmente trattati nei corsi di Analisi 1 e 2 . Comprende infatti, oltre al calcolo differenziale e integrale in una e più variabili, anche le applicazioni delle equazioni differenziali e problemi numerici.
Maithya, J.
1998-01-01
In 1988, the World Conservation Union (WCU) Red Book of Endangered Species listed hundreds of endemic fishes of Lake Victoria under a single heading - "ENDANGERED". Most of the endemic native food fishes are either endangered or extinct. However, a survey of the fauna of Lake Kanyaboli, revealed that a few remaining samples of these native fishes are actually thriving. These include several unidentified Haplochromis spp., Oreochromis esculentus and Oreochromis variabilis. As a resul...
Institute of Scientific and Technical Information of China (English)
范敏锐; 余新晓; 张振明; 史宇; 吕锡芝; 周彬
2010-01-01
应用生物地球化学过程模型BIOME-BGC估算了1977-1992年北京妙峰山栓皮栎(Quercus variabilis)林的净第一性生产力(NPP),并分析气候对NPP年际变化的影响以及未来气候变化情景下对NPP的影响.结果表明:1977-1992年15年间栓皮栎的NPP(以C计)平均值为340.17 g·m-2·a-1.NPP(以C计)变化在143.56~431.56 g·m-2·a-1之间,并无明显的整体变化趋势,但表现出明显的年际变化,年际变动率达18%.在这段时间内降水量成为控制栓皮栎林NPP年际变化的主要气候因子.通过设置18种不同未来气候方案进行栓皮栎林NPP模拟表明,CO2浓度加倍会降低栓皮栎林的NPP但降低幅度较小.在CO2浓度不变的情况下,温度升高2.0℃和降水的协同增加以及单个因子的增加都有利于NPP的积累,但协同增加不如单个因子的增加对NPP的积累效应明显;在CO2和气候同时改变的情况下,CO2浓度加倍、温度升高2.0℃和降水的协同增加有利于NPP的积累且协同增加比单个因子的增加对NPP的积累效应明显,但各因子之间交互作用较弱.
Case definitions for human poisonings postulated to palytoxins exposure.
Tubaro, A; Durando, P; Del Favero, G; Ansaldi, F; Icardi, G; Deeds, J R; Sosa, S
2011-03-01
A series of case reports and anecdotal references describe the adverse effects on human health ascribed to the marine toxin palytoxin (PLTX) after different exposure routes. They include poisonings after oral intake of contaminated seafood, but also inhalation and cutaneous/systemic exposures after direct contact with aerosolized seawater during Ostreopsis blooms and/or through maintaining aquaria containing cnidarian zoanthids. The symptoms commonly recorded during PLTX intoxication are general malaise and weakness, associated with myalgia, respiratory effects, impairment of the neuromuscular apparatus and abnormalities in cardiac function. Systemic symptoms are often recorded together with local damages whose intensity varies according to the route and length of exposure. Gastrointestinal malaise or respiratory distress is common for oral and inhalational exposure, respectively. In addition, irritant properties of PLTX probably account for the inflammatory reactions typical of cutaneous and inhalational contact. Unfortunately, the toxin identification and/or quantification are often incomplete or missing and cases of poisoning are indirectly ascribed to PLTXs, according only to symptoms, anamnesis and environmental/epidemiological investigations (i.e. zoanthid handling or ingestion of particular seafood). Based on the available literature, we suggest a "case definition of PLTX poisonings" according to the main exposure routes, and, we propose the main symptoms to be checked, as well as, hemato-clinical analysis to be carried out. We also suggest the performance of specific analyses both on biological specimens of patients, as well as, on the contaminated materials responsible for the poisoning. A standardized protocol for data collection could provide a more rapid and reliable diagnosis of palytoxin-poisoning, but also the collection of necessary data for the risk assessment for this family of toxins. Copyright © 2011 Elsevier Ltd. All rights reserved.
Photobiological hydrogen production and carbon dioxide sequestration
Berberoglu, Halil
Photobiological hydrogen production is an alternative to thermochemical and electrolytic technologies with the advantage of carbon dioxide sequestration. However, it suffers from low solar to hydrogen energy conversion efficiency due to limited light transfer, mass transfer, and nutrient medium composition. The present study aims at addressing these limitations and can be divided in three parts: (1) experimental measurements of the radiation characteristics of hydrogen producing and carbon dioxide consuming microorganisms, (2) solar radiation transfer modeling and simulation in photobioreactors, and (3) parametric experiments of photobiological hydrogen production and carbon dioxide sequestration. First, solar radiation transfer in photobioreactors containing microorganisms and bubbles was modeled using the radiative transport equation (RTE) and solved using the modified method of characteristics. The study concluded that Beer-Lambert's law gives inaccurate results and anisotropic scattering must be accounted for to predict the local irradiance inside a photobioreactor. The need for accurate measurement of the complete set of radiation characteristics of microorganisms was established. Then, experimental setup and analysis methods for measuring the complete set of radiation characteristics of microorganisms have been developed and successfully validated experimentally. A database of the radiation characteristics of representative microorganisms have been created including the cyanobacteria Anabaena variabilis, the purple non-sulfur bacteria Rhodobacter sphaeroides and the green algae Chlamydomonas reinhardtii along with its three genetically engineered strains. This enabled, for the first time, quantitative assessment of the effect of genetic engineering on the radiation characteristics of microorganisms. In addition, a parametric experimental study has been performed to model the growth, CO2 consumption, and H 2 production of Anabaena variabilis as functions of
Standardizzazione isogravitá di un case-mix ospedaliero mediante Charlson index
Directory of Open Access Journals (Sweden)
G. Messina
2003-05-01
Full Text Available
Introduzione: la comorbidità è un importante fattore confondente negli studi epidemiologici valutativi dell’assistenza ospedaliera. Diversi strumenti di risk adjustment misurano la complessità della malattia, consentendo di correlarla al consumo di risorse assistenziali, agli esiti, nonchè di confrontare studi eseguiti in tempi e realtà diversi.
Obiettivi: - Standardizzare per complessità casistica la mortalità dei pazienti assistiti da un grande ospedale; - Identificare le variabili in grado di migliorare la capacità predittiva di mortalità intraospedaliera (IM. Materiali e
Metodi: sono state analizzate 40.801 schede di dimissione prodotte dal Policlinico Senese nel 2001. Sono stati studiati i tassi di IM specifici per Charlson Index Score (CSI: quest’ultimo considera 19 categorie di patologia e si basa sull’ ICD-IX-CM. Le variabili studiate mediante analisi bivariate e regressione logistica, sono state: CSI (codificato in 5 livelli 0, 1, 2, 3, 4, lunghezza del ricovero (LR, sesso ed età. Risultati: CSI è risultato associato con IM (p‹0.001. Sesso, età e LR sono risultati associati sia con CSI (p‹0.001 che IM (p‹0.001. Confrontando i 4 livelli di CSI con quello di riferimento (0, le seguenti Odds Ratio (OR di IM sono state trovate: Livello 1 verso livello 0 OR: 6.79 (p‹0.001, Livello 2 verso livello 0 OR: 15.8 (p‹0.001, Livello 3 verso livello 0 OR: 9.36 (p‹0.001, Livello 4 verso livello 0 OR: 7.4 (p‹0.001. La variabile sesso non è risultata aver un effetto confondente tra CSI e IM al contrario delle variabili LR ed età.
Conclusioni: il CSI aiuta a valutare (predire il rischio di mortalità intraospedaliera, sebbene in modo non lineare. Abbiamo sempre rilevato valori più alti di mortalità confrontando i livelli 1, 2, 3, e 4 con quello di riferimento (0. In particolare il valore più alto lo ha raggiunto il secondo livello
Alastruey-Izquierdo, Ana; Castelli, Maria Victoria; Cuesta, Isabel; Monzon, Araceli; Cuenca-Estrella, Manuel; Rodriguez-Tudela, Juan Luis
2009-04-01
The antifungal susceptibility profiles of 77 clinical strains of Mucorales species, identified by internal transcribed spacer sequencing, were analyzed. MICs obtained at 24 and 48 h were compared. Amphotericin B was the most active agent against all isolates, except for Cunninghamella and Apophysomyces isolates. Posaconazole also showed good activity for all species but Cunninghamella bertholletiae. Voriconazole had no activity against any of the fungi tested. Terbinafine showed good activity, except for Rhizopus oryzae, Mucor circinelloides, and Rhizomucor variabilis isolates.
Directory of Open Access Journals (Sweden)
Aisha Waheed Qurashi
2012-09-01
Full Text Available To compensate for stress imposed by salinity, biofilm formation and exopolysaccharide production are significant strategies of salt tolerant bacteria to assist metabolism. We hypothesized that two previously isolated salt-tolerant strains Halomonas variabilis (HT1 and Planococcus rifietoensis (RT4 have an ability to improve plant growth, These strains can form biofilm and accumulate exopolysacharides at increasing salt stress. These results showed that bacteria might be involved in developing microbial communities under salt stress and helpful in colonizing of bacterial strains to plant roots and soil particles. Eventually, it can add to the plant growth and soil structure. We investigated the comparative effect of exopolysacharide and biofilm formation in two bacterial strains Halomonas variabilis (HT1 and Planococcus rifietoensis (RT4 in response to varying salt stress. We found that biofilm formation and exopolysaccharide accumulation increased at higher salinity. To check the effect of bacterial inoculation on the plant (Cicer arietinum Var. CM-98 growth and soil aggregation, pot experiment was conducted by growing seedlings under salt stress. Inoculation of both strains increased plant growth at elevated salt stress. Weight of soil aggregates attached with roots and present in soil were added at higher salt concentrations compared to untreated controls. Soil aggregation was higher at plant roots under salinity. These results suggest the feasibility of using above strains in improving plant growth and soil fertility under salinity.
Directory of Open Access Journals (Sweden)
Ekaterina Yu. Afonina
2018-02-01
Full Text Available The plankton community of sixteen saline lakes located on Onon-Torey plain (Northeastern Mongolia during the filling phase and the raising of the water level was investigated in July 2011. Thirty-five taxa of phytoplankton and thirty-one species of zooplankton were found. For phytoplankton, blue-green algae (Merismopedia elegans, Anabaenopsis elenkinii, Arthrospora fusiformis, Spirulina major, Lyngbya sp., Oscillatoria sp. and green algae (Monoraphidium minutum, Tetrastrum komarekii, Ankyra ocellata, Oocystis sp. were dominant. For zooplankton, Filinia longiseta, Brachionus plicatilis, B. variabilis, Hexarthra mira (Rotifera, Daphnia magna, Moina brachiata, M. mongolica (Cladocera, Arctodiaptomus bacillifer, Mixodiaptomus incrassatus, Metadiaptomus asiaticus (Copepoda dominated. Mineralization, active hydrogen ratio, dissolved oxygen and water temperature were the main factors influencing the diversity, structure and distribution of plankton organisms in the steppe lakes during low water level. The RDA analysis for phytoplankton and zooplankton from different lakes was carried out for selected two groups which included lakes and a subset related species. The first group is of oligohaline and mesohaline lakes in which mostly green algae, rotifers and copepods inhabit. The second group is of mesohaline and polyhaline lakes with mainly blue-green algae, some crustaceans and rotifers inhabiting. High abundance and biomass of Spirulina major, Oscillatoria sp. and Brachionus variabilis were observed in lakes with high mineralization, pH and temperature.
Helminths of the raccoon (Procyon lotor) in western Kentucky.
Cole, R A; Shoop, W L
1987-08-01
Seventy raccoons (Procyon lotor) from western Kentucky were examined for helminths from December 1985 through May 1986. Twenty-three species of helminths were collected including 10 species of Trematoda (Brachylaima virginiana, Euryhelmis squamula, Eurytrema procyonis, Fibricola cratera, Gyrosoma singulare, Maritreminoides nettae, Mesostephanus appendiculatoides, Metagonimoides oregonensis, Paragonimus kellicotti, Pharyngostomoides procyonis), 2 species of Cestoda (Atriotaenia procyonis, Mesocestoides variabilis), 10 species of Nematoda (Arthrocephalus lotoris, Baylisascaris procyonis, Capillaria putorii, C. plica, Crenosoma goblei, Dracunculus insignis, Gnathostoma procyonis, Molineus barbatus, Physaloptera rara, Trichinella spiralis), and 1 species of Acanthocephala (Macracanthorhynchus ingens). A mean of 6.4 (3-11) helminth species per host was recorded. Fibricola cratera, Atriotaenia procyonis, Mesocestoides variabilis, Arthrocephalus lotoris, Capillaria plica, Dracunculus insignis, Molineus barbatus, and Physaloptera rara were ubiquitous parasites of the raccoon, whereas specific nidi were observed for Eurytrema procyonis, Gyrosoma singulare, Paragonimus kellicotti, Baylisascaris procyonis, Trichinella spiralis, and Macracanthorhyncus ingens. With an overall prevalence of 10% or higher, 15 of the 23 helminth species were considered common parasites of the raccoon in western Kentucky. When the 10% prevalence rate was applied within geographical quadrants to correct for the presence of nidi it was found that 18 of the 23 helminth species were common and 5 were regarded as rare parasites of the raccoon. Two species of nematodes, T. spiralis and B. procyonis, displayed a markedly higher prevalence in male raccoons.
Biology and distribution of chafers (Coleoptera, Scarabaeidae) living in hollow trees in Sweden.
Nilsson, Sven; Baranowski, Rickard; Hedin, Jonas; Jansson, Niklas; Ranius, Thomas
2002-01-01
We review the ecology and distributions of the chafers Liocola marmorata (F.), Gnorimus nobilis (L.) and Gnorimus variabilis (L.) in Sweden based on museum and several large private collections. These species live in hollow deciduous trees, in Sweden especially in oaks. The former and recently documented localities are shown on maps. More than 100 years ago, all the species as well as their habitats were more common in Sweden than today. One problem when interpreting old finds is that hollow ...
Pueyo, J J; Curley, G P; Mayhew, S G
1996-01-01
The reactions of excess apoflavodoxin from Desulfovibrio vulgaris, Anabaena variabilis and Azotobacter vinelandii with ribo- flavin 5«-phosphate (FMN), riboflavin 3«,5«-bisphosphate and riboflavin are pseudo-first-order. The rates increase with decreasing pH in the range pH 5-8, and, in general, they increase with increasing ionic strength to approach a maximum at an ionic strength greater than 0.4 M. The rate of FMN binding in phosphate at high pH increases to a maximum ...
Borreliosis in free-ranging black bears from Wisconsin.
Kazmierczak, J J; Amundson, T E; Burgess, E C
1988-04-01
Blood, kidney and tick samples were obtained from 18 hunter-killed black bears (Ursus americanus) from three sites in northern Wisconsin. A Borrelia sp., morphologically and antigenically similar to Borrelia burgdorferi, was isolated from the blood of two of the animals, and from the kidney of a third. Ixodes dammini and Dermacentor variabilis were found on the bears. This is the first report of borreliosis in the Ursidae, and of the primary vector of Lyme disease, I. dammini, from this host.
Alastruey-Izquierdo, Ana; Castelli, Maria Victoria; Cuesta, Isabel; Monzon, Araceli; Cuenca-Estrella, Manuel; Rodriguez-Tudela, Juan Luis
2009-01-01
The antifungal susceptibility profiles of 77 clinical strains of Mucorales species, identified by internal transcribed spacer sequencing, were analyzed. MICs obtained at 24 and 48 h were compared. Amphotericin B was the most active agent against all isolates, except for Cunninghamella and Apophysomyces isolates. Posaconazole also showed good activity for all species but Cunninghamella bertholletiae. Voriconazole had no activity against any of the fungi tested. Terbinafine showed good activity, except for Rhizopus oryzae, Mucor circinelloides, and Rhizomucor variabilis isolates. PMID:19171801
Fibrinogen-related proteins in ixodid ticks
Czech Academy of Sciences Publication Activity Database
Štěrba, J.; Dupejová, J.; Fišer, M.; Vancová, Marie; Grubhoffer, Libor
2011-01-01
Roč. 4, - (2011), e127 ISSN 1756-3305 R&D Projects: GA MŠk(CZ) LC06009; GA AV ČR KJB600960906; GA ČR GA206/09/1782 Institutional research plan: CEZ:AV0Z60220518 Keywords : AMERICAN DOG TICK * INNATE IMMUNITY * DORIN-M * RHIPICEPHALUS-APPENDICULATUS * MOLECULAR CHARACTERIZATION * DERMACENTOR-VARIABILIS * ORNITHODOROS-MOUBATA * LECTINS * HEMOLYMPH * BINDING Subject RIV: EE - Microbiology, Virology Impact factor: 2.937, year: 2011 http://www.parasitesandvectors.com/content/pdf/1756-3305-4-127.pdf
Directory of Open Access Journals (Sweden)
Juliana Imenis Barradas
2010-06-01
Full Text Available Despite their ecological and social-economic importance, coral reefs are under constant threat and thus require proper management practices. Data on the spatial structure of these ecosystems are essential for good quality conservation projects in such areas. This study aimed to quantitatively analyze the spatial distribution of benthic macroorganisms from the reef environment of Porto de Galinhas Beach, with special focus on its corals and calcified hydroids. Reef flats of the area were surveyed by scuba diving, using 10m line transects. A high cover of macroalgae was verified, averaging 53% of the observations. Zoanthids were the second most representative group (11%. A total of 173 colonies of corals and calcified hydroids were observed and 40% of these colonies were partially or totally bleached.
The biology and chemistry of the zoanthamine alkaloids.
Behenna, Douglas C; Stockdill, Jennifer L; Stoltz, Brian M
2008-01-01
Marine natural products have long played an important role in natural products chemistry and drug discovery. Mirroring the rich variety and complicated interactions of the marine environment, the substances isolated from sea creatures tend to be incredibly diverse in both molecular structure and biological activity. The natural products isolated from the polyps of marine zoanthids are no exception. The zoanthamine alkaloids, the first of which were isolated over 20 years ago, are of particular interest to the synthetic community because they feature a novel structural framework and exhibit a broad range of biological activities. In this Review, we summarize the major contributions to understanding the zoanthamine natural products with regard to their isolation and structure determination, as well as studies on their biological activity and total synthesis.
Ellenrieder, Natalia Von; Watson, Gillian
2016-04-19
A mealybug species that feeds on Agave spp., Pseudococcus variabilis sp. n. (Hemiptera: Coccomorpha: Pseudococcidae), is described from North America. Its entry into the United States was likely via the horticultural trade on its host plants in the genus Agave (Liliales: Agavaceae). Descriptions and illustrations of the adult female and male, diagnosis from congeners in the New World, and a molecular characterization based on COI are provided, as well as a key to adult females of all Pseudococcus species recorded from the New World.
Bostock, Helen C.; Tracey, Dianne M.; Currie, Kim I.; Dunbar, Gavin B.; Handler, Monica R.; Mikaloff Fletcher, Sara E.; Smith, Abigail M.; Williams, Michael J. M.
2015-06-01
Habitat-forming deep-sea scleractinian and alcyonacean corals from around the southwest Pacific were analysed for their calcium carbonate mineralogy. Scleractinian coral species Solenosmilia variabilis, Enallopsammia rostrata, Goniocorella dumosa, Madrepora oculata and Oculina virgosa were all found to be 100% aragonitic, while some members of the alcyonacean taxa Keratoisis spp., Lepidisis spp., and Paragorgia spp. were determined to be high magnesium (Mg) calcite (with 8-11 mol% MgCO3) and Primnoa sp. is bimineralic with both aragonite and Mg calcite. The majority of these habitat-forming deep-sea corals are found at intermediate depths (800-1200 m) in the Antarctic Intermediate Waters (AAIW) with low salinities (~34.5), temperatures of 4-8 °C and high oxygen concentrations (>180 μmol/kg) and currently sitting above the aragonite saturation horizon (ASH). However, habitat-forming corals have been recorded from greater depths, in cooler waters (2-4 °C) that are undersaturated with respect to aragonite (Ωaragonite160 μmol/kg. To address the sampling depth bias the coral records were normalised by the number of benthic stations (sampling effort) in the same depth range. This shows that the highest number of corals per sampling effort is between 1000 and 1400 m with corals present in over 5% of the stations at these depths. The normalised records and Boot Strap analyses suggests that scleractinian corals, especially S. variabilis should be present in >1% of stations down to 1800 m water depth, with E. rostrata, M. oculata and G. dumosa slightly shallower. While alcyonacean corals are found in >1% down to 2600 m, with Keratoisis spp. the deepest down to 2600 m, while Lepidisis spp. and Paragorgia spp. found down to 1800 m. This suggests that most species can probably tolerate some undersaturation of aragonite (Ωaragonite=0.8-0.9), with several species/genera (S. variabilis; Keratoisis spp.) even more tolerant of lower carbonate concentrations ([CO3 2 -]), down
Effect of Dietary Amorphophallus sp From East Java on LDL-C Rats (Rattus novergicus Wistar Strain
Directory of Open Access Journals (Sweden)
Sri Widyarti
2011-06-01
Full Text Available One of indication of obesity is high LDL-C . Obesity has serious risk to health, it can cause heart disease and stroke. Effort to lower obesity using drugs have significant side effects such as insomnia, increased blood pressure, dry mouth and so forth. Therefore using natural products that contain glucomannan to reduce obesity and LDL-C is good choise. Glucomannan in the global market derived from Amorphophallus konjac. In this study, we used glucomannan from Amorphophallus endemic East Java to reduce fattened Wistar rats. Amorphophallus that used include Amorphophallus muelleri, A.variabilis (variant: Brongkos 32; Brongkos 5; Wonorejo, Brangsi and Amorphophallus campanulatus (Var Selopuro. Amorphophallus diet was given to white rats of Wistar strain that previously fattened using a mixture of cholesterol and lard, in addition to PARS (Chicken Feed Race Super as a basic food. Amorphophallus konjac was used as control. Measurement of LDL-C was conducted in four different time points, namely 1. Prior to dietary cholesterol, 2. 24 days after the dietary cholesterol, 3 11 days after Amorphophallus (+cholesterol diet, 4. 25 days after Amorphophallus (+cholesterol diet. The results showed that the diet of A.variabilis potentially lowered blood cholesterol levels for their respective 22.98%, 5.85% and 7.37% for consecutive variant Brongkos 32; Brongkos 5; Wonorejo. Diet from A.campanulatus and A.konjac had not been able to reduce cholesterol to the end of observation (25 days.
Larval settlement: the role of surface topography for sessile coral reef invertebrates.
Whalan, Steve; Wahab, Muhammad A Abdul; Sprungala, Susanne; Poole, Andrew J; de Nys, Rocky
2015-01-01
For sessile marine invertebrates with complex life cycles, habitat choice is directed by the larval phase. Defining which habitat-linked cues are implicated in sessile invertebrate larval settlement has largely concentrated on chemical cues which are thought to signal optimal habitat. There has been less effort establishing physical settlement cues, including the role of surface microtopography. This laboratory based study tested whether surface microtopography alone (without chemical cues) plays an important contributing role in the settlement of larvae of coral reef sessile invertebrates. We measured settlement to tiles, engineered with surface microtopography (holes) that closely matched the sizes (width) of larvae of a range of corals and sponges, in addition to surfaces with holes that were markedly larger than larvae. Larvae from two species of scleractinian corals (Acropora millepora and Ctenactis crassa) and three species of coral reef sponges (Luffariella variabilis, Carteriospongia foliascens and Ircinia sp.,) were used in experiments. L. variabilis, A. millepora and C. crassa showed markedly higher settlement to surface microtopography that closely matched their larval width. C. foliascens and Ircinia sp., showed no specificity to surface microtopography, settling just as often to microtopography as to flat surfaces. The findings of this study question the sole reliance on chemical based larval settlement cues, previously established for some coral and sponge species, and demonstrate that specific physical cues (surface complexity) can also play an important role in larval settlement of coral reef sessile invertebrates.
Vojnovskytesidae - a new family of Mississippian Rugosa (Anthozoa)
Fedorowski, Jerzy; Kullmann, Jürgen
2013-12-01
Fedorowski, J. and Kullmann, J. 2013. Vojnovskytesidae - a new family of Mississippian Rugosa (Anthozoa). Acta Geologica Polonica, 63(4), 657-679. Warszawa. Two new species of the genus Vojnovskytes Fedorowski, 2009, namely V. marcinowskii and V. arcuatus, and a new genus, Vojnimitor, based on the new species V. proiectus, all from Mississippian strata of northern Spain, are described. Vojnovskytes variabilis (Vojnovsky-Krieger, 1934), the type species for the genus from the lowermost Visean strata of southern Urals, also is discussed and illustrated. Characters displayed by the taxa mentioned permit introduction of a new family Vojnovskytesidae.
Attuali sviluppi nello studio dell’associazione tra variabili di tipo qualitativo.
Directory of Open Access Journals (Sweden)
C Antonelli
1996-02-01
Full Text Available The most common procedure for analyzing contingency table data is by using chi-square statistic. The early development of chi-square analysis of contingency table is credited to Pearson (1904 and Fisher (1929, successively expanded by Yates, Mantel-Haenszcl etc. In this paper some developments of the chi-square function has been outlined, particularly as statistical test for the null hypothesis of independence, for subdividing contingency tables and the chi-square test for linear association between ordinal variables.
Directory of Open Access Journals (Sweden)
Bruna Gumiero
2016-02-01
Full Text Available Sette Fasce Tampone, realizzate secondo le indicazioni tecniche contenute nello standard di condizionalità 5.2, in diversi ambiti e contesti climatici, sono state monitorate per un periodo biennale, al fine di quantificare la loro efficienza nella rimozione di azoto inorganico disciolto. Tale azoto è costituito per lo più da molecole di azoto nitrico che vengono veicolate principalmente tramite deflussi sub-superficiali da zone soggette a diverse pratiche colturali verso i corpi idrici superficiali adiacenti. Ad eccezione di due casi: i siti di Lodi e Metaponto, in tutti i sistemi monitorati è stata confermata la presenza di deflussi trasversali ai sistemi tampone, permanenti o temporanei, in grado di veicolare inquinanti e con portate variabili fra 919 e 8.590 m3/anno per 100 m lineari di FT. Le differenze di portata sono imputabili principalmente alla diversa superficie dei bacini agricoli afferenti ai sistemi tampone, che nei casi analizzati occupano superfici variabili fra il 3,6 ed il 33,3% del bacino agricolo. Sulla base dei bilanci di massa è emerso che dai campi coltivati giungono ai sistemi tampone percentuali variabili fra l’1,6 ed il 29,4% dell’azoto inorganico applicato. Ad eccezione dei sistemi in cui i maggiori deflussi non hanno alcuna interazione con la rizosfera (deflussi profondi oppure non attraversano la Fascia Tampone, in tutti gli altri siti si registra un effetto di riduzione dell’azoto fra entrata ed uscita, con percentuali variabili fra il 33 ed il 62 %. Percentuali di abbattimento non elevate sono giustificate dallo scarso grado di maturazione dei siti monitorati, in molti casi recentemente convertiti a Fascia Tampone. Ancora una volta si conferma l’estrema eterogeneità delle risposte di questi sistemi ed il ruolo prioritario delle forzanti idrologiche nel determinarne l’efficacia.Seven buffer strips (BS adjacent to fresh water bodies, realized according to the technical data contained in the standard 5
Directory of Open Access Journals (Sweden)
Bruna Gumiero
2016-02-01
Full Text Available Sette Fasce Tampone, realizzate secondo le indicazioni tecniche contenute nello Standard di condizionalità 5.2, in diversi ambiti e contesti climatici, sono state monitorate per un periodo biennale, al fine di quantificare la loro efficienza nella rimozione di azoto inorganico disciolto. Tale azoto è costituito per lo più da molecole di azoto nitrico che vengono veicolate principalmente tramite deflussi sub-superficiali da zone soggette a diverse pratiche colturali verso i corpi idrici superficiali adiacenti. Ad eccezione di due casi: i siti di Lodi e Metaponto, in tutti i sistemi monitorati è stata confermata la presenza di deflussi trasversali ai sistemi tampone, permanenti o temporanei, in grado di veicolare inquinanti e con portate variabili fra 919 e 8.590 m3/anno per 100 m lineari di FT. Le differenze di portata sono imputabili principalmente alla diversa superficie dei bacini agricoli afferenti ai sistemi tampone, che nei casi analizzati occupano superfici variabili fra il 3,6 ed il 33,3% del bacino agricolo. Sulla base dei bilanci di massa è emerso che dai campi coltivati giungono ai sistemi tampone percentuali variabili fra l’1,6 ed il 29,4% dell’azoto inorganico applicato. Ad eccezione dei sistemi in cui i maggiori deflussi non hanno alcuna interazione con la rizosfera (deflussi profondi oppure non attraversano la Fascia Tampone, in tutti gli altri siti si registra un effetto di riduzione dell’azoto fra entrata ed uscita, con percentuali variabili fra il 33 ed il 62 %. Percentuali di abbattimento non elevate sono giustificate dallo scarso grado di maturazione dei siti monitorati, in molti casi recentemente convertiti a Fascia Tampone. Ancora una volta si conferma l’estrema eterogeneità delle risposte di questi sistemi ed il ruolo prioritario delle forzanti idrologiche nel determinarne l’efficacia. Seven buffer strips (BS adjacent to fresh water bodies, realized according to the technical data contained in the Standard 5
Directory of Open Access Journals (Sweden)
Douglas F. M. Gherardi
2004-12-01
Full Text Available A small (100,000 m² rhodolith bank located at the Arvoredo Marine Biological Reserve (Santa Catarina, Brazil has been surveyed to determine the main bank components, the community structure, and carbonate production rates. Data from five photographic transects perpendicular to Arvoredo Island shore were complemented with sediment samples and shallow cores, all collected by scuba diving. The main bank component is the unattached, nongeniculate, coralline red algae Lithophyllum sp., used as substrate by the zoanthid Zoanthus sp. Percentage cover of living and dead coralline algae, zoanthids and sediment patches account for nearly 98% of the investigated area. Classification and ordination of samples showed that differences in the proportion of live and dead thalli of Lithophyllum sp. determine the relative abundances of zoanthids. Results also indicate that similarity of samples is high and community gradients are subtle. Significant differences in percentage cover along transects are concentrated in the central portion of the bank. Low carbonate content of sediments from deeper samples suggests low rates of recruitment and dispersal of coralline algae via fragmentation. However, carbonate production of Lithophyllum sp ranging from 55-136.3 g m-2 yr-1 agrees with production rates reported for other temperate settings. In the long run, rhodolith density at Arvoredo Is. is likely to be dependent upon random dispersal of spores and/or fragments from other source areas.Investigou-se um pequeno (100,000 m² banco de rodolitos localizado na Reserva Biológica Marinha do Arvoredo (Santa Catarina, Brasil para se determinar os pricipais componentes do banco, a estrutura da comunidade e a produção de carbonato de cálcio. Dados de cobertura relativa foram obtidos ao longo de cinco transectos fotográficos perpendiculares à ilha do Arvoredo, e complementados com amostras de sedimento superficial e testemunhos rasos. O principal componente do banco é a
Directory of Open Access Journals (Sweden)
John J. GILBERT
2004-09-01
Full Text Available Diapausing, fertilized eggs in monogonont rotifers typically are formed after an environmental signal induces amictic females to produce mictic daughters. Mictic females lay haploid eggs that may develop parthenogenetically into males, or that may be fertilized and develop into diapausing, female embryos called resting eggs. Laboratory experiments demonstrate that crowding is the signal for production of mictic females in strains of Brachionus calyciflorus from Texas, Spain and Germany, and in a strain of Brachionus variabilis from Spain. In these experiments, newborn amictic females were cultured singly in large and small volumes to give lowand high-density treatments. Therefore, the induction of mictic females is due exclusively to population density and cannot be attributed to a grouping effect involving some interaction among individuals. B. variabilis is very sensitive to population density; females had to be cultured in 30 ml to prevent appreciable production of mictic daughters. Crowding is now known to be the signal for initiation of sexuality and diapause in four species of Brachionus, two species of Epiphanes, and Rhinoglena frontalis. The chemical that mediates this response somehow influences oocytes in the maternal body cavity to differentiate into mictic females. Aggregation of individuals in natural systems may facilitate the production of mictic females. In some of these rotifers, the response to crowding is suppressed in early generations from the resting egg, assuring that clonal populations will attain higher population densities before committing to sexual reproduction. Fitness benefits of the mictic-female response to crowding, and to other environmental signals in other rotifers (dietary tocopherol, long photoperiod, are discussed.
Bernoulli numbers and polynomials from a more general point of view
Energy Technology Data Exchange (ETDEWEB)
Dattoli, G. [ENEA, Centro Ricerche Frascati, Frascati, RM(Italy). Div. Fisica Applicata; Cesarano, C. [Ulm Univ., Ulm (Germany). Dept. of Mathematics; Lonzellutta, S. [ENEA, Centro Ricerche E. Clementel, Bologna (Italy). Div. Fisica Applicata
2000-07-01
In this work it is applied the method of generating function, to introduce new forms of Bernoulli numbers and polynomials, which are exploited to derive further classes of partial sums involving generalized many index many variable polynomials. Analogous considerations are developed for the Euler numbers and polynomials. [Italian] Si applica il metodo della funzione generatrice per introdurre nuove forme di numeri e polinomi di Bernoulli che vengono utilizzati per sviluppare e per calcolare somme parziali che coinvolgono polinomi a piu' indici ed a piu' variabili. Si sviluppano considerazioni analoghe per i polinomi ed i numeri di Eulero.
Psicologia comportamental e turismo: Considerações sobre a hospitalidade
Damiani, Katia; Universidade de São Paulo - USP
2008-01-01
O presente artigo teve como objetivo apontar algumas direções nas quais a psicologia comportamental poderá contribuir para o turismo, em especial sobre a questão da hospitalidade. Para introduzir o turismólogo a essa abordagem psicológica, inicialmente, as premissas básicas da análise behaviorista radical foram apresentadas sob a luz do modelo de seleção por conseqüência. Em especial, focou-se a questão da hospitalidade em dois níveis de análise: operante e cultural, para explicar a variabili...
Ares, María Guadalupe; Varni, Marcelo; Entraigas, Ilda
2012-01-01
La estimación de la erosividad de las precipitaciones a través del índice EI30 requiere contar con registros deta-llados de lluvia y su intensidad. Con el objetivo de hallar relaciones que faciliten su estimación se analizan las relaciones entre el factor EI30 y la pluviometría a escala diaria y estacional. Asimismo se estudian la variabili-dad estacional de la erosividad y los períodos de potencialidad de ocurrencia de eventos erosivos por despren-dimiento se suelo debido a la acción de la l...
Survey of Borreliae in ticks, canines, and white-tailed deer from Arkansas, U.S.A.
Directory of Open Access Journals (Sweden)
Fryxell Rebecca T
2012-07-01
Full Text Available Abstract Background In the Eastern and Upper Midwestern regions of North America, Ixodes scapularis (L. is the most abundant tick species encountered by humans and the primary vector of B. burgdorferi, whereas in the southeastern region Amblyomma americanum (Say is the most abundant tick species encountered by humans but cannot transmit B. burgdorferi. Surveys of Borreliae in ticks have been conducted in the southeastern United States and often these surveys identify B. lonestari as the primary Borrelia species, surveys have not included Arkansas ticks, canines, or white-tailed deer and B. lonestari is not considered pathogenic. The objective of this study was to identify Borrelia species within Arkansas by screening ticks (n = 2123, canines (n = 173, and white-tailed deer (n = 228 to determine the identity and locations of Borreliae endemic to Arkansas using PCR amplification of the flagellin (flaB gene. Methods Field collected ticks from canines and from hunter-killed white-tailed were identified to species and life stage. After which, ticks and their hosts were screened for the presence of Borrelia using PCR to amplify the flaB gene. A subset of the positive samples was confirmed with bidirectional sequencing. Results In total 53 (21.2% white-tailed deer, ten (6% canines, and 583 (27.5% Ixodid ticks (252 Ixodes scapularis, 161 A. americanum, 88 Rhipicephalus sanguineus, 50 Amblyomma maculatum, 19 Dermacentor variabilis, and 13 unidentified Amblyomma species produced a Borrelia flaB amplicon. Of the positive ticks, 324 (22.7% were collected from canines (151 A. americanum, 78 R. sanguineus, 43 I. scapularis, 26 A. maculatum, 18 D. variabilis, and 8 Amblyomma species and 259 (37.2% were collected from white-tailed deer (209 I. scapularis, 24 A. maculatum, 10 A. americanum, 10 R. sanguineus, 1 D. variabilis, and 5 Amblyomma species. None of the larvae were PCR positive. A majority of the flaB amplicons were homologous with B
Histological Examination of Precious Corals from the Ryukyu Archipelago
Directory of Open Access Journals (Sweden)
Masanori Nonaka
2012-01-01
Full Text Available In this paper we examined the histology of three commercially valuable species of precious corals (Paracorallium japonicum, Corallium elatius, and C. konojoi from the Ryukyu Archipelago. In order to observe their inner structure, samples were thin sectioned and examined with a digital light microscope. Colonies of C. konojoi had thicker coenenchyme and larger autozooids than those of C. elatius and P. japonicum. The sclerites of the three species tended to be concentrated in the outer layers of coenenchyme. The gastric cavities of autozooids of all three species were found to be relatively empty. Some symbiotic polychates were observed in the axis of P. japonicum. As well, a zoanthid (Corallizoanthus tsukaharai was often observed living on the coenenchyme surface of P. japonicum. It is hoped our observations will provide a good foundation of future study of Japanese Coralliidae corals.
Palytoxin isolated from marine coelenterates. The inhibitory action on (Na,K)-ATPase.
Ishida, Y; Takagi, K; Takahashi, M; Satake, N; Shibata, S
1983-07-10
Palytoxin (PTX), C129H223N3O54, a highly toxic substance isolated from zoanthids of Palythoa tuberculosa, inhibited (Na,K)-ATPase (ATP phosphohydrolase, EC 3.6.1.3) prepared from guinea pig heart and hog cerebral cortex in a dose-dependent manner at concentrations greater than 10(-8) M. In the presence of Na (100 mM) and K (20 mM), PTX showed potency nearly equal to that of ouabain. When the ATPase was activated by the various Na concentrations at a constant K concentration, both PTX and ouabain inhibited the ATPase activity noncompetitively. On the other hand, when K concentration was changed at a constant Na concentration, PTX caused a competitive inhibition in all ranges of K concentrations employed, whereas ouabain caused a competitive inhibition at low concentrations and a noncompetitive inhibition at high concentrations.
Solution Structure of Reduced Plastocyanin from the Blue-Green Alga Anabaena Variabilis
DEFF Research Database (Denmark)
Led, J.J.; Badsberg, U.; Jørgensen, A.M.
1996-01-01
from those of other plastocyanins (+1 vs -9 +/- 1 at pH greater than or equal to 7). The most striking feature of the A.v. PCu structure is the absence of the beta-turn, formed at the remote site by residues (58)-(61) in most higher plant plastocyanins. The displacement caused by the absence...... of this turn is compensated for by an extension of the small helix [from Ala53(51) to Ser60(58) in A.v. PCu] found in other plastocyanins. Moreover, the extra residues of A.v. PCu from Pro77 to Asp79 form an appended loop. These two features allow A.v. PCu to retain almost the same global fold as observed...
Cachet, Nadja; Genta-Jouve, Grégory; Ivanisevic, Julijana; Chevaldonné, Pierre; Sinniger, Frédéric; Culioli, Gérald; Pérez, Thierry; Thomas, Olivier P.
2015-01-01
Metabolomics has recently proven its usefulness as complementary tool to traditional morphological and genetic analyses for the classification of marine invertebrates. Among the metabolite-rich cnidarian order Zoantharia, Parazoanthus is a polyphyletic genus whose systematics and phylogeny remain controversial. Within this genus, one of the most studied species, Parazoanthus axinellae is prominent in rocky shallow waters of the Mediterranean Sea and the NE Atlantic Ocean. Although different morphotypes can easily be distinguished, only one species is recognized to date. Here, a metabolomic profiling approach has been used to assess the chemical diversity of two main Mediterranean morphotypes, the “slender” and “stocky” forms of P. axinellae. Targeted profiling of their major secondary metabolites revealed a significant chemical divergence between the morphotypes. While zoanthoxanthin alkaloids and ecdysteroids are abundant in both morphs, the “slender” morphotype is characterized by the presence of additional and bioactive 3,5-disubstituted hydantoin derivatives named parazoanthines. The absence of these specific compounds in the “stocky” morphotype was confirmed by spatial and temporal monitoring over an annual cycle. Moreover, specimens of the “slender” morphotype are also the only ones found as epibionts of several sponge species, particularly Cymbaxinella damicornis thus suggesting a putative ecological link. PMID:25655432
Fungal necrotizing fasciitis, an emerging infectious disease caused by Apophysomyces (Mucorales).
Chander, Jagdish; Stchigel, Alberto Miguel; Alastruey-Izquierdo, Ana; Jayant, Mayank; Bala, Kiran; Rani, Hena; Handa, Uma; Punia, Rajpal Singh; Dalal, Usha; Attri, Ashok Kumar; Monzon, Araceli; Cano-Lira, José Francisco; Guarro, Josep
2015-01-01
The mucoralean fungi are emerging causative agents of primary cutaneous infections presenting in the form of necrotizing fasciitis. The aim of this study was to investigate a series of suspected necrotizing fasciitis cases by Apophysomyces species over one-year period in a northern Indian hospital. The clinical details of those patients suspected to suffer from fungal necrotizing fasciitis were recorded. Skin biopsies from local wounds were microscopically examined and fungal culturing was carried out on standard media. The histopathology was evaluated using conventional methods and special stains. Apophysomyces isolates were identified by their morphology and by molecular sequencing of the internal transcribed spacer (ITS) region of the ribosomal genes. Antifungal susceptibility testing was carried out following EUCAST guidelines and treatment progress was monitored. Seven patients were found to be suffering from necrotizing fasciitis caused by Apophysomyces spp. Six isolates were identified as Apophysomyces variabilis and one as Apophysomyces elegans. Five patients had previously received intramuscular injections in the affected area. Three patients recovered, two died and the other two left treatment against medical advice and are presumed to have died due to their terminal illnesses. Posaconazole and terbinafine were found to be the most active compounds against A. variabilis, while the isolate of A. elegans was resistant to all antifungals tested. Apophysomyces is confirmed as an aggressive fungus able to cause fatal infections. All clinicians, microbiologists and pathologists need to be aware of these emerging mycoses as well as of the risks involved in medical practices, which may provoke serious fungal infections such as those produced by Apophysomyces. Copyright © 2013 Revista Iberoamericana de Micología. Published by Elsevier Espana. All rights reserved.
Leydet, Brian F; Liang, Fang-Ting
2013-04-01
There are 4 major human-biting tick species in the northeastern United States, which include: Amblyomma americanum, Amblyomma maculatum, Dermacentor variabilis, and Ixodes scapularis. The black bear is a large mammal that has been shown to be parasitized by all the aforementioned ticks. We investigated the bacterial infections in ticks collected from Louisiana black bears (Ursus americanus subspecies luteolus). Eighty-six ticks were collected from 17 black bears in Louisiana from June 2010 to March 2011. All 4 common human-biting tick species were represented. Each tick was subjected to polymerase chain reaction (PCR) targeting select bacterial pathogens and symbionts. Bacterial DNA was detected in 62% of ticks (n=53). Rickettsia parkeri, the causative agent of an emerging spotted fever group rickettsiosis, was identified in 66% of A. maculatum, 28% of D. variabilis, and 11% of I. scapularis. The Lyme disease bacterium, Borrelia burgdorferi, was detected in 2 I. scapularis, while one A. americanum was positive for Borrelia bissettii, a putative human pathogen. The rickettsial endosymbionts Candidatus Rickettsia andeanae, rickettsial endosymbiont of I. scapularis, and Rickettsia amblyommii were detected in their common tick hosts at 21%, 39%, and 60%, respectively. All ticks were PCR-negative for Anaplasma phagocytophilum, Ehrlichia spp., and Babesia microti. This is the first reported detection of R. parkeri in vector ticks in Louisiana; we also report the novel association of R. parkeri with I. scapularis. Detection of both R. parkeri and B. burgdorferi in their respective vectors in Louisiana demands further investigation to determine potential for human exposure to these pathogens. Copyright © 2013 Elsevier GmbH. All rights reserved.
Biogeographical note on Antarctic microflorae: Endemism and cosmopolitanism
Directory of Open Access Journals (Sweden)
Waqar Azeem Jadoon
2013-11-01
Full Text Available This study deals with the biogeography of Antarctic microflora (Antarctica acts as best model to study microbial biogeography such as cyanobacteria and selected halophiles with special emphasis on Halomonas variabilis and Bacillus licheniformis. Halophiles are known to be resistant not only to salt stress, but also to extreme temperature, pressure, and aridity and they are capable of surviving in harsh environments such as polar regions, deep-sea habitats, and deserts. Many microbes are known to be resistant to hostile environmental conditions, and are capable of surviving in harsh environments. Our group has isolated 444 strains belonging to 28 genera of halophiles from various environments around the world. The 16S rRNA gene sequences revealed that many of the isolated strains from geographically distant habitats having different environmental conditions, were closely related to each other, with some strains possessing 100% identical sequences. Organisms possessing survival mechanism such as spore formation are usually ubiquitous. The genus Halomonas is represented by potentially endemic strains and the ubiquitous H. variabilis, while spore-forming B. licheniformis showed cosmopolitan distribution. One potentially endemic (moderate endemicity that is regional and/or continental distribution strain was reported from Syowa station, East Antarctica, and Mario Zucchelli station, West Antarctica, which are geographically separated by 3000 km. Moreover, 15 strains having 100% similarity with B. licheniformis were considered cosmopolitans. The results of this work provide support for the middle-ground model that some microbes have moderate endemicity and others have cosmopolitan distribution. These results will contribute to a greater understanding of microbial biogeography with special emphasis on Antarctica.
Phycodnavirus potassium ion channel proteins question the virus molecular piracy hypothesis.
Directory of Open Access Journals (Sweden)
Kay Hamacher
Full Text Available Phycodnaviruses are large dsDNA, algal-infecting viruses that encode many genes with homologs in prokaryotes and eukaryotes. Among the viral gene products are the smallest proteins known to form functional K(+ channels. To determine if these viral K(+ channels are the product of molecular piracy from their hosts, we compared the sequences of the K(+ channel pore modules from seven phycodnaviruses to the K(+ channels from Chlorella variabilis and Ectocarpus siliculosus, whose genomes have recently been sequenced. C. variabilis is the host for two of the viruses PBCV-1 and NY-2A and E. siliculosus is the host for the virus EsV-1. Systematic phylogenetic analyses consistently indicate that the viral K(+ channels are not related to any lineage of the host channel homologs and that they are more closely related to each other than to their host homologs. A consensus sequence of the viral channels resembles a protein of unknown function from a proteobacterium. However, the bacterial protein lacks the consensus motif of all K(+ channels and it does not form a functional channel in yeast, suggesting that the viral channels did not come from a proteobacterium. Collectively, our results indicate that the viruses did not acquire their K(+ channel-encoding genes from their current algal hosts by gene transfer; thus alternative explanations are required. One possibility is that the viral genes arose from ancient organisms, which served as their hosts before the viruses developed their current host specificity. Alternatively the viral proteins could be the origin of K(+ channels in algae and perhaps even all cellular organisms.
Survey of ticks (Acari: Ixodidae) and tick-borne pathogens in North Dakota.
Russart, Nathan M; Dougherty, Michael W; Vaughan, Jefferson A
2014-09-01
Ticks were sampled at nine locations throughout North Dakota during early summer of 2010, using flagging techniques and small mammals trapping. In total, 1,762 ticks were collected from eight of the nine locations. The dominant species were Dermacentor variabilis (Say) (82%), found throughout the state, and Ixodes scapularis Say (17%), found in northeastern counties. A few nymphal and adult I. scapularis tested positive for Borrelia burgdorferi (3%) and Anaplasma phagocytophilum (8%). This is the first report of I. scapularis and associated pathogens occurring in North Dakota and provides evidence for continued westward expansion of this important vector tick species in the United States.
Quorum sensing antagonism from marine organisms
DEFF Research Database (Denmark)
Skindersø, Mette Elena; Ettinger-Epstein, P.; Rasmussen, Thomas Bovbjerg
2008-01-01
target for the control of infectious bacteria. We present the results of screening of 284 extracts of marine organisms from the Great Barrier Reef, Australia, for their inhibition of QS. Of the 284 extracts, 64 (23%) were active in a general, LuxR-derived QS screen, and of these 36 (56%) were also active...... in a specific Pseudomonas aeruginosa QS screen. Extracts of the marine sponge Luffariella variabilis proved active in both systems. The secondary metabolites manoalide, manoalide monoacetate, and secomanoalide isolated from the sponge showed strong QS inhibition of a lasB::gfp(ASV) fusion, demonstrating...... the potential for further identification of specific QS antagonists from marine organisms....
Quattro tesi sul femminismo postumano
Directory of Open Access Journals (Sweden)
Rosi Braidotti
2015-11-01
Full Text Available Questo saggio si propone di dimostrare che il femminismo non si riduce all’umanesimo, essendosi spinto fino alla critica radicale dei suoi concetti-chiave. Si indaga quindi il modo in cui le analisi femministe e postcoloniali, grazie all’impulso del poststrutturalismo, hanno messo sotto esame il modello dell’“Uomo di ragione” ed elaborato visioni alternative dell’umanità, centrate su zoe come principio guida, capaci di andare oltre il genere, senza dimenticare le variabili di sesso, razza e classe. In conclusione si spiega come tali teorie rappresentino i presupposti della filosofia femminista postumana, riassumendo in quattro tesi le sue peculiarità principali.
New records of five sponge species (Porifera) for the Black Sea.
Evcen, Alper; Çinar, Melih Ertan; Zengin, Mustafa; Süer, Serdar; Rüzgar, Melih
2016-04-13
The present study deals with five sponge species [Chalinula renieroides, Haliclona (Halichoclona) fulva, H. (Rhizoniera) rosea, Hymedesmia (Hymedesmia) pansa and Ircinia variabilis] belonging to 3 families (Chalinidae, Hymedesmiidae, and Irciniidae) found at one locality (near the opening of Kızılırmak River) on the Black Sea coast of Turkey. All these species are new records for the Black Sea. Three species (Chalinula renieroides, H. (R.) rosea and H. (H.) pansa] are also new records for the marine fauna of Turkey. All these species were previously reported from Mediterranean Sea and the eastern Atlantic Ocean. The morphological and distributional features of these species are presented.
Dicty_cDB: Contig-U08816-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( CT005263 |pid:none) Leishmania major strain Friedlin,... 59 4e-07 ( O14217 ) RecName: Full=Probable mitochondrial imp...cDN... 34 0.59 3 ( CN127549 ) RHOH1_23_D09.g3_A002 Acid- and alkaline-treated r... 38 0.65 2 ( CX584796 ) TTE00035466 Ampli...117 |pid:none) Anabaena variabilis ATCC 29413,... 53 3e-05 (Q9D4H7) RecName: Full=LON peptidase N-term... vidqfhiinldyllnhfkmhwnqlnwkliglkviielvkl*kn*ikkmkpsnimkkvf*l nqiinq*eml*ivf*mlvkkikkvkilplivnqivnqivkkkvnliqnli...54857 ) 1095462006001 Global-Ocean-Sampling_GS-31-01-01-1... 28 0.051 5 ( AC181373 ) Strongylocentrotus purp
Directory of Open Access Journals (Sweden)
Nielson Mervin W.
2014-12-01
Full Text Available The following four new species of leafhoppers are described and illustrated: Jikradia dentata n. sp. and J. trispinata n. sp. from Guatemala, J. variabilis n. sp. from Belize, and J. exilis n. sp. from Costa Rica. Jikradia basipendula Nielson and J. krameri Nielson are new records for Guatemala. Belize is a new record for the genus. A record of the first introduction of the genus in the Old World is reviewed. A revised key to the known species is provided with a review of its possible origin. A checklist of all known species is also given. Rev. Biol. Trop. 62 (4: 1375-1383. Epub 2014 December 01.
Energy Technology Data Exchange (ETDEWEB)
Kentemich, T.; Haverkamp, G.; Bothe, H. (Koeln Univ. (Germany, F.R.). Botanisches Inst.)
1990-01-01
Currently there is renewed interest in projects on solar-energy conversion by microorganisms. Among all organisms, cyanobacteria are first choice for such projects. Hydrogen production by cyanobacteria is light-dependent and catalyzed by the enzyme complex nitrogenase which concomitantly catalyzes the reduction of N{sub 2} to ammonia. The cyanobacterium Anabaena variabilis can express an alternative, vanadium-containing nitrogenase which produces more hydrogen than the conventional, molybdenum-containing enzyme. In intact cells, most of the H{sub 2} produced by nitrogenase is immediatley reutilized by the hydrogenase enzymes. Maximal hydrogen production requires the genetic blockage of H{sub 2} utilization by the hydrogenases. (orig.).
http://safer.uct.cl/index.php/safer/article/view/881/774
Directory of Open Access Journals (Sweden)
Chelladurai Stella
2015-03-01
Full Text Available The new occurrence of Three species of bivalves from Pinnidae family is recorded for the first time from Palk Bay area based on a live and dead shells collected from the Intertidal area . All the three species are under the family of Pinnidae, Pinna bicolor, Pinna deltodes and Pinna incurva . In seagrass bed of Thondi Coast, all the species of Pen shells Pinna bicolor, Pinna deltodes and Pinna incurva were embedded in muddy sand and found associated with seagrasses at inter-tidal area. It was also found buried in hard substratum associated with living zoanthids and soft coral. The collected specimens were identified as, (1 Pinna bicolor, (2 Pinna deltodes and (3 Pinna Incurva by using both morphometric and meristic characters. The paper described the taxonomic status and the description of the three species of bivalves collected from Palk Bay areas.
Shick, J M
1990-08-01
Depending on their size and morphology, anthozoan polyps and colonies may be diffusion-limited in their oxygen consumption, even under well-stirred, air-saturated conditions. This is indicated by an enhancement of oxygen consumption under steady-state hyperoxic conditions that simulate the levels of O2 produced photosynthetically by zooxanthellae in the hosts' tissues. Such hyperoxia in the tissues of zooxanthellate species negates the effect of the diffusive boundary layer, and increases the rate of oxygen consumption; thus, in many cases, the rate of respiration measured under normoxia in the dark may not be representative of the rate during the day when the zooxanthellae are photosynthesizing and when the supply of oxygen for respiration is in the tissues themselves, not from the environment. These results have implications in respirometric methodology and in calculating the rate of gross photosynthesis in energetic studies. The activity of cytochrome c oxidase is higher in aposymbiotic than in zooxanthellate specimens of the sea anemone Aiptasia pulchella, and this may indicate a compensation for the relative hypoxia in the tissues of the former, enhancing the delivery of oxygen to the mitochondria from the environment.
Hossack, Blake R.; Corn, P. Stephen; Winsor H. Lowe,; R. Kenneth Honeycutt,; Sean A. Parks,
2013-01-01
Projected increases in wildfire and other climate-driven disturbances will affect populations and communities worldwide, including host–parasite relationships. Research in temperate forests has shown that wildfire can negatively affect amphibians, but this research has occurred primarily outside of managed landscapes where interactions with human disturbances could result in additive or synergistic effects. Furthermore, parasites represent a large component of biodiversity and can affect host fitness and population dynamics, yet they are rarely included in studies of how vertebrate hosts respond to disturbance. To determine how wildfire affects amphibians and their parasites, and whether effects differ between protected and managed landscapes, we compared abundance of two amphibians and two nematodes relative to wildfire extent and severity around wetlands in neighboring protected and managed forests (Montana, USA). Population sizes of adult, male long-toed salamanders (Ambystoma macrodactylum) decreased with increased burn severity, with stronger negative effects on isolated populations and in managed forests. In contrast, breeding population sizes of Columbia spotted frogs (Rana luteiventris) increased with burn extent in both protected and managed protected forests. Path analysis showed that the effects of wildfire on the two species of nematodes were consistent with differences in their life history and transmission strategies and the responses of their hosts. Burn severity indirectly reduced abundance of soil-transmitted Cosmocercoides variabilis through reductions in salamander abundance. Burn severity also directly reduced C. variabilis abundance, possibly though changes in soil conditions. For the aquatically transmitted nematode Gyrinicola batrachiensis, the positive effect of burn extent on density of Columbia spotted frog larvae indirectly increased parasite abundance. Our results show that effects of wildfire on amphibians depend upon burn extent
Energy Technology Data Exchange (ETDEWEB)
Catoni, Francesco; Cannata, Roberto [ENEA, Centro Ricerche Casaccia, Rome (Italy). Servizio Centralizzato Informatica e Reti; Catoni, Vincenzo; Zampetti, Paolo [ENEA, Centro Ricerche Casaccia, Rome (Italy). Unita tecnico scientifica Fonti Rinnovabili e Cicli Energetici Innovativi
2005-08-15
The commutative quaternions introduced by C. Segre are similar to the Hamilton quaternions but, thanks to their commutativity, allow to introduce the functions. This property opens new ways far applications. [Italian] E noto da un teorema di Scheffers che per i sistemi ipercomplessi com-mutativi esiste il calcolo integrodifferenziale che permette di definire le loro funzioni in modo perfettamente analogo alle funzioni di variabili complesse. Questa proprieta rende questi sistemi, potenzialmente utilizzabili in nuovi campi, rispetto ai quaternioni noncommutativi di Hamilton. In questo lavoro introduciamo due di questi sistemi con le loro proprieta algebriche, le condizioni differenziali (condizioni di Cauchy-Riemann generalizzate) a cui devono soddisfare le loro funzioni e, infine, sono date le espressioni delle funzioni elementari.
Le costellazioni al binocolo Trecento oggetti celesti da riconoscere ed esplorare
Kambič, Bojan
2013-01-01
Questo libro è un tour guidato attraverso le costellazioni visibili dalle medie latitudini settentrionali. È un’opera ideale per chi si accosta per la prima volta all’osservazione del cielo, ma anche l’astrofilo esperto la troverà ricca e utile, per come è strutturata. Nella prima parte, il libro è un succinto trattatello di astronomia, di meccanica celeste, d’evoluzione stellare e di cosmologia. Nella seconda parte, vengono proposte mappe per riconoscere tutte le costellazioni visibili dai nostri cieli, e schede con informazioni particolareggiate relative alle stelle visibili a occhio nudo, oltre che ad alcune centinaia di oggetti (stelle doppie e variabili, ammassi stellari, nebulose, galassie) alla portata di un semplice binocolo 10×50.
Cnidarian Neurotoxic Peptides Affecting Central Nervous System Targets.
Lazcano-Pérez, Fernando; Hernández-Guzmán, Ulises; Sánchez-Rodríguez, Judith; Arreguín-Espinosa, Roberto
2016-01-01
Natural products from animal venoms have been used widely in the discovery of novel molecules with particular biological activities that enable their use as potential drug candidates. The phylum Cnidaria (jellyfish, sea anemones, corals zoanthids, hydrozoans, etc.) is the most ancient venomous phylum on earth. Its venoms are composed of a complex mixture of peptidic compounds with neurotoxic and cytolitic properties that have shown activity on mammalian systems despite the fact that they are naturally targeted against fish and invertebrate preys, mainly crustaceans. For this reason, cnidarian venoms are an interesting and vast source of molecules with a remarkable activity on central nervous system, targeting mainly voltage-gated ion channels, ASIC channels, and TRPV1 receptors. In this brief review, we list the amino acid sequences of most cnidarian neurotoxic peptides reported to date. Additionally, we propose the inclusion of a new type of voltage-gated sea anemone sodium channel toxins based on the most recent reports.
Spatial distribution of epibenthic molluscs on a sandstone reef in the Northeast of Brazil
Directory of Open Access Journals (Sweden)
AS. Martinez
Full Text Available The present study investigated the distribution and abundance of epibenthic molluscs and their feeding habits associated to substrate features (coverage and rugosity in a sandstone reef system in the Northeast of Brazil. Rugosity, low coral cover and high coverage of zoanthids and fleshy alga were the variables that influenced a low richness and high abundance of a few molluscan species in the reef habitat. The most abundant species were generalist carnivores, probably associated to a lesser offer and variability of resources in this type of reef system, when compared to the coral reefs. The results found in this study could reflect a normal characteristic of the molluscan community distribution in sandstone reefs, with low coral cover, or could indicate a degradation state of this habitat if it is compared to coral reefs, once that the significantly high coverage of fleshy alga has been recognized as a negative indicator of reef ecosystems health.
Palytoxins and cytoskeleton: An overview.
Louzao, M Carmen; Ares, Isabel R; Cagide, Eva; Espiña, Begoña; Vilariño, Natalia; Alfonso, Amparo; Vieytes, Mercedes R; Botana, Luis M
2011-03-01
Cytoskeleton is a dynamic structure essential for a wide variety of normal cellular processes, including the maintenance of cell shape and morphology, volume regulation, membrane dynamics and signal transduction. Cytoskeleton is organized into microtubules, actin meshwork and intermediate filaments. Actin has been identified as a major target for destruction during apoptosis and is also important under pathological conditions such as cancers. Several natural compounds actively modulate actin organization by specific signaling cascades being useful tools to study cytoskeleton dynamics. Palytoxin is a large bioactive compound, first isolated from zoanthids, with a complex structure and different analogs such as ostreocin-D or ovatoxin-a. This toxin has been identified as a potent tumor promoter and cytotoxic molecule, which leads to actin filament distortion and triggers cell death or apoptosis. In this review we report the findings on the involvement of palytoxin and analogues modulating the actin cytoskeleton within different cellular models. Copyright © 2010 Elsevier Ltd. All rights reserved.
Spatial distribution of epibenthic molluscs on a sandstone reef in the Northeast of Brazil.
Martinez, A S; Mendes, L F; Leite, T S
2012-05-01
The present study investigated the distribution and abundance of epibenthic molluscs and their feeding habits associated to substrate features (coverage and rugosity) in a sandstone reef system in the Northeast of Brazil. Rugosity, low coral cover and high coverage of zoanthids and fleshy alga were the variables that influenced a low richness and high abundance of a few molluscan species in the reef habitat. The most abundant species were generalist carnivores, probably associated to a lesser offer and variability of resources in this type of reef system, when compared to the coral reefs. The results found in this study could reflect a normal characteristic of the molluscan community distribution in sandstone reefs, with low coral cover, or could indicate a degradation state of this habitat if it is compared to coral reefs, once that the significantly high coverage of fleshy alga has been recognized as a negative indicator of reef ecosystems health.
Hajdu, Eduardo; Castello-Branco, Cristiana; Lopes, Daniela A.; Sumida, Paulo Yukio Gomes; Perez, Jose Angel Alvarez
2017-12-01
Long overlooked, sponge grounds are now recognised as important habitats which support high biodiversity. Some of these deep-sea sponge aggregations are formed by hexactinellids, in varying densities, which can occur on both soft and hard substrates. Despite their ecological importance as habitat framework building taxa, hexactinellids have been little studied and only 33 species in this Class were reported from the entire South Atlantic until now. Most of this knowledge was gained from studies conducted on the eastern South America continental slope. Here we report a new hexactinellid sponge garden found by the Shinkai 6500 manned submersible on the Rio Grande Rise, a prominent topographic feature of the deep SW Atlantic. This is the first sponge garden worldwide found to be dominated by the stiff, often dichotomously branching, Sarostegia oculata which may occur in densities of over 5 individuals per square meter. This sponge, of uncertain familial allocation, seems to always carry epibiotic zoanthids, thus mimicking the 3D skeletal framework of actual coral gardens
McAllister, Chris T; Bursey, Charles R
2016-09-01
One hundred-thirty six Mediterranean geckos, Hemidactylus turcicus, were collected between December 1986 and March 2016 in Hardin (n = 7), Harris (n = 57), and Tom Green (n = 72) counties, Texas, USA., and examined for helminth parasites. Fifty-two H. turcicus (38%) were infected with at least one helminth species. Found were a trematode, Mesocoelium meggitti, three cestodes, Mesocestoides sp. (tetrathyridia), Oochoristica ameivae and Oochoristica scelopori, and four nematodes, Cosmocercoides variabilis, Oswaldocruzia pipiens, Parapharyngodon cubensis, and larvae of Physaloptera sp. Oochoristica ameivae, O. scelopori, P. cubensis, Physaloptera sp., and Os. pipiens represent new host records for H. turcicus and M. meggitti is reported from Texas for the first time. A summary of the helminth parasites of both native and non-native H. turcicus is presented.
Paulino, Gustavo Vasconcelos Bastos; Félix, Ciro Ramon; Broetto, Leonardo; Landell, Melissa Fontes
2017-10-15
Some of the main threats to coral reefs come from human actions on marine environment, such as tourism, overfishing and pollution from urban development. While several studies have demonstrated an association between bacteria and corals, demonstrating how these communities react to different anthropogenic stressors, yeast communities associated with corals have received far less attention from researchers. The aim of this work was therefore to describe cultivable yeasts associated with three coral species and to evaluate the influence of sewage discharge on yeasts community. We obtained 130 isolates, mostly belonging to phylum Ascomycota and many of them had previously been isolated from human samples or are considered pathogens. The mycobiota was more similar among corals collected from the same reef, indicating that the composition of reef yeast community is more influenced by environmental conditions than host species. We suggest further studies to elucidate which factors are most influential on the composition of the coral-associated yeast community. Copyright © 2017 Elsevier Ltd. All rights reserved.
Solution Structure of Reduced Plastocyanin from the Blue-green Alga Anabaena Variabilis
DEFF Research Database (Denmark)
Badsberg, Ulla; Jørgensen, Anne Marie M.; Gesmar, Henrik
1996-01-01
of other plastocyanins (+1 vs -9 +/- 1 at pH > or = 7). The most striking feature of the A.v. PCu structure is the absence of the beta-turn, formed at the remote site by residues (58)-(61) in most higher plant plastocyanins. The displacement caused by the absence of this turn is compensated...
van Achterberg, Cornelis; Long, Khuat Dang
2010-01-01
contrastus sp. n., Therophilus crenulisulcatus sp. n., Therophilus depressiferus sp. n., Therophilus elongator sp. n., Therophilus levisoma sp. n., Therophilus marucae sp. n., Therophilus mellisoma sp. n., Therophilus nigrolineatus sp. n., Therophilus nuichuaensis sp. n., Therophilus parasper sp. n., Therophilus planifrons sp. n., Therophilus punctiscutum sp. n., Therophilus robustus sp. n., Therophilus rugosiferus sp. n., Therophilus scutellatus sp. n., Troticus alloflavus sp. n., Troticus giganteus sp. n., Zelodia albobasalis sp. n., Zelodia anginota sp. n., Zelodia bicoloristigma sp. n., Zelodia brevifemoralis sp. n. and Zelodia flavistigma sp. n. The following new synonyms are proposed: Euagathis nigrithorax Bhat & Gupta, 1977, Euagathis variabilis Enderlein, 1920, Euagathis variabilis var. tibialis Enderlein, 1920, Euagathis variabilis var. melanopleura Enderlein, 1920 and Euagathis variabilis var. sucarandana Enderlein, 1920 with Euagathis abbotti (Ashmead, 1900); Euagathis jinshanensis Chen & Yang, 2006 and Euagathis sharkeyi Chen & Yang, 2006, with Euagathis forticarinata (Cameron, 1899). The genus Amputostypos Sharkey, 2009, is synonymised with Coccygidium de Saussure, 1892, syn. n. The following new combinations are given: Bassus subrasa (Enderlein, 1920), comb. n., Gyragathis angulosa (Bhat & Gupta, 1977), comb. n., Lytopylus romani (Shestakov, 1940), comb. n., Therophilus annulus (Chou & Sharkey, 1989), comb. n., Therophilus asper (Chou & Sharkey, 1989), comb. n., Therophilus cingulipes (Nees, 1812), comb. n., Therophilus daanyuanensis (Chen & Yang, 2006), comb. n., Therophilus fujianicus (Chen & Yang, 2006), comb. n., Therophilus javanus (Bhat & Gupta, 1977), comb. n., Therophilus lanyuensis (Chou & Sharkey, 1989), comb. n., Therophilus luzonicus (Bhat & Gupta, 1977), comb. n., Therophilus muesebecki (Bhat & Gupta, 1977), comb. n., Therophilus rudimentarius (Enderlein, 1920), comb. n., Therophilus similis (Bhat & Gupta, 1977), comb. n., Therophilus sungkangensis
Directory of Open Access Journals (Sweden)
Ildikó Kemenes
1995-12-01
useful tool to pinpoint sites of possible significance for the purposes of conservation of existing or potential otter habitats. Riassunto Modello predittivo dell'effetto dei fattori ambientali sulla presenza della Lontra (Lutra lutra L. in Ungheria - Un'indagine sulla distribuzione della lontra (Lutra lutra L. in Ungheria ha evidenziato che la specie è comune in buona parte del paese dove l'ambiente acquatico appare adatto. C'era comunque un largo numero di habitat apparentemente in buone condizioni dove la presenza della specie non era accertata. Al contrario, alcuni siti, che sulla base di una valutazione qualitativa sarebbero stati negativi per la lontra, rivelavano segni di presenza del mustelide. L'unico fattore che limitava fortemente la presenza della specie era l'elevato inquinamento chimico delle acque, come accertato dai dati raccolti dalle autorità competenti. Quanto sopra esposto ci ha portato all'impiego di un metodo quantitativo che tenesse conto delle variabili ambientali (3 valutate secondo una scala di punteggio e 5 sulla base della loro presenza/assenza che potevano influenzare la presenza della specie. Il modello di analisi utilizzato, chiamato regressione logistica, è utile per esaminare le relazioni tra una variabile dipendente binaria e un gruppo di variabili indipendenti espresse secondo categorie. Per 369 siti esaminati in diversi corpi idrici è stata accertata la presenza (valore 1 o l'assenza (valore 0 della lontra e sono state stimate le seguenti variabili: profondità dell'acqua, pendenza delle rive, copertura vegetale riparia e la presenza o assenza di vari fattori legati alle attività produttive, quali, ad esempio, l'uso agricolo dei terreni a ridosso delle rive dei corpi idrici e la presenza visibile di inquinamento. Le prime tre variabili erano valutate secondo una scala di punteggio, le altre invece avevano valore 1 quando presenti, 0 quando assenti (v. metodi. I risultati ottenuti
Tick Haller’s Organ, a New Paradigm for Arthropod Olfaction: How Ticks Differ from Insects
Directory of Open Access Journals (Sweden)
Ann L. Carr
2017-07-01
Full Text Available Ticks are the vector of many human and animal diseases; and host detection is critical to this process. Ticks have a unique sensory structure located exclusively on the 1st pairs of legs; the fore-tarsal Haller’s organ, not found in any other animals, presumed to function like the insect antennae in chemosensation but morphologically very different. The mechanism of tick chemoreception is unknown. Utilizing next-generation sequencing and comparative transcriptomics between the 1st and 4th legs (the latter without the Haller’s organ, we characterized 1st leg specific and putative Haller’s organ specific transcripts from adult American dog ticks, Dermacentor variabilis. The analysis suggested that the Haller’s organ is involved in olfaction, not gustation. No known odorant binding proteins like those found in insects, chemosensory lipocalins or typical insect olfactory mechanisms were identified; with the transcriptomic data only supporting a possible olfactory G-protein coupled receptor (GPCR signal cascade unique to the Haller’s organ. Each component of the olfactory GPCR signal cascade was identified and characterized. The expression of GPCR, Gαo and β-arrestin transcripts identified exclusively in the 1st leg transcriptome, and putatively Haller’s organ specific, were examined in unfed and blood-fed adult female and male D. variabilis. Blood feeding to repletion in adult females down-regulated the expression of all three chemosensory transcripts in females but not in males; consistent with differences in post-feeding tick behavior between sexes and an expected reduced chemosensory function in females as they leave the host. Data are presented for the first time of the potential hormonal regulation of tick chemosensation; behavioral assays confirmed the role of the Haller’s organ in N,N-diethyl-meta-toluamide (DEET repellency but showed no role for the Haller’s organ in host attachment. Further research is needed to understand
Formoso, Andrea; Heidrich, Daiane; Felix, Ciro Ramón; Tenório, Anne Carolyne; Leite, Belize R; Pagani, Danielle M; Ortiz-Monsalve, Santiago; Ramírez-Castrillón, Mauricio; Landell, Melissa Fontes; Scroferneker, Maria L; Valente, Patricia
2015-12-01
Four strains of Hortaea werneckii were isolated from different substrates in Brazil (a salt marsh macrophyte, a bromeliad and a marine zoanthid) and had their identification confirmed by sequencing of the 26S rDNA D1/D2 domain or ITS region. Most of the strains were able to express amylase, lipase, esterase, pectinase and/or cellulase, enzymes that recognize components of plant cells as substrates, but did not express albuminase, keratinase, phospholipase and DNAse, whose substrates are animal-related. Urease production was positive for all isolates, while caseinase, gelatinase and laccase production were variable among the strains. All the strains grew in media containing up to 30% NaCl. We propose that the primary substrate associated with H. werneckii is plant-related, in special in saline environments, where the fungus may live as a saprophyte and decomposer. Infection of animal-associated substrates would be secondary, with the fungus acting as an opportunistic animal pathogen. All strains were resistant to fluconazole and presented high MIC for amphotericin B, while they were susceptible to all the other antifungal agents tested.
Quale sapere religioso nella scuola pubblica? Dall’orizzonte europeo al caso Italia
Directory of Open Access Journals (Sweden)
Flavio Pajer
2009-07-01
Full Text Available Il trattamento della materia religiosa nei curricoli scolastici si diversifica secondo una vasta gamma di variabili. Da un punto di vista epistemologico, si possono inventariare 4 modelli di sapere religioso: un insegnamento a base teologica, uno a base mista tra scienze teologiche e scienze della religione, un terzo a base di scienze religiose non teologiche, e infine un approccio al fatto religioso operato all’interno dei saperi profani. Questi modelli sono contestuali a situazioni socio-religiose in evoluzione. Il sistema educativo italiano, dipendente dal concordato, è sollecitato oggi da molti fattori extrascolastici a evolvere verso un profilo di istruzione religiosa meno legato alla tradizione confessionale e più attento al confronto con diversità religiosa, con la società della conoscenza, con la metodologia della didattica interculturale.
Prevenzione delle infezioni ospedaliere in una terapia intensiva
Directory of Open Access Journals (Sweden)
G.B. Orsi
2003-05-01
Full Text Available
Obiettivi: sorveglianza delle infezioni ospedaliere (IO nell’unità di terapia intensiva (UTI di un grande ospedale romano.
Metodi. tutti i pazienti ricoverati nell’UTI tra il 1.1.2000 ed il 31.12.2001 per ›48 ore. Lo studio, applicando le definizioni di caso dei CDC, ha considerato le seguenti infezioni: infezioni polmonari (POL, setticemie (SET, infezioni delle vie urinarie (IVU, infezioni della ferita chirurgica (IFC. Inoltre sono stati valutati eventuali fattori di rischio preesistenti, procedure invasive, isolamento dei microrganismi e loro suscettibilità agli antibiotici.
Sulla base dei risultati epidemiologici preliminari, dall’ottobre 2000 al marzo 2001 sono stati effettuati una serie di interventi che hanno modificato alcune importanti variabili associate alle IO.
Ivanova, Ekaterina
2013-04-01
The weathering of sheet silicates is well known to be related to local and global geochemical cycles. Content and composition of clay minerals in soil determine the sorption properties of the soil horizons, water-holding capacity of the soil, stickiness, plasticity, etc. Microorganisms have a diverse range of mechanisms of minerals' structure transformation (acid- and alkali formation, biosorption, complexing, etc). One of the methods is an ability of exopolysaccharide-formation, in particular the formation of mucus, common to many bacteria, including cyanobacteria. Mucous covers cyanobacteria are the specific econiches for other bacteria, including actinomycetes. The objective was to analyze the structural changes of clay minerals under the influence of the cyanobacterial-actinomycetes associative growth. The objects of the study were: 1) the experimental symbiotic association, consisting of free-living heterocyst-formative cyanobacterium Anabaena variabilis Kutz. ATCC 294132 and actinomycete Streptomyces cyaneofuscatus FR837630, 2) rock samples obtained from the Museum of the Soil Science Department of the Lomonosov Moscow State University: kaolinite, consisting of kaolin (96%) Al4 (OH) 8 [Si4O10]; mixed with hydromica, chlorite and quartz; vermiculite, consisting of vermiculite (Ca, Mg, ...)*(Mg, Fe)3(OH)2[(Si, Al)4O10]*4H2O and trioctahedral mica (biotite). The mineralogical compositions of the rocks were determined by the universal X-ray Diffractometer Carl Zeiss Yena. The operationg regime was kept constant (30 kv, 40 mA). The cultivation of the association of actinomycete S. cyanoefuscatus and cyanobacterium A. variabilis caused a reduction in the intensity of kaolinite and hydromica reflexes. However, since both (mica and kaolinite) components have a rigid structure, the significant structural transformation of the minerals was not revealed. Another pattern was observed in the experiment, where the rock sample of vermiculite was used as the mineral
Reimer, James Davis; Sinniger, Frederic
2009-01-01
琉球大学21世紀COEプログラム「サンゴ礁島嶼系の生物多様性の総合解析」平成20年度成果発表会(平成21年3月14日開催) 講演・特別講演会場:理系複号棟102号室,ポスター発表会場:琉球大学50周年記念館1F
Energy Technology Data Exchange (ETDEWEB)
Mosello, R.; Brizzio, M.C. [Consiglio Nazionale delle Ricerche, Verbania (Italy). Ist. Italiano di Idrobiologia; Garibaldi, L. [Milan Univ. La Bicocca, Milan (Italy). Dipt. di Scienze dell' Ambiente; Buzzi, P. [Azienda Sanitaria Locale, Lecco (Italy). Unita' Operativa Fisica e Tutela Ambiente; Colzani, L.; Pizzotti, E. [Azienda Sanitaria Locale, Como (Italy). Unita' Operativa Chimica; Mocellin, D. [Azienda Sanitaria Locale, Sondrio (Italy). Unita' Operativa Chimica
1999-12-01
Monthly measurements of temperature, water chemistry and phytoplankton performed from september 1997 to August 1998 in lake basins close the towns of Como and Lecco (Italy) are presented and discussed. Chemical variables show a high trophic level in both stations, more pronounced in the Como station due to unfavourable hydrological conditions and to urban and industrial sources of pollution, which show the predominance of Oscillatoria rubescens. [Italian] Il presente lavoro riporta i risultati di un'indagine condotta con campionamenti mensili dal settembre 1997 all'agosto 1998 nei bacini di Como e Lecco. Le variabili chimiche analizzate evidenziano, per entrambe le stazioni considerate, un elevato livello di trofia piu' pronunciato nella stazione di Come a causa di sfavorevoli condizioni idrologiche e per la presenza di sorgenti di inquinamento urbano e industriale, confermato dalla predominanza di Oscillatoria rubescens.
Quantitative Analysis of Neogene Foraminfera in the Central Niger Delta
International Nuclear Information System (INIS)
Ojo, A. O.; Salami, M. B.
2003-01-01
A ranking and Scaling (RASC) computer programme for zonation and normality testing of paleontological events was employed to identify assemblages of foraminifera species in the sections studied. The emphasis is on ease of zonal recognition and reliability in correlation. A four fold interval zonation of benthonic and some planktonic foraminifera were established. Two distinct temporal and four depositional environments are recognizable. A few benthonic foraminifera appear to have biostratigraphic significance. Bulumina elegans is present in the early Miocene. Cyclammina cancellata, in the middle-late Miocene, while Brizalina beyrichi and Bolivina variabilis are restricted to late Miocene in the studied samples. However, these distributions may be environmentally controlled and therefore may be tell zones. The presence and abundance of neritic fauna with lignitic materials indicate alternating shallow marine and non-marine conditions during deposition in parts of the Niger-delta
Fare astronomia con piccoli telescopi
Gainer, Michael K
2007-01-01
Non sono necessariamente richiesti strumenti mastodontici per produrre risultati scientificamente validi nel campo dell’astronomia. Anche l’astrofilo dotato di un piccolo telescopio, con un diametro di soli 8-9 cm, può contribuire alla scienza del cielo realizzando utili osservazioni del Sole, della Luna, dei pianeti, delle comete, degli asteroidi, delle stelle doppie o variabili, delle nebulose e degli ammassi stellari. Il manuale di M.K. Gainer spiega quale sia la dotazione minima (un piccolo telescopio, un computer, una semplice fotocamera digitale), come utilizzarla, e quali siano le tecniche appropriate da adottare nelle osservazioni. Offre inoltre schemi per interpretare e ridurre i dati raccolti, nonché schede da compilare e da spedire ai centri di raccolta internazionali. Questo libro è il passaporto grazie al quale l’astrofilo può entrare a pieno titolo nel mondo affascinante della scienza astronomica.
Espansione del Cinghiale (Sus scrofa e danni alle coltivazioni in un'area delle Prealpi occidentali
Directory of Open Access Journals (Sweden)
Anna Brangi
2003-10-01
dell'importanza dei danni causati dal Cinghiale: l'estensione in ettari dei danni per ogni comune, l'estensione dei danni in percentuale sulle superfici comunali e la frequenza dei danni per ogni comune. Nell'arco degli 11 anni considerati si è avuto un sensibile incremento del numero di comuni interessati dalla presenza del Cinghiale e, parallelamente, della superficie dell'areale di distribuzione. Anche la superficie totale danneggiata ogni anno, considerata come indice della consistenza della popolazione, è aumentata di oltre 25 volte dal 1986 al 1996. L'Analisi Discriminante effettuata tra i comuni in cui si sono verificati i danni e quelli in cui non si sono verificati ha individuato tre variabili importanti per la discriminazione: le percentuali di boschi misti, di pascoli e di seminativi asciutti. Di queste i pascoli sono stati la variabile con maggior contributo alla funzione discriminante che ha classificato correttamente il 78,1% dei casi complessivi. L'Analisi di Regressione Multipla della frequenza dei danni verso le variabili ambientali misurate nei comuni ha individuato 5 variabili con coefficiente parziale di regressione significativo e positivo che hanno spiegato complessivamente il 77,3% della varianza della variabile dipendente. L'analisi di tendenza, effettuata col metodo della regressione stagionale, utilizzando l'entità e la ricorrenza dei danni ha evidenziato una marcata stagionalità dei danneggiamenti e una tendenza alla stabilità dopo un primo incremento iniziale.
Elevated temperatures and bleaching on a high latitude coral reef: the 1988 Bermuda event
Cook, Clayton B.; Logan, Alan; Ward, Jack; Luckhurst, Brian; Berg, Carl J.
1990-03-01
Sea temperatures were normal in Bermuda during 1987, when Bermuda escaped the episodes of coral bleaching which were prevalent throughout the Caribbean region. Survey transecs in 1988 on 4 6 m reefs located on the rim margin and on a lagoonal patch reef revealed bleaching only of zoanthids between May and July. Transect and tow surveys in August and September revealed bleaching of several coral species; Millepora alcicornis on rim reefs was the most extensively affected. The frequency of bleaching in this species, Montastrea annularis and perhaps Diploria labyrinthiformis was significantly higher on outer reefs than on inshore reefs. This bleaching period coincided with the longest period of elevated sea temperatures in Bermuda in 38 years (28.9 30.9°C inshore, >28° offshore). By December, when temperatures had returned to normal, bleaching of seleractinians continued, but bleaching of M. alcicornis on the outer reefs was greatly reduced. Our observations suggest that corals which normally experience wide temperature ranges are less sensitive to thermal stress, and that high-latitude reef corals are sensitive to elevated temperatures which are within the normal thermal range of corals at lower latitudes.
International Nuclear Information System (INIS)
Muirhead, A.; Tyler, P.A.
1984-01-01
This report is the third in a series concerned with the biological processes of deep-sea megainvertebrates. The research programme aims to aid long term planning of nuclear waste disposal by providing information on the nature and rates of reproductive activities of deep sea invertebrates from several different phylogenetic groups. This information serves three functions:- Firstly, baseline information is provided concerning processes at or around the sediment/water interface. Secondly, knowledge of the actual mode of reproduction indicates the extent to which the biota could be involved in recycling leaked radioactive heavy metals to different areas of the environment via their reproductive processes. The third function fulfilled by this programme is to provide information on the rates at which these processes occur. Evaluation of these aspects of the life cycles of the megainvertebrates of a specific site will indicate the potential role of a large proportion of the biota inhabiting that site following leakage of dumped material. This report is concerned with the growth and modes of reproduction of a hermit crab, Parapagurus pilosimanus and the zoanthids Epizoanthus paguriphilus and E. abyssorum with which it lives at different depths of the N. Atlantic. (U.K.)
Halomonas titanicae sp. nov., a halophilic bacterium isolated from the RMS Titanic.
Sánchez-Porro, Cristina; Kaur, Bhavleen; Mann, Henrietta; Ventosa, Antonio
2010-12-01
A Gram-negative, heterotrophic, aerobic, non-endospore-forming, peritrichously flagellated and motile bacterial strain, designated BH1(T), was isolated from samples of rusticles, which are formed in part by a consortium of micro-organisms, collected from the RMS Titanic wreck site. The strain grew optimally at 30-37°C, pH 7.0-7.5 and in the presence of 2-8 % (w/v) NaCl. We carried out a polyphasic taxonomic study in order to characterize the strain in detail. Phylogenetic analyses based on 16S rRNA gene sequence comparison indicated that strain BH1(T) clustered within the branch consisting of species of Halomonas. The most closely related type strains were Halomonas neptunia (98.6 % 16S rRNA sequence similarity), Halomonas variabilis (98.4 %), Halomonas boliviensis (98.3 %) and Halomonas sulfidaeris (97.5 %). Other closely related species were Halomonas alkaliphila (96.5 % sequence similarity), Halomonas hydrothermalis (96.3 %), Halomonas gomseomensis (96.3 %), Halomonas venusta (96.3 %) and Halomonas meridiana (96.2 %). The major fatty acids of strain BH1(T) were C(18 : 1)ω7c (36.3 %), C(16 : 0) (18.4 %) and C(19 : 0) cyclo ω8c (17.9 %). The DNA G+C content was 60.0 mol% (T(m)). Ubiquinone 9 (Q-9) was the major lipoquinone. The phenotypic features, fatty acid profile and DNA G+C content further supported the placement of strain BH1(T) in the genus Halomonas. DNA-DNA hybridization values between strain BH1(T) and H. neptunia CECT 5815(T), H. variabilis DSM 3051(T), H. boliviensis DSM 15516(T) and H. sulfidaeris CECT 5817(T) were 19, 17, 30 and 29 %, respectively, supporting the differential taxonomic status of BH1(T). On the basis of the phenotypic, chemotaxonomic and phylogenetic data, strain BH1(T) is considered to represent a novel species, for which the name Halomonas titanicae sp. nov. is proposed. The type strain is BH1(T) (=ATCC BAA-1257(T) =CECT 7585(T) =JCM 16411(T) =LMG 25388(T)).
Directory of Open Access Journals (Sweden)
Vera Matarese
2014-03-01
Full Text Available Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molto problematico, quello della località, che sarebbe esploso nell’esperimento prima concettuale di Bohm e poi sperimentale di Aspect. Ciò che questo articolo vuole delineare è lo sviluppo del problema della nonlocalità, dai suoi albori fino alla prova della sua effettiva esistenza nel mondo quantistico, dove, come ben ha dimostrato Bell, nulla possono fare le variabili nascoste per dissolvere la realtà nonlocale di alcuni fenomeni.
KrÜger, Andreas
2018-02-11
A vehicle-mounted "car-net" is a rarely used technique of insect sampling. In Liberia, it was used over several consecutive months, and the first results of taxonomic analyses of Heteroptera from the by-catch are presented, namely on the mirid subfamily Isometopinae ("jumping tree bugs"). So far, no isometopine species have been known from Liberia. New records of Isometopinae in Liberia are provided including: Isometopus slateri (Akingbohungbe), Myiomma cobbeni Akingbohungbe, M. rubra Smith, and M. rubrovenata Smith. Additional new species are described, including: Isometopus bongensis sp. nov., Paloniella garmsi sp. nov., P. erinacea sp. nov., Ptisca liberiense sp. nov., Myiomma albostiolata sp. nov., M .brunnea sp. nov., M. fuscipes sp. nov., M. goellneri sp. nov. and M. variabilis sp. nov. A new genus with one included species is similarly described as follows: Bongiella nodistylis gen. nov. et sp. nov.
Lezioni di meccanica razionale con elementi di statica grafica
Sbrana, Francesco
1950-01-01
Elementi di calcolo vettoriale ; riduzione di un sistema qualunque di vettori applicati ; trattazione analitica dei sistemi di vettori applicati ; uso dei poligni funicolari per la composizione di più vettori applicati complanari ; vettori variabili ; cinematica del punto ; studio del moto di un punto in un piano in coordinate polari ; cinematica de sistemi rigidi ; moto di un sistema rigido con un punto fisso (moto rigido sferico) ; moto relativo ; sistemi di punti in general, vincoli ; concetti e postulati fondamentali della meccanica ; unità mecchaniche, omogeneità, modelli ; equilibrio di un punto e di un sistema di punti materiali ; statica dei solidi indeformabili (sistemi rigidi) ; sistemi deformabili, travature reticolari ; equilibrio dei poligoni funicolari e delle curve funicolari ; nozioni sull'attrito ; integrazione grafica ; baricentri ; momenti d'inerzia ; calcolo grafico dei momenti statici e dei momenti d'inerzia dei sistemi piani ; dinamica del punto libero ; dinamica del punto vincolato ;...
L'informazione per l'efficienza e la trasparenza del mercato immobiliare: l'esperienza italiana
Directory of Open Access Journals (Sweden)
Gianni Guerrieri
2011-12-01
Full Text Available Il tema affrontato concerne il ruolo dell’informazione economica nell’ambito dei mercati immobiliari. Si parte dai riferimenti della letteratura economica sulla teoria dell’informazione per individuare le informazioni economiche rilevanti per monitorare e analizzare il mercato immobiliare, sia dal punto di vista macroeconomico sia da quello microeconomico. In entrambi gli ambiti non è sufficiente soltanto l’informazione sul prezzo, ma su numerose altre variabili. Sull’importanza dell’informazione economica è utile l’indicatore della trasparenza dei mercati immobiliari elaborato da Jones Lang Lasalle costruito anche sulla base di una valutazione sulla qualità e quantità di informazione economica disponibile sugli oggetti scambiati sui fenomeni che caratterizzano il mercato immobiliare. Si analizza infine lo stato dell’informazione in Italia sul mercato immobiliare ed il ruolo e l’offerta informativa istituzionale resa dall’Osservatorio del mercato immobiliare dell’Agenzia del Territorio.
Bouchet, Vincent M P; Debenay, Jean-Pierre; Sauriau, Pierre-Guy; Radford-Knoery, Joël; Soletchnik, Patrick
2007-09-01
Sediment cores were collected from April to August 2004 on tidal mudflats of the macrotidal Marennes-Oléron Bay (SW France), famous for the cultivation of Pacific oysters (Crassostrea gigas). The response of living (stained) benthic foraminifera to short-term biogeochemical disturbances in the sediment and overlying water, which may be involved in oyster summer mortality, was monitored. Short-term hypoxia occurred in early June, in conjunction with a sudden rise in temperature. In mid-June, the ammonia content of sediment porewater increased, leading to potentially maximal flux towards overlying waters. Foraminiferal assemblages, particularly in the topmost layer, were altered. Ammonia tepida was the most tolerant to temperature increase and hypoxic conditions whereas Brizalina variabilis and Haynesina germanica were sensitive to organic degradation and hypoxia. Cribroelphidium gunteri was the most opportunistic during recolonisation. Benthic foraminifera showed that short-term biochemical changes in the sediment are toxic and may be involved in the summer mortality of Pacific oysters.
Seamount egg-laying grounds of the deep-water skate Bathyraja richardsoni.
Henry, L-A; Stehmann, M F W; De Clippele, L; Findlay, H S; Golding, N; Roberts, J M
2016-08-01
Highly localized concentrations of elasmobranch egg capsules of the deep-water skate Bathyraja richardsoni were discovered during the first remotely operated vehicle (ROV) survey of the Hebrides Terrace Seamount in the Rockall Trough, north-east Atlantic Ocean. Conductivity-temperature-depth profiling indicated that the eggs were bathed in a specific environmental niche of well-oxygenated waters between 4·20 and 4·55° C, and salinity 34·95-35·06, on a coarse to fine-grained sandy seabed on the seamount's eastern flank, whereas a second type of egg capsule (possibly belonging to the skate Dipturus sp.) was recorded exclusively amongst the reef-building stony coral Solenosmilia variabilis. The depths of both egg-laying habitats (1489-1580 m) provide a de facto refuge from fisheries mortality for younger life stages of these skates. © 2016 The Authors. Journal of Fish Biology published by John Wiley & Sons Ltd on behalf of The Fisheries Society of the British Isles.
Canuto, Claudio
2014-01-01
Il presente testo intende essere di supporto ad un secondo insegnamento di Analisi Matematica in quei corsi di studio (quali ad esempio Ingegneria, Informatica, Fisica) in cui lo strumento matematico parte significativa della formazione dell'allievo. I concetti e i metodi fondamentali del calcolo differenziale ed integrale in più variabili, le serie di funzioni e le equazioni differenziali ordinarie sono presentati con l'obiettivo primario di addestrare lo studente ad un loro uso operativo, ma critico. L'impostazione didattica dell'opera ricalca quella usata nel testo parallelo di Analisi Matematica I. La modalità di presentazione degli argomenti ne permette un uso flessibile e modulare. Lo stile adottato privilegia la chiarezza e la linearità dell'esposizione. Il testo organizzato su due livelli di lettura. Uno, più essenziale, permette allo studente di cogliere i concetti indispensabili della materia, di familiarizzarsi con le relative tecniche di calcolo e di trovare le giustificazioni dei principali r...
Gao, Shu-Shan; Li, Xiao-Ming; Williams, Katherine; Proksch, Peter; Ji, Nai-Yun; Wang, Bin-Gui
2016-08-26
Genome mining of the fungus Mucor irregularis (formerly known as Rhizomucor variabilis) revealed the presence of various gene clusters for secondary metabolite biosynthesis, including several terpene-based clusters. Investigation into the chemical diversity of M. irregularis QEN-189, an endophytic fungus isolated from the fresh inner tissue of the marine mangrove plant Rhizophora stylosa, resulted in the discovery of 20 structurally diverse indole-diterpenes including six new compounds, namely, rhizovarins A-F (1-6). Among them, compounds 1-3 represent the most complex members of the reported indole-diterpenes. The presence of an unusual acetal linked to a hemiketal (1) or a ketal (2 and 3) in an unprecedented 4,6,6,8,5,6,6,6,6-fused indole-diterpene ring system makes them chemically unique. Their structures and absolute configurations were elucidated by spectroscopic analysis, modified Mosher's method, and chemical calculations. Each of the isolated compounds was evaluated for antitumor activity against HL-60 and A-549 cell lines.
Omairi, Tareq; Wainwright, Milton
2015-07-01
We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark.
Goldstein, Herbert
1971-01-01
Un corso avanzato di Meccanica classica ha costituito, per lungo tempo, una parte importante del curriculum di studi per la laurea in Fisica; al giorno d'oggi però si potrebbe metterne in dubbio la funzionalità. Questo tipo di corso infatti non introduce alcun concetto fisico nuovo e non porta lo studente a contatto diretto con la problematica corrente della ricerca fisica, né lo aiuta, sostanzialmente, a risolvere i problemi pratici di Meccanica che incontra in laboratorio. Ciò nonostante, la Meccanica classica resta parte indispensabile del bagaglio culturale di un fisico. Essa gioca un duplice ruolo nel preparare lo studente allo studio della Fisica moderna. In primo luogo, la Meccanica classica, nell'una o nell'altra delle sue formulazioni più avanzate, serve come trampolino per i diversi rami della Fisica moderna. Così, la tecnica delle variabili azione-angolo risulta necessaria nella vecchia teoria dei quanti, l'equazione di Hamilton-Jacobi e il principio di minima azione forniscono la base per il...
Obando S, Tobias A; Babykin, Michael M; Zinchenko, Vladislav V
2018-05-21
The unicellular freshwater cyanobacterium Synechocystis sp. PCC 6803 is capable of using dihydroxamate xenosiderophores, either ferric schizokinen (FeSK) or a siderophore of the filamentous cyanobacterium Anabaena variabilis ATCC 29413 (SAV), as the sole source of iron in the TonB-dependent manner. The fecCDEB1-schT gene cluster encoding a siderophore transport system that is involved in the utilization of FeSK and SAV in Synechocystis sp. PCC 6803 was identified. The gene schT encodes TonB-dependent outer membrane transporter, whereas the remaining four genes encode the ABC-type transporter FecB1CDE formed by the periplasmic binding protein FecB1, the transmembrane permease proteins FecC and FecD, and the ATPase FecE. Inactivation of any of these genes resulted in the inability of cells to utilize FeSK and SAV. Our data strongly suggest that Synechocystis sp. PCC 6803 can readily internalize Fe-siderophores via the classic TonB-dependent transport system.
Le donne e lo sport dal dopoguerra a oggi
Directory of Open Access Journals (Sweden)
Eugenia Porro
2013-04-01
Full Text Available La pratica sportiva femminile nell'Italia postbellica appare per alcuni versi un oggetto misterioso, collocandosi all'interno di quelli che fino a qualche anno fa venivano considerati due sotto-universi della sociologia: la sociologia dello sport e la sociologia di genere. È dunque importante analizzare l'evoluzione della pratica sportiva al femminile tenendo conto di variabili diverse sul piano socio-culturale e facendo altresì riferimento al patrimonio statistico di cui si dispone. In questo senso, per una più corretta analisi del fenomeno, si è scelto di differenziare il sistema della prestazione assoluta da quello della prestazione relativa. In tal modo, vengono poste in luce le dinamiche che interessano le politiche di genere, come la rivendicazione di diritti o di riforme sociali che diano impulso alla diffusione della pratica femminile. Insieme, si concentra l’analisi su fenomeni particolarmente rilevanti per il settore sportivo in generale quali la mediatizzazione e la politicizzazione.
Montemurro, Francesco Paolo
2012-01-01
L’attività fisica produce effetti benefici a livello mentale (Biddle et al.,2004) e sembra agire sull’emozione modificando attitudini e motivazioni verso la pratica motoria (Digelidis et al., 2003) a partire da sensazioni come il piacere o la noia del fare (Spray et al., 1999). Da questi presupposti il progetto che comprendeva l’analisi di due studi volti a verificare gli effetti dell’attività motoria e sportiva in ambito scolastico, sui comportamenti di adattamento sociale e self efficac...
Withers, N W; Kokke, W C; Fenical, W; Djerassi, C
1982-06-01
QUANTITATIVE STEROL COMPOSITIONS OF CULTURED ZOOXANTHELLAE ISOLATED FROM VARIOUS PACIFIC AND ATLANTIC INVERTEBRATE HOSTS: Zoanthus sociatus (a zoanthid), Oculina diffusa (a scleractian coral), Tridacna gigas (a giant clam), Melibe pilosa (a nudibranch), and Aiptasia pulchella (a sea anemone) are reported. The results clearly demonstrate large differences in sterol patterns of zooxanthellae and that there is no obvious relationship between the taxonomic affiliation of the host and the sterol pattern of its isolated symbiont. The sterols of the zooxanthellae of O. diffusa (Cnidaria) and T. gigas (Mollusca) are qualitatively equivalent. Based on the structures of the two major free sterols synthesized by each alga, the zooxanthellae from different hosts were separated into three distinct groups. It was also found that an aposymbiotic alga can synthesize the unique marine sterols gorgosterol and 23-desmethylgorgosterol. Most of the sterols were identified by using mass spectroscopy and 360-MHz proton magnetic resonance. Spectroscopic data are reported for four novel sterols-(23,24R)-dimethyl-5alpha-cholest-(22E)-en-3beta-o l, 23-methyl-5alpha-cholest-22E-en-3beta-ol, cholesta-5,14-dien-3beta-ol, and 4alpha-methyl-5alpha-cholesta-8(14)-24-dien-3beta-ol.
Severity of the 1998 and 2005 bleaching events in Venezuela, southern Caribbean.
Rodríguez, Sebastián; Cróquer, Aldo; Bone, David; Bastidas, Carolina
2010-10-01
This study describes the severity of the 2005 bleaching event at 15 reef sites across Venezuela and compares the 1998 and 2005 bleaching events at one of them. During August and September 2005, bleached corals were first observed on oceanic reefs rather than coastal reefs, affecting 1 to 4% of coral colonies in the community (3 reef sites, n = 736 colonies). At that time, however, no bleached corals were recorded along the eastern coast of Venezuela, an area of seasonal upwelling (3 reefs, n = 181 colonies). On coastal reefs, bleaching started in October but highest levels were reached in November 2005 and January 2006, when 16% of corals were affected among a wide range of taxa (e.g. scleractinians, octocorals, Millepora and zoanthids). In the Acropora habitats of Los Roques (an oceanic reef),no bleached was recorded in 2005 (four sites,n = 643 colonies). At Cayo Sombrero, a coastal reef site, bleaching was less severe in 1998 than in 2005 (9% of the coral colonies involving 2 species vs. 26% involving 23 species, respectively). Our results indicate that bleaching was more severe in 2005 than in 1998 on Venezuelan reefs; however, no mass mortality was observed in either of these two events.
Mechanism of palytoxin-induced [3H]norepinephrine release from a rat pheochromocytoma cell line
International Nuclear Information System (INIS)
Tatsumi, M.; Takahashi, M.; Ohizumi, Y.
1984-01-01
Palytoxin, isolated from the zoanthid Palytoha species, is one of the most potent marine toxins. Palytoxin caused a release of [ 3 H]norepinephrine from clonal rat pheochromocytoma cells in a concentration-dependent manner. This releasing action of palytoxin was markedly inhibited or abolished by Co 2+ or Ca 2+ -free medium, but was not modified by tetrodotoxin. The release of [ 3 H]norepinephrine induced by a low concentration of palytoxin was abolished in sodium-free medium and increased as the external Na+ concentrations were increased, but the release induced by a high concentration was unaffected by varying the concentration of external Na + . The release of [ 3 H]norepinephrine induced by both concentrations of palytoxin increased with increasing Ca 2+ concentrations. Palytoxin caused a concentration-dependent increase in 22 Na and 45 Ca influxes into pheochromocytoma cells. The palytoxin-induced 45 Ca influx was markedly inhibited by Co 2+ , whereas the palytoxin-induced 22 Na influx was not affected by tetrodotoxin. These results suggest that in pheochromocytoma cells the [ 3 H]norepinephrine release induced by lower concentrations of palytoxin is primarily brought about by increasing tetrodotoxin-insensitive Na + permeability across the cell membrane, whereas that induced by higher concentrations is mainly caused by a direct increase in Ca 2+ influx into them
The effect of palytoxin on neuromuscular junctions in the anococcygeus muscle of the rat.
Amir, I; Harris, J B; Zar, M A
1997-06-01
Palytoxin, a highly toxic natural product isolated from zoanthids of the genus Palythoa, is accumulated by a wide range of fishes and marine invertebrates used as food in the Indo-Pacific. It is responsible for many incidents of human morbidity and mortality. The toxin is a potent smooth muscle spasmogen. The cause of the contraction of smooth muscle is unclear, but recent work strongly suggests that it is primarily initiated by the release of neurotransmitters from the motor innervation of the smooth muscle. We show here that palytoxin caused the swelling of the muscle cells and some internal organelles of the anococcygeus muscle of the rat, but no substantial structural damage to the tissue. Axons and Schwann cells were also swollen but the most dramatic feature was the depletion of synaptic vesicles from putative release sites in the axons. Some axons were physically damaged following exposure to the toxin, but this was relatively uncommon (< 10% of all axons studied). In the majority of axons there was no damage to nerve terminal membranes, but there was damage to mitochondria. The depletion of vesicles involved all types-clear, dense-cored, large and small. Our observations and pharmacological data gathered elsewhere, provide a neuropathological basis for the spasmogenic activity of palytoxin.
[Family with fever after cleaning a sea aquarium].
Snoeks, Lobke; Veenstra, Jan
2012-01-01
Improved aquarium techniques are enabling sea aquariums to imitate reality even better. This means that they sometimes contain known and unknown marine toxins. Aquarium keepers and their families may then develop potentially severe poisoning. A 37-year-old man presented at the Emergency Department with fever, hypotension and symptoms of a metallic taste in the mouth, nausea, headache, shivering and severe muscle cramps. Symptoms appeared after he had tried to remove a colony of Zoanthids (soft corals) from his aquarium by pouring boiling water over them. His wife (35-year-old) and two children (10-year-old twins) had also inhaled the offensive-smelling steam coming from the aquarium and had similar symptoms. On physical examination, all family members had low blood pressure and fever > 38.5 degrees Celsius. Blood analysis showed leucocytosis and an elevated CRP. We diagnosed palytoxin poisoning. All family members recovered within 48 hours after receiving supportive therapy only. Manipulation of certain soft corals found in sea aquariums can cause emission of palytoxin. This may cause a potentially severe episode of poisoning. When working in a sea aquarium protective measures should be taken. There is no specific therapy for or antidote to palytoxin poisoning and for this reason, treatment is supportive.
Chadwick, Nanette E
1987-08-01
Corallimorpharians are sessile cnidarians that are morphologically similar to the actiniarian sea anemones and scleractinian corals. This study describes for the first time the behavioral mechanism and effects of aggression by a corallimorpharian. Polyps of the temperate clonal corallimorpharian Corynactis californica extruded their mesenteries and associated filaments onto members of certain species of sea anemones and corals. They did not exhibit this behavior intraspecifically, and members of different clones of C. californica remained expanded upon contact. In contrast, members of four species of corals and zoanthids responded to contact with C. californica by contracting their tentacles, and members of three sea anemone species bent or moved away, detached from the substrate, or attacked using their aggressive structures. When interspecific contact was prolonged, individuals of C. californica extruded filaments onto, and killed polyps of, the sea anemones Anthopleura elegantissima and Metridium senile within 3 weeks, and the corals Astrangia lajollaensis and Balanophyllia elegans within 4-10 months under laboratory conditions. The use of extruded mesenterial filaments by C. californica to attack members of other anthozoan species is similar to the aggressive behavior exhibited by many scleractinian reef corals. Field observations suggest that C. californica may use this agonistic behavior during interspecific competition for space on hard marine substrate.
Palytoxin: exploiting a novel skin tumor promoter to explore signal transduction and carcinogenesis.
Wattenberg, Elizabeth V
2007-01-01
Palytoxin is a novel skin tumor promoter, which has been used to help probe the role of different types of signaling mechanisms in carcinogenesis. The multistage mouse skin model indicates that tumor promotion is an early, prolonged, and reversible phase of carcinogenesis. Understanding the molecular mechanisms underlying tumor promotion is therefore important for developing strategies to prevent and treat cancer. Naturally occurring tumor promoters that bind to specific cellular receptors have proven to be useful tools for investigating important biochemical events in multistage carcinogenesis. For example, the identification of protein kinase C as the receptor for the prototypical skin tumor promoter 12-O-tetradecanoylphorbol-13-acetate (TPA) (also called phorbol 12-myristate 13-acetate, PMA) provided key evidence that tumor promotion involves the aberrant modulation of signaling cascades that govern cell fate and function. The subsequent discovery that palytoxin, a marine toxin isolated from zoanthids (genus Palythoa), is a potent skin tumor promoter yet does not activate protein kinase C indicated that investigating palytoxin action could help reveal new aspects of tumor promotion. Interestingly, the putative receptor for palytoxin is the Na(+),K(+)-ATPase. This review focuses on palytoxin-stimulated signaling and how palytoxin has been used to investigate alternate biochemical mechanisms by which important targets in carcinogenesis can be modulated.
Plastid and mitochondrion genomic sequences from Arctic Chlorella sp. ArM0029B
2014-01-01
Background Chorella is the representative taxon of Chlorellales in Trebouxiophyceae, and its chloroplast (cp) genomic information has been thought to depend only on studies concerning Chlorella vulgaris and GenBank information of C. variablis. Mitochondrial (mt) genomic information regarding Chlorella is currently unavailable. To elucidate the evolution of organelle genomes and genetic information of Chlorella, we have sequenced and characterized the cp and mt genomes of Arctic Chlorella sp. ArM0029B. Results The 119,989-bp cp genome lacking inverted repeats and 65,049-bp mt genome were sequenced. The ArM0029B cp genome contains 114 conserved genes, including 32 tRNA genes, 3 rRNA genes, and 79 genes encoding proteins. Chlorella cp genomes are highly rearranged except for a Chlorella-specific six-gene cluster, and the ArM0029B plastid resembles that of Chlorella variabilis except for a 15-kb gene cluster inversion. In the mt genome, 62 conserved genes, including 27 tRNA genes, 3 rRNA genes, and 32 genes encoding proteins were determined. The mt genome of ArM0029B is similar to that of the non-photosynthetic species Prototheca and Heicosporidium. The ArM0029B mt genome contains a group I intron, with an ORF containing two LAGLIDADG motifs, in cox1. The intronic ORF is shared by C. vulgaris and Prototheca. The phylogeny of the plastid genome reveals that ArM0029B showed a close relationship of Chlorella to Parachlorella and Oocystis within Chlorellales. The distribution of the cox1 intron at 721 support membership in the order Chlorellales. Mitochondrial phylogenomic analyses, however, indicated that ArM0029B shows a greater affinity to MX-AZ01 and Coccomyxa than to the Helicosporidium-Prototheca clade, although the detailed phylogenetic relationships among the three taxa remain to be resolved. Conclusions The plastid genome of ArM0029B is similar to that of C. variabilis. The mt sequence of ArM0029B is the first genome to be reported for Chlorella. Chloroplast
Directory of Open Access Journals (Sweden)
Eugenia López- López
1999-12-01
Full Text Available Se estudiaron las comunidades planctónicas y los factores ambientales del embalse Ignacio Allende de julio de 1990 a junio de 1991. Se presentó una proliferación de cianofíceas en el verano coincidente con el mayor nivel de agua, seguido por la dominacia de bacilariofíceas en los meses fríos, en primavera con el incremento en la temperatura las cloroficeas alcanzaron sus mayores densidades. Las dinofíceas y euglenofíceas presentaron la menor riqueza específica. La proliferación de Anabaena variabilis en el verano y la alta frecuencia de Ceratium hirundinella, Aulacosseira granulata y Fragilaria crotonensis se asocian con cuerpos de agua tropicales eutróficos. Se encontraron 39 taxones zooplanctónicos, de los cuales Diaphanosoma birgei, Bosmina longirostris, Daphnia parvula, Diaptomus (Mastigodiaptomus montezumae, Acanthocyclops vernalis, Keratella cochlearis, Polyarthra vulgaris y Asplanchna priodonta, fueron persistentes en todo el ciclo. Un análisis de correspondencias canónicas mostró las relaciones que guardan los cambios en composición del zooplancton con las características físicas y químicas del embalse.The plankton communities and environmental factors of the Ignacio Allende reservoir were surveyed from July 1990 to June 1991. A total of 57 phytoplankton species were identified. There was a blue green algae bloom in the summer, simultaneously with highest water levels, followed by the dominance of diatoms in the coldest months (February and March. Chlorophyceans became dominant in the spring, consonant with highest temperature records. Bacillariophyceans and cyanophyceans had the greater species richness, while dinophyceans and euglenophyceans had the lowest values. The summer bloom of Anabaena variabilis and the abundance of Ceratium hirundinella, Aulacosseira granulata and Fragilaria crotonensis are associated with tropical eutrophic waters. The zooplankton was composed by 39 species, from these, Diaphanosoma birgei
Omairi, Tareq; Wainwright, Milton
2015-07-01
We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark. Copyright © 2015 The Committee on Space Research (COSPAR). Published by Elsevier Ltd. All rights reserved.
Zagata, Patrycja; Greczek-Stachura, Magdalena; Tarcz, Sebastian; Rautian, Maria
2016-01-01
Paramecium bursaria (Ehrenberg 1831), a freshwater ciliate, typically harbors hundreds of green algal symbionts inside the cell. The aim of present study was the molecular identification of newly analyzed P. bursaria symbionts. The second aspect of the present survey was testing a hypothesis whether endosymbionts prefer the specified syngen of the host, and the specified geographical distribution. Ten strains of endosymbionts isolated from strains of P. bursaria originating from different geographical locations were studied. We analyzed for the first time, both the fragment of plastid genome containing 3'rpl36-5' infA genes and a fragment of a nuclear gene encoding large subunit ribosomal RNA (LSU rDNA). The analysis of the LSU rDNA sequences showed the existence of 3 haplotypes and the haplotype diversity of 0.733, and 8 haplotypes for the 3'rpl36-5' infA gene fragment and haplotype diversity of 0.956. The endosymbionts isolated from P. bursaria strains were identified as Chlorella vulgaris, Ch. variabilis and Micractinium conductrix. There was no correlation between the syngen of P. bursaria and the species of endosymbiont.
[La diagnosi del disturbo da uso di alcol dal punto di vista psicologico].
Coriale, Giovanna; Fiorentino, Daniela; Porrari, Raffaella; Battagliese, Gemma; Capriglione, Ida; Cereatti, Federica; Iannuzzi, Silvia; Mauri, Benilde; Galli, Domenica; Fiore, Marco; Attilia, Maria Luisa; Ceccanti, Mauro
2018-01-01
RIASSUNTO. Il disturbo da uso di alcol (DUA) è uno dei disturbi psichiatrici più comuni nella popolazione generale. Il DUA è caratterizzato da un pattern di bere eccessivo, che si mantiene nonostante gli effetti negativi che l'alcol ha sul funzionamento lavorativo, sulla salute, sulle problematiche legali, sull'educazione e sulla vita sociale. Attualmente, il modello bio-psico-sociale è quello che spiega meglio il DUA. Infatti, molte ricerche hanno fornito evidenze su come il DUA sia una patologia multidimensionale. Variabili biologiche, psicologiche e socio-culturali entrano in gioco nell'eziologia, nella natura, nel mantenimento e nel cambiamento nel tempo del disturbo. La fase diagnostica è un momento importante del processo di cura, perché il successo del trattamento dipende in larga misura dall'esattezza e dall'adeguatezza della diagnosi. La diagnosi clinica si basa su una valutazione globale del funzionamento del paziente e utilizza il colloquio e gli strumenti psicometrici come mezzo di raccolta di informazioni. Questo articolo fornirà una panoramica delle dimensioni psicologiche più importanti da valutare e sui migliori strumenti psicometrici da usare per una diagnosi adeguata.
Cloud, P.; Moorman, M.; Pierce, D.
1975-01-01
Electron microscopical studies of a morphologically diverse, coccoid, presumably late Proterozoic blue-green alga are here reported. They show, together with light microscopy, that the form studied is widespread in the Cordilleran geosyncline, extend the record of well-defined endosporangia perhaps 700 million years into the past, and reveal previously unrecorded ultrastructural details. Coming from northeastern Utah, southwestern Alberta, and east central Alaska, these minute fossils belong to the recently described, morphologically diverse taxon Sphaerocongregus variabilis Moorman, are related to living entophysalidaceans, and have affinities with both the chroococcalean and chamaesiphonalean cyanophytes. Included in the morphological modes displayed by this alga are individual unicells, coenobial clusters of unicells, and a range of endosporangia comparable to those described for living entophysalidaceans. Scanning and transmission electron microscopy reveal that the endospores are commonly embedded in a vesicular matrix, that some of them show what appears to be a bilaminate or perhaps locally multilaminate wall structure, and that some remain together to mature as coenobial clones or 'colonies'. Taxonomic classification and phylogeny are discussed.
Etienne, Kizee A; Gillece, John; Hilsabeck, Remy; Schupp, Jim M; Colman, Rebecca; Lockhart, Shawn R; Gade, Lalitha; Thompson, Elizabeth H; Sutton, Deanna A; Neblett-Fanfair, Robyn; Park, Benjamin J; Turabelidze, George; Keim, Paul; Brandt, Mary E; Deak, Eszter; Engelthaler, David M
2012-01-01
Case reports of Apophysomyces spp. in immunocompetent hosts have been a result of traumatic deep implantation of Apophysomyces spp. spore-contaminated soil or debris. On May 22, 2011 a tornado occurred in Joplin, MO, leaving 13 tornado victims with Apophysomyces trapeziformis infections as a result of lacerations from airborne material. We used whole genome sequence typing (WGST) for high-resolution phylogenetic SNP analysis of 17 outbreak Apophysomyces isolates and five additional temporally and spatially diverse Apophysomyces control isolates (three A. trapeziformis and two A. variabilis isolates). Whole genome SNP phylogenetic analysis revealed three clusters of genotypically related or identical A. trapeziformis isolates and multiple distinct isolates among the Joplin group; this indicated multiple genotypes from a single or multiple sources. Though no linkage between genotype and location of exposure was observed, WGST analysis determined that the Joplin isolates were more closely related to each other than to the control isolates, suggesting local population structure. Additionally, species delineation based on WGST demonstrated the need to reassess currently accepted taxonomic classifications of phylogenetic species within the genus Apophysomyces.
Exploring vocabulary-related epistemological beliefs with Q-methodology
Directory of Open Access Journals (Sweden)
James Rock
2014-06-01
Full Text Available Negli ultimi decenni parecchie ricerche si sono concentrate sulla comprensione delle motivazioni che rendono conto dell’adozione di determinate strategie per l’apprendimento di vocaboli da parte di alcuni studenti e non di altri. Ciò ha comportato il prendere in esame numerose variabili, comprese tra le altre l’attitudine dello studente allo studio delle lingue, la motivazione, il ruolo dell’insegnante, e la convinzione di essere autoefficaci. In questo articolo si è dato rilievo all’esplorazione delle credenze epistemologiche riguardanti l’apprendimento di vocaboli, in un tentativo di comprendere quali credenze epistemologiche sono state più o meno favorite da 40 studenti universitari italiani di inglese come lingua straniera. Utilizzando una tecnica nota come metodologia Q, l’indagine ha rivelato che, sebbene i partecipanti condividano molte credenze epistemologiche riguardanti l’apprendimento di vocaboli, ci sono anche alcune importanti differenze tra di loro. Queste in particolare si riferiscono a come gli studenti sono dipendenti da una fonte esterna di conoscenza e alle loro opinioni sulla certezza della conoscenza.
Improvement of selective removal of heavy metals in cyanobacteria by NaOH treatment.
Nagase, Hiroyasu; Inthorn, Duangrat; Oda, Aiko; Nishimura, Jun; Kajiwara, Yumiko; Park, Myong-Oku; Hirata, Kazumasa; Miyamoto, Kazuhisa
2005-04-01
In the freshwater cyanobacterium, Tolypothrix tenuis, treatment with 0.1 M NaOH increased its Cd-selective adsorption ability in the presence of Ca(2+) or Mg(2+). The selective adsorption was also achieved by other alkaline treatments. Energy-distributed spectroscopy analysis revealed that Cd(2+) was found mainly on the surface of non-treated cells, whereas it was distributed throughout the cell after NaOH treatment. The alkaline treatment was effective in increasing the selective adsorption ability of the cyanobacterium for other bivalent heavy metals such as Cu(2+), Pb(2+) and Zn(2+). The treatment was also applicable to Anabaena variabilis and Microcystis aeruginosa, which are typical cyanobacteria causing algal blooms. The main binding site of Cd(2+) in NaOH-treated cells is assumed to be the carboxyl groups because the binding ability of the cells was diminished by the esterification of carboxyl groups. These results suggest that alkaline treatment of cyanobacteria is a useful technique for producing biosorbents having highly specific binding abilities for heavy metals.
Energy Technology Data Exchange (ETDEWEB)
Schulze, E.
1986-04-15
For an investigation of algae sinking characteristics in natural bodies of water, three different species (Chlorella fusca, Scenedesmus quadricauda, Nostoc variabilis) were labelled with neutron-activable elements. The rare earths Dy, Er, and Eu were preferred for their rare natural occurrence and favourable activation analysis characteristics. Growth and enrichment were monitored using a method of chlorophyll fluorescence measurement which enables measurements of the chlorophyll concentration and photosynthetic activity. After sampling, the suspensions were filtered and activated with thermal neutrons in a research reactor. The indicator masses were determined by a quantitative evaluation of the ..gamma.. spectra. In parallel to these investigation, labelling with fluorescent dyes was investigated. The transport characteristics of phosphate-carrying aggregates of the coarse clay fraction, glasses containing Dy, Eu and Er were prepared and fractionated in a centrifugal ball mill to obtain an earth with near-natural grain size distribution. The applicability of the labelling and detection methods developed for the dissertation was tested in a natural environment. Limits of application and costs were assessed.
Portugal, Cauré; Pinto, Luís; Ribeiro, Miguel; Tenorio, Carmen; Igrejas, Gilberto; Ruiz-Larrea, Fernanda
2015-10-01
Wine microbiota is complex and includes a wide diversity of yeast species. Few of them are able to survive under the restrictive conditions of dry red wines. In our study we detected and identified seven yeast species of the order Saccharomycetales that can be considered potential spoilers of wines due to physiological traits such as acidogenic metabolism and off-odor generation: Arthroascus schoenii, Candida ishiwadae, Meyerozyma guilliermondii, Pichia holstii, Pichia manshurica, Trigonopsis cantarellii, and Trigonopsis variabilis. Based on the prevalence of T. cantarellii isolates in the wine samples of our study, we further characterized this species, determined molecular and phenotypic features, and performed a proteomic analysis to identify differentially expressed proteins at mid-exponential growth phase in the presence of ethanol in the culture broth. This yeast species is shown to be able to grow in the presence of ethanol by expressing heat shock proteins (Hsp70, Hsp71) and a DNA damage-related protein (Rad24), and to be able to confer spoilage characteristics on wine. Copyright © 2015 Elsevier B.V. All rights reserved.
Severity of the 1998 and 2005 bleaching events in Venezuela, southern Caribbean
Directory of Open Access Journals (Sweden)
Sebastián Rodríguez
2010-10-01
Full Text Available This study describes the severity of the 2005 bleaching event at 15 reef sites across Venezuela and compares the 1998 and 2005 bleaching events at one of them. During August and September 2005, bleached corals were first observed on oceanic reefs rather than coastal reefs, affecting 1 to 4% of coral colonies in the community (3 reef sites, n=736 colonies. At that time, however, no bleached corals were recorded along the eastern coast of Venezuela, an area of seasonal upwelling (3 reefs, n=181 colonies. On coastal reefs, bleaching started in October but highest levels were reached in November 2005 and January 2006, when 16% of corals were affected among a wide range of taxa (e.g. scleractinians, octocorals, Millepora and zoanthids. In the Acropora habitats of Los Roques (an oceanic reef, no bleached was recorded in 2005 (four sites, n=643 colonies. At Cayo Sombrero, a coastal reef site, bleaching was less severe in 1998 than in 2005 (9% of the coral colonies involving 2 species vs. 26% involving 23 species, respectively. Our results indicate that bleaching was more severe in 2005 than in 1998 on Venezuelan reefs; however, no mass mortality was observed in either of these two events. Rev. Biol. Trop. 58 (Suppl. 3: 189-196. Epub 2010 October 01.
First Identification of Palytoxin-Like Molecules in the Atlantic Coral Species Palythoa canariensis.
Fraga, María; Vilariño, Natalia; Louzao, M Carmen; Molina, Lucía; López, Yanira; Poli, Mark; Botana, Luis M
2017-07-18
Palytoxin (PLTX) is a complex marine toxin produced by Zoanthids (Palyhtoa), dinoflagellates (Ostreopsis), and cyanobacteria (Trichodesmium). Contact with PLTX-like compounds present in aerosols or marine organisms has been associated with adverse effects on humans. The worldwide distribution of producer species and seafood contaminated with PLTX-like molecules illustrates the global threat to human health. The identification of species capable of palytoxin production is critical for human safety. We studied the presence of PLTX analogues in Palythoa canariensis, a coral species collected in the Atlantic Ocean never described as a PLTX-producer before. Two methodologies were used for the detection of these toxins: a microsphere-based immunoassay that offered an estimation of the content of PLTX-like molecules in a Palythoa canariensis extract and an ultrahigh-pressure liquid chromatography coupled to an ion trap with a time-of-flight mass spectrometer (UPLC-IT-TOF-MS) that allowed the characterization of the toxin profile. The results demonstrated the presence of PLTX, hydroxy-PLTX and, at least, two additional compounds with PLTX-like profile in the Palythoa canariensis sample. The PLTX content was estimated in 0.27 mg/g of lyophilized coral using UPLC-IT-TOF-MS. Therefore, this work demonstrates that Palythoa canariensis produces a mixture of PLTX-like molecules. This is of special relevance to safeguard human health considering Palythoa species are commonly used for decoration by aquarium hobbyists.
Marine toxins and the cytoskeleton: a new view of palytoxin toxicity.
Louzao, M Carmen; Ares, Isabel R; Cagide, Eva
2008-12-01
Palytoxin is a marine toxin first isolated from zoanthids (genus Palythoa), even though dinoflagellates of the genus Ostreopsis are the most probable origin of the toxin. Ostreopsis has a wide distribution in tropical and subtropical areas, but recently these dinoflagellates have also started to appear in the Mediterranean Sea. Two of the most remarkable properties of palytoxin are the large and complex structure (with different analogs, such as ostreocin-D or ovatoxin-a) and the extreme acute animal toxicity. The Na(+)/K(+)-ATPase has been proposed as receptor for palytoxin. The marine toxin is known to act on the Na(+) pump and elicit an increase in Na(+) permeability, which leads to depolarization and a secondary Ca(2+) influx, interfering with some functions of cells. Studies on the cellular cytoskeleton have revealed that the signaling cascade triggered by palytoxin leads to actin filament system distortion. The activity of palytoxin on the actin cytoskeleton is only partially associated with the cytosolic Ca(2+) changes; therefore, this ion represents an important factor in altering this structure, but it is not the only cause. The goal of the present minireview is to compile the findings reported to date about: (a) how palytoxin and analogs are able to modify the actin cytoskeleton within different cellular models; and (b) what signaling mechanisms could be involved in the modulation of cytoskeletal dynamics by palytoxin.
Holm, Johanna B; Heidelberg, Karla B
2016-01-01
Octocorals are sources of novel but understudied microbial diversity. Conversely, scleractinian or reef-building coral microbiomes have been heavily examined in light of the threats of climate change. Muricea californica and Muricea fruticosa are two co-occurring species of gorgonian octocoral abundantly found in the kelp forests of southern California, and thus provide an excellent basis to determine if octocoral microbiomes are host specific. Using Illumina MiSeq amplicon sequencing and replicate samples, we evaluated the microbiomes collected from multiple colonies of both species of Muricea to measure both inter- and intra-colony microbiome variabilities. In addition, microbiomes from overlying sea water and nearby zoanthids (another benthic invertebrate) were also included in the analysis to evaluate whether bacterial taxa specifically associate with octocorals. This is also the first report of microbiomes from these species of Muricea. We show that microbiomes isolated from each sample type are distinct, and specifically, that octocoral species type had the greatest effect on predicting the composition of the Muricea microbiome. Bacterial taxa contributing to compositional differences include distinct strains of Mycoplasma associated with either M. californica or M. fruticosa, an abundance of Spirochaetes observed on M. californica, and a greater diversity of γ-Proteobacteria associated with M. fruticosa. Many of the bacterial taxa contributing to these differences are known for their presence in photosymbiont-containing invertebrate microbiomes.
Da Silva, M; Passarini, M R Z; Bonugli, R C; Sette, L D
2008-12-01
Marine-derived fungi represent a valuable source of structurally novel and biologically active metabolites of industrial interest. They also have drawn attention for their capacity to degrade several pollutants, including textile dyes, organochlorides and polycyclic aromatic hydrocarbons (PAHs), among others. The fungal tolerance to higher concentrations of salt might be considered an advantage for bioremediation processes in the marine environment. Therefore, filamentous fungi were isolated from cnidarians (scleractinian coral and zoanthids) collected from the north coast of São Paulo State, Brazil. A total of 144 filamentous fungi were morphologically and molecularly characterised. Among them there were several species of Penicillium and Aspergillus, in addition to Cladosporium spp., Eutypella sp., Fusarium spp., Khuskia sp., Mucor sp., Peacilomyces sp., Phoma sp. and Trichoderma spp. These fungi were tested regarding their decolourisation activity for Remazol Brilliant Blue R (RBBR), a textile dye used as an initial screening for PAH-degrading fungi. The most efficient fungi for RBBR decolourisation after 12 days were Penicillium citrinum CBMAI 853 (100%), Aspergillus sulphureus CBMAI 849 (95%), Cladosporium cladosporioides CBMAI 857 (93%) and Trichoderma sp. CBMAI 852 (89%). Besides its efficiency for dye decolourisation within liquid media, C. cladosporioides CBMAI 857 also decolourised dye on solid media, forming a decolourisation halo. Further research on the biotechnological potential, including studies on PAH metabolism, of these selected fungi are in progress.
The synthesis of mycosporine-like amino acids (MAAs) by cultured, symbiotic dinoflagellates.
T Banaszak1 A; LaJeunesse; Trench
2000-06-28
We tested the hypothesis that there is a relation between phylotypes (phylogenetic types, as determined by restriction fragment length polymorphism (RFLP) and partial sequence analysis of the small subunit ribosomal RNA gene (SSUrDNA)) and the synthesis of mycosporine-like amino acids (MAAs) by symbiotic dinoflagellates under the influence of ultraviolet radiation (UV-B/A) and photosynthetically active radiation (PAR). We exposed 27 isolates of symbiotic dinoflagellates simultaneously to UV-B/A and PAR, and subsequently determined the MAAs present in cell extracts and in the media. The algae used included 24 isolates of Symbiodinium spp. originating from jellyfishes, sea anemones, zoanthids, scleractinians, octocorals, and bivalves, and three others in the genera Gymnodinium, Gloeodinium and Amphidinium from a jellyfish, an hydrocoral and a flatworm, respectively. In this study, all of the phylotype A Symbiodinium spp. synthesized up to three identified MAAs. None of the 11 cultured phylotypes B and C Symbiodinium spp. synthesized MAAs. The three non-Symbiodinium symbionts also synthesized up to three MAAs. The results support a conclusion that phylotype A Symbiodinium spp. have a high predilection for the synthesis of MAAs, while phylotypes B and C do not. Synthesis of MAAs by symbiotic dinoflagellates in culture does not appear to relate directly to depths or to the UV exposure regimes from which the consortia were collected.
Inventary of the Sponge Fauna of the cemitério Paleolake, Catalão, Goiás, Brazil
Directory of Open Access Journals (Sweden)
Vanessa de Souza Machado
2012-03-01
Full Text Available The Cemitério Paleolake, Catalão, Goiás, is a lacustrine deposit that is rich in spicules of continental sponges. These spicules, which are present in three sections (1-3, were analyzed for the taxonomic identification of the species in order to reconstruct the late Quaternary palaeoenvironment. An indigenous assemblage of lentic sponges was found, consisting of Metania spinata (Carter 1881, Dosilia pydanieli Volkmer-Ribeiro (1992, Radiospongilla amazonensis Volkmer-Ribeiro and Maciel (1983, Trochospongilla variabilis Bonetto and Ezcurra de Drago (1973, Corvomeyenia thumi (Traxler 1895, Heterorotula fistula Volkmer-Ribeiro and Motta (1995, plus Corvoheteromeyenia australis (Bonetto and Ezcurra de Drago 1966, which here has its first record in an assemblage formed by biosiliceous deposits. Furthermore, at the base of the sections, spicules of sponges from lotic environments were detected, including Corvospongilla seckti Bonetto and Ezcurra de Drago (1966, Oncosclera navicella (Carter 1881 and Eunapius fragilis (Leidy 1851, which suggests a contribution from flowing water. We identified 25 spongofacies horizons caused by sponge assemblages typical of a lentic environment, dated from at least 39,700 years BP., and currently occurring in lakes typical of the Cerrado Biome.O Paleolago Cemitério, Catalão, Goiás, é um depósito lacustre rico em espículas de esponjas continentais. Essas espículas, que estão presentes em três seções (1-3, foram analisadas para identificação taxonômica das espécies, a fim de reconstruir o paleoambiente do Quaternário tardio. Foi encontrada uma assembleia nativa de esponjas lênticas, consistindo de Metania spinata (Carter 1881, Dosilia pydanieli Volkmer-Ribeiro (1992, Radiospongilla amazonensis Volkmer-Ribeiro e Maciel (1983, Trochospongilla variabilis Bonetto e Ezcurra de Drago (1973, Corvomeyenia thumi (Traxler 1895, Heterorotula fistula Volkmer-Ribeiro e Motta (1995, acrescida de Corvoheteromeyenia
STUDY OF A PROTOCOL FOR MEASURING SAIL SPORTS TRAINING
Directory of Open Access Journals (Sweden)
Claudio Scotton
2015-04-01
Full Text Available Durante l’attività agonistica i velisti incontrano molteplici difficoltà. Elenchiamo solo alcune variabili ambientali che condizionano le scelte tattiche e tecniche che possono rivelarsi vincenti o perdenti (Scotton 2007: vento, onda, corrente, umidità, temperatura dell’acqua e dell’aria, distanza del campo di regata dalla sistemazione degli atleti a terra, sole, pioggia. Da tutto ciò si evince che la Vela, rispetto ad altre specialità sportive praticate in una condizione stabile come accade in una palestra o in un campo di atletica e caratterizzate dalla prevalenza di abilità motorie sportive stereotipate (Scotton 2003, naviga, vocabolo pertinente, con maggiori difficoltà nell’individuare i carichi di lavoro interno ed esterno. Obiettivo: Scopo del presente studio è l’indagine conoscitiva delle caratteristiche antropometriche di base e di alcune capacità organico-muscolari e coordinative di velisti della classe 29er; deriva in doppio acrobatica giovanile (Federvela 2008, molto veloce in qualsiasi condizione, ma anche instabile e difficile da condurre. Il lavoro ha permesso di gettare le basi per la messa punto di un protocollo di misurazione dell’allenamento applicabile alla Vela.
Adaptation of light-harvesting functions of unicellular green algae to different light qualities.
Ueno, Yoshifumi; Aikawa, Shimpei; Kondo, Akihiko; Akimoto, Seiji
2018-05-28
Oxygenic photosynthetic organisms perform photosynthesis efficiently by distributing captured light energy to photosystems (PSs) at an appropriate balance. Maintaining photosynthetic efficiency under changing light conditions requires modification of light-harvesting and energy-transfer processes. In the current study, we examined how green algae regulate their light-harvesting functions in response to different light qualities. We measured low-temperature time-resolved fluorescence spectra of unicellular green algae Chlamydomonas reinhardtii and Chlorella variabilis cells grown under different light qualities. By observing the delayed fluorescence spectra, we demonstrated that both types of green algae primarily modified the associations between light-harvesting chlorophyll protein complexes (LHCs) and PSs (PSII and PSI). Under blue light, Chlamydomonas transferred more energy from LHC to chlorophyll (Chl) located far from the PSII reaction center, while energy was transferred from LHC to PSI via different energy-transfer pathways in Chlorella. Under green light, both green algae exhibited enhanced energy transfer from LHCs to both PSs. Red light induced fluorescence quenching within PSs in Chlamydomonas and LHCs in Chlorella. In Chlorella, energy transfer from PSII to PSI appears to play an important role in balancing excitation between PSII and PSI.
First phylogenetic analysis of Ehrlichia canis in dogs and ticks from Mexico. Preliminary study
Directory of Open Access Journals (Sweden)
Carolina G. Sosa-Gutiérrez
2016-09-01
Full Text Available Objective. Phylogenetic characterization of Ehrlichia canis in dogs naturally infected and ticks, diagnosed by PCR and sequencing of 16SrRNA gene; compare different isolates found in American countries. Materials and methods. Were collected Blood samples from 139 dogs with suggestive clinical manifestations of this disease and they were infested with ticks; part of 16SrRNA gene was sequenced and aligned, with 17 sequences reported in American countries. Two phylogenetic trees were constructed using the Maximum likelihood method, and Maximum parsimony. Results. They were positive to E. canis 25/139 (18.0% dogs and 29/139 (20.9% ticks. The clinical manifestations presented were fever, fatigue, depression and vomiting. Rhipicephalus sanguineus Dermacentor variabilis and Haemaphysalis leporis-palustris ticks were positive for E. canis. Phylogenetic analysis showed that the sequences of dogs and ticks in Mexico form a third group diverging of sequences from South America and USA. Conclusions. This is the first phylogenetic analysis of E. canis in Mexico. There are differences in the sequences of Mexico with those reported in South America and USA. This research lays the foundation for further study of genetic variability.
Latent effects of Iranian crude oil and a chemical oil dispersant on red sea molluscs
Energy Technology Data Exchange (ETDEWEB)
Eisler, R
1973-01-01
Predation rate of the gastropod drill, Drupa granulata, on the mussel, Mytilus variabilis, was measured over a period of 28 days after adults from both species had been immersed for 168 h in seawater solutions containing high sublethal concentrations (10 ml/liter) of Iranian crude oil. Predation rate was three times higher in controls than in the group where both predator and prey had been exposed initially; intermediate values were determined among groups where only one species had been treated initially. Fecundity of drills, as evidenced by number of egg cases deposited, was directly related to mussel consumption. In a similar study with a chemical oil dispersant, exposure to high (0.003 ml/liter) sublethal levels for 168 h did not affect markedly the rate at which mussels were destroyed and consumed during post-treatment. However, the fecundity of untreated drills feeding on untreated mussels (controls) was 3 to 10 times greater than among groups in which one or bothsc species had been exposed initially to dispersant. Except for mussels consumed by drills, there were no deaths during the post-treatment period in either study, and all organisms appeared normal.
Ugalde, Diana; Gómez, Patricia; Simões, Nuno
2015-01-19
Marine sponges usually constitute the most diverse group of the benthic community in coral reefs. Although they are reasonably well studied at the northern Gulf of Mexico (GMx), the southern GMx is poorly known and lacks records from many major reef systems that lie off the Mexican coast. The present taxonomic study is the first sponge account from Alacranes reef, the largest coral reef system in the GMx, and from the shallow reef banks of Sisal, both in the northwest Yucatan Peninsula. The 19 species herein described represent the first sponge fauna records from these reefs. Among these, seven species represent new record for GMx: Erylus formosus, Cliona flavifodina, Spirastrella aff. mollis, Strongylacidon bermuda, Topsentia bahamensis, Agelas tubulata and Chelonaplysilla aff. erecta. Twelve species are new records for the Southern GMx: Erylus trisphaerus, Cliona amplicavata, Chondrilla caribensis, Halichondria lutea, Hymeniacidon caerulea, Axinella corrugata, Dragmacidon reticulatum, Chalinula molitba, Amphimedon caribica, A. complanata, Hyatella cavernosa and Dysidea variabilis. Additionally, a redescription of Erylus trisphaerus is presented which had not been reviewed since its original description in 1953 off Western Florida, except that it was listed for north La Habana, Cuba.
Directory of Open Access Journals (Sweden)
L. DINI
2013-12-01
Full Text Available L' articolo esamina il funzionamento del sistema finanziario attuale, segnalando la sua funzione più importante , vale a dire l'offerta di liquidità e il suo impatto sulla vasta gamma di variabili finanziarie internazionali. Liquidità e rischio sono concetti strettamente correlati. Come Keynes e Hicks hanno insegnato , una definizione significativa di liquidità non può essere data senza fare riferimento al rischio. L'autore fornisce alcune considerazioni per aiutare a far luce sulle azioni politiche che potrebbero essere necessarie per mitigare i problemi e le difficoltà connesse con l'attuale impostazione monetaria internazionale .The article looks at how the present financial system works, signalling out its most crucial function, namely the provision of liquidity and its impact on the broad spectrum of international financial variables. Liquidity and risk are closely interrelated concepts. As Keynes and Hicks taught, a meaningful definition of liquidity cannot be given without reference to risk itself. The author provides some considerations to help shed light on the policy actions that may be required to mitigate the problems and difficulties associated with the current international monetary setting. JEL: G15, F30, E42
Ixodid ticks: physiological and behavioral responses to gamma radiation, light and humidity
International Nuclear Information System (INIS)
Stanley, M.A.
1982-01-01
In Part I, Effects of ''Gamma Radiation on Cytogenetics and Reproduction of Male Amblyomma americanum,'' male lone star ticks were exposed to 0.5, 1, 2, 3, 4, 8, and 16 krads prior to feeding. Testicular squashes were made, and chromosomal aberrations were described. Timing of spermatogenesis was not affected; however, frequency of abnormal spermatocytes and rounded and elongated spermatids increased as radiation dosage increased. Untreated females mated to irradiated males remained attached to their hosts longer than control females did. Few of the females paired with treated males oviposited. Length of preoviposition period and numbers of eggs produced by individual females were not influenced by dosage levels of males. Percent hatch of eggs was decreased by irradiation of male parent. No hatch occurred at 2 krads or above. Weights of individual larvae appeared to increase with increasing dosage of male parents. Most eggs weighed 60-80 μg; larvae weighed 40-60μg. Irradiation of ticks as a potential biological control measure was discussed. Part II, ''Orientation to Light and Humidity in Haemaphysalis leporispalustris and Dermacentor variabilis,'' compared behavioral preferences of a host-specific and a broad-host-species
Buchholz, Matthew J; Davis, Cheryl; Rowland, Naomi S; Dick, Carl W
2018-04-01
The incidence of tick-borne zoonoses such as Lyme disease has steadily increased in the southeastern United States. Southeastern states accounted for 1500 of over 28,000 confirmed cases of Lyme disease reported in the United States during 2015. Borrelia burgdorferi, the etiologic agent of Lyme disease, is maintained in small mammal reservoirs and vectored to new hosts by ixodid ticks. This study examined ecological relationships of the B. burgdorferi/vector/reservoir system in order to understand the dynamics of Lyme disease risk in Kentucky. Small mammals were captured using live traps from November 2014 to October 2015. Ticks were removed and blood and tissue collected from small mammals were screened for B. burgdorferi DNA by PCR with primers specific to the OspA gene. Prevalence of B. burgdorferi (21.8%) in Kentucky small mammals was comparable to the lowest recorded prevalence in regions where Lyme disease is endemic. Moreover, infestation of small mammals by Ixodes scapularis, the primary vector of B. burgdorferi, was rare, while Dermacentor variabilis comprised the majority of ticks collected. These findings provide ecological insight into the relative paucity of Lyme disease in Kentucky.
Ganglioneuroblastoma: Case report and review of the literature.
Alessi, S; Grignani, M; Carone, L
2011-06-01
Neuroblastoma are among the most important tumors of extracranial origin in pediatric patients. They arise from embryonal cells involved in the development of the sympathetic nervous system, whose differentiation has been arrested [1,2]. They are the tumors most frequently diagnosed during the first decade of life. Their evolution is unpredictable, ranging from progression to spontaneous regression or maturation, and their location and metastatic potential vary. Little is known about the cause of these tumors and the risk factors associated with their development. This article describes a typical case of ganglioneuroblastoma and provides a review of the literature on this type of tumor.Sommario Il neuroblastoma è uno dei più importanti tumori pediatrici di derivazione extracranica; esso origina dalle cellule embrionali coinvolte nello sviluppo del sistema nervoso simpatico a causa di un blocco nel loro processo di differenziamento [1,2]. È la più frequente neoplasia della prima decade di vita; la sua progressione biologica è imprevedibile, regressione spontanea, maturazione a ganglioneuroma, localizzazione e metastatizzazione variabili. Poco è noto a riguardo dei fattori di rischio e della sua eziopatogenesi. Viene presentato un caso tipico di ganglioneuroblastoma e riesaminata la letteratura su questa neoplasia.
Directory of Open Access Journals (Sweden)
Adewale Sogo Olalemi
2012-10-01
Full Text Available An investigation into the effect of refined petroleum products contamination on bacterial population and physicochemical characteristics of cultivated agricultural soil was carried out. The soil samples obtained from the Teaching and Research Farm, Obakekere, Federal University of Technology, Akure, Ondo State were contaminated with varying volumes of petrol, diesel and kerosene. The results revealed higher bacterial populations in uncontaminated soils than contaminated soils. The counts of bacteria ranged from 3.0 × 105 to 5.0 × 105 cfu/g in uncontaminated soils and 1.0 × 105 to 3.0 × 105 cfu/g in contaminated soils. The isolated bacteria were identified as Bacillus subtilis, Flavobacterium lutescens, Micrococcus luteus, Corynebacterium variabilis, Pseudomonas fluorescens. The contamination had no significant effect on pH, potassium, sodium, organic carbon and nitrogen content of the soils, while the moisture, calcium, phosphorus and magnesium content of the contaminated soils were significantly different (P < 0.05 compared with the uncontaminated soils. The ability of Bacillus subtilis, Flavobacterium lutescens, Micrococcus luteus, and Pseudomonas fluorescens to utilize the refined petroleum products suggest that these bacteria had potential to bioremediate petroleum contaminated soils.
Viruses: agents of coral disease?
Davy, S K; Burchett, S G; Dale, A L; Davies, P; Davy, J E; Muncke, C; Hoegh-Guldberg, O; Wilson, W H
2006-03-23
The potential role of viruses in coral disease has only recently begun to receive attention. Here we describe our attempts to determine whether viruses are present in thermally stressed corals Pavona danai, Acropora formosa and Stylophora pistillata and zoanthids Zoanthus sp., and their zooxanthellae. Heat-shocked P. danai, A. formosa and Zoanthus sp. all produced numerous virus-like particles (VLPs) that were evident in the animal tissue, zooxanthellae and the surrounding seawater; VLPs were also seen around heat-shocked freshly isolated zooxanthellae (FIZ) from P. danai and S. pistillata. The most commonly seen VLPs were tail-less, hexagonal and about 40 to 50 nm in diameter, though a diverse range of other VLP morphotypes (e.g. rounded, rod-shaped, droplet-shaped, filamentous) were also present around corals. When VLPs around heat-shocked FIZ from S. pistillata were added to non-stressed FIZ from this coral, they resulted in cell lysis, suggesting that an infectious agent was present; however, analysis with transmission electron microscopy provided no clear evidence of viral infection. The release of diverse VLPs was again apparent when flow cytometry was used to enumerate release by heat-stressed A. formosa nubbins. Our data support the infection of reef corals by viruses, though we cannot yet determine the precise origin (i.e. coral, zooxanthellae and/or surface microbes) of the VLPs seen. Furthermore, genome sequence data are required to establish the presence of viruses unequivocally.
Ryland, John S
2015-07-17
Colonial zoanthids are a conspicuous feature of the subtropical rocky intertidal in KwaZulu-Natal but those of the genus Zoanthus have a confused taxonomy with 10, difficult to separate, nominal species described from the region. This paper presents an analysis of polyp size, measured as mean diameter determined photographically from the number of polyps occupying an area of 6 × 4 cm(2). The results, based on diameter frequency of 127 samples from five shores, indicate three populations (morphotypes) with means of 4.3 (SD ±0.53), 5.7 (SD ±0.70) and 8.4 (SD ±0.58) mm occurring in the approximate abundance ratios of 10:5:1, possibly corresponding to Zoanthus sansibaricus, Z. natalensis and Z. lawrencei. The underlying assumptions with regard to population structure (the number, size and degree of fragmentation of clones) and the normality of data are discussed, as are trans-oceanic larval dispersal, recruitment, and genetic connectivity. The essential, traditional species description in Zoanthus, using internal morphology, on its own may be an inadequate discriminator of species. The status of the few possibly valid species is discussed in relation to the present results and recent studies based on the application of molecular genetics. Thorough studies of the population structure (genets and ramets) and a taxonomic approach based on the combined use of morphology, genetic methods and statistically robust, quantitative morphometrics are proposed as a potential way forward.
Toxicological studies on palytoxin and ostreocin-D administered to mice by three different routes.
Ito, Emiko; Yasumoto, Takeshi
2009-09-01
Palytoxin (PLT) first isolated from zoanthids is extremely lethal to animals by intraperitoneal or intravenous administration but shows little toxicity by gavage dosing in contradiction to the occurrence of fatal poisoning due to PLT-containing seafood. In order to fully elucidate its potential risks to human we evaluated the toxicological effects via three ways of dosing: gavage, intra-tracheal administration (IT) and sublingual administration. A new analog, 42-hydroxy-3,26-didemethyl-19,44-dideoxypalytoxin isolated from the dinoflagellate Ostreopsis siamensis and named ostreocin-D (OSD), was also used for comparison, additionally conducted by i.p. By gavage dosing, both toxins did not produce death in mice at the maximum dosage of 200 microg/kg of PLT and 300 microg/kg of OSD. Addition of dietary lipid components to PLT solutions for gavage or use of ulcerated mice did not alter the results, indicating no enhancement of PLT absorption. The two toxins were most toxic by the IT route, causing bleeding and alveolar destruction in the lung and resultant death at 2 microg/kg of PLT, and 11 microg/kg of OSD. Both toxins also induced organ injuries after 24h when dosed by sublingual administration at about 200 microg/kg. The injuries became fatal when PLT was dosed 2 or 3 times. The results pointed to the necessity of taking multiple approaches to assess the potential health risks due to PLT and its analogs in food and environments.
Montoya, W. Jhoel; Nolasco, Oscar P.; Acuña, Rosalyn K.; Gutiérrez, Ana I. F.
2016-01-01
The fungus Beauveria bassiana Vuill. is well known for its ability entomopathogenic but there is also references to be an antagonist fungus, one of the possible ways of their antagonism it is antibiosis as is known the presence of hydrolytic enzymes in their genome. The main enzymes expressed against phytopathogenic are β-1,3-glucanases, since the cell wall of the phytopathogenic like fungi and oomycetes consists mostly polymers of β-1,3 glucans. The expression of exo-1,3-beta glucanase [XM_0...
Al-Saari, Nurhidayu; Gao, Feng; Rohul, Amin A K M; Sato, Kazumichi; Sato, Keisuke; Mino, Sayaka; Suda, Wataru; Oshima, Kenshiro; Hattori, Masahira; Ohkuma, Moriya; Meirelles, Pedro M; Thompson, Fabiano L; Thompson, Cristiane; Filho, Gilberto M A; Gomez-Gil, Bruno; Sawabe, Toko; Sawabe, Tomoo
2015-01-01
5085T, V. hangzhouensis JCM 15146T V. maritimus LMG 25439T, and V. variabilis LMG 25438T). In silico DDH data also supported the genomic relationship. The strains C7T also had less than 95% average amino acid identity (AAI) and average nucleotide identity (ANI) towards V. maritimus C210, V. variabilis C206, and V. mediterranei AK1T, V. brasiliensis LMG 20546T, V. orientalis ATCC 33934T, and V. sinaloensis DSM 21326. The name Vibrio astriarenae sp. nov. is proposed with C7 as the type strains. Both V. agarivorans CECT 5058T and V. astriarenae C7T are members of the newest clade of Vibrionaceae named Agarivorans.
Directory of Open Access Journals (Sweden)
Nurhidayu Al-Saari
. agarivorans CECT 5085T, V. hangzhouensis JCM 15146T V. maritimus LMG 25439T, and V. variabilis LMG 25438T. In silico DDH data also supported the genomic relationship. The strains C7T also had less than 95% average amino acid identity (AAI and average nucleotide identity (ANI towards V. maritimus C210, V. variabilis C206, and V. mediterranei AK1T, V. brasiliensis LMG 20546T, V. orientalis ATCC 33934T, and V. sinaloensis DSM 21326. The name Vibrio astriarenae sp. nov. is proposed with C7 as the type strains. Both V. agarivorans CECT 5058T and V. astriarenae C7T are members of the newest clade of Vibrionaceae named Agarivorans.
Gross and microscopic morphology of lesions in Cnidaria from Palmyra Atoll, Central Pacific
Williams, Gareth J.; Work, Thierry M.; Aeby, Greta S.; Knapp, Ingrid S.; Davy, Simon K.
2011-01-01
We conducted gross and microscopic characterizations of lesions in Cnidaria from Palmyra Atoll, Central Pacific. We found growth anomalies (GA) to be the most commonly encountered lesion. Cases of discoloration and tissue loss were rare. GAs had a focal or multi-focal distribution and were predominantly nodular, exophytic, and umbonate. In scleractinians, the majority of GAs manifested as hyperplasia of the basal body wall (52% of cases), with an associated absence or reduction of polyp structure (mesenteries and filaments, actinopharynx and tentacles), and depletion of zooxanthellae in the gastrodermis of the upper body wall. In the soft corals Sinularia sp. and Lobophytum sp., GAs exclusively manifested as prominent hyperplasia of the coenenchyme with an increased density of solenia. In contrast to scleractinians, soft coral GAs displayed an inflammatory and necrotizing component with marked edema of the mesoglea, accompanied by infiltrates of variably-sized granular amoebocytes. Fungi, algae, sponges, and Crustacea were present in some scleractinian GAs, but absent in soft coral GAs. Fragmentation of tissues was a common finding in Acropora acuminata and Montipora cf. dilatata colonies with tissue loss, although no obvious causative agents were seen. Discoloration in the zoanthid, Palythoa tuberculosa, was found to be the result of necrosis, while in Lobophytum sp. discoloration was the result of zooxanthellar depletion (bleaching). Soft corals with discoloration or tissue loss showed a marked inflammatory response, however no obvious causative organisms were seen. Lesions that appeared similar at the gross level were revealed to be distinct by microscopy, emphasizing the importance of histopathology.
Surface Plasmon Resonance Biosensor Method for Palytoxin Detection Based on Na+,K+-ATPase Affinity
Alfonso, Amparo; Pazos, María-José; Fernández-Araujo, Andrea; Tobio, Araceli; Alfonso, Carmen; Vieytes, Mercedes R.; Botana, Luis M.
2013-01-01
Palytoxin (PLTX), produced by dinoflagellates from the genus Ostreopsis was first discovered, isolated, and purified from zoanthids belonging to the genus Palythoa. The detection of this toxin in contaminated shellfish is essential for human health preservation. A broad range of studies indicate that mammalian Na+,K+-ATPase is a high affinity cellular receptor for PLTX. The toxin converts the pump into an open channel that stimulates sodium influx and potassium efflux. In this work we develop a detection method for PLTX based on its binding to the Na+,K+-ATPase. The method was developed by using the phenomenon of surface plasmon resonance (SPR) to monitor biomolecular reactions. This technique does not require any labeling of components. The interaction of PLTX over immobilized Na+,K+-ATPase is quantified by injecting different concentrations of toxin in the biosensor and checking the binding rate constant (kobs). From the representation of kobs versus PLTX concentration, the kinetic equilibrium dissociation constant (KD) for the PLTX-Na+,K+-ATPase association can be calculated. The value of this constant is KD = 6.38 × 10−7 ± 6.67 × 10−8 M PLTX. In this way the PLTX-Na+,K+-ATPase association was used as a suitable method for determination of the toxin concentration in a sample. This method represents a new and useful approach to easily detect the presence of PLTX-like compounds in marine products using the mechanism of action of these toxins and in this way reduce the use of other more expensive and animal based methods. PMID:24379088
Yoshimura, Fumihiko; Sasaki, Minoru; Hattori, Izumi; Komatsu, Kei; Sakai, Mio; Tanino, Keiji; Miyashita, Masaaki
2009-07-06
The zoanthamine alkaloids, a type of heptacyclic marine alkaloid isolated from colonial zoanthids of the genus Zoanthus sp., have distinctive biological and pharmacological properties in addition to their unique chemical structures with stereochemical complexity. Namely, norzoanthamine (1) can suppress the loss of bone weight and strength in ovariectomized mice and has been expected as a promising candidate for a new type of antiosteoporotic drug, while zoanthamine (2) has exhibited potent inhibitory activity toward phorbol myristate-induced inflammation in addition to powerful analgesic effects. Recently, norzoanthamine derivatives were demonstrated to inhibit strongly the growth of P-388 murine leukemia cell lines, in addition to their potent antiplatelet activities on human platelet aggregation. Their distinctive biological properties, combined with novel chemical structures, make this family of alkaloids extremely attractive targets for chemical synthesis. However, the chemical synthesis of the zoanthamine alkaloids has been impeded owing to their densely functionalized complex stereostructures. In this paper, we report the first and highly efficient total syntheses of norzoanthamine (1) and zoanthamine (2) in full detail, which involve stereoselective synthesis of the requisite triene (18) for an intramolecular Diels-Alder reaction via the sequential three-component coupling reactions, the key intramolecular Diels-Alder reaction, and subsequent crucial bis-aminoacetalization as the key steps. Ultimately, we achieved the total synthesis of norzoanthamine (1) in 41 steps with an overall yield of 3.5 % (an average of 92 % yield each step) and that of zoanthamine (2) in 43 steps with an overall yield of 2.2 % (an average of 91 % yield each step) starting from (R)-5-methylcyclohexenone (3), respectively.
Surface plasmon resonance biosensor method for palytoxin detection based on Na+,K+-ATPase affinity.
Alfonso, Amparo; Pazos, María-José; Fernández-Araujo, Andrea; Tobio, Araceli; Alfonso, Carmen; Vieytes, Mercedes R; Botana, Luis M
2013-12-27
Palytoxin (PLTX), produced by dinoflagellates from the genus Ostreopsis was first discovered, isolated, and purified from zoanthids belonging to the genus Palythoa. The detection of this toxin in contaminated shellfish is essential for human health preservation. A broad range of studies indicate that mammalian Na+,K+-ATPase is a high affinity cellular receptor for PLTX. The toxin converts the pump into an open channel that stimulates sodium influx and potassium efflux. In this work we develop a detection method for PLTX based on its binding to the Na+,K+-ATPase. The method was developed by using the phenomenon of surface plasmon resonance (SPR) to monitor biomolecular reactions. This technique does not require any labeling of components. The interaction of PLTX over immobilized Na+,K+-ATPase is quantified by injecting different concentrations of toxin in the biosensor and checking the binding rate constant (Kobs). From the representation of Kobs versus PLTX concentration, the kinetic equilibrium dissociation constant (K(D)) for the PLTX-Na+,K+-ATPase association can be calculated. The value of this constant is K(D) = 6.38 × 10-7 ± 6.67 × 10-8 M PLTX. In this way the PLTX-Na+,K+-ATPase association was used as a suitable method for determination of the toxin concentration in a sample. This method represents a new and useful approach to easily detect the presence of PLTX-like compounds in marine products using the mechanism of action of these toxins and in this way reduce the use of other more expensive and animal based methods.
The cytotoxic effect of palytoxin on Caco-2 cells hinders their use for in vitro absorption studies.
Pelin, M; Sosa, S; Della Loggia, R; Poli, M; Tubaro, A; Decorti, G; Florio, C
2012-02-01
Palytoxin (PLTX), found in Palythoa zoanthids and Ostreopsis dinoflagellates, has also been detected in crabs and fish, through which it can enter into the food chain. Indeed, PLTX is considered the causative agent of several cases of human seafood poisoning resulting in systemic symptoms. Available epidemiological data on PLTX human toxicity suggest that the intestinal tract may be one of its in vivo targets and its potential site of access into the bloodstream. Hence, the purpose of this study was to investigate the suitability of the human intestinal Caco-2 cell line for evaluating PLTX oral absorption. A detailed analysis of PLTX cytotoxicity revealed a high sensitivity of Caco-2 cells: 4h toxin exposure reduced mitochondrial activity (MTT assay, EC(50) of 8.9±3.7×10(-12)M), cell density (SRB assay, EC(50) of 2.0±0.6×10(-11)M) and membrane integrity (LDH release, EC(50) of 4.5±1.4×10(-9)M and PI uptake, EC(50) of 1.0±0.8×10(-8)M). After low PLTX concentration (1.0×10(-11)M) exposure for 1-8h, followed by 24h recovery time in toxin-free medium, cell density reduction was only partially reversible. These results indicate that, due to the high susceptibility to PLTX cytotoxic effects, Caco-2 cells do not represent an appropriate and reliable model for investigating intestinal barrier permeation by this toxin. Copyright © 2011 Elsevier Ltd. All rights reserved.
Surface Plasmon Resonance Biosensor Method for Palytoxin Detection Based on Na+,K+-ATPase Affinity
Directory of Open Access Journals (Sweden)
Amparo Alfonso
2013-12-01
Full Text Available Palytoxin (PLTX, produced by dinoflagellates from the genus Ostreopsis was first discovered, isolated, and purified from zoanthids belonging to the genus Palythoa. The detection of this toxin in contaminated shellfish is essential for human health preservation. A broad range of studies indicate that mammalian Na+,K+-ATPase is a high affinity cellular receptor for PLTX. The toxin converts the pump into an open channel that stimulates sodium influx and potassium efflux. In this work we develop a detection method for PLTX based on its binding to the Na+,K+-ATPase. The method was developed by using the phenomenon of surface plasmon resonance (SPR to monitor biomolecular reactions. This technique does not require any labeling of components. The interaction of PLTX over immobilized Na+,K+-ATPase is quantified by injecting different concentrations of toxin in the biosensor and checking the binding rate constant (kobs. From the representation of kobs versus PLTX concentration, the kinetic equilibrium dissociation constant (KD for the PLTX-Na+,K+-ATPase association can be calculated. The value of this constant is KD = 6.38 × 10−7 ± 6.67 × 10−8 M PLTX. In this way the PLTX-Na+,K+-ATPase association was used as a suitable method for determination of the toxin concentration in a sample. This method represents a new and useful approach to easily detect the presence of PLTX-like compounds in marine products using the mechanism of action of these toxins and in this way reduce the use of other more expensive and animal based methods.
Directory of Open Access Journals (Sweden)
Chia-Min Hsu
Full Text Available The identification of coral recruits has been problematic due to a lack of definitive morphological characters being available for higher taxonomic resolution. In this study, we tested whether fluorescent detection of coral recruits used in combinations of different DNA-barcoding markers (cytochrome oxidase I gene [COI], open reading frame [ORF], and nuclear Pax-C intron [PaxC] could be useful for increasing the resolution of coral spat identification in ecological studies. One hundred and fifty settlement plates were emplaced at nine sites on the fringing reefs of Kenting National Park in southern Taiwan between April 2011 and September 2012. A total of 248 living coral spats and juveniles (with basal areas ranging from 0.21 to 134.57 mm(2 were detected on the plates with the aid of fluorescent light and collected for molecular analyses. Using the COI DNA barcoding technique, 90.3% (224/248 of coral spats were successfully identified into six genera, including Acropora, Isopora, Montipora, Pocillopora, Porites, and Pavona. PaxC further separated I. cuneata and I. palifera of Isopora from Acropora, and ORF successfully identified the species of Pocillopora (except P. meandrina and P. eydouxi. Moreover, other cnidarian species such as actinarians, zoanthids, and Millepora species were visually found using fluorescence and identified by COI DNA barcoding. This combination of existing approaches greatly improved the taxonomic resolution of early coral life stages, which to date has been mainly limited to the family level based on skeletal identification. Overall, this study suggests important improvements for the identification of coral recruits in ecological studies.
Hsu, Chia-Min; de Palmas, Stéphane; Kuo, Chao-Yang; Denis, Vianney; Chen, Chaolun Allen
2014-01-01
The identification of coral recruits has been problematic due to a lack of definitive morphological characters being available for higher taxonomic resolution. In this study, we tested whether fluorescent detection of coral recruits used in combinations of different DNA-barcoding markers (cytochrome oxidase I gene [COI], open reading frame [ORF], and nuclear Pax-C intron [PaxC]) could be useful for increasing the resolution of coral spat identification in ecological studies. One hundred and fifty settlement plates were emplaced at nine sites on the fringing reefs of Kenting National Park in southern Taiwan between April 2011 and September 2012. A total of 248 living coral spats and juveniles (with basal areas ranging from 0.21 to 134.57 mm(2)) were detected on the plates with the aid of fluorescent light and collected for molecular analyses. Using the COI DNA barcoding technique, 90.3% (224/248) of coral spats were successfully identified into six genera, including Acropora, Isopora, Montipora, Pocillopora, Porites, and Pavona. PaxC further separated I. cuneata and I. palifera of Isopora from Acropora, and ORF successfully identified the species of Pocillopora (except P. meandrina and P. eydouxi). Moreover, other cnidarian species such as actinarians, zoanthids, and Millepora species were visually found using fluorescence and identified by COI DNA barcoding. This combination of existing approaches greatly improved the taxonomic resolution of early coral life stages, which to date has been mainly limited to the family level based on skeletal identification. Overall, this study suggests important improvements for the identification of coral recruits in ecological studies.
Acute toxicities of crude oils and oil-dispersant mixtures to Red sea fishes and invertebrates
Energy Technology Data Exchange (ETDEWEB)
Eisler, R.
1975-11-01
Crude oil from fields in the Persian Gulf and in the Sinai plus a chemical oil dispersant were tested, using static bioassay procedures, for toxicity to adults or juveniles of ten marine species: Heteroxenia fuscescens, a soft coral; Nerita forskali and Drupa granulata, gastropod molluscs; Mytilus variabilis, a mussel; Acanthopleura haddoni, a chiton (mollusc); Echinometra mathaei, sea urchin; Calcinus latens, a hermit crab; Palaemon pacificus, a shrimp; Parupeneus barberinus, goatfish; and Siganus rivulatus, rabbitfish. Concentrations fatal to 50 percent of individual test species in 168 hours, LC-50 (168 h), ranged from 0.74 to more than 30.0 ml/liter for Persian Gulf crude, from 14.5 to more than 30.0 ml/liter for Sinai crude, and from 0.006 to 0.064 ml/liter for the dispersant. In general, fishes and crustaceans were the most sensitive groups assayed and molluscs the most resistant. LC-50 (168 h) values for oil-dispersant mixtures of 10 parts oil to 1 part dispersant (v/v) for selected species ranged from 0.047 to 0.152 ml/liter which appears to reflect the biocidal properties of the dispersant. Some individuals that survived immersion in high concentrations of the test compounds for 168 h were adversely affected during treatment and afterwards.
Alvarez, Eduardo; Stchigel, Alberto M; Cano, Josep; Sutton, Deanna A; Fothergill, Annette W; Chander, Jagdish; Salas, Valentina; Rinaldi, Michael G; Guarro, Josep
2010-06-30
Apophysomyces is a monotypic genus belonging to the order Mucorales. The species Apophysomyces elegans has been reported to cause severe infections in immunocompromised and immunocompetent people. In a previous study of Alvarez et al.(3) [J Clin Microbiol 2009;47:1650-6], we demonstrated a high variability among the 5.8S rRNA gene sequences of clinical strains of A. elegans. We performed a polyphasic study based on the analysis of the sequences of the histone 3 gene, the internal transcribed spacer region of the rDNA gene, and domains D1 and D2 of the 28S rRNA gene, as well as by evaluation of some relevant morphological and physiological characteristics of a set of clinical and environmental strains of A. elegans. We have demonstrated that A. elegans is a complex of species. We propose as new species Apophysomyces ossiformis, characterised by bone-shaped sporangiospores, Apophysomyces trapeziformis, with trapezoid-shaped sporangiospores, and Apophysomyces variabilis, with variable-shaped sporangiospores. These species failed to assimilate esculin, whereas A. elegans was able to assimilate that glycoside. Amphotericin B and posaconazole are the most active in vitro drugs against Apophysomyces. Copyright 2009 Revista Iberoamericana de Micología. Published by Elsevier Espana. All rights reserved.
Directory of Open Access Journals (Sweden)
Irshad M. Sulaiman
2014-06-01
Full Text Available In our previous study, we described the development of an internal transcribed spacer (ITS1 sequencing method, and used this protocol in species-identification of isolated fungi collected from the manufacturing areas of a compounding company known to have caused the multistate fungal meningitis outbreak in the United States. In this follow-up study, we have analyzed the unopened vials of Greek yogurt from the recalled batch to determine the possible cause of microbial contamination in the product. A total of 15 unopened vials of Greek yogurt belonging to the recalled batch were examined for the detection of fungi in these samples known to cause foodborne illness following conventional microbiological protocols. Fungi were isolated from all of the 15 Greek yogurt samples analyzed. The isolated fungi were genetically typed by DNA sequencing of PCR-amplified ITS1 region of rRNA gene. Analysis of data confirmed all of the isolated fungal isolates from the Greek yogurt to be Rhizomucor variabilis. The generated ITS1 sequences matched 100% with the published sequences available in GenBank. In addition, these yogurt samples were also tested for the presence of five types of bacteria (Salmonella, Listeria, Staphylococcus, Bacillus and Escherichia coli causing foodborne disease in humans, and found negative for all of them.
Dubey, Anil Kumar; Martin, Jon H
2018-03-28
The whitefly genus Tuberaleyrodes Takahashi is reviewed using types and determined specimens. The generic diagnosis is redefined together with description of five new species: T. bruneiensis Dubey Martin sp. nov. from Brunei, T. crypta Dubey Martin sp. nov. from Hong Kong, and T. ordo Dubey Martin sp. nov., T. aequalis Dubey Martin sp. nov. and T. variabilis Dubey Martin sp. nov. from Malaysia. New species descriptions are accompanied with camera lucida drawings and microphotographs of holotype and paratypes. Tuberaleyrodes actinodaphnis Takahashi is elevated from its status as a variety of T. machili Takahashi to species level. Lectotypes are selected for T. actinodaphnis Takahashi Stat. nov. and T. bobuae Takahashi. Tuberaleyrodes actinodaphnis Takahashi is a new record to Taiwan. A new combination, Tuberaleyrodes glutae (Corbett) Comb. nov. is proposed for Dialeurodes glutae Corbett. Two species, T. glutae (Corbett) and Tuberaleyrodes spiniferosa (Corbett) are re-described, and placement of T. spiniferosa in the genus Tuberaleyrodes is confirmed. The genus Tuberaleyrodes is newly recorded from Borneo and Sulawesi. An identification key to puparia of Tuberaleyrodes species so far described is provided along with the countries of present records. Four plants families viz., Annonaceae, Fabaceae, Myristicaceae and Pentaphylacaeae are recorded as new hosts for Tuberaleyrodes species. New host plant records are indicated.
Directory of Open Access Journals (Sweden)
Esther J Lee
Full Text Available Modern Arctic Siberia provides a wealth of resources for archaeological, geological, and paleontological research to investigate the population dynamics of faunal communities from the Pleistocene, particularly as the faunal material coming from permafrost has proven suitable for genetic studies. In order to examine the history of the Canid species in the Siberian Arctic, we carried out genetic analysis of fourteen canid remains from various sites, including the well-documented Upper Paleolithic Yana RHS and Early Holocene Zhokhov Island sites. Estimated age of samples range from as recent as 1,700 years before present (YBP to at least 360,000 YBP for the remains of the extinct wolf, Canis cf. variabilis. In order to examine the genetic affinities of ancient Siberian canids species to the domestic dog and modern wolves, we obtained mitochondrial DNA control region sequences and compared them to published ancient and modern canid sequences. The older canid specimens illustrate affinities with pre-domestic dog/wolf lineages while others appear in the major phylogenetic clades of domestic dogs. Our results suggest a European origin of domestic dog may not be conclusive and illustrates an emerging complexity of genetic contribution of regional wolf breeds to the modern Canis gene pool.
Directory of Open Access Journals (Sweden)
Jayaseelan Murugaiyan
2016-12-01
Full Text Available Microalgae of the genus Prototheca (P. spp are associated with rare algal infections of invertebrates termed protothecosis. Among the seven generally accepted species, P. zopfii genotype 2 (GT2 is associated with a severe form of bovine mastitis while P. blaschkeae causes the mild and sub-clinical form of mastitis. The reason behind the infectious nature of P. zopfii GT2, while genotype 1 (GT1 remains non-infectious, is not known. Therefore, in the present study we investigated the protein expression level difference between the genotypes of P. zopfii and P. blaschkeae. Cells were cultured to the mid-exponential phase, harvested, and processed for LC-MS analysis. Peptide data was acquired on an LTQ Orbitrap Velos, raw spectra were quantitatively analyzed with MaxQuant software and matching with the reference database of Chlorella variabilis and Auxenochlorella protothecoides resulted in the identification of 226 proteins. Comparison of an environmental strain with infectious strains resulted in the identification of 51 differentially expressed proteins related to carbohydrate metabolism, energy production and protein translation. The expression level of Hsp70 proteins and their role in the infectious process is worth further investigation. All mass spectrometry data are available via ProteomeXchange with identifier PXD005305.
Li, Dong Ming; Lun, Li De
2012-12-01
Mucor irregularis (Rhizomucor variabilis) infection and lethal midline granuloma (LMG) are characterized by progressive swelling, ulceration, and destruction of the central face that is usually fatal. Pathological features are inflammation, necrosis, and granulation. LMG has been called by various names, and in recent years, it has been known as NK/T cell lymphoma. However, diagnosis still relies on the progressive necrosis course rather than malignancy in histology. The disease has long challenged physicians, particularly when it worsens with radiotherapy or chemotherapy but sometimes achieves total remission without anti-malignancy therapies. We describe a 35-year-old man who had typical clinical-pathological symptoms of LMG, which turned out to be primary M. irregularis infection; that was diagnosed by positive tissue culture and fungal elements in histology. The patient was successfully treated with antifungal therapy (liposomal amphotericin B, total 4,600 mg and amphotericin B total 277 mg, over a duration of 70 days). We hereby review current knowledge about the epidemiology, clinical manifestations, radiographic characteristics, and pathologic features of LMG with those of M. irregularis infection and their associations. We conclude that primary M. irregulars infection can mimic the clinico-pathological symptoms of LMG and the condition responds favorably to aggressive antifungal therapy.
Ventorino, Valeria; Aliberti, Alberto; Faraco, Vincenza; Robertiello, Alessandro; Giacobbe, Simona; Ercolini, Danilo; Amore, Antonella; Fagnano, Massimo; Pepe, Olimpia
2015-02-01
The aims of this study were to evaluate the microbial diversity of different lignocellulosic biomasses during degradation under natural conditions and to isolate, select, characterise new well-adapted bacterial strains to detect potentially improved enzyme-producing bacteria. The microbiota of biomass piles of Arundo donax, Eucalyptus camaldulensis and Populus nigra were evaluated by high-throughput sequencing. A highly complex bacterial community was found, composed of ubiquitous bacteria, with the highest representation by the Actinobacteria, Proteobacteria, Bacteroidetes and Firmicutes phyla. The abundances of the major and minor taxa retrieved during the process were determined by the selective pressure produced by the lignocellulosic plant species and degradation conditions. Moreover, cellulolytic bacteria were isolated using differential substrates and screened for cellulase, cellobiase, xylanase, pectinase and ligninase activities. Forty strains that showed multienzymatic activity were selected and identified. The highest endo-cellulase activity was seen in Promicromonospora sukumoe CE86 and Isoptericola variabilis CA84, which were able to degrade cellulose, cellobiose and xylan. Sixty-two percent of bacterial strains tested exhibited high extracellular endo-1,4-ß-glucanase activity in liquid media. These approaches show that the microbiota of lignocellulosic biomasses can be considered an important source of bacterial strains to upgrade the feasibility of lignocellulose conversion for the `greener' technology of second-generation biofuels.
Energy Technology Data Exchange (ETDEWEB)
Sanna, G.; Tomassetti, G. [L`Aquila Univ. (Italy). Dipt. di Fisica
1998-02-01
The discontinuities in the flow fields (both tangential and shocks) are considered and the equations for the quantities conserved across them are written. The post-shock flow variables are expressed by the Mach number of the incident supersonic flow and its deflection angle operated by rigid wall. Normal and oblique shocks are considered and graphs and polar diagrams are introduced. Then the reflections of a shock wave operated by a rigid wall and by the boundary between a jet and a stagnating gas are analyzed. Finally, the interactions between two distinct shock waves are considered. [Italiano] Vengono considerate le discontinuita` (tangenziali e shocks) nei campi di flusso e sono scritte le equazioni per le quantita` che si conservano attraverso di esse. Le variabili del flusso oltre lo shock sono espresse in funzione del numero di Mach del flusso supersonico incidente e dell`angolo di deflessione di questo operato da una parete rigida. I casi di shock normale, obliquo e distaccato sono considerati e sono introdotti grafici vari e rappresentazioni polari. Sono quindi considerate le riflessioni di un fronte di shock da una parete rigida e dalla frontiera tra un gas in moto ed uno stagnante. Sono infine considerate le diverse interazioni tra due shock distinti.
A radioactivity study of mollusca distributed along the Syrian coast
International Nuclear Information System (INIS)
Al-Masri, M. S.; Ammar, I.; Mamish, S.; Haleem, M. A.
2006-10-01
In the present work, radioactivity has been studied in several Mollusca collected from four selected sites(Al Basset, Lattakia, Banise and Tartous) along the Syrian coast. Concentration Factors (CF) of radionuclides (Lead-210, Polonium-210, Uranium Isotopes, Potassium-40 and Cesium-137) in mussels and shells of Mollusca have been calculated in order to determine the species that could be used as Bioindicators for these isotopes. Statistical analysis of the results using the box plot method showed that the mussels of Spondylus spinosus and Chama pacifica can be used as biomonitor for the studied radionuclides in addition to shell of Strombus persicus and Spondylus spinosus. While the mussels of Brachidonta variabilis and Spondylus spinosus have shown good selectivity for Cd and Pb and Pinctada radiate for Zn and Thais haemostoma for Cu. In addition, the migrant Mullusca from the Red Sea, Strombus persicus, can be used as biomonitor for lead, Zn and Cu, Cd, while the shell of Thais haemostoma for lead. However, the importance of the results of the present study that are considered as a baseline data for radionuclides in Mullusca distributed along the Syria coast and it is the only study in the eastern Mediterranean basin, that defined the Mollusca species which could be use as biomonitors for radionuclides. (Authors)
Candan, Esra Deniz
2018-02-26
The aim of this study is to investigate the fungal diversity of green turtle nests and to examine phylogenetic relationships among these isolates. During the nesting season, samples of intra-nest sand and failed eggs were collected from 25% of the surviving nests in Sugözü Beaches, which are amongst the most important nesting beaches for endangered green turtles in the Mediterranean. Twenty-three fungi were identified by molecular techniques. Fungal isolates belonged to genera Aspergillus, Emericella, Rhizopus, Actinomucor and Apophysomyces with two undescribed species. Aspergillus variecolor, Aspergillus quadrilinieatus, Aspergillus tubingensis, Rhizopus oryzae, Actinomucor elegans and Apophysomyces variabilis were firstly detected in all sea turtle nests within this study. Our results demonstrate that 36.4% of the nests had fungal contamination. Also hatching success of the nests contaminated by fungi were significantly lower than the uncontaminated nests (P = 0.029). Also, this may represent a threat to marine turtles and a risk for the health of conservation workers. This study is the first molecular phylogenetic study associated with sea turtle nests in the eastern Mediterranean coast and contributes to the wider body of literature on fungal invasion of sea turtle nests with firstly isolated species. These findings are important for improving potential conservation measures for the nest sites.
Screening of wild type Streptomyces isolates able to overproduce clavulanic acid
Directory of Open Access Journals (Sweden)
Daniela A. Viana Marques
2014-09-01
Full Text Available The selection of new microorganisms able to produce antimicrobial compounds is hoped for to reduce their production costs and the side effects caused by synthetic drugs. Clavulanic acid is a β-lactam antibiotic produced by submerged culture, which is widely used in medicine as a powerful inhibitor of β-lactamases, enzymes produced by bacteria resistant to antibiotics such penicillin and cephalosporin. The purpose of this work was to select the best clavulanic acid producer among strains of Streptomyces belonging to the Microorganism Collection of the Department of Antibiotics of the Federal University of Pernambuco (DAUFPE. Initially, the strains were studied for their capacity to inhibit the action of β-lactamases produced by Klebsiella aerogenes ATCC 15380. From these results, five strains were selected to investigate the batch kinetics of growth and clavulanic acid production in submerged culture carried out in flasks. The results were compared with the ones obtained by Streptomyces clavuligerus ATCC 27064 selected as a control strain. The best clavulanic acid producer was Streptomyces DAUFPE 3060, molecularly identified as Streptomyces variabilis, which increased the clavulanic acid production by 28% compared to the control strain. This work contributes to the enlargement of knowledge on new Streptomyces wild strains able to produce clavulanic acid by submerged culture.
Directory of Open Access Journals (Sweden)
F. MODIGLIANI
2013-12-01
Full Text Available Oltre al reddito ci sono altri due influenze principali sul risparmio nazionale : la politica fiscale e l'inflazione . Gli autori costruiscono un modello dell'economia italiana per analizzare l'impatto di queste due variabili correlate. Si è concluso che i disavanzi pubblici del passato hanno prodotto una riduzione proporzionale del risparmio nazionale . A partire dai primi anni 1960 risparmi nazionali sono diminuiti di quasi 9 punti percentuali , di cui 3,6 punti percentuali possono essere contabilizzati da un aumento del 4 per cento nel deficit del governo . I risultati per quanto riguarda l'impatto dell'inflazione non sono definiti , e non è possibile stabilirli .Apart from income there are two other main influences on national savings: fiscal policy and inflation. The authors construct a model of the Italian economy to analyse the impact of these two related variables. It is concluded that past government deficits have produced a proportional reduction in national saving. Since the early 1960s national savings have declined by nearly 9 percentage points, of which 3.6 percentage points can be accounted for by a 4 per cent increase in the government's deficit. The results regarding the impact of inflation are not definite, and no conclusion is drawn.JEL: E21, E31, E62,
Directory of Open Access Journals (Sweden)
Alessandro Massolo
2003-10-01
Full Text Available Nonostante la loro grande diffusione negli ultimi decenni, i modelli di valutazione ambientale (MVA trovano tuttoggi scarsa applicazione pratica. Molte difficoltà s?incontrano non solo nel loro concreto utilizzo, ma anche nella validazione e applicazione. Spesso, il problema fondamentale consiste nella difficoltà di reperire dati biologici e geografici su grande scala che siano attendibili e omogenei. La gestione spesso però richiede valutazioni su grande scala e il problema diventa quindi rilevante. Nel presente lavoro sono descritte alcune procedure di modellizzazione e verifica a partire dai risultati di uno studio condotto sul capriolo nel Parco Nazionale del Pollino. A tale scopo, sono state utilizzate due delle più diffuse tecniche statistiche multivariate (Analisi della Funzione Discriminante e Regressione Logistica, confrontando modelli formulati con e senza l?uso di indici di complessità del paesaggio come variabili predittive. L?analisi è stata condotta a grande scala compatibilmente con le stime delle dimensioni degli home range della specie. Lo sviluppo di più modelli ha permesso di verificare l?adeguatezza delle tecniche utilizzate e l?efficacia dei più comuni indici di paesaggio, nel predire la distribuzione della specie. Le analisi ambientali sono state effettuate mediante l?uso di ArcView 3.2 e della sua estensione Patch Analyst, a partire da cartografia informatizzata come la carta di uso del suolo Corine Land Cover e i punti quotati IGMI. I modelli sono stati formulati da un set di dati provenienti dell?Appennino centro-settentrionale e validati con un set di dati locali (area di distribuzione e avvistamenti diretti, raccolti tra il 2001 e il 2003. Il confronto tra i modelli si è basato sulle loro capacità di classificazione (sensitività e sensibilità. Gli indici di paesaggio sono risultati critici nel predire correttamente la distribuzione della specie. Nella fase di validazione sui dati di partenza 3 dei 4 modelli
Energy Technology Data Exchange (ETDEWEB)
Borelli, L.; Tagliaferro, B. (R.B.L. Riello Bruciatori, Legnago Spa, Legnago (Italy)); Cossalter, V.; Da Lio, M. (Padua Univ. (Italy). Dip. di Ingegneria Meccanica)
1993-08-01
A new class of fuel oil burners has recently been developed by an Italian firm with the aim of obtaining high performances in terms of both energy efficiency and air pollution abatement. The innovative feature of these burners is that they are equipped with a device which permits the automatic and optimum regulation of the air fuel mixture independent of ambient and operating conditions. To reduce costs, the regulation system is a mechanical one instead of electronic which would require an expensive lambda probe. The mechanical regulating system controls air intake by simply taking into account two main combustion factors - ambient temperature and the nominal fuel flow rate. The special cam mechanism is thus classified as one which performs a single function with two degrees of freedom, i.e., the independent variables of ambient temperature and nominal fuel flow. One of the air intake valve's movements is governed by a temperature transducer, the other (primary), by a screw which allows the registering of the air flow during burner installation or upon completion of periodic maintenance checks. In addition to optimizing combustion control, this control technique affords the possibility to adapt the air flow to the different fuel flows obtained by changing the type of nozzle or supply pressure.
Mumby, Peter J; van Woesik, Robert
2014-05-19
Coral reefs are highly sensitive to the stress associated with greenhouse gas emissions, in particular ocean warming and acidification. While experiments show negative responses of most reef organisms to ocean warming, some autotrophs benefit from ocean acidification. Yet, we are uncertain of the response of coral reefs as systems. We begin by reviewing sources of uncertainty and complexity including the translation of physiological effects into demographic processes, indirect ecological interactions among species, the ability of coral reefs to modify their own chemistry, adaptation and trans-generational plasticity. We then incorporate these uncertainties into two simple qualitative models of a coral reef system under climate change. Some sources of uncertainty are far more problematic than others. Climate change is predicted to have an unambiguous negative effect on corals that is robust to several sources of uncertainty but sensitive to the degree of biogeochemical coupling between benthos and seawater. Macroalgal, zoanthid, and herbivorous fish populations are generally predicted to increase, but the ambiguity (confidence) of such predictions are sensitive to the source of uncertainty. For example, reversing the effect of climate-related stress on macroalgae from being positive to negative had no influence on system behaviour. By contrast, the system was highly sensitive to a change in the stress upon herbivorous fishes. Minor changes in competitive interactions had profound impacts on system behaviour, implying that the outcomes of mesocosm studies could be highly sensitive to the choice of taxa. We use our analysis to identify new hypotheses and suggest that the effects of climatic stress on coral reefs provide an exceptional opportunity to test emerging theories of ecological inheritance. Copyright © 2014 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Blanc, Guillaume; Agarkova, Irina; Grimwood, Jane; Kuo, Alan; Brueggeman, Andrew; Dunigan, David D.; Gurnon, James; Ladunga, Istvan; Lindquist, Erika; Lucas, Susan; Pangilinan, Jasmyn; Proschold, Thomas; Salamov, Asaf; Schmutz, Jeremy; Weeks, Donald; Tamada, Takashi; Lomsadze, Alexandre; Borodovsky, Mark; Claverie, Jean-Michel; Grigoriev, Igor V.; Van Etten, James L.
2012-02-13
Background Little is known about the mechanisms of adaptation of life to the extreme environmental conditions encountered in polar regions. Here we present the genome sequence of a unicellular green alga from the division chlorophyta, Coccomyxa subellipsoidea C-169, which we will hereafter refer to as C-169. This is the first eukaryotic microorganism from a polar environment to have its genome sequenced. Results The 48.8 Mb genome contained in 20 chromosomes exhibits significant synteny conservation with the chromosomes of its relatives Chlorella variabilis and Chlamydomonas reinhardtii. The order of the genes is highly reshuffled within synteny blocks, suggesting that intra-chromosomal rearrangements were more prevalent than inter-chromosomal rearrangements. Remarkably, Zepp retrotransposons occur in clusters of nested elements with strictly one cluster per chromosome probably residing at the centromere. Several protein families overrepresented in C. subellipsoidae include proteins involved in lipid metabolism, transporters, cellulose synthases and short alcohol dehydrogenases. Conversely, C-169 lacks proteins that exist in all other sequenced chlorophytes, including components of the glycosyl phosphatidyl inositol anchoring system, pyruvate phosphate dikinase and the photosystem 1 reaction center subunit N (PsaN). Conclusions We suggest that some of these gene losses and gains could have contributed to adaptation to low temperatures. Comparison of these genomic features with the adaptive strategies of psychrophilic microbes suggests that prokaryotes and eukaryotes followed comparable evolutionary routes to adapt to cold environments.
A radioactivity study of mollusca distributed along the Syrian coast
International Nuclear Information System (INIS)
Al-Masri, M. S.; Ammar, I.; Mamish, S.; Haleem, M. A.
2008-01-01
In the present work, radioactivity has been studied in several Mollusca collected from four selected sites (Al Basset, Latakia, Banise and Tartous) along the Syrian coast. Concentration Factors (CF) of radionuclides (Lead-210, Polonium-210, Uranium Isotopes, Potassium-40 and Cesium-137) in mussels and shells of Mollusca have been calculated in order to determine the species that could be used as Bioindicators for these isotopes. Statistical analysis of the results using the box plot method showed that the mussels of Spondylus gaederopus spinosus and Chama pacifica can be used as biomonitor for the studied radionuclides in addition to shell of Strombus decorus persicus and Spondylus gaederopus spinosus. While the mussels of Brachidonta variabilis and Spondylus gaederopus spinosus have shown good selectivity for Cd and Pb and Pinctada radiate for Zn and Thais haemostoma for Cu. In addition, the migrant Mullusca from the Red Sea, Strombus decoruspersicus, can be used as biomonitor for lead, Zn and Cu, Cd, while the shell of Thais haemostoma for lead. However, the importance of the results of the present study that are considered as a baseline data for radionuclides in Mullusca distributed along the Syria coast and it is the only study in the eastern Mediterranean basin, that defined the Mollusca species which could be use as biomonitors for radionuclides. (Authors)
Effect of mustard gas hydrolysis products on the development of water-bloom forming cyanobacteria
Directory of Open Access Journals (Sweden)
Zaytseva Tatyana
2017-03-01
Full Text Available Mustard gas and its hydrolysis products (MGHP belong to stable organochlorine compounds with high toxicity and broad spectrum of activity. Since the Second World War many aquatic ecosystems including the Baltic and the Adriatic Sea as well as the coastal waters of Japan, the USA, the UK, Australia have been contaminated with mustard gas due to the dumping of chemical weapon. Mustard gas and its hydrolysis products have a negative impact on aquatic life including microbiota. The aim of this work was to define the effect of MGHP on the growth, photosynthetic activity and synthesis of secondary metabolites by water-bloom forming cyanobacteria Trichormus variabilis, Aphanizomenon flos-aquae, Microcystis aeruginosa, Nodularia spumigena. Microbiological, chromatographic, spectrophotometric methods were used. The growth inhibition test with MGHP on cyanobacteria showed influence on the concentration EC50 within the range of 5.5 – 11.2 mg of organochlorine compounds (ОCC per liter. The synthesis of chlorophyll a was also decreased. It was shown that the chlorophyll synthesis was more sensitive to MGHP than the growth of cyanobacteria. NGHP induced enhanced excretion of exopolysaccharides. Low concentration of MGHP – 0.3 mg OCC/l - promoted the growth of toxigenic cyanobacterium Microcystis aeruginosa and increased microcystin-LR concentration in the environment. enhanced excretion of such metabolites as polysaccharides and cyanotoxins has a serious negative impact on water pollution due to MGHP.
Brown, H.E.; Yates, K.F.; Dietrich, G.; MacMillan, K.; Graham, C.B.; Reese, S.M.; Helterbrand, Wm. S.; Nicholson, W.L.; Blount, K.; Mead, P.S.; Patrick, S.L.; Eisen, R.J.
2011-01-01
In the United States, tickborne diseases occur focally. Missouri represents a major focus of several tickborne diseases that includes spotted fever rickettsiosis, tularemia, and ehrlichiosis. Our study sought to determine the potential risk of human exposure to human-biting vector ticks in this area. We collected ticks in 79 sites in southern Missouri during June 7-10, 2009, which yielded 1,047 adult and 3,585 nymphal Amblyomma americanum, 5 adult Amblyomma maculatum, 19 adult Dermacentor variabilis, and 5 nymphal Ixodes brunneus. Logistic regression analysis showed that areas posing an elevated risk of exposure to A. americanum nymphs or adults were more likely to be classified as forested than grassland, and the probability of being classified as elevated risk increased with increasing relative humidity during the month of June (30-year average). Overall accuracy of each of the two models was greater than 70% and showed that 20% and 30% of the state were classified as elevated risk for human exposure to nymphs and adults, respectively. We also found a significant positive association between heightened acarologic risk and counties reporting tularemia cases. Our study provides an updated distribution map for A. americanum in Missouri and suggests a wide-spread risk of human exposure to A. americanum and their associated pathogens in this region. Copyright ?? 2011 by The American Society of Tropical Medicine and Hygiene.
Martino, Elena; Morin, Emmanuelle; Grelet, Gwen-Aëlle; Kuo, Alan; Kohler, Annegret; Daghino, Stefania; Barry, Kerrie W; Cichocki, Nicolas; Clum, Alicia; Dockter, Rhyan B; Hainaut, Matthieu; Kuo, Rita C; LaButti, Kurt; Lindahl, Björn D; Lindquist, Erika A; Lipzen, Anna; Khouja, Hassine-Radhouane; Magnuson, Jon; Murat, Claude; Ohm, Robin A; Singer, Steven W; Spatafora, Joseph W; Wang, Mei; Veneault-Fourrey, Claire; Henrissat, Bernard; Grigoriev, Igor V; Martin, Francis M; Perotto, Silvia
2018-02-01
Some soil fungi in the Leotiomycetes form ericoid mycorrhizal (ERM) symbioses with Ericaceae. In the harsh habitats in which they occur, ERM plant survival relies on nutrient mobilization from soil organic matter (SOM) by their fungal partners. The characterization of the fungal genetic machinery underpinning both the symbiotic lifestyle and SOM degradation is needed to understand ERM symbiosis functioning and evolution, and its impact on soil carbon (C) turnover. We sequenced the genomes of the ERM fungi Meliniomyces bicolor, M. variabilis, Oidiodendron maius and Rhizoscyphus ericae, and compared their gene repertoires with those of fungi with different lifestyles (ecto- and orchid mycorrhiza, endophytes, saprotrophs, pathogens). We also identified fungal transcripts induced in symbiosis. The ERM fungal gene contents for polysaccharide-degrading enzymes, lipases, proteases and enzymes involved in secondary metabolism are closer to those of saprotrophs and pathogens than to those of ectomycorrhizal symbionts. The fungal genes most highly upregulated in symbiosis are those coding for fungal and plant cell wall-degrading enzymes (CWDEs), lipases, proteases, transporters and mycorrhiza-induced small secreted proteins (MiSSPs). The ERM fungal gene repertoire reveals a capacity for a dual saprotrophic and biotrophic lifestyle. This may reflect an incomplete transition from saprotrophy to the mycorrhizal habit, or a versatile life strategy similar to fungal endophytes. © 2018 The Authors. New Phytologist © 2018 New Phytologist Trust.
[Analysis of factors predicting early unplanned readmissions].
Di Domenico, Gabriella; Tersigni, Ivan; Federico, Bruno; Leuter, Cinzia
2016-01-01
OBIETTIVI: determinare i fattori associati ai ricoveri ripetuti per identificare i pazienti a rischio di riospedalizzazione entro i 30 giorni dalla dimissione. DISEGNO: analisi retrospettiva delle dimissioni nell'anno 2013 attraverso le schede di dimissione ospedaliera (SDO). 3.900 pazienti ricoverati presso il presidio ospedaliero "Fabrizio Spaziani" di Frosinone. PRINCIPALI MISURE DI OUTCOME: analisi bivariata per l'analisi dell'associazione tra variabili. La regressione logistica è stata utilizzata per identificare i fattori di rischio associati al ricovero ripetuto. RISULTATI: tra i 3.900 pazienti considerati, il 12,8% ha avuto una riammissione non programmata entro un mese dalla dimissione precedente per le stesse categorie diagnostiche principali (MCD). Sono state rilevate differenze statisticamente significative tra i pazienti con e senza ricovero ripetuto per età, durata della degenza, titolo di studio, condizione occupazionale e diagnosi. I fattori che aumentano la probabilità di una riospedalizzazione sono il vivere da solo, la condizione di pensionato o casalinga, una degenza più lunga e alcune diagnosi, fra cui malattie dell'apparato respiratorio, del sistema nervoso e dell'apparato urinario. CONCLUSIONE: alcune caratteristiche sociodemografiche e la diagnosi dei pazienti ospedalizzati sono associate al rischio di riospedalizzazione entro 30 giorni dalla dimissione. I dati disponibili nell'archivio delle SDO possono essere utilizzati per un'identificazione dei pazienti a rischio sui quali definire specifici piani di dimissione.
Natural regeneration of trees in three types of afforested stands in the Taihang Mountains, China.
Directory of Open Access Journals (Sweden)
Xitian Yang
Full Text Available Natural regeneration is the natural process by which plants replace themselves. It is a cost-effective way to re-establish vegetation, and it helps to preserve genetic identity and diversity. In this study, we investigated the natural regeneration of trees in three types of afforested stands in the Taihang Mountains, China, which were dominated by Robinia pseudoacacia (black locust, Quercus variabilis (Chinese cork oak and Platycladus orientalis (Chinese arborvitae respectively. A consistent pattern was found among the three types of stands, being that the density of seedlings was positively correlated with the overstory canopy cover and negatively correlated with the covers of shrub, herb and litter layers. While a positive correlation between the density of seedlings and stand age was found for the conifer stands, negative correlations were found for the two types of broadleaf stands. Correlations between the density of saplings and the stand attributes were not consistent among the three types of stands. The two types of broadleaf stands had higher densities of seedlings and saplings than the conifer stands. While the broadleaf stands had adequate recruits for regeneration, the conifer stands did not have enough recruits. Our findings suggest that the overstory canopy should be prevented from being disturbed, any reduction of the canopy cover will decrease the recruits and affect the regeneration.
Bleaching of reef coelenterates in the San Blas Islands, Panama
Lasker, Howard R.; Peters, Esther C.; Coffroth, Mary Alice
1984-12-01
Starting in June 1983, 25 species of hermatypic corals, gorgonians, hydrocorals, anemones and zoanthids in the San Blas Islands, Panama, began showing signs of a loss of colour leading in some cases to a white “bleached” appearance. Histologic examination of six coral species indicated that bleaching was associated with drastic reductions in the density of zooxanthellae and with the atrophy and necrosis of the animal tissue. The severity of the bleaching varied among species and many species were unaffected. The species most extensively affected were: Agaricia spp., which became completely bleached and frequently died; Montastraea annularis which bleached and continued to survive; and Millepora spp. which bleached white but quickly regained their colouration. Shallow reefs dominated by Agaricia spp. suffered the most extensive bleaching. At one site, Pico Feo, 99% of the Agaricia (32% of the living cover) was bleached. On fore reers, which were dominated by Agaricia spp. and M. annularis, the proportion of M. annularis bleached ranged from 18 to 100% and that of Agaricia spp. from 30 to 53%. Transects at Sail Rock and House Reef were surveyed in August 1983 and January 1984. At those sites, 53% of the Agaricia cover died between August and January. The remaining living cover of Agaricia and of all other species exhibited normal colouration in January. Salinity and temperature were monitored every second day at 4 m depth between May 10 and August 28, 1983 at one of the localities. Bleaching was first observed within two weeks of a 2 °C rise in temperature which occurred in late May 1983. Temperatures remained at or above 31.5 °C for the following 3 weeks and were at or above 30 °C for an additional 4 weeks. The bleaching of corals in the San Blas was most likely due to those elevanted temperatures.
Impact of Submarine Groundwater Discharge on Marine Water Quality and Reef Biota of Maui.
Directory of Open Access Journals (Sweden)
Daniel W Amato
Full Text Available Generally unseen and infrequently measured, submarine groundwater discharge (SGD can transport potentially large loads of nutrients and other land-based contaminants to coastal ecosystems. To examine this linkage we employed algal bioassays, benthic community analysis, and geochemical methods to examine water quality and community parameters of nearshore reefs adjacent to a variety of potential, land-based nutrient sources on Maui. Three common reef algae, Acanthophora spicifera, Hypnea musciformis, and Ulva spp. were collected and/or deployed at six locations with SGD. Algal tissue nitrogen (N parameters (δ15N, N %, and C:N were compared with nutrient and δ15N-nitrate values of coastal groundwater and nearshore surface water at all locations. Benthic community composition was estimated for ten 10-m transects per location. Reefs adjacent to sugarcane farms had the greatest abundance of macroalgae, low species diversity, and the highest concentrations of N in algal tissues, coastal groundwater, and marine surface waters compared to locations with low anthropogenic impact. Based on δ15N values of algal tissues, we estimate ca. 0.31 km2 of Kahului Bay is impacted by effluent injected underground at the Kahului Wastewater Reclamation Facility (WRF; this region is barren of corals and almost entirely dominated by colonial zoanthids. Significant correlations among parameters of algal tissue N with adjacent surface and coastal groundwater N indicate that these bioassays provided a useful measure of nutrient source and loading. A conceptual model that uses Ulva spp. tissue δ15N and N % to identify potential N source(s and relative N loading is proposed for Hawai'i. These results indicate that SGD can be a significant transport pathway for land-based nutrients with important biogeochemical and ecological implications in tropical, oceanic islands.
Impact of Submarine Groundwater Discharge on Marine Water Quality and Reef Biota of Maui.
Amato, Daniel W; Bishop, James M; Glenn, Craig R; Dulai, Henrietta; Smith, Celia M
2016-01-01
Generally unseen and infrequently measured, submarine groundwater discharge (SGD) can transport potentially large loads of nutrients and other land-based contaminants to coastal ecosystems. To examine this linkage we employed algal bioassays, benthic community analysis, and geochemical methods to examine water quality and community parameters of nearshore reefs adjacent to a variety of potential, land-based nutrient sources on Maui. Three common reef algae, Acanthophora spicifera, Hypnea musciformis, and Ulva spp. were collected and/or deployed at six locations with SGD. Algal tissue nitrogen (N) parameters (δ15N, N %, and C:N) were compared with nutrient and δ15N-nitrate values of coastal groundwater and nearshore surface water at all locations. Benthic community composition was estimated for ten 10-m transects per location. Reefs adjacent to sugarcane farms had the greatest abundance of macroalgae, low species diversity, and the highest concentrations of N in algal tissues, coastal groundwater, and marine surface waters compared to locations with low anthropogenic impact. Based on δ15N values of algal tissues, we estimate ca. 0.31 km2 of Kahului Bay is impacted by effluent injected underground at the Kahului Wastewater Reclamation Facility (WRF); this region is barren of corals and almost entirely dominated by colonial zoanthids. Significant correlations among parameters of algal tissue N with adjacent surface and coastal groundwater N indicate that these bioassays provided a useful measure of nutrient source and loading. A conceptual model that uses Ulva spp. tissue δ15N and N % to identify potential N source(s) and relative N loading is proposed for Hawai'i. These results indicate that SGD can be a significant transport pathway for land-based nutrients with important biogeochemical and ecological implications in tropical, oceanic islands.
Kodama, Yuuki; Fujishima, Masahiro
2012-10-01
The association of ciliate Paramecium bursaria with symbiotic Chlorella sp. is a mutualistic symbiosis. However, both the alga-free paramecia and symbiotic algae can still grow independently and can be reinfected experimentally by mixing them. Effects of the host's nutritional conditions against the symbiotic algal cell division and density were examined during early reinfection. Transmission electron microscopy revealed that algal cell division starts 24 h after mixing with alga-free P. bursaria, and that the algal mother cell wall is discarded from the perialgal vacuole membrane, which encloses symbiotic alga. Labelling of the mother cell wall with Calcofluor White Stain, a cell-wall-specific fluorochrome, was used to show whether alga had divided or not. Pulse labelling of alga-free P. bursaria cells with Calcofluor White Stain-stained algae with or without food bacteria for P. bursaria revealed that the fluorescence of Calcofluor White Stain in P. bursaria with bacteria disappeared within 3 days after mixing, significantly faster than without bacteria. Similar results were obtained both under constant light and dark conditions. This report is the first describing that the cell division and density of symbiotic algae of P. bursaria are controlled by the host's nutritional conditions during early infection. © 2012 Society for Applied Microbiology and Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
Guillaume Blanc
Full Text Available Paramecium bursaria chlorella virus 1 (PBCV-1 is the prototype of the genus Chlorovirus (family Phycodnaviridae that infects the unicellular, eukaryotic green alga Chlorella variabilis NC64A. The 331-kb PBCV-1 genome contains 416 major open reading frames. A mRNA-seq approach was used to analyze PBCV-1 transcriptomes at 6 progressive times during the first hour of infection. The alignment of 17 million reads to the PBCV-1 genome allowed the construction of single-base transcriptome maps. Significant transcription was detected for a subset of 50 viral genes as soon as 7 min after infection. By 20 min post infection (p.i., transcripts were detected for most PBCV-1 genes and transcript levels continued to increase globally up to 60 min p.i., at which time 41% or the poly (A+-containing RNAs in the infected cells mapped to the PBCV-1 genome. For some viral genes, the number of transcripts in the latter time points (20 to 60 min p.i. was much higher than that of the most highly expressed host genes. RNA-seq data revealed putative polyadenylation signal sequences in PBCV-1 genes that were identical to the polyadenylation signal AAUAAA of green algae. Several transcripts have an RNA fragment excised. However, the frequency of excision and the resulting putative shortened protein products suggest that most of these excision events have no functional role but are probably the result of the activity of misled splicesomes.
Soil fungi for mycoremediation of arsenic pollution in agriculture soils.
Singh, M; Srivastava, P K; Verma, P C; Kharwar, R N; Singh, N; Tripathi, R D
2015-11-01
Soil arsenic (As) contamination of food-chains and public health can be mitigated through fungal bioremediation. To enumerate culturable soil fungi, soils were collected from the As-contaminated paddy fields (3-35 mg kg(-1) ) of the middle Indo-Gangetic Plains. Total 54 fungal strains were obtained and identified at their molecular level. All strains were tested for As tolerance (from 100 to 10,000 mg l(-1) arsenate). Fifteen fungal strains, tolerant to 10,000 mg l(-1) arsenate, were studied for As removal in-vivo for 21 days by cultivating them individually in potato dextrose broth enriched with 10 mg l(-1) As. The bioaccumulation of As in fungal biomass ranged from 0·023 to 0·259 g kg(-1). The biovolatilized As ranged from 0·23 to 6·4 mg kg(-1). Higher As bioaccumulation and biovolatilization observed in the seven fungal strains, Aspergillus oryzae FNBR_L35; Fusarium sp. FNBR_B7, FNBR_LK5 and FNBR_B3; Aspergillus nidulans FNBR_LK1; Rhizomucor variabilis sp. FNBR_B9; and Emericella sp. FNBR_BA5. These fungal strains were also tested and found suitable for significant plant growth promotion in the calendula, withania and oat plants in a greenhouse based pot experiment. These fungal strains can be used for As remediation in As-contaminated agricultural soils. © 2015 The Society for Applied Microbiology.
L'integrazione delle pratiche di Sanitá Pubblica in Europa
Directory of Open Access Journals (Sweden)
H. Waller
2003-05-01
Full Text Available
Rilevanza dell’argomento: questo tema è diventato un importante problema di Sanità Pubblica anche in Europa. Studi epidemiologici mostrano che quasi tutti i problemi di salute e la prevalenza di malattie e di disabilità sono più frequenti negli strati sociali più bassi, indipendentemente dal modo in cui la classe sociale viene misurata (con qualche eccezione come ad esempio il cancro della mammella e le allergie. Inoltre, l’associazione tra svantaggio sociale e malattia è divenuta sempre più forte negli ultimi decenni (Marmot e Wilkinson, 1999.
La rilevanza del tema è diventata ancora più grande dal momento che in molti Paesi candidati all’ingresso nell’Unione Europea sono frequenti povertà e disgregazione sociale (Mackenbach e Bakker, 2002. Future necessita’ di ricerca: in futuro, tutte le indagini nazionali sulla salute dovranno includere la classe sociale tra le variabili registrate regolarmente. La ricerca dovrà infatti concentrarsi sulla spiegazione della correlazione tra classe sociale e malattia usando studi longitudinali ed includendo fattori sociali, oltre a determinanti medico-sanitari.
La correlazione tra classe sociale e la presenza di problemi di salute va studiata in entrambe le direzioni: un basso status sociale come determinante di malattia, come pure la presenza di problemi di salute come causa della discesa nella “scala sociale”. La pratica di Sanità Pubblica e lo sviluppo di politiche sociali devono affrontare adeguatamente entrambe le ipotesi.
Directory of Open Access Journals (Sweden)
Vineeta Singh
2016-12-01
Full Text Available The search for novel bioactive compounds from the natural environment has been rapidly increased with the increase in multi-drug resistant (MDR pathogens. In the present study, the antimicrobial potential of novel actinomycetes has been evaluated by initial screening of six soil samples. Primary and secondary screening was performed against Bacillus subtilis, Staphylococcus aureus, Escherichia coli, Candida albicans, Candida tropicalis, Trichophyton rubrum, and other MDR bacterial and fungal test strains, and at the end thirteen active isolates were selected for further study. Microbial strains were identified on the basis of growth conditions and other biochemical characters. Five most active microbial strains were identified using 16S rRNA sequence homology and designated as Streptomyces xanthophaeus MTCC 11938, Streptomyces variabilis MTCC 12266, Streptomyces xanthochromogenes MTCC 11937, Streptomyces levis EU 124569 and Streptomyces sp. NCIM 5500. Four antibacterial and three antifungal compounds isolated from the above five isolates were purified and partially characterized using UV absorption and IR spectra. Two antibacterial metabolites, belong to chromone and peptide antibiotic, respectively. The antifungal compounds were found to be of non-polyene nature. In conclusion, we study the isolation of novel bacterial strains of actinomycetes for producing novel compounds having antibacterial and antifungal activities from the unexplored agro-ecological niches of India. Also, this study paves the way for further characterization of these isolates of Streptomyces sp. for their optimum utilization for antimicrobial purposes.
Zhu, Longbao; Feng, Guoqiang; Ge, Fei; Song, Ping; Wang, Taotao; Liu, Yi; Tao, Yugui; Zhou, Zhemin
2018-06-08
The phenylalanine ammonia-lyase (AvPAL) from Anabaena variabilis catalyzes the amination of substituent trans-cinnamic acid (t-CA) to produce racemic D,L-enantiomer arylalanine mixture owing to its low stereoselectivity. To produce high optically pure D-arylalanine, a modified AvPAL with high D-selectivity is expected. Based on the analyses of catalytic mechanism and structure, the Asn347 residue in the active site was proposed to control stereoselectivity. Therefore, Asn347 was mutated to construct mutant AvPAL-N347A, the stereoselectivity of AvPAL-N347A for D-enantiomer arylalanine was 2.3-fold higher than that of wild-type AvPAL (WtPAL). Furthermore, the residual L-enantiomer product in reaction solution could be converted into the D-enantiomer product through stereoselective oxidation by PmLAAD and nonselective reduction by reducing agent NH 3 BH 3 . At optimal conditions, the conversion rate of t-CA and optical purity (enantiomeric excess (ee D )) of D-phenylalanine reached 82% and exceeded 99%, respectively. The two enzymes displayed activity toward a broad range of substrate and could be used to efficiently synthesize D-arylalanine with different groups on the phenyl ring. Among these D-arylalanines, the yield of m-nitro-D-phenylalanine was highest and reached 96%, and the ee D exceeded 99%. This one-pot synthesis using AvPAL and PmLAAD has prospects for industrial application.
In vitro inactivation of hepatic microsomal phospholipase A2 by the marine natural product manoalide
International Nuclear Information System (INIS)
Master, M.M.; Jacobs, R.S.
1986-01-01
The effects of manoalide (MLD) and several analogs (isolated from the sponge Luffariella variabilis) on mouse hepatic microsomal phospholipase A 2 (PLA 2 ) activity was investigated. Microsomal PLA 2 , a membrane bound, Ca ++ dependent enzyme with an alkaline pH optimum, functions in intracellular phospholipid turnover. In vitro PLA 2 activity was assayed by preincubating MLD or analogs (2.5-100μM) with microsomes for 60 min. at 37 0 C, combining this mixture with 14 C-phosphatidylcholine and CaCl 2 , and incubating at 37 0 C for 40 minutes. Enzyme activity was quantitated by measurement of the extracted 14 C-arachidonic acid product. MLD inhibited PLA 2 in a dose-dependent manner, with an IC 50 = 94μM. Lineweaver-Burk analysis suggests that MLD inhibits PLA 2 noncompetitively. One of the analogs, producing a comparable dose-response curve to MLD, was found to be more potent (IC 50 = 33μM). Another analog facilitated PLA 2 activity (15%) at 25μM, followed by inactivation at higher doses (IC 50 > 100 μM). Facilitation of PLA 2 activity was seen with concentrations as low as 2.5μM of a third analog, and significant inactivation of PLA 2 was evident. These results indicate that MLD is not as potent against microsomal PLA 2 as has been shown with purified bee venom and cobra venom PLA 2 's
Occurrence of Hirudinea species in a post urban reach of a Patagonian mountain stream
Directory of Open Access Journals (Sweden)
M. Laura Miserendino
2014-09-01
Full Text Available Temporal (May 2005 to February 2006 and habitat distribution (pools and riffles of Hirudinea species was analyzed at a post urban reach from Esquel stream (Chubut province, Patagonia, Argentina. Site was located 5.7 km downstream a Waste Treatment Plant. Mean values of nutrients: ammonia, nitrates and soluble reactive phosphate, as well water conductivity, turbidity and total suspended solids indicated physical and organic pollution. Leeches assemblage was composed by the glossiphonids: Helobdella scutifera Blanchard, 1900, H. michaelseni (Blanchard, 1900, H. simplex (Moore, 1911, Helobdella sp., H. hyalina Ringuelet, 1942, H. obscura Ringuelet, 1942 and the semiscolecid Patagoniobdella variabilis (Blanchard, 1900. From these H. hyalina and H. obscura are new records for Chubut province. Helobdella hyalina (810 ind.m-2 and H. simplex (465 ind. m-2 clearly dominated the assemblage at the reach. Only H. simplex displayed a spatial preference being significantly more abundant in pools than in riffle habitats (p<0.001. Species recruitment occurred mostly at September, December and March when juveniles were very abundant. Although several species of Helobdella were able to live in the disturbed section of the stream, only H. simplex and H. hyalina sustained large populations at the site and can be considered as tolerant to organic enrichment. This information is valuable to future studies on stream condition assessment in mountainous areas in Patagonia, and in other areas in which these species are present.
Directory of Open Access Journals (Sweden)
Vanessa Grandolfo
2013-07-01
Abstract. Urban environments have become a refuge for many species, including some bees of the tribe Euglossini. The group includes species with large capacity flight, so they are considered important neotropical pollinators. Euglossini is scarce information about the Cerrado, incomplete information like geographic distribution, which are endemic and which are cosmopolitan. This study aimed to identify and analyze the composition of bee species of the tribe Euglossini occurring in urban parks as to abundance, richness and attractiveness through the use of scent baits. The specimens of Euglossini were collected monthly from April to August 2008 in four urban parks in Goiânia, Goiás. The bees were sampled with the aid of scent traps, exposed from 8 am to 12 noon, containing one of the essences: salicylate methyl, benzyl acetate, cineole, vanillin. We collected 147 male orchid bees belonging to three genera and five species. There was a strong dominance of individuals Eulaema nigrita Lepeletier (95.23%, followed by Euglossa cordata (Linnaeus (2.72%. The Cineol was the essence that attracted the greatest abundance of males and methyl salicylate had the highest species richness attracted. This study is the first record of species occurrence of Exaerete smaragdina (Guérin and Euglossa imperialis Cockerell for the Midwest and Euglossa variabilis Friese for the Cerrado. The preservation of all these areas will keep bee populations of wild these regions ecological importance of maintaining the service pollination of plant species.
The Suez Canal as a habitat and pathway for marine algae and seagrasses
Aleem, A. A.
The Suez Canal supports a diversified benthic algal flora; 133 species of benthic algae are now known from the Canal, as compared with only 24 in 1924. The vertical and horizontal distribution of algae is considered in relation to hydrographic factors. The algae display zonation and 3-4 algal belts are distinguished on the Canal banks on buoys and pier supports. Associated fauna include Balanus amphitrite and Brachidontes variabilis, together with various hydroids, sponges, ascidians, asteroids, ophiuroids and crustaceans. Merceriella enigmatica thrives well in brackish water habitats. The algal flora in the Bitter Lakes resembles that in the Red Sea. The number of Red Sea species decreases from Suez to Port Said in the littoral zone. On the other hand, bottom algae predominantly belong to Red Sea flora. Thirty of the species of algae found belong to the Indo-Pacific flora; half of these are new records to the Canal. Several of these Indo-Pacific algae have recently become established in the Eastern Mediterranean, whereas only two of the Mediterranean macro-algal flora (viz. Caulerpa prolifera and Halopteris scoparia) have been found in the Gulf of Suez. Two seagrasses, Halopia ovalis and Thalassia hemprichii, are recorded for the first time in the Canal. Only Halophila stipulacea has found its way into the Mediterranean via the Suez Canal, but none of the Mediterranean seagrasses is found either in the Canal or in the Red Sea.
Experimental warming effects on the bacterial community structure and diversity
Kim, W.; Han, S.; Adams, J.; Son, Y.
2014-12-01
The objective of this study is to investigate the responses of soil bacterial community to future temperature increase by conducting open-field warming experiment. We conducted an open-field experimental warming system using infra-red heater in 2011 and regulated the temperature of warmed plots by 3oC higher than that of control plots constantly. The seeds of Pinus densiflora, Abies holophylla, Abies koreana, Betula costata, Quercus variabilis, Fraxinus rhynchophylla, and Zelkova serrata were planted in each 1 m × 1 m plot (n=3) in April, 2012. We collected soil samples from the rhizosphere of 7 tree species. DNA was extracted and PCR-amplified for the bacterial 16S gene targeting V1-V3 region. The paired-end sequencing was performed at Beijing Genome Institute (BGI, Hong Kong, China) using 2× 100 bp Hiseq2000 (Illumina). This study aimed to answer the following prediction/hypothesis: 1) Experimental warming will change the structure of soil bacterial community, 2) There will be distinct 'indicator group' which response to warming treatment relatively more sensitive than other groups. 3) Warming treatment will enhance the microbial activity in terms of soil respiration. 4) The rhizoplane bacterial communities for each of 7 tree species will show different response pattern to warming treatment. Since the sequence data does not arrive before the submission deadline, therefore, we would like to present the results and discussions on December 2014, AGU Fall Meeting.
THE DISTRIBUTION OF RICKETTSIA IN THE TISSUES OF INSECTS AND ARACHNIDS.
Cowdry, E V
1923-03-31
In the absence of a satisfactory definition of Rickettsia the observations herein recorded were arbitrarily limited to bacterium-like organisms which are intracellular and Gram-negative. Rickettsia of this type were found in the following species: Amblyomma americana, Amblyomma hebraeum, Boophilus decoloratus, Atomus sp., Casinaria infesta, Chrysopa oculata, Ctenocephalus canis, Dermacentor variabilis, Lepisma saccharina, Lucoppia curviseta, Margaropus annulatus, Margaropus annulatus australis, Ornithodoros turicata, Pulex irritans, Rhipicephalus sanguineus, Rhipicephalus evertsi, and Salticus scenicus. Since intracellular, Gram-negative Rickettsia have been recorded in the literature as existing in Cimex lectularius, Dermacentor venustus, Melophagus ovinus, and Pediculus humanus, the occasional occurrence of such bodies must be conceded in the following groups not closely related phylogenetically: Attidae, Trombidiidae, Argasidae, lxodidae, Cinura, Acanthiidae, Pediculidae, Hippoboscidae, Chrysopidae, Pulicidae, and Ichneumonidae. The species which harbor Rickettsia differ widely in diet and habitat. One such species is insectivorous throughout life, two are insectivorous in larval stages, becoming vegetarian in the adult condition, one is chiefly vegetarian but partakes of some animal products, and two are usually entirely vegetarian; while the remainder subsist wholly upon a diet of mammalian blood. Rickettsia are associated, in only a few cases, with diseases in mammals. The evidence at hand does not lead beyond the conclusion that the Rickettsia mentioned above are true Gram-negative microorganisms, easily distinguishable from mitochondria and all other cytoplasmic and nuclear granulations, rather completely adapted to an intracellular existence, exhibiting in some cases a remarkable degree of host specificity, and often inherited through the eggs.
da Silva, F R; Begnini, R M; Lopes, B C; Castellani, T T
2012-02-01
Insect seed predation may vary depending on seed production. The present study considers the hypothesis that the rates of seed predation tend to be smaller in years of higher fruit production. Thus, we monitored the production of fruits and predation of seeds of the palm Syagrus romanzoffiana over 2 years in the Atlantic Forest (Parque Municipal da Lagoa do Peri, Florianópolis, SC, Brazil), between July 2006 and June 2008. Plots of 0.25 m(2) were fitted under 20 mother plants and fruits were monthly collected for assessment of abundance and seed predation. There was variation in fruit production between the 2 years and among reproductive plants. Predation rates were high and occurred in the predispersal phase by the Curculionidae Revena rubiginosa Boheman, Anchylorhynchus aegrotus Fahraeus, and Anchylorhynchus variabilis Gyllenhal. Seed predation by these species of Anchylorhynchus is first registered in the present study. In average, about 60% of the seeds monthly produced in the population tend to escape insect predation in year of high or low production, becoming available for recruitment. The predation rate was not related to the amount of fruits produced per reproductive plant. Also, different than expected, there was a positive relation between the rates of seed predation and the total of fruits produced monthly on the plots. Thus, no evidence for the satiation of insect seed predators was found in this study with S. romanzoffiana.
Montoya Espinoza, W. Jhoel; Nolasco Cárdenas, Oscar P; Acuña Payano, Rosalyn K; Gutiérrez, Ana I. F
2016-01-01
El hongo Beauveria bassiana Vuill. es muy conocido por su capacidad entomopatógena, pero también existe referencias de ser un hongo antagonista, una de las posibles formas de su antagonismo es la antibiosis debido a la presencia de enzimas hidrolíticas en su genoma. Las principales enzimas expresadas contra fitopatógenos son las β-1,3-glucanasas, ya que la pared celular de los fitopatógenos como hongos y oomycetes está constituida en su mayoría por polímeros de β-1,3-glucanos. Se evaluó por q...
Schwartz, B S; Nadelman, R B; Fish, D; Childs, J E; Forseter, G; Wormser, G P
1993-01-01
We measured anti-tick saliva antibody (ATSA) by enzyme-linked immunosorbent assay using whole sonicated Ixodes dammini salivary glands as antigen in subjects with 1) a recent and confirmed I. dammini (n = 100) or Dermacentor variabilis bite (n = 3), 2) erythema migrans (n = 15), 3) late-stage Lyme disease (n = 4), and 4) normal controls without a history of tick bites (n = 5). Tick bite subjects had three ATSA determinations over approximately six weeks. On the first ATSA measurement at a mean +/- SD of 18.5 +/- 19.8 hr after removal of the tick, the subjects bitten by I. dammini had a mean ATSA optical density value (95% confidence interval [CI]) of 0.264 (0.223, 0.305); the corresponding value in controls was 0.142 (0.115, 0.169). There was no consistent change in ATSA levels in individuals with time. Multiple linear regression indicated that tick engorgement (P males; P = 0.03) were all independent predictors of ATSA levels. Logistic regression revealed that a bite by I. dammini that became engorged (defined as an engorgement index > or = 3.4) was a risk factor for ATSA seropositivity (odds ratio [95% CI] = 6.2 [1.7, 21.8]). Finally, the ATSA test had a sensitivity of 0.81 and a specificity of 0.56 for a bite by I. dammini that became engorged. Overall, the data are further evidence that ATSA is a biologic marker of tick exposure, in that the engorgement index, a surrogate for tick saliva dose, was the strongest independent predictor of antibody response.
Distribution of Tomato spotted wilt virus in dahlia plants.
Asano, S; Hirayama, Y; Matsushita, Y
2017-04-01
Tomato spotted wilt virus (TSWV) causes significant losses in the production of the ornamental plant Dahlia variabilis in Japan. The purpose of this study was to examine the distribution of TSWV in dahlia plants and identify plant parts that can be used in the selection of TSWV-free plants. The distribution of TSWV was investigated using reverse transcriptional polymerase chain reaction (RT-PCR) and tissue blot immunoassay. The detection rate of TSWV in latent infected compound leaves was the highest in the petiole, and it decreased from the veins and rachis to the lamina. The tissue blot immunoassays of the leaflets showed an uneven distribution of TSWV, especially along the edge of the leaf blade. In stems, the detection rate of TSWV was high partway up the stem compared to that in the upper and the lower parts of the stem during the vegetative growth stage. A highly uneven distribution was observed in the bulb. Our results indicated that middle parts of the stem as well as the petioles, rachis, and veins of compound leaves are suitable for detection of TSWV in dahlias. This study is the first to report uneven distribution of TSWV in dahlia plants. In this study, the distribution of Tomato spotted wilt virus (TSWV) in various parts of dahlia plants was investigated for the first time. The distribution of TSWV was uneven in compound leaves, leaflets, stems, and bulbs. The middle parts of the stem or the petiole and leaf veins should be sampled to detect TSWV when selecting healthy plants. © 2017 The Society for Applied Microbiology.
Role of phytoplankton in maintaining endemicity and seasonality of cholera in Bangladesh.
Islam, M Sirajul; Islam, M Shafiqul; Mahmud, Zahid H; Cairncross, Sandy; Clemens, John D; Collins, Andrew E
2015-09-01
In Bangladesh, cholera is endemic and maintains a regular seasonal pattern. The role of phytoplankton in maintaining endemicity and seasonality of cholera was monitored in Matlab, Bangladesh. Phytoplankton and water samples were collected from two ponds bi-weekly for 1 year. The association of Vibrio cholerae O1 with phytoplankton was studied by culture and direct fluorescent antibody techniques. The bio-physicochemical parameters of water were measured and data for cases of cholera were collected from the records of Matlab hospital. The correlation of cholera cases with levels of phytoplankton, V. cholerae and bio-physicochemical parameters of water was carried out using Pearson's correlation coefficients. V. cholerae O1 survived for 48 days in association with Anabaena variabilis in a culturable state, but survived for a year in a viable but non-culturable (VBNC) state. V. cholerae survived for 12 and 32 days in a culturable state in control water (without algae) and water with algae, respectively. There was a significant correlation between changing levels of cholera cases in the community and the blue green algae and total phytoplankton in the aquatic environment. A significant correlation was also found between the cholera cases and chlorophyll-a and VBNC V. cholerae O1 in the aquatic environment. This study demonstrated the role of phytoplankton in maintaining endemicity and seasonality of cholera in Bangladesh. © The Author 2015. Published by Oxford University Press on behalf of Royal Society of Tropical Medicine and Hygiene. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Haramis, G.M.; Link, W.A.; Osenton, P.C.; Carter, Daniel B.; Weber, R.G.; Clark, N.A.; Teece, M.A.; Mizrahi, D.S.
2007-01-01
We used stable isotope (SI) methods in combination with pen feeding trials to determine the importance of eggs of the Atlantic horseshoe crab Limulus polyphemus to migratory fattening of red knots Calidris canutus rufa and ruddy turnstones Arenaria interpres morinella during spring stopover in Delaware Bay. By manifesting measurable fractionation (ca +3?) and rapid turnover, blood plasma *15 nitrogen proved a functional marker for SI diet tracking during the short 3-week stopover. Blood samples from free-ranging knots (3 data sets) and turnstones (1 data set) produced similar convergence of plasma *15 N signatures with increasing body mass that indicated highly similar diets. Asymptotes deviated slightly (0.3? to 0.7?) from that of captive shorebirds fed a diet of only crab eggs during stopover, thus confirming a strong crab egg-shorebird linkage. The plasma *15N crab-egg diet asymptote was enriched ca +4.5? and therefore readily discriminated from that of either blue mussels Mytilus edulis or coquina clams Donax variabilis, the most likely alternative prey of knots in Delaware Bay. Crab eggs were highly palatable to captive knots and turnstones which achieved rates of mass gain (3?11 g/d) comparable to that of free-ranging birds. Peak consumption rates during hyperphagic events were 23,940 and 19,360 eggs/bird/d, respectively. The empirical conversions of eggs consumed to body mass gained (5,017 eggs/g for knots and 4,320 eggs/g for turnstones) indicate the large quantities of crab eggs required for the maintenance of these shorebird populations during stopover.
Energy Technology Data Exchange (ETDEWEB)
Master, M.M.; Jacobs, R.S.
1986-03-01
The effects of manoalide (MLD) and several analogs (isolated from the sponge Luffariella variabilis) on mouse hepatic microsomal phospholipase A/sub 2/ (PLA/sub 2/) activity was investigated. Microsomal PLA/sub 2/, a membrane bound, Ca/sup + +/ dependent enzyme with an alkaline pH optimum, functions in intracellular phospholipid turnover. In vitro PLA/sub 2/ activity was assayed by preincubating MLD or analogs (2.5-100..mu..M) with microsomes for 60 min. at 37/sup 0/C, combining this mixture with /sup 14/C-phosphatidylcholine and CaCl/sub 2/, and incubating at 37/sup 0/C for 40 minutes. Enzyme activity was quantitated by measurement of the extracted /sup 14/C-arachidonic acid product. MLD inhibited PLA/sub 2/ in a dose-dependent manner, with an IC/sub 50/ = 94..mu..M. Lineweaver-Burk analysis suggests that MLD inhibits PLA/sub 2/ noncompetitively. One of the analogs, producing a comparable dose-response curve to MLD, was found to be more potent (IC/sub 50/ = 33..mu..M). Another analog facilitated PLA/sub 2/ activity (15%) at 25..mu..M, followed by inactivation at higher doses (IC/sub 50/ > 100 ..mu..M). Facilitation of PLA/sub 2/ activity was seen with concentrations as low as 2.5..mu..M of a third analog, and significant inactivation of PLA/sub 2/ was evident. These results indicate that MLD is not as potent against microsomal PLA/sub 2/ as has been shown with purified bee venom and cobra venom PLA/sub 2/'s.
Espinel-Ingroff, A; Chakrabarti, A; Chowdhary, A; Cordoba, S; Dannaoui, E; Dufresne, P; Fothergill, A; Ghannoum, M; Gonzalez, G M; Guarro, J; Kidd, S; Lass-Flörl, C; Meis, J F; Pelaez, T; Tortorano, A M; Turnidge, J
2015-03-01
Clinical breakpoints (CBPs) have not been established for the Mucorales and any antifungal agent. In lieu of CBPs, epidemiologic cutoff values (ECVs) are proposed for amphotericin B, posaconazole, and itraconazole and four Mucorales species. Wild-type (WT) MIC distributions (organisms in a species-drug combination with no detectable acquired resistance mechanisms) were defined with available pooled CLSI MICs from 14 laboratories (Argentina, Australia, Canada, Europe, India, Mexico, and the United States) as follows: 10 Apophysomyces variabilis, 32 Cunninghamella bertholletiae, 136 Lichtheimia corymbifera, 10 Mucor indicus, 123 M. circinelloides, 19 M. ramosissimus, 349 Rhizopus arrhizus, 146 R. microsporus, 33 Rhizomucor pusillus, and 36 Syncephalastrum racemosum isolates. CLSI broth microdilution MICs were aggregated for the analyses. ECVs comprising ≥95% and ≥97.5% of the modeled populations were as follows: amphotericin B ECVs for L. corymbifera were 1 and 2 μg/ml, those for M. circinelloides were 1 and 2 μg/ml, those for R. arrhizus were 2 and 4 μg/ml, and those for R. microsporus were 2 and 2 μg/ml, respectively; posaconazole ECVs for L. corymbifera were 1 and 2, those for M. circinelloides were 4 and 4, those for R. arrhizus were 1 and 2, and those for R. microsporus were 1 and 2, respectively; both itraconazole ECVs for R. arrhizus were 2 μg/ml. ECVs may aid in detecting emerging resistance or isolates with reduced susceptibility (non-WT MICs) to the agents evaluated. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Is chloroplastic class IIA aldolase a marine enzyme?
Miyasaka, Hitoshi; Ogata, Takeru; Tanaka, Satoshi; Ohama, Takeshi; Kano, Sanae; Kazuhiro, Fujiwara; Hayashi, Shuhei; Yamamoto, Shinjiro; Takahashi, Hiro; Matsuura, Hideyuki; Hirata, Kazumasa
2016-01-01
Expressed sequence tag analyses revealed that two marine Chlorophyceae green algae, Chlamydomonas sp. W80 and Chlamydomonas sp. HS5, contain genes coding for chloroplastic class IIA aldolase (fructose-1, 6-bisphosphate aldolase: FBA). These genes show robust monophyly with those of the marine Prasinophyceae algae genera Micromonas, Ostreococcus and Bathycoccus, indicating that the acquisition of this gene through horizontal gene transfer by an ancestor of the green algal lineage occurred prior to the divergence of the core chlorophytes (Chlorophyceae and Trebouxiophyceae) and the prasinophytes. The absence of this gene in some freshwater chlorophytes, such as Chlamydomonas reinhardtii, Volvox carteri, Chlorella vulgaris, Chlorella variabilis and Coccomyxa subellipsoidea, can therefore be explained by the loss of this gene somewhere in the evolutionary process. Our survey on the distribution of this gene in genomic and transcriptome databases suggests that this gene occurs almost exclusively in marine algae, with a few exceptions, and as such, we propose that chloroplastic class IIA FBA is a marine environment-adapted enzyme. This hypothesis was also experimentally tested using Chlamydomonas W80, for which we found that the transcript levels of this gene to be significantly lower under low-salt (that is, simulated terrestrial) conditions. Expression analyses of transcriptome data for two algae, Prymnesium parvum and Emiliania huxleyi, taken from the Sequence Read Archive database also indicated that the expression of this gene under terrestrial conditions (low NaCl and low sulfate) is significantly downregulated. Thus, these experimental and transcriptome data provide support for our hypothesis. PMID:27058504
Directory of Open Access Journals (Sweden)
Dino Scaravelli
2003-10-01
Full Text Available I due Neomys italiani sono ancora da chiarire dal punto di vista della loro caratterizzazione morfologica e ecologica. Il lavoro prende in considerazione un campione di entrambe le specie proveniente da habitat forestali dell?Appennino settentrionale per i quali sono stati identificati i principali parametri ambientali. Vengono quindi descritte la variabilità dei tratti morfologici delle due specie in aree localizzate nel Parco Nazionale Foreste Casentinesi, Monte Falterona e Campigna nell?Appennino tosco-romagnolo. Risultano di sicuro effetto discriminatorio la maschera facciale, il rapporto piede posteriore/coda e i caratteri cranici. Sulla base dei criteri identificativi si sono realizzate rilevazioni di misure corporee per le due specie e una comparazione degli habitat utilizzati. N. fodiens appare unica specie nelle faggete-abetine e dominante nei castagneti, mentre nell?Ontaneta e nelle zone aperte e termofile si registra la sola presenza di N. anomalus. Mancano entrambi nei prati cespugliati, nella pecceta e nella cerreta. I gradienti presenti sono quindi illustrati. Non appare una differenza altitudinale nel campione esaminato, posto in stazioni tra i 400 e i 1300 m, ma per entrambe vi sono maggiori riscontri nella fascia tra 700 e 850 m. Nell?analisi multivariata rispetto alle altre specie e alle variabili ambientali si riscontra sempre una discreta correlazione con la presenza di acqua di una certa ampiezza, che comunque è significativa solo per N. fodiens, mentre risulta di interesse la positiva correlazione di N. anomalus con Apodemus sylvaticus.
Feitosa, João Lucas L.; Concentino, Adilma M.; Teixeira, Simone F.; Ferreira, Beatrice P.
2012-05-01
Damselfishes are a highly abundant group of reef fishes that are considered keystone species for structuring benthic communities on coral-dominated reefs. To assess how food is utilized by the damselfish species Stegastes fuscus and Stegastes variabilis living on algae-dominated coastal reefs, we evaluated the compositions of algal communities inside their territories and investigated their diets by analyzing their stomach contents. Jointed-calcareous algae were the most abundant morphological group inside the territories of both damselfish species (> 80%), and the biomass of these algae showed a positive linear relationship to all the other non-calcareous algae when grouped together (R² = 0.674; p 70%), but they also fed on invertebrates and detritus as accessory items (~ 15%). Algal material composed a consistent proportion of the items ingested by adults and juveniles of both damselfish species with diatoms being the most frequent item, followed by filamentous algae. A positive food selection for all macroalgae morphological groups was observed, except for jointed-calcareous algae (Ivlev's index). The most preferred macroalgae types were filamentous, with values close to + 1 for both damselfish species. Pianka's food overlap index was extremely high regardless of the damselfish species or their life phase and ANOSIM analyses also confirmed that there were essentially no differences between their diets. The present work is the first indication that damselfish may maintain territories dominated by highly unpalatable calcareous macroalgae that have herbivore-deterrent life strategies, although the complex branching structures of these macroalgae create suitable microhabitats for the growth of epiphytic species consumed by the damselfish.
Fraga, María; Vilariño, Natalia; Louzao, M Carmen; Fernández, Diego A; Poli, Mark; Botana, Luis M
2016-01-15
Palytoxin (PLTX) is a complex marine toxin produced by zoanthids (i.e. Palythoa), dinoflagellates (Ostreopsis) and cyanobacteria (Trichodesmium). PLTX outbreaks are usually associated with Indo-Pacific waters, however their recent repeated occurrence in Mediterranean-European Atlantic coasts demonstrate their current worldwide distribution. Human sickness and fatalities have been associated with toxic algal blooms and ingestion of seafood contaminated with PLTX-like molecules. These toxins represent a serious threat to human health. There is an immediate need to develop easy-to-use, rapid detection methods due to the lack of validated protocols for their detection and quantification. We have developed an immuno-detection method for PLTX-like molecules based on the use of microspheres coupled to flow-cytometry detection (Luminex 200™). The assay consisted of the competition between free PLTX-like compounds in solution and PLTX immobilized on the surface of microspheres for binding to a specific monoclonal anti-PLTX antibody. This method displays an IC50 of 1.83 ± 0.21 nM and a dynamic range of 0.47-6.54 nM for PLTX. An easy-to-perform extraction protocol, based on a mixture of methanol and acetate buffer, was applied to spiked mussel samples providing a recovery rate of 104 ± 8% and a range of detection from 374 ± 81 to 4430 ± 150 μg kg(-1) when assayed with this method. Extracts of Ostreopsis cf. siamensis and Palythoa tuberculosa were tested and yielded positive results for PLTX-like molecules. However, the data obtained for the coral sample suggested that this antibody did not detect 42-OH-PLTX efficiently. The same samples were further analyzed using a neuroblastoma cytotoxicity assay and UPLC-IT-TOF spectrometry, which also pointed to the presence of PLTX-like compounds. Therefore, this single detection method for PLTX provides a semi-quantitative tool useful for the screening of PLTX-like molecules in different matrixes. Copyright © 2015
Megabenthic assemblages at the Hudson Canyon head (NW Atlantic margin): Habitat-faunal relationships
Pierdomenico, Martina; Gori, Andrea; Guida, Vincent G.; Gili, Josep-Maria
2017-09-01
The distribution of megabenthic communities at the head of Hudson Canyon and adjacent continental shelf was studied by means of underwater video transects and still photo imagery collected using a towed camera system. The goal was to explore the relationships between faunal distribution and physical seafloor conditions and to test the hypothesis that increased seafloor heterogeneity in the Hudson Canyon supports a larger diversity of benthic communities, compared with the adjacent continental shelf. Hierarchical cluster analysis was performed to identify benthic assemblages as defined in imagery. The BIO-ENV procedure and the Canonical Correspondence Analysis were carried out to elucidate species groupings in relation to terrain variables extracted from bathymetric data. Species accumulation curves were generated to evaluate species turn over in and out of Hudson Canyon. The results indicate that seafloor morphology is the main physical factor related to benthic community composition and distribution. Assemblages dominated by sponges, zoanthids and cup corals colonized the canyon margins and flanks, and were associated with coarse-grained sediments, while sea pen assemblages were observed along muddy seafloor within the thalweg. An assemblage dominated by sea stars occurred on the shelf, associated with a sandy seafloor. Some assemblages were exclusively observed in the canyon area, suggesting that the increased variability of seafloor composition, together with the oceanographic processes specific to the canyon area, enhance beta diversity. The colonization by benthic suspension feeders within the canyon, in contrast to shelf assemblages, mainly composed of carnivores and detritus feeders could be favored the intense hydrodynamics at the canyon head that increase the availability of suspended organic matter. From the perspective of management and conservation of marine resources, the results obtained support the relevance of Hudson Canyon as a biodiversity hotspot
Bell, Sean M; Wendt, Dan J; Zhang, Yanhong; Taylor, Timothy W; Long, Shinong; Tsuruda, Laurie; Zhao, Bin; Laipis, Phillip; Fitzpatrick, Paul A
2017-01-01
Phenylketonuria (PKU) is a genetic metabolic disease in which the decrease or loss of phenylalanine hydroxylase (PAH) activity results in elevated, neurotoxic levels of phenylalanine (Phe). Due to many obstacles, PAH enzyme replacement therapy is not currently an option. Treatment of PKU with an alternative enzyme, phenylalanine ammonia lyase (PAL), was first proposed in the 1970s. However, issues regarding immunogenicity, enzyme production and mode of delivery needed to be overcome. Through the evaluation of PAL enzymes from multiple species, three potential PAL enzymes from yeast and cyanobacteria were chosen for evaluation of their therapeutic potential. The addition of polyethylene glycol (PEG, MW = 20,000), at a particular ratio to modify the protein surface, attenuated immunogenicity in an animal model of PKU. All three PEGylated PAL candidates showed efficacy in a mouse model of PKU (BTBR Pahenu2) upon subcutaneous injection. However, only PEGylated Anabaena variabilis (Av) PAL-treated mice demonstrated sustained low Phe levels with weekly injection and was the only PAL evaluated that maintained full enzymatic activity upon PEGylation. A PEGylated recombinant double mutant version of AvPAL (Cys503Ser/Cys565Ser), rAvPAL-PEG, was selected for drug development based on its positive pharmacodynamic profile and favorable expression titers. PEGylation was shown to be critical for rAvPAL-PEG efficacy as under PEGylated rAvPAL had a lower pharmacodynamic effect. rAvPAL and rAvPAL-PEG had poor stability at 4°C. L-Phe and trans-cinnamate were identified as activity stabilizing excipients. rAvPAL-PEG is currently in Phase 3 clinical trials to assess efficacy in PKU patients.
Wang, Shao-Kun; Zuo, Xiao-An; Zhao, Xue-Yong; Li, Yu-Qiang; Zhou, Xin; Lv, Peng; Luo, Yong-Qing; Yun, Jian-Ying
2016-01-01
Sandy grassland restoration is a vital process including re-structure of soils, restoration of vegetation, and soil functioning in arid and semi-arid regions. Soil fungal community is a complex and critical component of soil functioning and ecological balance due to its roles in organic matter decomposition and nutrient cycling following sandy grassland restoration. In this study, soil fungal community and its relationship with environmental factors were examined along a habitat gradient of sandy grassland restoration: mobile dunes (MD), semi-fixed dunes (SFD), fixed dunes (FD), and grassland (G). It was found that species abundance, richness, and diversity of fungal community increased along with the sandy grassland restoration. The sequences analysis suggested that most of the fungal species (68.4 %) belonged to the phylum of Ascomycota. The three predominant fungal species were Pleospora herbarum, Wickerhamomyces anomalus, and Deconica Montana, accounting for more than one fourth of all the 38 species. Geranomyces variabilis was the subdominant species in MD, Pseudogymnoascus destructans and Mortierella alpine were the subdominant species in SFD, and P. destructans and Fungi incertae sedis were the dominant species in FD and G. The result from redundancy analysis (RDA) and stepwise regression analysis indicated that the vegetation characteristics and soil properties explain a significant proportion of the variation in the fungal community, and aboveground biomass and C:N ratio are the key factors to determine soil fungal community composition during sandy grassland restoration. It was suggested that the restoration of sandy grassland combined with vegetation and soil properties improved the soil fungal diversity. Also, the dominant species was found to be alternative following the restoration of sandy grassland ecosystems.
Directory of Open Access Journals (Sweden)
Caroline Chénard
2016-06-01
Full Text Available Here we present the first genomic characterization of viruses infecting Nostoc, a genus of ecologically important cyanobacteria that are widespread in freshwater. Cyanophages A-1 and N-1 were isolated in the 1970s and infect Nostoc sp. strain PCC 7210 but remained genomically uncharacterized. Their 68,304- and 64,960-bp genomes are strikingly different from those of other sequenced cyanophages. Many putative genes that code for proteins with known functions are similar to those found in filamentous cyanobacteria, showing a long evolutionary history in their host. Cyanophage N-1 encodes a CRISPR array that is transcribed during infection and is similar to the DR5 family of CRISPRs commonly found in cyanobacteria. The presence of a host-related CRISPR array in a cyanophage suggests that the phage can transfer the CRISPR among related cyanobacteria and thereby provide resistance to infection with competing phages. Both viruses also encode a distinct DNA polymerase B that is closely related to those found in plasmids of Cyanothece sp. strain PCC 7424, Nostoc sp. strain PCC 7120, and Anabaena variabilis ATCC 29413. These polymerases form a distinct evolutionary group that is more closely related to DNA polymerases of proteobacteria than to those of other viruses. This suggests that the polymerase was acquired from a proteobacterium by an ancestral virus and transferred to the cyanobacterial plasmid. Many other open reading frames are similar to a prophage-like element in the genome of Nostoc sp. strain PCC 7524. The Nostoc cyanophages reveal a history of gene transfers between filamentous cyanobacteria and their viruses that have helped to forge the evolutionary trajectory of this previously unrecognized group of phages.
Directory of Open Access Journals (Sweden)
Sean M Bell
Full Text Available Phenylketonuria (PKU is a genetic metabolic disease in which the decrease or loss of phenylalanine hydroxylase (PAH activity results in elevated, neurotoxic levels of phenylalanine (Phe. Due to many obstacles, PAH enzyme replacement therapy is not currently an option. Treatment of PKU with an alternative enzyme, phenylalanine ammonia lyase (PAL, was first proposed in the 1970s. However, issues regarding immunogenicity, enzyme production and mode of delivery needed to be overcome. Through the evaluation of PAL enzymes from multiple species, three potential PAL enzymes from yeast and cyanobacteria were chosen for evaluation of their therapeutic potential. The addition of polyethylene glycol (PEG, MW = 20,000, at a particular ratio to modify the protein surface, attenuated immunogenicity in an animal model of PKU. All three PEGylated PAL candidates showed efficacy in a mouse model of PKU (BTBR Pahenu2 upon subcutaneous injection. However, only PEGylated Anabaena variabilis (Av PAL-treated mice demonstrated sustained low Phe levels with weekly injection and was the only PAL evaluated that maintained full enzymatic activity upon PEGylation. A PEGylated recombinant double mutant version of AvPAL (Cys503Ser/Cys565Ser, rAvPAL-PEG, was selected for drug development based on its positive pharmacodynamic profile and favorable expression titers. PEGylation was shown to be critical for rAvPAL-PEG efficacy as under PEGylated rAvPAL had a lower pharmacodynamic effect. rAvPAL and rAvPAL-PEG had poor stability at 4°C. L-Phe and trans-cinnamate were identified as activity stabilizing excipients. rAvPAL-PEG is currently in Phase 3 clinical trials to assess efficacy in PKU patients.
Directory of Open Access Journals (Sweden)
Mingyi Tian
2012-01-01
Full Text Available The carabid genus Orthogonius MacLeay is treated, based mainly on materials collected in Thailand through the TIGER project (the Thailand Inventory Group for Entomological Research. Among 290 specimens, 20 species are identified in total, 10 of them are new species: O. taghavianae sp. n. (Nakhon Nayok: Khao Yai National Park, O. coomanioides sp. n. (Phetchabun: Thung Salaeng Luang National Park, O. similaris sp. n. (Phetchabun: Thung Salaeng Luang National Park; Loei: Phu Kradueng National Park, O. setosopalpiger sp. n. (Phetchabun: Thung Salaeng Luang National Park, O. gracililamella sp. n. (Loei: Phu Kradueng National Park; Chaiyaphum: Tat Tone National Park, O. pseudochaudoiri sp. n. (Phetchabum: Thung Salaeng Luang National Park; Nakhon Nayok: Khao Yai National Park, O. constrictus sp. n. (Phetchabum: Thung Salaeng Luang National Park, O. pinophilus sp. n. (Phetchabum: Thung Salaeng Luang National Park, O. vari sp. n. (Cambodia: Siem Reap; Thailand: Ubon Ratchathani: Pha Taem National Park; Phetchabun: Thung Salaeng Luang National Park and O. variabilis sp. n. (Thailand: Phetchabun: Thung Salaeng Luang National Park; Nakhon Nayok: Khao Yai National Park; Phetchabun: Nam Nao National Park; China: Yunnan. In addition, O. mouhoti Chaudoir, 1871 and O. kirirom Tian & Deuve, 2008 are recorded in Thailand for the first time. In total, 30 species of Orthogonius have been recorded from Thailand, indicating that Thailand holds one of the richest Orthogonius faunas in the world. A provisional key to all Thai species is provided. A majority of Thai Orthogonius species are endemic. Among the ten national parks in which orthogonine beetles were collected, Thung Salaeng Luang holds the richest fauna, including 16 species.
Energy Technology Data Exchange (ETDEWEB)
Catoni, F.; Cannata, R.; Nichelatti, E.; Zampetti, P. [ENEA, Divisione Sistemi Energetici per la Mobilita' e l' Habitat, Centro Ricerche Casaccia, S. Maria di Galeria, Rome (Italy)
2001-07-01
Gauss showed the link between the definite quadratic differential forms and the complex functions. Beltrami, following Gauss' idea, linked the complex functions to elliptic partial differential equations. In this report it was shown how the use of hyperbolic numbers and hyperbolic functions allows to extend the same results to non definite quadratic differential forms. Using this kind of approach, one can tackle the hyperbolic partial differential equations by a different point of view. [Italian] In un famoso lavoro per la rappresentazione conforme di due superfici, Gauss scompose le forme differenziali quadratiche in due fattori complessi coniugati. In questo modo ridusse la soluzione del problema a quella di una forma differnziale lineare. Beltrami, partendo dalla stessa decomposizione, collego' le f.d.q. alle equazioni differenziali a derivate parziali di tipo ellittico aprendo cosi' nuove strade per la loro soluzione. Dalla relativita' ristretta hanno pero' assunto importanza fisica anche le forme differenziali quadratiche non definite. Viene qui mostrato come con i numeri ipercomplessi iperbolici si possono seguire i procedimenti di Gauss e Beltrami e collegare queste forme alle equazioni differenziali a derivate parziali di tipo iperbolico. Questo pero' permettere di vedere sotto nuovi aspetti questo tipo di equazioni.
Nitrogen-Dependent Carbon Fixation by Picoplankton In Culture and in the Mississippi River
Energy Technology Data Exchange (ETDEWEB)
Aubrey Smith; Marguerite W. Coomes; Thomas E. Smith
2005-04-30
The pepc gene, which encodes phosphoenolpyruvate carboxylase (PEPC), of the marine cyanobacterium Synechococcus PCC 7002, was isolated and sequenced. PEPC is an anaplerotic enzyme, but it may also contribute to overall CO2 fixation through β-carboxylation reactions. A consensus sequence generated by aligning the pepc genes of Anabaena variabilis, Anacystis nidulans and Synechocystis PCC 6803 was used to design two sets of primers that were used to amplify segments of Synechococcus PCC 7002 pepc. In order to isolate the gene, the sequence of the PCR product was used to search for the pepc nucleotide sequence from the publicly available genome of Synechococcus PCC 7002. At the time, the genome for this organism had not been completed although sequences of a significant number of its fragments are available in public databases. Thus, the major challenge was to find the pepc gene among those fragments and to complete gaps as necessary. Even though the search did not yield the complete gene, PCR primers were designed to amplify a DNA fragment using a high fidelity thermostable DNA polymerase. An open reading frame (ORF) consisting of 2988 base pairs coding for 995 amino acids was found in the 3066 bp PCR product. The pepc gene had a GC content of 52% and the deduced protein had a calculated molecular mass of 114,049 Da. The amino acid sequence was closely related to that of PEPC from other cyanobacteria, exhibiting 59-61% identity. The sequence differed significantly from plant and E. coli PEPC with only 30% homology. However, comparing the Synechococcus PCC 7002 sequence to the recently resolved E. coli PEPC revealed that most of the essential domains and amino acids involved in PEPC activity were shared by both proteins. The recombinant Synechococcus PCC 7002 PEPC was expressed in E. coli.
Is Monoglucosyldiacylglycerol a Precursor to Monogalactosyldiacylglycerol in All Cyanobacteria?
Sato, Naoki
2015-10-01
Monogalactosyldiacylglycerol (MGDG) is ubiquitous in the photosynthetic membranes of cyanobacteria and chloroplasts. It is synthesized by galactosylation of diacylglycerol (DAG) in the chloroplasts, whereas it is produced by epimerization of monoglucosyldiacylglycerol (GlcDG) in at least several cyanobacteria that have been analyzed such as Synechocystis sp. PCC 6803. A previous study, however, showed that the mgdE gene encoding the epimerase is absent in some cyanobacteria such as Gloeobacter violaceus, Thermosynechococcus elongatus and Acaryochloris marina. In addition, the N-terminal 'fatty acid hydroxylase' domain is lacking in the MgdE protein of Prochlorococcus marinus. These problems may cast doubt upon the general (or exclusive) role of MgdE in the epimerization of GlcDG to MGDG in cyanobacteria. In addition, GlcDG is usually present at a very low level, and the structural determination of endogenous GlcDG has not been accomplished with cyanobacterial samples. In this study, I determined the structure of GlcDG from Anabaena variabilis by (1)H- and (13)C-nuclear magnetic resonance (NMR) spectroscopy. I then showed that G. violaceus, T. elongatus, A. marina and P. marinus contain GlcDG. In all cases, GlcDG consisted of fewer unsaturated molecular species than MGDG, providing further evidence that GlcDG is a precursor to MGDG. The conversion of GlcDG to MGDG was also demonstrated by radiolabeling and chase experiments in G. violaceus and P. marinus. These results demonstrate that all the analyzed cyanobacteria contain GlcDG, which is converted to MGDG, and suggest that an alternative epimerase is required for MGDG synthesis in these cyanobacteria. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
La mortalitá infantile ebraica a Ferrara nell'800
Directory of Open Access Journals (Sweden)
C. Adamo
2003-05-01
Full Text Available
Obiettivi: per conoscere la qualità di vita e lo sviluppo di una collettività, tanto per il passato quanto per il presente, si ricorre sempre più spesso agli studi sulla mortalità infantile (I anno di vita. L’obiettivo del lavoro è quello di descrivere la mortalità infantile ottocentesca nella comunità ebraica di Ferrara.
Metodi: presso l’Archivio Storico del Comune di Ferrara sono conservati i registri di morte dal 1813 al 1902 della popolazione ebraica da cui si sono tratte le seguenti variabili: anno di morte, numero progressivo del registro, cognome e nome del deceduto, sesso, giorno e mese di morte, malattia o causa di morte, età alla morte (mesi, giorni, ore. Il sesso è desunto dal nome del deceduto. Come in precedenti lavori, il nostro gruppo di ricerca, per definire la classificazione delle cause di morte nel primo anno di vita ha utilizzato fino all’anno 1854 un lavoro di Silini G. basato sulle metodologie di studio delle cause di morte nel secolo XIX a Lovere (Bergamo adattandola al diverso contesto storico geografico. Per il periodo successivo si è adottato il criterio classificatorio ISTAT (IX revisione.
Risultati: dalle prime elaborazioni emerge, per il periodo 1813 1902, il seguente quadro: i morti nel primo anno di vita sono 552, di cui morti nella prima settimana 127 (23%, morti tra la prima settimana ed il primo mese 185 (33,5% ed oltre il primo mese 240 (43,5%. Gli aborti sono risultati complessivamente 194 ed i nati morti 96. Il 51% sono maschi ed il rimanente 49% femmine. Le cause di morte prevalenti sono “materia”, “infiammazione”, “inanizione” ed “epilessia”.
Skinner, Delaina; Mitcham, Jessica R; Starkey, Lindsay A; Noden, Bruce H; Fairbanks, W Sue; Little, Susan E
2017-10-01
American black bears (Ursus americanus) are commonly infested with ticks throughout their range, but there are few surveys for tick-borne disease agents in bears. To characterize tick infestations and determine the prevalence of current infection with Babesia spp. and past or current infection with Ehrlichia spp. in newly re-established populations of black bears in east central and southeastern Oklahoma, US, we identified adult (n=1,048) and immature (n=107) ticks recovered from bears (n=62). We evaluated serum and whole blood samples from a subset (n=49) for antibodies reactive to, and characteristic DNA fragments of, Ehrlichia spp., as well as characteristic DNA fragments of Babesia spp. Amblyomma americanum, the most common tick identified, was found on a majority (56/62; 90%) of bears and accounted for 697/1,048 (66.5%) of all ticks recovered. Other ticks included Dermacentor variabilis (338/1,048; 32.3%) from 36 bears, Amblyomma maculatum (9/1,048; 0.9%) from three bears, and Ixodes scapularis (4/1,048; 0.4%) from three bears. Antibodies reactive to Ehrlichia spp. were detected in every bear tested (49/49; 100%); maximum inverse titers to Ehrlichia chaffeensis ranged from 64-4,096 (geometric mean titer 1,525). However, PCR failed to identify active infection with E. chaffeensis, Ehrlichia ewingii, or an Ehrlichia ruminantium-like agent. Infection with Babesia spp. was detected by PCR in 3/49 (6%) bears. Together these data confirm that tick infestations and infection with tick-borne disease agents are common in bears in the southern US. The significance of these infestations and infections to the health of bears, if any, and the identity of the Ehrlichia spp. responsible for the antibody reactivity seen, warrant further evaluation.
Streptomyces euryhalinus sp. nov., a new actinomycete isolated from a mangrove forest.
Biswas, Kaushik; Choudhury, Jayanta D; Mahansaria, Riddhi; Saha, Malay; Mukherjee, Joydeep
2017-06-01
A Gram-positive, aerobic, non-motile actinomycete (strain MS 3/20 T ) was isolated from the sediment of the Sundarbans mangrove forest in India. On International Streptomyces Project (ISP) medium 2, the isolate produced yellowish brown to red aerial hyphae that carried spiny-surfaced spores in a retinaculum-apertum arrangement. Whole-cell hydrolysate of the strain contained LL-diaminopimelic acid and galactose. Predominant menaquinones were MK-9(H 8 ) and MK-9(H 6 ). Diagnostic polar lipids were glycolipid, phosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine, unidentified phospholipid and unidentified amino lipid. The major fatty acids were anteiso-C 15:0 (17.53%), iso-C 16:0 (23.89%) and anteiso-C 17:0 (10.29%). The strain showed 100% 16S ribosomal RNA (rRNA) gene sequence similarity with Streptomyces variabilis NBRC 12825 T , Streptomyces erythrogriseus LMG 19406 T , Streptomyces griseoincarnatus LMG 19316 T and Streptomyces labedae NBRC 15864 T . However, strain MS 3/20 T could be distinguished from these and seven other closely related species based on low levels of DNA-DNA relatedness (27.2-53.8%), supported by the unique banding pattern obtained from random amplified polymorphic DNA-PCR amplification and the distinctive matrix-assisted laser desorption/ionization-time-of-flight/mass spectrometry (MALDI-TOF/MS) profile of whole-cell proteins acquired for strain MS 3/20 T in comparison with its phylogenetic relatives. Disparate morphological, physiological and chemotaxonomic features, principally growth in NaCl, further corroborated the distinction of strain MS 3/20 T from other phylogenetic relatives. Strain MS 3/20 T is therefore suggested to be a novel species of the genus Streptomyces, for which the name Streptomyces euryhalinus sp. nov. is proposed. The type strain is MS 3/20 T (=CICC 11032 T =DSM 103378 T ).
Trout Fryxell, R T; Steelman, C D; Szalanski, A L; Billingsley, P M; Williamson, P C
2015-05-01
Rocky Mountain spotted fever (RMSF), caused by the etiological agent Rickettsia rickettsii, is the most severe and frequently reported rickettsial illness in the United States, and is commonly diagnosed throughout the southeast. With the discoveries of Rickettsia parkeri and other spotted fever group rickettsiae (SFGR) in ticks, it remains inconclusive if the cases reported as RMSF are truly caused by R. rickettsii or other SFGR. Arkansas reports one of the highest incidence rates of RMSF in the country; consequently, to identify the rickettsiae in Arkansas, 1,731 ticks, 250 white-tailed deer, and 189 canines were screened by polymerase chain reaction (PCR) for the rickettsial genes gltA, rompB, and ompA. None of the white-tailed deer were positive, while two of the canines (1.1%) and 502 (29.0%) of the ticks were PCR positive. Five different tick species were PCR positive: 244 (37%) Amblyomma americanum L., 130 (38%) Ixodes scapularis Say, 65 (39%) Amblyomma maculatum (Koch), 30 (9%) Rhipicephalus sanguineus Latreille, 7 (4%) Dermacentor variabilis Say, and 26 (44%) unidentified Amblyomma ticks. None of the sequenced products were homologous to R. rickettsii. The most common Rickettsia via rompB amplification was Rickettsia montanensis and nonpathogenic Candidatus Rickettsia amblyommii, whereas with ompA amplification the most common Rickettsia was Ca. R. amblyommii. Many tick specimens collected in northwest Arkansas were PCR positive and these were commonly A. americanum harboring Ca. R. amblyommii, a currently nonpathogenic Rickettsia. Data reported here indicate that pathogenic R. rickettsii was absent from these ticks and suggest by extension that other SFGR are likely the causative agents for Arkansas diagnosed RMSF cases. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Lukovsky-Akhsanov, Nicole; Keating, M Kelly; Spivey, Pamela; Lathrop, George W; Powell, Nathaniel; Levin, Michael L
2016-01-01
Rickettsia slovaca is a tick-borne human pathogen that is associated with scalp eschars and neck lymphadenopathy known as tick-borne lymphadenopathy (TIBOLA) or Dermacentor-borne necrosis erythema and lymphadenopathy (DEBONEL). Originally, R. slovaca was described in Eastern Europe, but since recognition of its pathogenicity, human cases have been reported throughout Europe. European vertebrate reservoirs of R. slovaca remain unknown, but feral swine and domestic goats have been found infected or seropositive for this pathogen. Recently, a rickettsial pathogen identical to R. slovaca was identified in, and isolated from, the American dog tick, Dermacentor variabilis. In previous experimental studies, this organism was found infectious to guinea pigs and transovarially transmissible in ticks. In this study, domestic goats (Capra hircus) were experimentally inoculated with the North American isolate of this R. slovaca-like agent to assess their reservoir competence-the ability to acquire the pathogens and maintain transmission between infected and uninfected ticks. Goats were susceptible to infection as demonstrated by detection of the pathogen in skin biopsies and multiple internal tissues, but the only clinical sign of illness was transient fever noted in three out of four goats, and reactive lymphoid hyperplasia. On average, less than 5% of uninfected ticks acquired the pathogen while feeding upon infected goats. Although domestic goats are susceptible to the newly described North American isolate of R. slovaca, they are likely to play a minor role in the natural transmission cycle of this pathogen. Our results suggest that goats do not propagate the North American isolate of R. slovaca in peridomestic environments and clinical diagnosis of infection could be difficult due to the brevity and mildness of clinical signs. Further research is needed to elucidate the natural transmission cycle of R. slovaca both in Europe and North America, as well as to identify a
Zolnik, Christine P; Makkay, Amanda M; Falco, Richard C; Daniels, Thomas J
2015-09-01
Ticks and whole blood were collected from American black bears (Ursus americanus Pallas) between October 2011 and October 2012 across four counties in northwestern New Jersey, an area where blacklegged ticks (Ixodes scapularis Say) and their associated tick-borne pathogens are prevalent. Adult American dog ticks (Dermacentor variabilis Say) were the most frequently collected tick species in late spring, whereas adult and nymphal blacklegged ticks were found in both the late spring and fall months. Additionally, for blacklegged ticks, we determined the quality of bloodmeals that females acquired from black bears compared with bloodmeals from white-tailed deer (Odocoileus virginianus Zimmerman), the most important host for the adult stage of this tick species. Measures of fecundity after feeding on each host species were not significantly different, suggesting that the bloodmeal a female blacklegged tick acquires from a black bear is of similar quality to that obtained from a white-tailed deer. These results establish the American black bear as both a host and quality bloodmeal source to I. scapularis. Thus, black bears may help support blacklegged tick populations in areas where they are both present. In addition, samples of black bear blood were tested for DNA presence of three tick-borne pathogens. Anaplasma phagocytophilum Foggie and Babesia microti Franca were found in 9.2 and 32.3% of blood samples, respectively. All blood samples were quantitative polymerase chain reaction-negative for Borrelia burgdorferi Johnson, Schmid, Hyde, Steigerwalt, & Brenner. Although circulating pathogens were found in blood, the status of black bears as reservoirs for these pathogens remains unknown. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Apperson, Charles S; Engber, Barry; Nicholson, William L; Mead, Daniel G; Engel, Jeffrey; Yabsley, Michael J; Dail, Kathy; Johnson, Joey; Watson, D Wesley
2008-10-01
Cases of Rocky Mountain spotted fever (RMSF) in North Carolina have escalated markedly since 2000. In 2005, we identified a county in the Piedmont region with high case numbers of RMSF. We collected ticks and examined them for bacterial pathogens using molecular methods to determine if a novel tick vector or spotted fever group rickettsiae (SFGR) might be emerging. Amblyomma americanum, the lone star tick, comprised 99.6% of 6,502 specimens collected in suburban landscapes. In contrast, Dermacentor variabilis, the American dog tick, a principal vector of Rickettsia rickettsii, comprised < 1% of the ticks collected. Eleven of 25 lone star tick pools tested were infected with "Rickettsia amblyommii," an informally named SFGR. Sera from patients from the same county who were presumptively diagnosed by local physicians with a tick-borne illness were tested by an indirect immunofluorescence antibody (IFA) assay to confirm clinical diagnoses. Three of six patients classified as probable RMSF cases demonstrated a fourfold or greater rise in IgG class antibody titers between paired acute and convalescent sera to "R. amblyommii" antigens, but not to R. rickettsii antigens. White-tailed deer, Odocoileus virginianus, are preferred hosts of lone star ticks. Blood samples collected from hunter-killed deer from the same county were tested by IFA test for antibodies to Ehrlichia chaffeensis and "R. amblyommii." Twenty-eight (87%) of 32 deer were positive for antibodies to E. chaffeensis, but only 1 (3%) of the deer exhibited antibodies to "R. amblyommii," suggesting that deer are not the source of "R. amblyommii" infection for lone star ticks. We propose that some cases of rickettsiosis reported as RMSF may have been caused by "R. amblyommii" transmitted through the bite of A. americanum.
Directory of Open Access Journals (Sweden)
Elia N. Aquino-Bolaños
2017-01-01
Full Text Available La especie Macadamia pertenece a la familia Proteacea , y las únicas especies de interés comercial son M. integrifolia y M. tetraphylla . Existe una cr eciente demanda de las nueces debido a su alto valor nutrimental y funcional ya que numerosos estudios han demostrado los efectos protectores de su consumo disminuyendo el riesgo de padecer enfermedades cardiovasculares. Sin embargo, hay una alta variabili dad en la calidad de la nuez y sus productos derivados. Método . En la nuez se registraron los parámetros de color L*, a* y b* y se analizó humedad, azúcares, polifenoles y actividad antioxidante. En el aceite se evaluó humedad, índice de saponificación, ín dice de ácidos grasos libres (AGL e índice de peróxido (IP. Resultados . La humedad de la nuez contrastó entre variedades (22.9 a 40.6 g 100 g - 1 , contrario a los parámetros de color que fueron similares (L*= 60.2 a 68.8. La variedad Victoria por su mayo r contenido de azúcares (57.5 mg glucosa g - 1 podría destinarse para consumo en fresco. UCLA y Huatusco presentaron el mayor contenido de polifenoles (>1.2 mg EAG g - 1 y actividad antioxidante (>7.0 μmol Eq. trolox g - 1 . El aceite presentó baja hum edad (≤0.22% y de AGL; además, el IP fue inferior al límite permitido para aceites vegetales vírgenes (15 m Eq. O 2 kg - 1 . Conclusión . De acuerdo con las características físico - químicas de la nuez y aceite de las distintas variedades se recomienda usos di ferenciados preferentemente en la industria alimentaria.
Boro e Vanadio: requisiti di potabilitá e valori di parametro
Directory of Open Access Journals (Sweden)
M. Ferrante
2003-05-01
Full Text Available
Obiettivi: i minerali, che costituiscono circa il 4% del peso corporeo e svolgono numerose ed importanti funzioni biodinamiche, si possono suddividere in due gruppi: elementi principali ed elementi essenziali. Gli elementi essenziali necessitano in quantità minime, dal millesimo di milligrammo fino a qualche decina di milligrammi e per la bassissima concentrazione nei tessuti del corpo umano vengono chiamati anche oligoelementi o minerali in traccia. I minerali in traccia sono stati molto attenzionati dalle normative per le acque potabili essendo per i suddetti motivi importanti requisiti di potabilità. Con l’evoluzione della normativa alcuni oligoelementi che prima erano citati solo per memoria adesso devono rientrare in precisi valori di parametro. Tra questi il boro e il vanadio. In questa nota riportiamo la problematica relativa alla presenza di boro e vanadio nelle acque utilizzate per il consumo umano nella zona etnea.
Metodi: le acque utilizzate nella zona etnea, in particolare quelle della provincia di Catania, sono state analizzate con spettrofometria in emissione (Inductively Coupled Plasma e con spettrofotometria per Assorbimento Atomico (A.A.con effetto Zeeman per il dosaggio del boro e del vanadio in esse contenuti.
Risultati: il boro e il vanadio essendo elementi naturalmente presenti nei vari comparti ambientali sono stati ritrovati nelle acque potabili della zona etnea in concentrazioni estremamente variabili che talvolta superano i valori di parametro.
Conclusioni: alla luce dei risultati ottenuti, non essendo ancora dimostrata la reale tossicità per assunzione di tali elementi attraverso il canale alimentare ed essendo molto difficile la loro eliminazione dalle acque, si propone un riesame delle concentrazioni massime ammissibili sulla base della percentuale di assorbimento gastro-enterico e dei relativi “tollerable intake” con
Gleim, Elizabeth R; Conner, L Mike; Berghaus, Roy D; Levin, Michael L; Zemtsova, Galina E; Yabsley, Michael J
2014-01-01
Some tick populations have increased dramatically in the past several decades leading to an increase in the incidence and emergence of tick-borne diseases. Management strategies that can effectively reduce tick populations while better understanding regional tick phenology is needed. One promising management strategy is prescribed burning. However, the efficacy of prescribed burning as a mechanism for tick control is unclear because past studies have provided conflicting data, likely due to a failure of some studies to simulate operational management scenarios and/or account for other predictors of tick abundance. Therefore, our study was conducted to increase knowledge of tick population dynamics relative to long-term prescribed fire management. Furthermore, we targeted a region, southwestern Georgia and northwestern Florida (USA), in which little is known regarding tick dynamics so that basic phenology could be determined. Twenty-one plots with varying burn regimes (burned surrounded by burned [BB], burned surrounded by unburned [BUB], unburned surrounded by burned [UBB], and unburned surrounded by unburned [UBUB]) were sampled monthly for two years while simultaneously collecting data on variables that can affect tick abundance (e.g., host abundance, vegetation structure, and micro- and macro-climatic conditions). In total, 47,185 ticks were collected, of which, 99% were Amblyomma americanum, 0.7% were Ixodes scapularis, and fewer numbers of Amblyomma maculatum, Ixodes brunneus, and Dermacentor variabilis. Monthly seasonality trends were similar between 2010 and 2011. Long-term prescribed burning consistently and significantly reduced tick counts (overall and specifically for A. americanum and I. scapularis) regardless of the burn regimes and variables evaluated. Tick species composition varied according to burn regime with A. americanum dominating at UBUB, A. maculatum at BB, I. scapularis at UBB, and a more even composition at BUB. These data indicate that
Kodama, Yuuki; Fujishima, Masahiro
2014-12-01
Endosymbiosis between symbiotic Chlorella and alga-free Paramecium bursaria cells can be induced by mixing them. To establish the endosymbiosis, algae must acquire temporary resistance to the host lysosomal enzymes in the digestive vacuoles (DVs). When symbiotic algae isolated from the alga-bearing paramecia are kept under a constant dark conditions for 24 h before mixing with the alga-free paramecia, almost all algae are digested in the host DVs. To examine the cause of algal acquisition to the host lysosomal enzymes, the isolated algae were kept under a constant light conditions with or without a photosynthesis inhibitor 3-(3,4-dichlorophenyl)-1,1-dimethylurea for 24 h, and were mixed with alga-free paramecia. Unexpectedly, most of the algae were not digested in the DVs irrespective of the presence of the inhibitor. Addition of 1 mM maltose, a main photosynthetic product of the symbiotic algae or of a supernatant of the isolated algae kept for 24 h under a constant light conditions, did not rescue the algal digestion in the DVs. These observations reveal that unknown factors induced by light are a prerequisite for algal resistance to the host lysosomal enzymes. © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
Chiarugi, Ivana; And Others
1995-01-01
This paper considers the problem of variables, in particular parameters, analyzes how these concepts are presented in textbooks, comments on paradigms of exercises in which parameters intervene, and points out difficulties encountered by students. Discusses results of teacher interviews concerning their dealing with parameters in class.…
Fabricius, K. E.
1997-07-01
The distribution and abundance of soft coral genera on reefs of the central Great Barrier Reef was investigated in relation to reef position, recent history of disturbance, wave exposure, substratum slope and depth. Eighty-five 25 m long transects were surveyed at 10 m depth on windward sides of 14 mid- and outer-shelf reefs. A further 75 transects in different zones on one mid-shelf reef (Davies Reef) between 5 and 30 m depth were investigated. The crown-of-thorns starfish Acanthaster planci had caused large-scale mortality of scleractinians on eight of these reefs five to ten years prior to the study, and as a result, scleractinian cover was only 35-55% of that on the six unimpacted reefs. On the impacted reefs, stony corals with massive and encrusting growths form had smaller average colony diameters but similar or slightly lower numerical abundance. In contrast, mean colony size, cover and abundance of branching stony corals showed no difference between impacted and unimpacted reefs. Twenty-four genera of soft corals (in eight families) were recorded, and none showed different abundance or cover in areas of former A. planci impact, compared to unaffected sites. Similarly, no difference was detected among locations in the numbers or area cover of sponges, tunicates, zoanthids, Halimeda or other macro-algae. Mean soft coral cover was 2 to 5% at 10 m on sheltered mid-shelf reefs, and 12 to 17% on more current-exposed reefs. Highest cover and abundances generally occurred on platforms of outer-shelf reefs exposed to relatively strong currents but low wave energy. On Davies Reef, cover and colony numbers of the families Nephtheidae and Xeniidae were low within the zone of wave impact, in flow-protected bays and lagoons, on shaded steep slopes, and at depths above 10 and below 25 m. In contrast, distributions of genera of the family Alcyoniidae were not related to these physical parameters. The physical conditions of a large proportion of habitats appear "sub
Directory of Open Access Journals (Sweden)
Sara Serrano Pérez
2009-02-01
di un'importante specie preda come il coniglio selvatico sono dipendenti dalla disponibilità di cibo e di rifugi. È noto che le zone con cespugliati frammisti a pascoli sono particolarmente selezionate dal coniglio selvatico, ma ad oggi la selezione dell'habitat da parte della specie nelle aree agricole intensamente coltivate è ancora poco conosciuta. In questo studio abbiamo stimato la densità del coniglio selvatico in un'area agricola dell'Italia settentrionale e analizzato l'uso dell'habitat a livello di macro e micro-habitat, indivuiduando i principali fattori ambientali che influenzano la distribuzione della specie. Abbiamo stimato le densità pre e post-riproduttive da dicembre 2005 a marzo 2008, in un'area di 9.9 km2 situata nell'alta pianura lombarda, in provincia di Milano. La distribuzione del coniglio selvatico è stata stimata nei mesi di luglio e agosto del 2007 dalla presenza/assenza delle feci in 150 cerchi campione di 1 m di raggio. L'areale occupato dalla specie è stato definito mediante Kernel Analysis al 99% e al 50% sui cerchi positivi ed è stato calcolato l'indice di Jacobs di selezione per ogni tipo di vegetazione, confrontando l'uso nell'areale con la disponibilità dell'area di studio; inoltre, sono stati calcolati l'indice w di selezione e l'indice α di preferenza di Manly, confrontando l'uso all'interno dell'areale con la disponibilità dello stesso. Sono state misurate 10 variabili del macro-habitat e 11 del micro-habitat e ne sono state verificate le differenze tra cerchi di presenza e di assenza della specie. Successivamente, è stata utilizzate l'Analisi di Funzione Discriminante per evidenziare le variabili con maggiore potere discriminante tra casi di presenza e di assenza. I risultati hanno mostrato come il coniglio selvatico selezioni i boschi e i margini dei campi che forniscono cibo e rifugio dai predatori, mentre evita i campi arati, i prati e gli incolti lontani dai boschi. La densa vegetazione
Six, Robert H; Everett, William R; Young, David R; Carter, Lori; Mahabir, Sean P; Honsberger, Nicole A; Myers, Melanie R; Holzmer, Susan; Chapin, Sara; Rugg, Jady J
2016-05-30
The efficacy of a single oral treatment with sarolaner (Simparica™, Zoetis), a novel isoxazoline compound, was evaluated against five tick species known to infest dogs in the United States. A total of 10 laboratory studies, two against each species, were conducted using adult purpose-bred mongrels or Beagle dogs. In each study, 16 dogs were randomly allocated to one of two treatment groups based on pre-treatment host-suitability tick counts. Dogs were infested with approximately 50 unfed adult Amblyomma americanum, Amblyomma maculatum, Dermacentor variabilis, Ixodes scapularis or Rhipicephalus sanguineus ticks on Days -2, 5, 12, 19, 26 and 33. On Day 0, dogs were treated with a placebo or a sarolaner tablet providing a minimum dose of 2 mg/kg. Tick counts were conducted 48h after treatment and after each subsequent weekly re-infestation. There were no treatment-related adverse reactions during any of the studies. Dogs in the placebo-treated group maintained tick infestations throughout the studies. Geometric mean live tick counts were significantly lower (P≤0.0001) in the sarolaner-treated group compared to the tick counts in the placebo group at all timepoints. Treatment with sarolaner resulted in ≥99.6% efficacy against existing infestations of all five tick species within 48h. The efficacy against weekly post-treatment re-infestations of all tick species was ≥96.9% for at least 35 days after treatment. Thus, a single dose of sarolaner administered orally at the minimum dosage of 2mg/kg, resulted in excellent efficacy within 48h against existing tick infestations, and against weekly re-infestations for 35 days after treatment. These studies confirmed that administration of the minimum dose of sarolaner will provide rapid treatment of existing infestations and give at least one month of control against re-infestation by the common tick species affecting dogs in the US. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.
Amblyomma americanum as a Bridging Vector for Human Infection with Francisella tularensis.
Directory of Open Access Journals (Sweden)
Rinosh J Mani
Full Text Available The γ-proteobacterium Francisella tularensis causes seasonal tick-transmitted tularemia outbreaks in natural rabbit hosts and incidental infections in humans in the south-central United States. Although Dermacentor variabilis is considered a primary vector for F. tularensis, Amblyomma americanum is the most abundant tick species in this endemic region. A systematic study of F. tularensis colonization of A. americanum was undertaken to better understand its potential to serve as an overwintering reservoir for F. tularensis and as a bridging vector for human infections. Colony-reared A. americanum were artificially fed F. tularensis subspecies holarctica strain LVS via glass capillaries and colonization levels determined. Capillary-fed larva and nymph were initially infected with 10(4 CFU/tick which declined prior to molting for both stages, but rebounded post-molting in nymphs and persisted in 53% at 10(3 to 10(8 CFU/nymph at 168 days post-capillary feeding (longest sampling time in the study. In contrast, only 18% of adults molted from colonized nymphs maintained LVS colonization at 10(1 to 10(5 CFU/adult at 168 days post-capillary feeding (longest sampling time. For adults, LVS initially colonized the gut and disseminated to salivary glands by 24 h and had an ID50 of <5CFU in mice. Francisella tularensis infected the ovaries of gravid females, but transmission to eggs was infrequent and transovarial transmission to hatched larvae was not observed. The prolonged persistence of F. tularensis in A. americanum nymphs supports A. americanum as an overwintering reservoir for F. tularensis from which seasonal epizootics may originate; however, although the rapid dissemination of F. tularensis from gut to salivary glands in adults A. americanum is compatible with intermittent feeding adult males acting as bridging vectors for incidental F. tularensis infections of humans, acquisition of F. tularensis by adults may be unlikely based on adult feeding
Shobharani, M; Viraktamath, C A; Webb, M D
2018-01-02
Species of the leafhopper genus Penthimia Germar known from the Indian subcontinent are reviewed based on the examination of type specimens. Seven new species of the genus, Penthimia curvata sp. nov. (Karnataka: Bandipur), P. meghalayensis sp. nov. (Meghalaya: Nangpoh), P. neoattenuata sp. nov. (India: Tamil Nadu), P. ribhoi sp. nov. (India: Meghalaya), P. sahyadrica sp. nov. (Karnataka: Dharmasthala, Agumbe; Kerala: Thekkady), P. spiculata sp. nov. (Karnataka: Nagarahole) and P. tumida sp. nov. (Tamil Nadu: Ootacamund; Kerala: Munnar) are described. The following nomenclatorial changes are proposed: Penthimia alba Zahniser, McKamey Dmitriev, 2012 (replacement name for P. thoracica Distant, 1918, nec Panzer, 1799), syn. nov. of P. quadrinotata Distant, 1918; Neodartus scutellatus Distant, 1908 syn. nov. of Penthimia ereba Distant 1908; P. nilgiriensis Distant, 1918 syn. nov. of P. montana Distant, 1918; P. scutellata (Distant) comb. nov. (from genus Neodartus); a lectotype is designated for P. maculosa Distant, stat. revived, thereby removing its synonymy with P. scapularis Distant. The following other lectotypes are designated: P. attenuata Distant, P. subniger Distant, P. scapularis Distant, P. distanti Baker, P. ereba Distant, N. scutellatus Distant, P. fraterna Distant, P. funebris Distant, P. juno Distant, P. maculosa Distant, P. montana Distant, P. noctua Distant, P. quadrinotata Distant, P. alba Zahniser, McKamey Dmitriev. Examination of types of Penthimia rufopunctata Motschulsky revealed that it belongs to Penthimia and hence it is transferred back to that genus from Neodartus, revised placement. The following species previously included in the genus Penthimia are transferred to the genera Tambila Distant and Vulturnus Kirkaldy: Tambila badia (Distant) comb. nov., T. majuscula (Distant) comb. nov., T. vittatifrons (Distant) comb. nov., T. variabilis (Distant) comb. nov. and Vulturnus flavocapitata (Distant) comb. nov. Three species are treated in a new
Directory of Open Access Journals (Sweden)
Elizabeth R Gleim
Full Text Available Some tick populations have increased dramatically in the past several decades leading to an increase in the incidence and emergence of tick-borne diseases. Management strategies that can effectively reduce tick populations while better understanding regional tick phenology is needed. One promising management strategy is prescribed burning. However, the efficacy of prescribed burning as a mechanism for tick control is unclear because past studies have provided conflicting data, likely due to a failure of some studies to simulate operational management scenarios and/or account for other predictors of tick abundance. Therefore, our study was conducted to increase knowledge of tick population dynamics relative to long-term prescribed fire management. Furthermore, we targeted a region, southwestern Georgia and northwestern Florida (USA, in which little is known regarding tick dynamics so that basic phenology could be determined. Twenty-one plots with varying burn regimes (burned surrounded by burned [BB], burned surrounded by unburned [BUB], unburned surrounded by burned [UBB], and unburned surrounded by unburned [UBUB] were sampled monthly for two years while simultaneously collecting data on variables that can affect tick abundance (e.g., host abundance, vegetation structure, and micro- and macro-climatic conditions. In total, 47,185 ticks were collected, of which, 99% were Amblyomma americanum, 0.7% were Ixodes scapularis, and fewer numbers of Amblyomma maculatum, Ixodes brunneus, and Dermacentor variabilis. Monthly seasonality trends were similar between 2010 and 2011. Long-term prescribed burning consistently and significantly reduced tick counts (overall and specifically for A. americanum and I. scapularis regardless of the burn regimes and variables evaluated. Tick species composition varied according to burn regime with A. americanum dominating at UBUB, A. maculatum at BB, I. scapularis at UBB, and a more even composition at BUB. These data
Unexpected diversity and new species in the sponge-Parazoanthidae association in southern Japan
Montenegro, Javier; Sinniger, Frederic; Reimer, James Davis
2015-01-01
© 2015 Elsevier Inc. Currently the genera Parazoanthus (family Parazoanthidae) and Epizoanthus (family Epizoanthidae) are the only sponge-associated zoantharians (Cnidaria, Anthozoa). The Parazoanthidae-sponge associations are widely distributed in tropical and subtropical waters from the intertidal to the deep sea in the Atlantic and Indo-Pacific Oceans. However, the taxonomic identification of both parties is often confused due to variable morphology and wide ecological ranges. In particular, Parazoanthidae species diversity remains poorly understood in the Indo-Pacific. In the present study, the diversity of the sponge-zoanthid association in the Indo-Pacific was investigated with 71 Parazoanthidae specimens collected from 29 different locations in Japan (n= 22), Australia (n= 6) and Florida, USA (n= 1). For all specimens morphological analyses were performed and total DNA was extracted and amplified for four DNA markers (COI-mtDNA, mt 16S-rDNA, ITS-rDNA and ALG11-nuDNA). The combined data demonstrate that the specimens of this study are clearly different from those of all described Parazoanthus species, and lead us to erect Umimayanthus gen. n., within family Parazoanthidae, containing the three newly described species U. chanpuru sp. n., U. miyabi sp. n., U. nakama sp. n. The new genus also includes the previously described species U. parasiticus (Duchassaing and Michelotti, 1860; comb. nov.), previously belonging to the genus Parazoanthus. Neighbor joining, maximum likelihood and Bayesian posterior probability phylogenetic trees clearly demonstrate the monophyly of Umimayanthus gen. n. to the exclusion of all outgroup sequences. The phylogenetic results were also compared to morphological features, and polyp sizes, amount of sand content in tissues, types of connections between polyps, and cnidae data, in particular holotrichs-1, were useful in distinguishing the different species within this new genus. This new genus can be distinguished from all other
Unexpected diversity and new species in the sponge-Parazoanthidae association in southern Japan.
Montenegro, Javier; Sinniger, Frederic; Reimer, James Davis
2015-08-01
Currently the genera Parazoanthus (family Parazoanthidae) and Epizoanthus (family Epizoanthidae) are the only sponge-associated zoantharians (Cnidaria, Anthozoa). The Parazoanthidae-sponge associations are widely distributed in tropical and subtropical waters from the intertidal to the deep sea in the Atlantic and Indo-Pacific Oceans. However, the taxonomic identification of both parties is often confused due to variable morphology and wide ecological ranges. In particular, Parazoanthidae species diversity remains poorly understood in the Indo-Pacific. In the present study, the diversity of the sponge-zoanthid association in the Indo-Pacific was investigated with 71 Parazoanthidae specimens collected from 29 different locations in Japan (n=22), Australia (n=6) and Florida, USA (n=1). For all specimens morphological analyses were performed and total DNA was extracted and amplified for four DNA markers (COI-mtDNA, mt 16S-rDNA, ITS-rDNA and ALG11-nuDNA). The combined data demonstrate that the specimens of this study are clearly different from those of all described Parazoanthus species, and lead us to erect Umimayanthus gen. n., within family Parazoanthidae, containing the three newly described species U. chanpuru sp. n., U. miyabi sp. n., U. nakama sp. n. The new genus also includes the previously described species U. parasiticus (Duchassaing and Michelotti, 1860; comb. nov.), previously belonging to the genus Parazoanthus. Neighbor joining, maximum likelihood and Bayesian posterior probability phylogenetic trees clearly demonstrate the monophyly of Umimayanthus gen. n. to the exclusion of all outgroup sequences. The phylogenetic results were also compared to morphological features, and polyp sizes, amount of sand content in tissues, types of connections between polyps, and cnidae data, in particular holotrichs-1, were useful in distinguishing the different species within this new genus. This new genus can be distinguished from all other Zoantharia by a unique and
Unexpected diversity and new species in the sponge-Parazoanthidae association in southern Japan
Montenegro, Javier
2015-08-01
© 2015 Elsevier Inc. Currently the genera Parazoanthus (family Parazoanthidae) and Epizoanthus (family Epizoanthidae) are the only sponge-associated zoantharians (Cnidaria, Anthozoa). The Parazoanthidae-sponge associations are widely distributed in tropical and subtropical waters from the intertidal to the deep sea in the Atlantic and Indo-Pacific Oceans. However, the taxonomic identification of both parties is often confused due to variable morphology and wide ecological ranges. In particular, Parazoanthidae species diversity remains poorly understood in the Indo-Pacific. In the present study, the diversity of the sponge-zoanthid association in the Indo-Pacific was investigated with 71 Parazoanthidae specimens collected from 29 different locations in Japan (n= 22), Australia (n= 6) and Florida, USA (n= 1). For all specimens morphological analyses were performed and total DNA was extracted and amplified for four DNA markers (COI-mtDNA, mt 16S-rDNA, ITS-rDNA and ALG11-nuDNA). The combined data demonstrate that the specimens of this study are clearly different from those of all described Parazoanthus species, and lead us to erect Umimayanthus gen. n., within family Parazoanthidae, containing the three newly described species U. chanpuru sp. n., U. miyabi sp. n., U. nakama sp. n. The new genus also includes the previously described species U. parasiticus (Duchassaing and Michelotti, 1860; comb. nov.), previously belonging to the genus Parazoanthus. Neighbor joining, maximum likelihood and Bayesian posterior probability phylogenetic trees clearly demonstrate the monophyly of Umimayanthus gen. n. to the exclusion of all outgroup sequences. The phylogenetic results were also compared to morphological features, and polyp sizes, amount of sand content in tissues, types of connections between polyps, and cnidae data, in particular holotrichs-1, were useful in distinguishing the different species within this new genus. This new genus can be distinguished from all other
Kakumanu, Madhavi L; Ponnusamy, Loganathan; Sutton, Haley T; Meshnick, Steven R; Nicholson, William L; Apperson, Charles S
2016-04-01
A novel nested PCR assay was developed to detectRickettsiaspp. in ticks and tissue samples from humans and laboratory animals. Primers were designed for the nested run to amplify a variable region of the 23S-5S intergenic spacer (IGS) ofRickettsiaspp. The newly designed primers were evaluated using genomic DNA from 11Rickettsiaspecies belonging to the spotted fever, typhus, and ancestral groups and, in parallel, compared to otherRickettsia-specific PCR targets (ompA,gltA, and the 17-kDa protein gene). The new 23S-5S IGS nested PCR assay amplified all 11Rickettsiaspp., but the assays employing other PCR targets did not. The novel nested assay was sensitive enough to detect one copy of a cloned 23S-5S IGS fragment from "CandidatusRickettsia amblyommii." Subsequently, the detection efficiency of the 23S-5S IGS nested assay was compared to those of the other three assays using genomic DNA extracted from 40 adultDermacentor variabilisticks. The nested 23S-5S IGS assay detectedRickettsiaDNA in 45% of the ticks, while the amplification rates of the other three assays ranged between 5 and 20%. The novel PCR assay was validated using clinical samples from humans and laboratory animals that were known to be infected with pathogenic species ofRickettsia The nested 23S-5S IGS PCR assay was coupled with reverse line blot hybridization with species-specific probes for high-throughput detection and simultaneous identification of the species ofRickettsiain the ticks. "CandidatusRickettsia amblyommii,"R. montanensis,R. felis, andR. belliiwere frequently identified species, along with some potentially novelRickettsiastrains that were closely related toR. belliiandR. conorii. Copyright © 2016 Kakumanu et al.
Factors affecting Brown Hare (Lepus europaeus hunting bags in Tuscany region (central Italy
Directory of Open Access Journals (Sweden)
Francesco Santilli
2006-09-01
Full Text Available Abstract We carried out an exploratory analysis of hare Lepus europaeus hunting bags (number of brown hares shot in the nineteen Hunting Districts of Tuscany (central Italy from 2001 to 2004, in order to identify which variables (land use and characteristics, climate and management could affect hare harvest. Vineyards and grass in rotation with winter cereals were positively associated with the number of hares shot, whereas industrial crops (mainly sunflowers seemed to have a negative effect,as did the density of grazing sheep. Mean annual rainfall was negatively related to the harvest but with a borderline significance. We found a positive relationship between the number of hares harvested and the percentage of protected areas managed to conserve and produce small game species, whereas private hunting estates showed a negative association. Restocking both with wild hares captured in protected areas and with farm-reared animals did not show any effect on hunting bags of hares. Riassunto Fattori influenzanti il carniere di lepri (Lepus europaeus in Toscana (Italia centrale E’ stata condotta una ricerca preliminare sui carnieri di lepre (dal 2001 al 2004 dei diciannove Ambiti Territoriali di Caccia della Toscana, al fine di identificare quali variabili (di tipo ambientale, climatico e gestionale possano influire sulla resa venatoria di questa specie. Il numero di lepri abbattute dai cacciatori è risultato influenzato positivamente dalla percentuale di vigneti e di foraggiere in avvicendamento, mentre le colture industriali (principalmente rappresentate dal girasole e la densità del bestiame ovicaprino hanno evidenziato un effetto negativo. Anche le precipitazioni medie annuali sono risultate associate negativamente al numero di lepri abbattute, tuttavia in questo caso la variabile non ha raggiunto il livello di significatività statistica. L’abbondanza del carniere di
Energy Technology Data Exchange (ETDEWEB)
D' Arcangelo, D; Malizia, P [Libera Universita' Maria SS. Assunta, Facolta' di Lettere e Filosofia, Rome (Italy); Di Marco, R A [ENEA, Funzione Centrale Informatica, Sede Centrale, Rome (Italy)
2000-07-01
Today's globalization, technological innovation and new normative-institutional context (the reform of the Civil Service tending towards bureaucratical simplification and a restructuring of public works) make for a stronger stimulus for change in terms of organization. Communication culture and climate, which can be described as soft variables, take on great importance as determining the identity and internal image of the organization. The definition of roles and responsibilities, working surroundings, levels of information, credibility of the information itself, communication content and channels, degree of and delegation of responsibility, staff management policy, the training system, union relations, all of these are variables which must necessarily be administered with a view to greater adherence to the criteria of organizational economics. Internal communication takes on a key role in the construction, modification and promotion of a new organizational identity, coherent with the strategic objectives that the corporation has set itself. The specific features of the internal telematic network of the organization (Intra ENEA) are its interactivity and multimediality; the employment of this type of communication can be conceived as use of an instrument for definition and circulation of a multitude of products/services, directed to the satisfaction of the needs of information and communication of the internal customer, all within the viewpoint of internal marketing. [Italian] La globalizzazione, l'innovazione tecnologica, il nuovo contesto normativo-istituzionale (la riforma della Pubblica Amministrazione volta alla semplificazione amministrativa e alla riorganizzazione del lavoro pubblico) costituiscono, oggi, per l'organizzazione, un piu' forte stimolo al cambiamento. Grande importanza assumono la cultura ed il clima comunicazionale, variabili definibili soft, che determinano l'identita' e l'immagine interna dell'organizzazione. La comunicazione interna assume
Phase 1 Trial of Subcutaneous rAvPAL-PEG in Subjects with Phenylketonuria
Longo, Nicola; Harding, Cary O.; Burton, Barbara K.; Grange, Dorothy K.; Vockley, Jerry; Wasserstein, Melissa; Rice, Gregory M.; Musson, Donald G.; Gu, Zhonghua; Sile, Saba
2014-01-01
Objective Phenylketonuria is an inherited disease caused by impaired activity of phenylalanine hydroxylase, the enzyme that converts phenylalanine to tyrosine, leading to accumulation of phenylalanine and subsequent neurocognitive dysfunction. A phenylalanine-restricted diet initiated early in life can ameliorate the toxic effects of phenylalanine. However, the diet is onerous and compliance is extremely difficult. Phenylalanine ammonia lyase (PAL) is a prokaryotic enzyme that converts phenylalanine to ammonia and trans-cinnamic acid. This Phase 1, multicenter clinical trial evaluated the safety, tolerability, pharmacokinetics and efficacy of rAvPAL-PEG (recombinant Anabaena variabilis PAL produced in E. coli conjugated with polyethylene glycol [PEG] to reduce immunogenicity) in reducing phenylalanine levels in subjects with phenylketonuria. Methods Single subcutaneous injections of rAvPAL-PEG in escalating doses (0·001, 0·003, 0·01, 0·03, and 0·1 mg/kg) were administered to 25 adults with phenylketonuria recruited from those attending metabolic clinics in North America whose blood phenylalanine concentrations were ≥600 μmol/L. Results The most frequently reported adverse events were injection-site reactions and dizziness. Reactions were self-limited without sequelae. During the trial, two subjects had adverse reactions to intramuscular (IM) medroxyprogesterone acetate, a drug containing polyethylene glycol as an excipient. Three subjects developed a generalized skin rash at the highest rAvPAL-PEG dose (0·1 mg/kg). Drug levels peaked ∼5 days after the injection. Treatment was effective in reducing blood phenylalanine in all five subjects receiving the highest dose (0·1 mg/kg, mean percent change of -58 from baseline), with a nadir ∼6 days after injection and inverse correlation between drug and phenylalanine concentrations in plasma. Phenylalanine concentrations returned to near-baseline levels ∼20 days after the single injection. Conclusions
Energy Technology Data Exchange (ETDEWEB)
Cenni, P.; Fagarazzi, G. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente; Sarchielli, M.; Zanobini, F. [Bologna Univ., Bologna (Italy). Dipt. di Psicologia
1999-07-01
The aim of this research on 143 workers of the ENEA area in Bologna, has been to survey the degree of well-being perceived and expressed by these workers with respect to different factors of the work environment. This study follows some training/information seminars on environment, health and safety organized in ENEA by Occupational Medicine Group to comply with Leg. Decr. 626/94. In a multidisciplinary approach the health idea has been interpreted not as lack of illness but as pursuit and preservation of the well-being in the work environment. For this purpose, also the involvement and participation of the workers seem to be very useful for subjective reports about individual task, equipment, interfaces, workplace and work organization. In this research, we have adopted an ergonomic checklist based on guiding principles to be applied to the design of optimal working conditions with regard to human well-being, safety and health (see UNI ENV 26385, 1991). Data processing and analysis have requested occupational medicine, ergonomics and statistics competencies. [Italian] La ricerca condotta su un campione ENEA di 143 dipendenti dell'area bolognese ha inteso verificare il grado di benessere percepito ed espresso dai lavoratori in rapporto alle diverse variabili presenti nel contesto lavorativo. Tale indagine e' stata preceduta da specifici seminari di formazione/informazione su ambiente, salute e sicurezza, organizzati a cura della Medicina del Lavoro di Bologna presso le sedi ENEA, a seguito delle disposizioni contenute nel D.Lvo. 626/94. In un'ottica multidisciplinare, il concetto di salute e' stato interpretato non tanto come assenza di malattia quanto come ricerca e mantenimento del benessere lavorativo e, per raggiungere questo scopo, sembra essere molto utile anche il diretto coinvolgimento e la partecipazione dei lavoratori per valutazioni soggettive sulle mansioni assegnate, le attrezzature, le interfacce, la postazione di lavoro e l
Distribuzione e uso dell'habitat del Lupo (Canis lupus L., 1758 nell'alto Appennino reggiano
Directory of Open Access Journals (Sweden)
Nicola Gilio
2005-01-01
variabili indipendenti mostrano che la presenza del lupo è influenzata principalmente dalla presenza e dall'abbondanza delle sue prede e che i diversi tipi di vegetazione non sembrano condizionare in maniera rilevante la distribuzione del predatore sul territorio.
Sulfate-reducing bacteria in rice field soil and on rice roots.
Wind, T; Stubner, S; Conrad, R
1999-05-01
related to Desulforhabdus sp. (strain BKA11), Desulfobulbus (R-PropA1), or culstered between Desulfobotulus sapovorans and Desulfosarcina variabilis (R-ButA1 and R-CaprA1).
Valutazione della qualitá dei dati in uno studio post marketing
Directory of Open Access Journals (Sweden)
D. D’Alessandro
2003-05-01
Full Text Available
Obiettivo: misurare l'affidabilita nella segnalazione
di eventi avversi a vaccino nell'ambito di uno studio post-marketing sulla tollerabilita della vaccinazione antipneumococcica (AP in associazione con la vaccinazione antinfluenzale (AI nella popolazione anziana.
Metodi: e stato predisposto un modello di regressione
logistica per stimare gli OR tra la segnalazione di almeno un effetto collaterale locale (y ed alcune variabili individuali dei vaccinati (x1: eta .75 anni; x2: sesso; x3: allergie; x4: associazione AI+AP; x5: vivere solo; x6: patologie croniche. I medici aderenti al progetto (229 sono stati stratificati in cinque categorie in funzione dellfincidenza media di eventi avversi da loro registrata: 0% (29, 1-5%
(68, 6-10% (50, 11-50% (72, .50% (10. Lo stesso modello di regressione e stato applicato ai quattro
sotto-gruppi di vaccinati afferenti alle categorie di medici che hanno segnalato sintomi, per valutare la coerenza degli OR registrati nei gruppi.
Risultati: tra i 29.086 vaccinati, l'f11,3% (3.278 ha segnalato almeno un evento avverso locale nelle
72 ore successive alla vaccinazione: 9,9% tra i soggetti vaccinati con AI e 13,9% tra i vaccinati con
AI+AP. I fattori significativamente associati all'faumento di rischio sono: AI+AP (OR 1,4; allergie (OR 1,3; patologie croniche (OR 1,3. L' applicazione del modello di regressione ai sotto-gruppi di vaccinati ha mostrato un trend negli OR per le categorie di medici che hanno segnalato dall'f1-5% fino all'f11- 50%, mostrando un'effettiva differenza di rischio dei pazienti.
Tale coerenza non si e evinta nell'ultima categoria (.50%, dove tali fattori appaiono addiritura protettivi nei riguardi dei sintomi (AI+AP: OR 0,5; allergie: OR 0,7, o non associati
(patologie croniche: OR 1,0.
Conclusioni: il 4,3% dei medici arruolati nello studio (10 su 229 ha
Vidovic, Jelena; Cosovic, Vlasta; Gallmetzer, Ivo; Haselmair, Alexandra; Zuschin, Martin
2015-04-01
The Late Holocene in the northern Adriatic is characterized by the eustatic peak of the sea-level rise, followed by the equilibrium between the regional tectonic subsidence and hydro-isostatic emergence and relatively stable sea level for a few thousand years. During this period the area experienced changes in sedimentation rate, food/oxygen availability in the benthic ecosystem and eutrophication with seasonal hypoxic and anoxic events. In order to reconstruct the marine paleoecology in the Brijuni Islands area during this period, a multidisciplinary study was carried out, including geochemical (TOC, trace metals, carbonate content), micropaleontological analyses (benthic foraminifera) and dating of sediments and mollusc shells. The principal aim of this study is to observe the effects of ecological shifts on foraminiferal assemblages during the Late Holocene. One core of 1.5 m length was taken at a sampling station south of Veli Brijuni Island, located within a marine protected area with no fishing/dredging pressure (Croatian national park). The core was sliced into smaller subsamples, and four sediment fractions of each subsample (63, 125, 250 and 500 µm) were analyzed for standard properties of the foraminiferal community (species richness, faunal composition, biodiversity indices), in comparison with relevant physical and geochemical properties of the sediment. The results concerning changes in foraminiferal species composition and abundance point to differences within the core: surface sediments are dominated by suspension feeders (Planorbulina mediterranensis, Lobatula lobatula, Cibicides variabilis, Cibicides refulgens), whereas deposit feeders (genera Textularia, Siphonaperta, Adelosina, Trioculina) appear in higher abundances at approximately 30 cm of the sediment depth and dominate down-core. Species richness in the first 30 cm is lower (10 to 34 species per sample) in comparison to the middle part of the core (39 to 53 species), and decreases again at
Directory of Open Access Journals (Sweden)
Mario Sarcinelli
2012-04-01
Full Text Available Concordo certamente con gli autori sul punto principale, cioè che i tassi di cambio flessibili non danno luogo a un aggiustamento automatico che riporta all’equilibrio di piena occupazione. Ciò che vorrei sostenere è che i cambi flessibili, nondimeno, possono essere più vantaggiosi di quelli fissi e che la gestione del tasso di cambio per il conseguimento di obiettivi di politica economica interni, sebbene utile in alcune circostanze, non dovrebbe diventare la regola in un mondo in cui eventi finanziari influiscono di frequente sulle variabili reali.A mio avviso, l’intervento sul mercato dei cambi da parte della banca centrale dovrebbe avere una scarsa frequenza ed essere usato come segnale per bloccare una tendenza all’ingiù o all’insù, il che ovviamente richiede cooperazione e sostegno da parte di altre banche centrali. Quanto alle misure compatibili col mercato relative ai movimenti di capitale, il ricorso a esse dovrebbe essere ancora più cauto. Comunque, una gestione per (rara eccezione del tasso di cambio è certamente possibile. I certainly agree with the authors on the main point, which is that flexible exchange rates do not result in an automatic adjustment that brings equilibrium with full employment. What I would argue is that flexible exchange rates, however, may be more advantageous than those fixed and that the management of the exchange rate to achieve domestic policy objectives, although useful in some circumstances, it should become the norm in a world in which financial events affect frequently on real variables.In my view, the intervention on the foreign exchange market by the central bank should have a low frequency and used as a signal to prevent upward or downward trend, which of course requires the cooperation and support from other banks central. With regard to the measures compatible with the market on the movement of capital, the use of them should be even more cautious. However, a management for (rare
Severity of the 1998 and 2005 bleaching events in Venezuela, southern Caribbean
Directory of Open Access Journals (Sweden)
Sebastián Rodríguez
2010-10-01
Full Text Available This study describes the severity of the 2005 bleaching event at 15 reef sites across Venezuela and compares the 1998 and 2005 bleaching events at one of them. During August and September 2005, bleached corals were first observed on oceanic reefs rather than coastal reefs, affecting 1 to 4% of coral colonies in the community (3 reef sites, n=736 colonies. At that time, however, no bleached corals were recorded along the eastern coast of Venezuela, an area of seasonal upwelling (3 reefs, n=181 colonies. On coastal reefs, bleaching started in October but highest levels were reached in November 2005 and January 2006, when 16% of corals were affected among a wide range of taxa (e.g. scleractinians, octocorals, Millepora and zoanthids. In the Acropora habitats of Los Roques (an oceanic reef, no bleached was recorded in 2005 (four sites, n=643 colonies. At Cayo Sombrero, a coastal reef site, bleaching was less severe in 1998 than in 2005 (9% of the coral colonies involving 2 species vs. 26% involving 23 species, respectively. Our results indicate that bleaching was more severe in 2005 than in 1998 on Venezuelan reefs; however, no mass mortality was observed in either of these two events. Rev. Biol. Trop. 58 (Suppl. 3: 189-196. Epub 2010 October 01.En este estudio se describe la severidad del evento de blanqueamiento del 2005 en 15 arrecifes coralinos de Venezuela, y se compara con el ocurrido en 1998 para uno de esos arrecifes. Los primeros corales blanqueados se observaron en agosto y septiembre 2005, en arrecifes oceánicos en lugar de costeros, afectando entre 1 y 4% de las colonias coralinas (3 arrecifes, n= 736 colonias. Para ese momento, tampoco se había detectado blanqueamiento en áreas oceánicas de la costa este de Venezuela (3 arrecifes, n= 181 colonias, donde ocurre una surgencia estacional. En arrecifes costeros, el blanqueamiento comenzó en octubre pero alcanzó su máximo entre noviembre 2005 y enero 2006, afectando hasta el 16% de
La leucemia del bambino come causa di disgregazione familiare
Directory of Open Access Journals (Sweden)
G. Varchetta
2003-05-01
Full Text Available
Introduzione: le patologie del bambino, soprattutto se gravi e durature, possono essere definite come “malattie della famiglia” a causa dell’intensità di assistenza richiesta, delle difficoltà organizzative quotidiane e dello stress causato. Obiettivo: identificare il ruolo di alcuni potenziali fattori di rischio coinvolti nella rottura di famiglie di bambini leucemici.
Materiali e metodi: mediante l’uso di questionari, sono state studiate, durante l’anno 2002, 150 cartelle cliniche di bambini leucemici dell’ospedale pediatrico “Santobono-Pausillipon”- Dipartimento di Oncologia; 11 casi sono stati esclusi per incompletezza dei dati. Outcome è stata considerata la “separazione familiare.” Sono state analizzate le seguenti variabili: trapianto di midollo osseo, lavoro del padre, della madre e loro età ed educazione, sesso ed età del bambino (CA, numerosità della famiglia, stato socio-economico, probabilità clinica di guarire (CPR, appartenenza ad una associazione. Sono state condotte analisi bivariate e logistiche. Risultati: all’analisi bivariata CA e CPR, entrambi stratificati in tre livelli, sono risultati associati alla separazione. L’Odds Ratio grezzo (OR della separazione familiare con CA di 5/10 anni e bambini di 11 anni o più a confronto con quelli d’età di 0/4 era, rispettivamente, di 8.68 (p=0.02 e di 5.7 (p=0.07. L’OR grezzo della separazione con un CPR medio e un CPR buono confrontato con un CPR basso ha dato rispettivamente 0.35 (p=0.02 e 0.08 (p‹0.001. Un modello logistico che includeva CPR come variabile principale e controllata per CA ha evidenziato che la probabilità di guarigione è media o alta e, dopo aver aggiustato per l’età del bambino, è stato ottenuto un rischio di rottura familiare rispettivamente di 0.29 (p=0.01 e 0.08 (p=0.02.
Conclusioni: la rottura dell’unità familiare è evento frequente in caso di grave
Energy Technology Data Exchange (ETDEWEB)
D' Arcangelo, D.; Malizia, P. [Libera Universita' Maria SS. Assunta, Facolta' di Lettere e Filosofia, Rome (Italy); Di Marco, R.A. [ENEA, Funzione Centrale Informatica, Sede Centrale, Rome (Italy)
2000-07-01
Today's globalization, technological innovation and new normative-institutional context (the reform of the Civil Service tending towards bureaucratical simplification and a restructuring of public works) make for a stronger stimulus for change in terms of organization. Communication culture and climate, which can be described as soft variables, take on great importance as determining the identity and internal image of the organization. The definition of roles and responsibilities, working surroundings, levels of information, credibility of the information itself, communication content and channels, degree of and delegation of responsibility, staff management policy, the training system, union relations, all of these are variables which must necessarily be administered with a view to greater adherence to the criteria of organizational economics. Internal communication takes on a key role in the construction, modification and promotion of a new organizational identity, coherent with the strategic objectives that the corporation has set itself. The specific features of the internal telematic network of the organization (Intra ENEA) are its interactivity and multimediality; the employment of this type of communication can be conceived as use of an instrument for definition and circulation of a multitude of products/services, directed to the satisfaction of the needs of information and communication of the internal customer, all within the viewpoint of internal marketing. [Italian] La globalizzazione, l'innovazione tecnologica, il nuovo contesto normativo-istituzionale (la riforma della Pubblica Amministrazione volta alla semplificazione amministrativa e alla riorganizzazione del lavoro pubblico) costituiscono, oggi, per l'organizzazione, un piu' forte stimolo al cambiamento. Grande importanza assumono la cultura ed il clima comunicazionale, variabili definibili soft, che determinano l'identita' e l'immagine interna dell
Caratterizzazione genetica di alcune popolazioni di cinghiale (Sus scrofa dell'Italia meridionale
Directory of Open Access Journals (Sweden)
M.F. Caliendo
2003-10-01
Full Text Available In Italia il Cinghiale ha subito varie oscillazioni numeriche per immissioni d?esemplari provenienti soprattutto dall'est europeo o da paesi vicini (Massei & Toso, 1993 e incrocio con esemplari di maiale domestico, allevato allo stato brado o semi brado in molte zone d'Italia (Apollonio et al., 1988. Questi fattori sono stati responsabili anche di un impoverimento genetico della forma autoctona italiana Sus scrofa meridionalis e majori che sembrano persistere solo in Sardegna e Maremma (Apollonio et al., 1988. Tra le riserve in cui si ritiene possano trovarsi popolazioni ancora integre, figura la tenuta presidenziale di Castelporziano (Roma. Prendendo spunto da questo lavoro, con il nostro contributo riportiamo i risultati, a livello genetico, della ibridazione con il maiale da parte di cinghiali della Campania, basato sul DNA microsatellite di 4 loci polimorfi. Sono state studiate 9 popolazioni (allevate e libere, usando per riferimenti maiali allo stato brado e cinghiali di Castelporziano. Dall?analisi delle frequenze alleliche è stato eseguito il test di assignment (implementato in una sub routine del software Arlequin 2.0 che individua la possibile origine di un individuo, rispetto ad una rosa di probabili popolazioni di riferimento (Paetkau et al., 1998. Con i risultati del test di assignment si è costruito il grafico log-log genotype, rappresentato da un piano individuato dalle due variabili di riferimento (cinghiale e maiale brado. Le popolazioni esaminate evidenziano una generalizzata distribuzione a cavallo tra i due riferimenti con individui geneticamente simili al cinghiale ed altri al maiale. Questa ripartizione simmetrica è molto evidente nel caso dei cinghiali catturati a Punta Licosa e in quelli dell?allevamento di Polla. La distribuzione dei genotipi sul piano è spesso dispersa, ad eccezione dei cinghiali della Valle del Vento e quelli di Monteverde (individui
Directory of Open Access Journals (Sweden)
Alain Goussot
2010-02-01
Full Text Available Interviste qualitative a genitori immigrati di bambine e bambini con disabilità: 5 interviste a Cesena e 4 interviste a Pescara. Somministrazione questionari ad insegnanti. La maggioranza dei bambini frequenta la scuola primaria e qualcuno la secondaria. Dalle interviste fatte ai genitori, in particolare le madri si hanno una serie di indicazioni sulla storia nella prima infanzia, su come i genitori vivono la disabilità dei propri figli in una condizione particolare che è quella dell'esperienza migratoria. Nella ricostruzione della storia migratoria abbiamo anche la ricostruzione delle storie cliniche dei bambini; alcuni con disabilità congenite (la maggior parte di tipo sensoriale (sordità, cecità , qualcuno con disabilità intellettiva, vi sono anche due casi con disabilità acquisite. la ricerca mette in evidenza quanto lo sguardo e il vissuto dei genitori sia fortemente condizionato da alcuni variabili: cultura di origine, condizioni e motivi dell'esperienza migratoria, evento traumatico che provoca la disabilità, condizioni dell'accoglienza in Italia, storia familiare, aspettative di guarigione dei genitori. Vi è anche una analisi del vissuto delle madri e del loro modo di concepire la relazione con il figlio disabile: vissuto e concezione fortemente condizionati dalla cultura della cura del proprio contesto di origine e dalle condizioni psico-affettive e sociali dell'inserimento della donna. Vi sono madri che arrivano in Italia pensando di curare e 'riparare' il figlio, vi è anche chi si trova in difficoltà nel combinare lo sguardo medico della neuropsichiatria infantile 'occidentale' con lo sguardo della cultura tradizionale del paese di provenienza. Quello che emerge dal lavoro è anche l'importanza del nesso madre-figlia/o disabile nonché la valorizzazione delle forme di maternage veicolate dalle madri migranti; forme che non coincidono sempre con quelle italiane. I casi di accompagnamento positivo sono dovuti all
Lipid extracted microalgal biomass residue as a fertilizer substitute for Zea mays L
Directory of Open Access Journals (Sweden)
Rahulkumar eMaurya
2016-01-01
Full Text Available High volumes of lipid extracted microalgal biomass residues (LMBRs are expected to be produced upon commencement of biodiesel production on a large scale, thus necessitating its value addition for sustainable development. LMBRs of Chlorella variabilis and Lyngbya majuscula were employed to substitute the nitrogen content of recommended rate of fertilizer (RRF for Zea mays L. The pot experiment comprised of 10 treatments, i.e. T1 (No fertilizer; T2 (RRF-120 N: 60 P2O5: 40 K2O kg ha-1; T3 to T6 -100, 75, 50 and 25% N through LMBR of the Chlorella sp., respectively; T7 to T10 -100, 75, 50 and 25% N through LMBR of Lyngbya sp., respectively. It was found that all LMBR substitution treatments were at par to RRF with respect to grain yield production. T10 gave the highest grain yield (65.16 g plant-1, which was closely followed by that (63.48 g plant-1 under T5. T10 also recorded the highest phosphorus and potassium contents in grains. T4 was markedly superior over control in terms of dry matter accumulation (DMA as well as carbohydrate content, which was ascribed to higher pigment content and photosynthetic activity in leaves. Even though considerably lower DMA was obtained in Lyngbya treatments, which might have been due to the presence of some toxic factors, no reduction in grain yield was apparent. The length of the tassel was significantly higher in either of the LMBRs at any substitution rates over RRF, except T6 and T7. The ascorbate peroxidase activity decreased with decreasing dose of Chlorella LMBR, while all the Lyngbya LMBR treatments recorded lower activity, which were at par with each other. Among the Chlorella treatments, only T5 recorded significantly higher values of glutathione reductase activity over RRF, while the rest were at par. There were significant increases in carbohydrate and crude fat, respectively, only in T4 and T3 over RRF, while no change was observed in crude protein due to LMBR treatments. Apparently, there was no
Retreatment of a mandibular second premolar with two canals in two roots
Directory of Open Access Journals (Sweden)
Chiara Fossati
2018-06-01
l’impossibilità di individuare, trattare tutti i canali del sistema radicolare. 2. I premolari mandibolari hanno un complesso sistema endodontico. 3. I premolari mandibolari hanno un alto rischio di canali non trattati. 4. Le radiografie preoperatorie sono essenziali per valutare e individuare variabili anatomiche. 5. Il microscopio operatorio e la CBCT possono essere essenziali per confermare e prevenire errori riguardo alla configurazione radicolare dei premolari mandibolari. Keywords: Second mandibular premolar, Uncommon anatomies, Missed anatomy, Two roots, Complex canal system, Parole chiave: Secondo premolare mandibolare, Varianti anatomiche, Anatomie dimenticate, Due radici, sistema canalare complesso
Im, S C; Worrall, J A; Liu, G; Aliverti, A; Zanetti, G; Luchinat, C; Bertini, I; Sykes, A G
2000-04-17
The recently reported NMR solution structure of FeIIIFeIII parsley FdI has made possible 2D NOESY NMR studies to determine the point of attachment of CrIIIL in FeIIIFeIII...CrIIIL. The latter Cr-modified product was obtained by reduction of FeIIIFeIII parsley and spinach FdI forms with [Cr(15-aneN4) (H2O)2]2+ (15-aneN4 = 1,4,8,12-tetraazacyclopentadecane), referred to here as CrIIL, followed by air oxidation and chromatographic purification. From a comparison of NMR cross-peak intensities of native and Cr-modified proteins, two surface sites designated A and B, giving large paramagnetic CrIIIL broadening of a number of amino acid peaks, have been identified. The effects at site A (residues 19-22, 27, and 30) are greater than those at site B (residues 92-94 and 96), which is on the opposite side of the protein. From metal (ICP-AES) and electrospray ionization mass spectrometry (EIMS) analyses on the Cr-modified protein, attachment of a single CrIIIL only is confirmed for both parsley and spinach FdI and FdII proteins. Electrostatic interaction of the 3+ CrIIIL center covalently attached to one protein molecule (charge approximately -18) with a second (like) molecule provides an explanation for the involvement of two regions. Thus for 3-4 mM FeIIIFeIII...CrIIIL solutions used in NMR studies (CrIIIL attached at A), broadening effects due to electrostatic interactions at B on a second molecule are observed. Experiments with the Cys18Ala spinach FdI variant have confirmed that the previously suggested Cys-18 at site A is not the site of CrIIIL attachment. Line broadening at Val-22 of A gives the largest effect, and CrIIIL attachment at one or more adjacent (conserved) acidic residues in this region is indicated. The ability of CrIIL to bind in some (parsley and spinach) but not all cases (Anabaena variabilis) suggests that intramolecular H-bonding of acidic residues at A is relevant. The parsley and spinach FeIIFeIII...CrIIIL products undergo a second stage of reduction
Chénard, Caroline; Wirth, Jennifer F; Suttle, Curtis A
2016-06-14
Here we present the first genomic characterization of viruses infecting Nostoc, a genus of ecologically important cyanobacteria that are widespread in freshwater. Cyanophages A-1 and N-1 were isolated in the 1970s and infect Nostoc sp. strain PCC 7210 but remained genomically uncharacterized. Their 68,304- and 64,960-bp genomes are strikingly different from those of other sequenced cyanophages. Many putative genes that code for proteins with known functions are similar to those found in filamentous cyanobacteria, showing a long evolutionary history in their host. Cyanophage N-1 encodes a CRISPR array that is transcribed during infection and is similar to the DR5 family of CRISPRs commonly found in cyanobacteria. The presence of a host-related CRISPR array in a cyanophage suggests that the phage can transfer the CRISPR among related cyanobacteria and thereby provide resistance to infection with competing phages. Both viruses also encode a distinct DNA polymerase B that is closely related to those found in plasmids of Cyanothece sp. strain PCC 7424, Nostoc sp. strain PCC 7120, and Anabaena variabilis ATCC 29413. These polymerases form a distinct evolutionary group that is more closely related to DNA polymerases of proteobacteria than to those of other viruses. This suggests that the polymerase was acquired from a proteobacterium by an ancestral virus and transferred to the cyanobacterial plasmid. Many other open reading frames are similar to a prophage-like element in the genome of Nostoc sp. strain PCC 7524. The Nostoc cyanophages reveal a history of gene transfers between filamentous cyanobacteria and their viruses that have helped to forge the evolutionary trajectory of this previously unrecognized group of phages. Filamentous cyanobacteria belonging to the genus Nostoc are widespread and ecologically important in freshwater, yet little is known about the genomic content of their viruses. Here we report the first genomic analysis of cyanophages infecting
Profili di salute soggettivi e oggettivi: una combinazione vincente
Directory of Open Access Journals (Sweden)
C. Quercioli
2003-05-01
Full Text Available
Introduzione: nella valutazione prospettica dell’impegno assistenziale richiesto o retrospettiva del risultato di salute ottenuto, entrambi collegabili a meccanismi retributivi, diventa sempre più importante usare sintetici descrittori di severità/complessità/outcome. In quest’ottica abbiamo studiato con strumenti oggettivi (Charlson Index Score-CSI e soggettivi (SF36 lo stato di salute di pazienti non ospedalizzati. Obiettivo: confrontare e correlare i livelli di salute registrati con i due strumenti.
Materiali e Metodi: il CSI è un indice che considera numero e severità delle copatologie. Il questionario SF36 studia lo stato di salute percepito attraverso 8 domini. Sono stati studiati 137 pazienti di un Medico di Medicina Generale, che ha fornito età, sesso, livello di istruzione e stato civile dei pazienti. È stato creato un modello di regressione in cui il punteggio del CSI costituiva la variabile dipendente e le quattro scale dell’SF36 che sono risultate correlate con il CSI le variabili indipendenti. Risultati: è stata identificata correlazione tra i punteggi del CSI e le scale Salute Generale (SG (Coefficiente di Spearman 0,38 p‹0,001, Attività Fisica (AF (C.S. 0,35 p‹0,001, Ruolo Fisico (RF (C.S. 0,37 p‹0,001, Ruolo Emotivo (RE (C.S. 0,25 p=0,003. Aggiustando il CSI e le suddette 4 scale dell’SF 36 per “sesso”, “livello di istruzione” e “stato civile”, si è trovato che: (i “stato civile” influenza l’associazione tra RF e CSI (crude O.R. 1,71, p‹0,001; O.R. coniugati 1,47 p= 0,025; O.R. non coniugati 3,05 p‹ 0,001 e SG e CSI (crude O.R. 1,76 p‹0,001; O.R. stato civile 1,61 p=0,006; (ii “livello di istruzione” influenza l’associazione tra AF e CSI (crude O.R. 1,88 p‹0,001; O.R. livello di istruzione 1,76 p=0,001 e SG e CSI (crude O.R. 1,76 p‹0,001; O.R. elevata istruzione 1,22 p=0,33; O.R. scarsa istruzione 2,69 p‹0,001.
Influence of Palythoa caribaeorum (Anthozoa, Cnidaria zonation on site-attached reef fishes
Directory of Open Access Journals (Sweden)
José P. Mendonça-Neto
2008-09-01
Full Text Available This work aimed to test the influence of Palythoa caribeorum, a widely distributed zoanthid in the Atlantic, on site-attached reef fish in a subtropical rocky shore. Density, richness and vertical distribution of reef fish inside (ID and outside (OD previously chosen P. caribaeorum dominance patches were compared through stationary visual censuses along three different periods. Fishes were grouped in different trophic guilds to evidence differences in resources uses in both treatments. A complexity index was estimated by the chain link method and percentage covering of benthic organisms was obtained analyzing random points from replicated photo-quadrats. We observed thirty-eight species of fishes, belonging to twenty-five families. Reef fish communities between studied patches were similar,both in terms of species composition and vertical distribution. Considering only the most site-attached fishes, which were the most frequent and abundant species, data showed that ID sustains higher diversity and abundance than OD. Results showed that benthic composition differ significantly among patches whereas complexity remained without differences. Otherwise, results indicated that these areas might play an important role in space limitation, structuring neighboring benthic community and consequently reef fish assemblages.Este estudo visou testar a influência de Palythoa caribeorum, um zoantídeo amplamente distribuído no Atlântico, na estruturação da comunidade de peixes recifais associados a um costão rochoso de uma região subtropical. A densidade, a riqueza e a distribuição vertical de peixes recifais em áreas previamente selecionadas com e sem a dominância de Palythoa caribaeorum foram comparadas através de censos visuais estacionários em três períodos distintos de tempo. Os peixes foram agrupados em guildas tróficas a fim de evidenciar diferenças nos usos dos recursos nas diferentes áreas analisadas. Foram analisados também
Energy Technology Data Exchange (ETDEWEB)
Ridolfi, A.; Villaamil, E. C.; Ravenna, A.; Sassone, A. H.; Alvarez, G.; Olmos, V.; Lopez, C. M.; Roses, O. E. [Buenos Aires Univ., Buenos Aires (Argentina). Facultad de Farmacia y Bioquimica, Catedra de Toxicologia y Quimica Legal
2001-06-01
termiti. L'ettacloro e' stato trovato sulle superfici acquatiche a livelli di 5-30 ng/litro, ed il suo epossido in concentrazioni di 5 a 40 ng/litro (WHO, 1984). La presenza nell'acqua di pesticidi persistenti, come l'ettacloro e il {gamma}-HCH e' il risultato non solo dell'uso attuale ma anche dell'uso precedente. Il {gamma}-HCH e' uno dei pesticidi organoclorurati frequentemente scoperto in corsi d'acqua in Argentina. Obiettivo di questo lavoro e' stato lo studio delle CL50 dell'ettacloro in concentrazioni variabili da solo e in presenza di una concentrazione invariabile di {gamma}-HCH su pesci Cnesterodon decemmaculatus a 24, 48, 72 e 96 ore di distanza.
Longo, Nicola; Harding, Cary O; Burton, Barbara K; Grange, Dorothy K; Vockley, Jerry; Wasserstein, Melissa; Rice, Gregory M; Dorenbaum, Alejandro; Neuenburg, Jutta K; Musson, Donald G; Gu, Zhonghua; Sile, Saba
2014-07-05
Phenylketonuria is an inherited disease caused by impaired activity of phenylalanine hydroxylase, the enzyme that converts phenylalanine to tyrosine, leading to accumulation of phenylalanine and subsequent neurocognitive dysfunction. Phenylalanine ammonia lyase is a prokaryotic enzyme that converts phenylalanine to ammonia and trans-cinnamic acid. We aimed to assess the safety, tolerability, pharmacokinetic characteristics, and efficacy of recombinant Anabaena variabilis phenylalanine ammonia lyase (produced in Escherichia coli) conjugated with polyethylene glycol (rAvPAL-PEG) in reducing phenylalanine concentrations in adult patients with phenylketonuria. In this open-label, phase 1, multicentre trial, single subcutaneous injections of rAvPAL-PEG were given in escalating doses (0·001, 0·003, 0·010, 0·030, and 0·100 mg/kg) to adults with phenylketonuria. Participants aged 18 years or older with blood phenylalanine concentrations of 600 μmol/L or higher were recruited from among patients attending metabolic disease clinics in the USA. The primary endpoints were safety and tolerability of rAvPAL-PEG. Secondary endpoints were the pharmacokinetic characteristics of the drug and its effect on concentrations of phenylalanine. Participants and investigators were not masked to assigned dose group. This study is registered with ClinicalTrials.gov, number NCT00925054. 25 participants were recruited from seven centres between May 6, 2008, and April 15, 2009, with five participants assigned to each escalating dose group. All participants were included in the safety population. The most frequently reported adverse events were injection-site reactions and dizziness, which were self-limited and without sequelae. Two participants had serious adverse reactions to intramuscular medroxyprogesterone acetate, a drug that contains polyethylene glycol as an excipient. Three of five participants given the highest dose of rAvPAL-PEG (0·100 mg/kg) developed a generalised skin rash
Directory of Open Access Journals (Sweden)
S. Brusaferro
2003-05-01
Full Text Available
Razionale dello studio proposto In contesti come le Residenze Sanitarie Assistenziali (RSA, le Residenze Protette (RP, l’Assistenza Domiciliare Integrata (ADI la letteratura e le prime esperirne italiane evidenziano come il problema ICPA sia importante e, pur variando le tipologie di infezione prevalenti, i costi individuali, sociali ed economici ad esse collegati rimangono molto elevati.
In questo scenario diventa importante che i Comitati per il Controllo delle Infezioni Ospedaliere (CIO aziendali affrontino il problema del controllo delle infezioni in ambito extraospedaliero e comincino a strutturare modelli organizzativi in grado di operare efficacemente. Il dimensionamento del problema, ovvero l’attività di sorveglianza epidemiologica, anche in questo caso è tra le prime attività necessarie di provata efficacia.
Obiettivo dello studio: una prima valutazione della dimensione del problema ICPA nelle strutture RSA presenti nelle diverse regioni italiane attraverso uno studio di prevalenza nazionale. Materiali e metodi: l progetto prevede una prima fase con l’individuazione dei centri partecipanti e dei rispettivi referenti medici ed infermieristici. Successivamente si procederà, utilizzando la metodologia già testata in uno studio pilota, alla formazione del personale sull’uso degli strumenti. Saranno arruolati tutti i pazienti degenti da oltre 48 ore nelle RSA partecipanti, escludendo quelli in dimissione o in trasferimento nel giorno di rilevazione. I rilevatori, esterni alla struttura, raccoglieranno i dati consultando il quaderno infermieristico, il quaderno terapia, il diario clinico, la cartella clinica ed esaminando ciascun paziente per validare la eventuale presenza di “devices” e confermare sintomi e segni rientranti nelle definizioni di caso. Laddove necessario verrà consultato il personale medico ed infermieristico della struttura. Le variabili raccolte saranno centrate su dati
Directory of Open Access Journals (Sweden)
C. Oppio
2003-10-01
Full Text Available La conservazione delle popolazioni di stambecco ha grande rilevanza a livello italiano ed europeo, a causa della distribuzione concentrata in poche aree, mentre le consistenti popolazioni di camoscio hanno importanza economica e gestionale. L?espansione dell?areale di distribuzione dei cervidi in territorio alpino, è un fenomeno ormai consolidato e legato all?abbandono dei territori collinari e montani ma anche alle reintroduzioni e alle azioni di tutela nei confronti delle specie. I modelli d?idoneità ambientale rappresentano un efficace strumento per il confronto a livello qualitativo (numero di specie e quantitativo (abbondanza delle popolazioni tra l?attuale popolamento faunistico dei territori alpini e la loro situazione potenziale. Il Parco Nazionale del Gran Paradiso si estende per oltre 700 km² sul territorio di Piemonte e di Valle d?Aosta; gli affioramenti rocciosi ne occupano il 37.0%, la vegetazione rada il 20.1% e le praterie sommitali e le brughiere il 17.3%. L?analisi ambientale del Parco è stata effettuata mediante Arcview 3.2 per Windows misurando il valore di 20 variabili ambientali (Corine Land Cover III Liv., 27 fisiche (DTM e 17 di complessità paesaggistica in 2925 Unità Campione di 0,5 km di lato. Per la formulazione dei modelli relativi alla distribuzione (presenza/assenza dello stambecco sono stati utilizzati i dati dei censimenti (1999 effettuati nel Parco; per il camoscio ed il capriolo sono stati utilizzati i dati rilevati nelle province di Vercelli e Biella (1997 e in quella di Verbania (1999, mentre per il cervo sono stati utilizzati quelli relativi alla sola provincia di Verbania (1999. I modelli sono stati formulati mediante Analisi di Funzione Discriminante (Magnusson, 1983; Massolo & Meriggi, 1995 e Analisi di Regressione Logistica (Norusis, 1994. Per lo stambecco i dati sono stati suddivisi in due sets, di cui uno utilizzato per la formulazione del modello e l?altro per la sua validazione. Mediante un test
Lo sportivo: un soggetto immunocompromesso? Fattori di rischio e misure preventive
Directory of Open Access Journals (Sweden)
E. Castellacci
2003-05-01
considerati al pari di coloro che si spostano nel mondo per lavoro. La vaccinazione degli atleti che viaggiano segue diverse variabili: la destinazione, la durata del viaggio, lo stato immunitario, di salute e l’età dell’atleta, la eventuale presenza di allergie e, non ultimo, l’eventuale stato di gravidanza. Vanno inoltre valutati i possibili effetti collaterali dei vaccini, le possibili interferenze tra antigeni in caso di necessità di polivaccinazione, il tempo a disposizione prima della partenza nonché l’eventuale presenza di epidemie nelle regioni dove ci si deve recare.
È importante quindi la conoscenza dei protocolli di vaccinazione secondo le varie zone del pianeta e le conseguenti patologie endemiche o epidemiche ed è altresì opportuno acquisire maggiori consapevolezze sull’argomento vaccinoprofilassi, al fine di contribuire ad un miglioramento della salute pubblica. Soprattutto, è importante abituarsi a considerare lo sportivo come un soggetto ad elevato rischio di infezione ed adottare le opportune misure preventive e terapeutiche focalizzate sull’impiego di vaccini con il profilo di sicurezza e di efficacia più alto possibile e sull’uso dei farmaci dotati di caratteristiche terapeutiche ben consolidate. Il tutto, è ancora opportuno sottolinearlo, alla luce delle specificità legate al particolare assetto fisiologico ed immunologico dell’atleta, ed in relazione ai luoghi e alle condizioni in cui svolge la sua attività.
Energy Technology Data Exchange (ETDEWEB)
Ferrozzi, F.; Zuccoli, G.; Tognini, G.; Castriota-Scanderbeg, A.; Bacchini, E. [Parma Univ., Parma (Italy). Ist. di Scienze Radiologiche; Bernasconi, S. [Modena Univ., Modena (Italy). Clinica Pediatrica; Campani, R. [Pavia Univ., Pavia (Italy). Ist. di Radiologia
1999-12-01
,8 anni sono stati valutati sia con TC che con ecografia. E' stato determinato il valore assoluto del grasso intra-addominale, sottocutaneo e totale, espresso in cm{sup 2,} sulla base delle elaborazioni TC. Con l'ecografia sono state valutate le distanze tra il muscolo retto e la colonna vertebrale e tra il muscolo retto e l'aorta, senza e con compressione dosata, quali parametri indicativi dello spessore del grasso viscerale nonche' la distanza tra cute e muscolo retto quale indicatore del grasso sottocutaneo. I risultati dell'ecografia e della TC sono stati inoltre correlati con altre variabili morfometriche (peso, peso corporeo ideale, plicometria cutanea). E' stata dimostrata correlazione statisticamente significativa tra la quota di grasso viscerale misurato con la TC e le distanze muscolo retto/aorta (r=0,80) e muscolo retto/colonna vertebrale (r=0,74). Anche l'area sottocutanea misurata con la TC si correlava (r=0,82) con la distanza cute/muscolo retto valutata ecograficamente. Non e' stata riscontrata alcuna correlazione tra l'indice di massa corporea e i dati ecografici e TC. I risultati ottenuti suggeriscono che l'ecografia puo' essere utilizzata in alternativa alla TC nella valutazione della distribuzione del grasso corporeo nei bambini obesi.
Directory of Open Access Journals (Sweden)
Ruttapon Srisonchai
2018-05-01
, comb. n., H. simplipodus (Liu, Golovatch & Tian, 2016, comb. n., H. specialis (Nguyen, Golovatch & Anichkin, 2005, comb. n., H. spectabilis (Attems, 1937, comb. n., H. spinitergus (Liu, Golovatch & Tian, 2016, comb. n., H. spinissimus (Golovatch, Li, Liu & Geoffroy, 2012, comb. n. and H. variabilis (Liu, Golovatch & Tian, 2016, comb. n. Desmoxytes s.s. includes the following species: D. breviverpa Srisonchai, Enghoff & Panha, 2016; D. cervina (Pocock,1895; D. delfae (Jeekel, 1964; D. des Srisonchai, Enghoff & Panha, 2016; D. pinnasquali Srisonchai, Enghoff & Panha, 2016; D. planata (Pocock, 1895; D. purpurosea Enghoff, Sutcharit & Panha, 2007; D. takensis Srisonchai, Enghoff & Panha, 2016; D. taurina (Pocock, 1895; D. terae (Jeekel, 1964, all of which are re-described based mainly on type material. Two new synonyms are proposed: Desmoxytes pterygota Golovatch & Enghoff, 1994, syn. n. (= Desmoxytes cervina (Pocock, 1895, Desmoxytes rubra Golovatch & Enghoff, 1994, syn. n. (= Desmoxytes delfae (Jeekel, 1964. Six new species are described from Thailand: D. aurata Srisonchai, Enghoff & Panha, sp. n., D. corythosaurus Srisonchai, Enghoff & Panha, sp. n., D. euros Srisonchai, Enghoff & Panha, sp. n., D. flabella Srisonchai, Enghoff & Panha, sp. n., D. golovatchi Srisonchai, Enghoff & Panha, sp. n., D. octoconigera Srisonchai, Enghoff & Panha, sp. n., as well as one from Malaysia: D. perakensis Srisonchai, Enghoff & Panha, sp. n., and one from Myanmar: D. waepyanensis Srisonchai, Enghoff & Panha, sp. n. The species can mostly be easily distinguished by gonopod structure in combination with other external characters; some cases of particularly similar congeners are discussed. All species of Desmoxytes s.s. seem to be endemic to continental Southeast Asia (except the ‘tramp’ species D. planata. Some biological observations (relationship with mites, moulting are recorded for the first time. Complete illustrations of external morphological characters, an identification key
Samson, R.A.; Yilmaz, N.; Houbraken, J.; Spierenburg, H.; Seifert, K.A.; Peterson, S.W.; Varga, J.; Frisvad, J.C.
2011-01-01
, Rogerson) Samson, Yilmaz, Frisvad & Seifert, T. purpurogenus (Stoll) Samson, Yilmaz, Frisvad & Seifert, T. rademirici (Quintan.) Samson, Yilmaz & Frisvad, T. radicus (A.D. Hocking & Whitelaw) Samson, Yilmaz, Frisvad & Seifert, T. ramulosus (Visagie & K. Jacobs) Samson, Yilmaz, Frisvad & Seifert, T. rubicundus (J.H. Mill., Giddens & A.A. Foster) Samson, Yilmaz, Frisvad & Seifert, T. rugulosus (Thom) Samson, Yilmaz, Frisvad & Seifert, T. sabulosus (Pitt & A.D. Hocking) Samson, Yilmaz & Frisvad, T. siamensis (Manoch & C. Ramírez) Samson, Yilmaz & Frisvad, T. sublevisporus (Yaguchi & Udagawa) Samson, Yilmaz & Frisvad, T. variabilis (Sopp) Samson, Yilmaz, Frisvad & Seifert, T. varians (G. Sm.) Samson, Yilmaz & Frisvad, T. verruculosus (Peyronel) Samson, Yilmaz, Frisvad & Seifert, T. viridulus Samson, Yilmaz & Frisvad. PMID:22308048
Geographical epidemiology of antibacterials in the preschool age
Directory of Open Access Journals (Sweden)
Cartabia Massimo
2012-12-01
permanent education activities. Moreover, the competent authorities should increasing their efforts to limit unnecessary prescriptions and increase appropriateness of prescribing. Riassunto Introduzione Le mappe tematiche consentono una più rapida ed immediata lettura delle differenze geografiche nella distribuzione di dati riferiti ad un territorio specifico. Lo scopo dello studio è mostrare, per la prima volta, l’applicazione di alcuni strumenti statistici e cartografici, nell’analisi dell’uso dei farmaci nella popolazione pediatrica di una regione italiana e valutare le differenze intra-regionali. Metodi Per valutare il tipo di distribuzione geografica delle prescrizioni, sono stati calcolati i tassi di prevalenza standardizzati (punteggi-z a livello di ASL, Distretti Sanitari e Comuni. Per valutare la correlazione con le ospedalizzazioni è stato usato il coefficiente di correlazione di Pearson; per valutare l’esistenza di autocorrelazione spaziale è stato usato l’indice I di Moran. Tramite l’uso della statistica G di Getis-Ord sono stati identificati cluster di aree ad alto e basso livello di prevalenza. Infine con un modello di regressione logistica è stata stimata la probabilità di ricevere almeno una prescrizione nel corso dell’anno per tutti i pazienti inclusi nello studio. Risultati Con l’uso delle mappe è possibile vedere che le prescrizioni non sono correlate con lo stato di salute della popolazione, ma sono correlate con l’attitudine prescrittiva del pediatra. Questo è confermato anche dal modello di regressione logistica costruito per stimare la probabilità di ricevere almeno una prescrizione considerando come variabili indipendenti l’età, il sesso, la prevalenza di ricoveri nel distretto di residenza, l’attitudine prescrittiva del pediatra, la classe di età del pediatra e la durata della convenzione del pediatra con l’Azienda Sanitaria Locale (ASL. Conclusioni Gli interventi primari per razionalizzare l’uso degli
Directory of Open Access Journals (Sweden)
Alberto Meriggi
1991-07-01
,30; bassa collina 0,71/km² (D.S.=0,37; media collina 1,20/km² (D.S.=0,35; montagna 0,41/km² (D.S.=0,42. Le densità più elevate sono state registrate nei territori protetti (0,98 tane/km², quelle più basse nelle Aree a gestione sociale della caccia (0,41/km² e nelle Aziende faunistico-venatorie (0,33/km². La densità è risultata correlata positivamente con l'altitudine media (r=0,443; P
Monte Carlo analysis of radiative transport in oceanographic lidar measurements
Energy Technology Data Exchange (ETDEWEB)
Cupini, E.; Ferro, G. [ENEA, Divisione Fisica Applicata, Centro Ricerche Ezio Clementel, Bologna (Italy); Ferrari, N. [Bologna Univ., Bologna (Italy). Dipt. Ingegneria Energetica, Nucleare e del Controllo Ambientale
2001-07-01
foreseen its use for the analysis of data measured both by a ship bottom fluorosensor lidar and by a fluorosensor package payload of a submersible vehicle (ROV). [Italian] L'analisi delle misure di sistemi lidar oceanografici viene spesso effettuata mediante metodi semi empirici poiche' si ha solamente una conoscenza approssimata degli effetti delle numerose variabili ambientali. Si rende quindi necessario lo sviluppo di tecniche che permettano di valutare l'accuratezza delle misure dei sistemi lidar al variare delle condizioni ambientali, delle configurazioni della geometria sorgente/sensore e di determinate condizioni al contorno. Lo sviluppo di un modello di simulazione Montecarlo semi analitico rappresenta una soluzione che ben si presta a rispondere a questi quesiti. Il codice Montecarlo PREMAR-2F e' stato sviluppato prendendo in considerazione i principali componenti, sia molecolari che non, dell'ambiente marino. Sono previsti i processi di interazione della radiazione laser di diffusione, riemissione, rifrazione e assorbimento. In particolare vengono considerati lo scattering elastico di tipo Rayleigh prodotto da atomi e molecole con dimensioni piccole rispetto alla lunghezza d'onda di emissione del laser (per esempio molecole d'acqua), lo scattering elastico di Mie originato da atomi o molecole con dimensioni comparabili alla lunghezza d'onda del laser (idrosol), lo scattering inelastico di tipo Raman, tipico dell'acqua, l'assorbimento dell'acqua, degli idrosol inorganici (sedimenti) e organici (fitoplancton e CDOM), la fluorescenza di riemissione di clorofilla e sostanze gialle. PREMAR-2F e' un'estensione di un codice per la simulazione del trasporto radioattivo in ambienti atmosferici (PREMAR-2). Il codice PREMAR-2, sviluppato precedentemente, associa a tecniche Montecarlo convenzionali stime analitiche della probabilita' del ricevitore di avere un contributo da fotoni che ritornano dopo un
Luna-Cozar, Jesús; Anderson, Robert S; Jones, Robert W; León-Corté, Jorge L
2014-04-15
The species of the genus Tylodinus from the Mexican state of Chiapas are revised. We examined 989 specimens representing 36 species; 23 species are grouped into eight species groups with 13 species considered as Incertae sedis. A total of 32 species are described as new and one species is a new record for México. Species groups (numbers of species in parentheses) and species are: Tylodinus buchanani species group (6) T. buchanani new species (type locality: Chiapas, Unión Juárez, Volcán Tacan), T. exiguus new species (type locality: Chiapas, Motozintla, 7 km SSW Motozintla de Mendoza), T. ixchel new species (type locality: Chiapas, Unión Juarez, Volcán Tacan), T. jonesi new species (type locality: Chiapas, Angel Albino Corzo, Reserva de la Biosfera el Triunfo, Campamento el Quetzal), T. variabilis new species (type locality: Chiapas, San Cristóbal de las Casas, Cerro Huitepec), T. wibmeri new species (type locality: Chiapas, Motozintla, 7 km SSW Motozintla de Mendoza); Tylodinus canaliculatus species group (3) T. canaliculatus Champion (Chiapas, Unión Juárez, Volcán Tacan, new record for México), T. sepulturaensis new species (Type locality: Chiapas, Villa Corzo, Ejido Sierra Morena), T. triumforium new species (Type locality: Chiapas, La Concordia, 4 km SE Custepec); Tylodinus cavicrus species group (3) T. cavicrus Champion, T. pseudocavicrus new species (type locality: Chiapas, San Cristóbal de las Casas, Cerro Huitepec), T. rugosus new species (type locality: Chiapas, Villa Flores, Sierra Morena); Tylodinus coapillensis species group (2) T. coapillensis new species (type locality: Chiapas, Coapilla, ca. 10.5 km NE Coapilla), T. leoncortesi new species (type locality: Chiapas, Pueblo Nuevo Solistahuacán, La Yerbabuena); Tylodinus mutabilis species group (2) Tylodinus mutabilis new species (type locality: Chiapas, Villa Corzo, Ejido Sierra Morena), T. parvus new species (type locality: Chiapas, Trinitaria, Lagunas de Montebello); Tylodinus
Aortopexy for the treatment of tracheomalacia in children: review of the literature
2012-01-01
delicate is represented by those with associated gastro-esophageal reflux, in whom a fundoplication should be performed. Other treatments of tracheomalacia, particularly tracheal stenting, were associated with a higher rate of failure, severe morbidity and mortality. Non english abstract La tracheomalacia severa rappresenta una sfida per Pediatri, Intensivisti, Pneumologi, Otorinolaringoiatri, Chirurghi Pediatri. Il trattamento della tracheomalacia è tuttora controverso. L’aortopessi è considerata da molti la migliore opzione terapeutica. Abbiamo condotto una revisione della letteratura di lingua inglese su tale argomento. Di 125 lavori, 40 sono stati inclusi nella revisione. Tra 758 pazienti (62% maschi) affetti da tracheomalacia, 581 sono stati sottoposti ad aortopessi tra il 1968 e il 2008. In 659 pazienti alcune comorbidità erano presenti. L’associazione più frequente era con l’atresia esofagea (44%), l’anello vascolare o un’anomalia dei grossi vasi (18%), la compressione da parte dell’arteria innominata (16%); nel 9% la tracheomalacia era idiopatica. I sintomi riportati sono stati variabili, ma l’indicazione più importante all’aortopessi sono stati eventi di ALTE, osservati nel 43% dei pazienti. Lo studio diagnostico preoperatorio principale è stato la broncoscopia. L’approccio chirurgico è avvenuto attraverso una toracotomia anteriore sinistra nel 72% dei pazienti, mentre un approccio mediano è stato scelto nel 14% e nell’1.3% dei casi è stato eseguito un approccio toracoscopico. Al follow-up (mediana di 47 mesi) la maggioranza dei pazienti sono migliorati significativamente, ma l’8% di essi non è migliorato, il 4% è peggiorato e il 6% è morto. Complicazioni sono state riportate nel 15% dei pazienti, nell’1% un nuovo intervento di aortopessi è stato necessario. In questa revisione abbiamo trovato che non c’è un consenso generale sulla valutazione e sulla descrizione dei sintomi, sulle indicazioni chirurgiche ed esami
Directory of Open Access Journals (Sweden)
Andrea Mustoni
2003-10-01
differences between municipalities with and without bears in human population density and intensity of tourism. The importance of a wide-scale and detailed analysis of human attitude towards the project and of education strategies to increase acceptance by local people are discussed. Riassunto La reintroduzione dell'orso bruno (Ursus arctos nel Parco Naturale Adamello Brenta: uno strumento per il ripristino di una metapopolazione nelle Alpi centro-orientali Nel XVII secolo gli orsi (Ursus arctos erano ancora abbondanti ed ampiamente distribuiti in tutta l'area alpina dell'Italia settentrionale e nelle aree densamente forestate delle Prealpi e della Pianura Padana. Il declino delle popolazioni ebbe inizio a partire dal XVIII secolo con l'aumentare della deforestazione per ottenere maggiori aree coltivabili e, nel XIX secolo, si ebbero fenomeni di estinzione locale, causati principalmente da abbattimenti. La popolazione alpina residua, composta esclusivamente da 3 individui che non si riproducono dal 1989, occupa oggi l'area coincidente con il Parco Naturale Adamello-Brenta ed è da considersarsi biologicamente estinta. Nel presente lavoro vengono analizzati rischi e benefici della reintroduzione, intesa come strumento ritenuto maggiormente idoneo per il recupero dell'orso bruno sulle Alpi italiane, con una valutazione più ampia sulla conservazione della specie estesa all'intero contesto della regione alpina. Le aree maggiormente adatte alla reintroduzione sono state identificate mediante un modello di valutazione della qualità dell'habitat basato su di un Sistema Informativo Territoriale. Il modello ha preso in considerazione tutte le segnalazioni di presenza dell'orso bruno relative agli ultimi 20 anni registrate nell'area del Parco Naturale Adamello-Brenta (6500 km², unitamente ad alcune variabili ambientali associate ad unità discrete di 25 ha ciascuna rilevate entro il territorio occupato dal nucleo residuo (645 km
Coelomycetous Dothideomycetes with emphasis on the families Cucurbitariaceae and Didymellaceae
Directory of Open Access Journals (Sweden)
N. Valenzuela-Lopez
2018-06-01
-Lopez, Cano, Crous, Guarro & Stchigel, Juxtiphoma Valenzuela-Lopez, Cano, Crous, Guarro & Stchigel, Neopyrenochaeta Valenzuela-Lopez, Crous, Stchigel, Guarro & Cano, Neopyrenochaetopsis Valenzuela-Lopez, Cano, Guarro & Stchigel, Paracucurbitaria Valenzuela-Lopez, Stchigel, Guarro & Cano, Parapyrenochaeta Valenzuela-Lopez, Crous, Stchigel, Guarro & Cano, Pseudopyrenochaeta Valenzuela-Lopez, Crous, Stchigel, Guarro & Cano, Remotididymella Valenzuela-Lopez, Crous, Cano, Guarro & Stchigel, Similiphoma Valenzuela-Lopez, Crous, Cano, Guarro & Stchigel, Vacuiphoma Valenzuela-Lopez, Cano, Crous, Guarro & Stchigel, Xenopyrenochaetopsis Valenzuela-Lopez, Crous, Stchigel, Guarro & Cano, New species: Allocucurbitaria botulispora Valenzuela-Lopez, Stchigel, Guarro & Cano, Allophoma cylindrispora Valenzuela-Lopez, Cano, Guarro & Stchigel, Cumuliphoma indica Valenzuela-Lopez, Cano, Crous, Guarro & Stchigel, Cu. pneumoniae Valenzuela-Lopez, Stchigel, Crous, Guarro & Cano, Didymella brunneospora Valenzuela-Lopez, Cano, Crous, Guarro & Stchigel, D. keratinophila Valenzuela-Lopez, Cano, Guarro & Stchigel, Epicoccum catenisporum Valenzuela-Lopez, Stchigel, Crous, Guarro & Cano, Ep. keratinophilum Valenzuela-Lopez, Cano, Guarro & Stchigel, Ep. ovisporum Valenzuela-Lopez, Stchigel, Crous, Guarro & Cano, Ep. pneumoniae Valenzuela-Lopez, Stchigel, Guarro & Cano, Neoascochyta cylindrispora Valenzuela-Lopez, Cano, Guarro & Stchigel, Neoa. tardicrescens Valenzuela-Lopez, Cano, Crous, Guarro & Stchigel, Neocucurbitaria aquatica Valenzuela-Lopez, Crous, Stchigel, Guarro & Cano, Neocu. irregularis Valenzuela-Lopez, Cano, Guarro & Stchigel, Neopyrenochaeta fragariae Valenzuela-Lopez, Crous, Stchigel, Guarro & Cano, Neopyrenochaetopsis hominis Valenzuela-Lopez, Cano, Guarro & Stchigel, Nothophoma variabilis Valenzuela-Lopez, Cano, Guarro & Stchigel, Paracucurbitaria italica Valenzuela-Lopez, Crous, Stchigel, Guarro & Cano, Pseudopyrenochaeta terrestris Valenzuela-Lopez, Crous, Cano, Guarro & Stchigel
Directory of Open Access Journals (Sweden)
Mario Posillico
1995-12-01
ripartizione in fasce orarie dell'attività mostra un andamento bimodale in primavera e estate, mentre è unimodale in autunno e inverno, con un picco notturno. La ripartizione in fasce orarie dell'attività differisce significativamente tra le stagioni, tranne che per l'inverno rispetto all'autunno e alla primavera. Le correlazioni tra le attivit e le variabili abiotiche (eccettuata la piovosità sono dirette, tranne che per l'attività notturna. Non è stata trovata nessuna correlazione significativa con la piovosità. L attività è risultata significativamente e direttamente correlata soltanto con i rettili, tra tutti i componenti della dieta. Coleotteri e Ortotteri, il cibo principale tra gli invertebrati, e la frutta, risultano scarsamente correlati con l'attività. Sorprendentemente le risorse alimentari non sembrano essere il fattore maggiormente responsabile delle variazioni d'attività.
Energy Technology Data Exchange (ETDEWEB)
Muto, Mario; Muto, Emanuale; Izzo, Roberto; Diano, Alvaro Antonio; Lavagna, Arcangelo; Di Furia, Ugo [Istituto di Neuroradiologia AORN Cardarelli, Napoli (Italy)
2005-03-01
e sotto controllo TC in 5 pazienti affetti da neoplasia vertebrale. Non abbiamo mai effettuato la flebografia prima del trattamento. In 55 pazienti l'approccio e' stato bilaterale, mentre nei rimanenti e' stato monolaterale. Il posizionamento dell'ago e la iniezione del cemento e' stata effettuata sempre sotto controllo scopico. Le quantita' di cemento iniettate sono state variabili a livello dorsale o lombare con volumi compresi tra 12 e 4 ml. Il cemento utilizzato e' a bassa viscosita' opacizzato con diossido di zirconio, tantalio o solfato di bario sterile. Risultati: I risultati sono stati sicuramente migliori nei pazienti affetti da osteoporosi e da angiomi vertebrali (successo nel 95% e 90% dei casi nel giro di 24-72 ore) rispetto ai pazienti affetti da neoplasie secondarie del rachide (successo del 77% dei casi). Abbiamo riscontrato fughe di cemento extravertebrali vascolari o discali in 39 pazienti ma solo in 2 casi tali fughe hanno determinato la comparsa di una sintomatologia clinica radicolare per diffusione epidurale. Non abbiamo riscontrato mai nella nostra esperienza fratture a vertebre adiacenti trattate con vertebroplastica. Discussione e conclusioni: Sebbene i primi casi di vertebroplastica siano stati effettuati per il trattamento degli angiomi vertebrali, si e' subito passati ad applicare tale tecnica anche al trattamento dei crolli vertebrali da osteoporosi o da lesioni secondarie. La RM svolge un ruolo chiave nella corretta selezione dei pazienti da trattare mentre la TC puo' essere utile per valutare l'integrita' del muro posteriore del metamero. La controindicazione assoluta e' data da infezioni sistemiche e locali mentre quelle relative dalla estensione epidurale della neoplasia, dalla vertebra plana, dalla presenza di segni clinici di interessamento mielico o radicolare e da eventuali disturbi della coagulazione. I risultati da noi ottenuti evidenziano un successo che e
A systematic revision of Operclipygus Marseul (Coleoptera, Histeridae, Exosternini
Directory of Open Access Journals (Sweden)
Michael Caterino
2013-02-01
. panamensis (Wenzel & Dybas, 1941], O. sejunctus group [O. depressus (Hinton, 1935, O. itoupe sp. n., O. juninensis sp. n., O. pecki sp. n., O. punctiventer sp. n., O. sejunctus (Schmidt, 1896 comb. n., O. setiventris sp. n.], O. mortavis group [O. ecitonis sp. n., O. mortavis sp. n., O. paraguensis sp. n.], O. dytiscoides group [O. carinisternus sp. n., O. crenulatus sp. n., O. dytiscoides sp. n., O. quadratus sp. n.], O. dubitabilis group [O. dubitabilis (Marseul, 1889, O. yasuni sp. n.], O. angulifer group [O. angulifer sp. n., O. impressifrons sp. n.], O. dubius group [O. andinus sp. n., O. dubius (Lewis, 1888, O. extraneus sp. n., O. intermissus sp. n., O. lunulus sp. n., O. occultus sp. n., O. perplexus sp. n., O. remotus sp. n., O. validus sp. n., O. variabilis sp. n.], O. hospes group [O. assimilis sp. n., O. belemensis sp. n., O. bulbistoma sp. n., O. callifrons sp. n., O. colombicus sp. n., O. communis sp. n., O. confertus sp. n., O. confluens sp. n., O. curtistrius sp. n., O. diffluens sp. n., O. fusistrius sp. n., O. gratus sp. n., O. hospes (Lewis, 1902, O. ibiscus sp. n., O. ignifer sp. n., O. impositus sp. n., O. incisus sp. n., O. innocuus sp. n., O. inquilinus sp. n., O. minutus sp. n., O. novateutoniae sp. n., O. praecinctus sp. n., O. prominens sp. n., O. rileyi sp. n., O. subterraneus sp. n., O. tenuis sp. n., O. tiputinus sp. n.], O. farctus group [O. atlanticus sp. n., O. bidessois (Marseul, 1889, O. distinctus (Hinton, 1935, O. distractus (Schmidt, 1896 comb. n., O. farctissimus sp. n., O. farctus (Marseul, 1864, O. gilli sp. n., O. impressistrius sp. n., O. inflatus sp. n., O. latemarginatus (Bickhardt, 1920 comb. n., O. petrovi sp. n., O. plicatus (Hinton, 1935 comb. n., O. prolixus sp. n., O. punctifrons sp. n., O. proximus sp. n., O. subrufus sp. n.], O. hirsutipes group [O. guianensis sp. n., O. hirsutipes sp. n.], O. hamistrius group [O. arquus sp. n., O. campbelli sp. n., O. chiapensis sp. n., O. dybasi sp. n., O. geometricus (Casey, 1893 comb. n
The Doryctinae (Braconidae) of Costa Rica: genera and species of the tribe Heterospilini.
Marsh, Paul M; Wild, Alexander L; Whitfield, James B
2013-01-01
., H. nigracapitus sp. n., H. nigragonatus sp. n., H. nigricoxus sp. n., H. nixoni sp. n., H. noyesi sp. n., H. nueve sp. n., H. nunesi sp. n., H. once sp. n., H. orbitus sp. n., H. orosi sp. n., H. paloverde sp. n., H. pappi sp. n., H. parkeri sp. n., H. parvus sp. n., H. pech sp. n., H. penosa sp. n., H. petiolatus sp. n., H. petralbus sp. n., H. phaeocoxus sp. n., H. phaeoskelus sp. n., H. pharkidodus sp. n., H. phytorius sp. n., H. pitillaensis sp. n., H. poqomchi sp. n., H. poqomom sp. n., H. puertoviejoensis sp. n., H. puntarensis sp. n., H. qanjobal sp. n., H. quickei sp. n., H. quitirrisi sp. n., H. racostica sp. n., H. rama sp. n., H. ramirezi sp. n., H. ratzeburgi sp. n., H. reagani sp. n., H. reinhardi sp. n., H. retheospilus sp. n., H. rhabdotus sp. n., H. ricacosta sp. n., H. rinconensis sp. n., H. robbieae sp. n., H. rohweri sp. n., H. rojasi sp. n., H. romani sp. n., H. rugosus sp. n., H. sabrinae sp. n., H. saminae sp. n., H. sanjosensis sp. n., H. santarosensis sp. n., H. sanvitoensis sp. n., H. saturn sp. n., H. seis sp. n., H. sergeyi sp. n., H. sharkeyi sp. n., H. shawi sp. n., H. shenefelti sp. n., H. shonan sp. n., H. siete sp. n., H. similis sp. n., H. sinuatus sp. n., H. smithi sp. n., H. spiloheterus sp. n., H. staryi sp. n., H. stelfoxi sp. n., H. strazanaci sp. n., H. sumo sp. n., H. szepligeti sp. n., H. terrabas sp. n., H. thereospilus sp. n., H. tobiasi sp. n., H. tolupan sp. n., H. townesi sp. n., H. trece sp. n., H. tres sp. n., H. tricolor sp. n., H. trienta sp. n., H. tuberculatus sp. n., H. turrialbaensis sp. n., H. tzutujil sp. n., H. ugaldei sp. n., H. uno sp. n., H. variabilis sp. n., H. veinte sp. n., H. veintidos sp. n., H. veintitres sp. n., H. veintiuno sp. n., H. vierecki sp. n., H. villegasi sp. n., H. vittatus sp. n., H. vulcanus sp. n., H. wahli sp. n., H. warreni sp. n., H. washingtoni sp. n., H. wesmaeli sp. n., H. whartoni sp. n., H. whitfieldi sp. n., H. wildi sp. n., H. wilkinsoni sp. n., H. wrightae sp. n., H. xanthus
The Doryctinae (Braconidae of Costa Rica: genera and species of the tribe Heterospilini
Directory of Open Access Journals (Sweden)
Paul Marsh
2013-11-01
. n., H. nephus sp. n., H. nigracapitus sp. n., H. nigragonatus sp. n., H. nigricoxus sp. n., H. nixoni sp. n., H. noyesi sp. n., H. nueve sp. n., H. nunesi sp. n., H. once sp. n., H. orbitus sp. n., H. orosi sp. n., H. paloverde sp. n., H. pappi sp. n., H. parkeri sp. n., H. parvus sp. n., H. pech sp. n., H. penosa sp. n., H. petiolatus sp. n., H. petralbus sp. n., H. phaeocoxus sp. n., H. phaeoskelus sp. n., H. pharkidodus sp. n., H. phytorius sp. n., H. pitillaensis sp. n., H. poqomchi sp. n., H. poqomom sp. n., H. puertoviejoensis sp. n., H. puntarensis sp. n., H. qanjobal sp. n., H. quickei sp. n., H. quitirrisi sp. n., H. racostica sp. n., H. rama sp. n., H. ramirezi sp. n., H. ratzeburgi sp. n., H. reagani sp. n., H. reinhardi sp. n., H. retheospilus sp. n., H. rhabdotus sp. n., H. ricacosta sp. n., H. rinconensis sp. n., H. robbieae sp. n., H. rohweri sp. n., H. rojasi sp. n., H. romani sp. n., H. rugosus sp. n., H. sabrinae sp. n., H. saminae sp. n., H. sanjosensis sp. n., H. santarosensis sp. n., H. sanvitoensis sp. n., H. saturn sp. n., H. seis sp. n., H. sergeyi sp. n., H. sharkeyi sp. n., H. shawi sp. n., H. shenefelti sp. n., H. shonan sp. n., H. siete sp. n., H. similis sp. n., H. sinuatus sp. n., H. smithi sp. n., H. spiloheterus sp. n., H. staryi sp. n., H. stelfoxi sp. n., H. strazanaci sp. n., H. sumo sp. n., H. szepligeti sp. n., H. terrabas sp. n., H. thereospilus sp. n., H. tobiasi sp. n., H. tolupan sp. n., H. townesi sp. n., H. trece sp. n., H. tres sp. n., H. tricolor sp. n., H. trienta sp. n., H. tuberculatus sp. n., H. turrialbaensis sp. n., H. tzutujil sp. n., H. ugaldei sp. n., H. uno sp. n., H. variabilis sp. n., H. veinte sp. n., H. veintidos sp. n., H. veintitres sp. n., H. veintiuno sp. n., H. vierecki sp. n., H. villegasi sp. n., H. vittatus sp. n., H. vulcanus sp. n., H. wahli sp. n., H. warreni sp. n., H. washingtoni sp. n., H. wesmaeli sp. n., H. whartoni sp. n., H. whitfieldi sp. n., H. wildi sp. n., H. wilkinsoni sp. n., H