WorldWideScience

Sample records for yy pyy profiles

  1. Neuropeptide Y (NPY) and peptide YY (PYY) receptors in rat brain

    International Nuclear Information System (INIS)

    Ohkubo, T.; Niwa, M.; Yamashita, K.; Kataoka, Y.; Shigematsu, K.

    1990-01-01

    1. Specific binding sites for neuropeptide Y (NPY) and peptide YY (PYY) were investigated in rat brain areas using quantitative receptor autoradiography with 125 I-Bolton-Hunter NPY ( 125 I-BH-NPY) and 125 I-PYY, radioligands for PP-fold family peptides receptors. 2. There were no differences between localization of 125 I-BH-NPY and 125 I-PYY binding sites in the rat brain. High densities of the binding sites were present in the anterior olfactory nucleus, lateral septal nucleus, stratum radiatum of the hippocampus, posteromedial cortical amygdaloid nucleus, and area postrema. 3. In cold ligand-saturation experiments done in the presence of increasing concentrations of unlabeled NPY and PYY, 125 I-BH-NPY and 125 I-PYY binding to the stratum radiatum of the hippocampus, layer I of the somatosensory frontoparietal cortex, molecular layer of the cerebellum, and area postrema was single and of a high affinity. There was a significant difference between the affinities of 125 I-BH-NPY (Kd = 0.96 nM) and 125 I-PYY binding (Kd = 0.05 nM) to the molecular layer of the cerebellum. The binding of the two radioligands to the other areas examined had the same affinities. 4. When comparing the potency of unlabeled rat pancreatic polypeptide (rPP), a family peptide of NPY and PYY, to inhibit the binding to the areas examined, rPP displaced 125 I-BH-NPY and 125 I-PYY binding to the area postrema more potently than it did the binding to the stratum radiatum of the hippocampus, layer I of the somatosensory frontoparietal cortex, and molecular layer of the cerebellum. 5. Thus, the quantitative receptor autoradiographic method with 125 I-BH-NPY and 125 I-PYY revealed differences in binding characteristics of specific NPY and PYY binding sites in different areas of the rat brain. The results provide further evidence for the existence of multiple NPY-PYY receptors in the central nervous system

  2. Ghrelin suppresses cholecystokinin (CCK), peptide YY (PYY) and glucagon-like peptide-1 (GLP-1) in the intestine, and attenuates the anorectic effects of CCK, PYY and GLP-1 in goldfish (Carassius auratus).

    Science.gov (United States)

    Blanco, Ayelén Melisa; Bertucci, Juan Ignacio; Valenciano, Ana Isabel; Delgado, María Jesús; Unniappan, Suraj

    2017-07-01

    Ghrelin is an important gut-derived hormone with an appetite stimulatory role, while most of the intestinal hormones, including cholecystokinin (CCK), peptide YY (PYY) and glucagon-like peptide-1 (GLP-1), are appetite-inhibitors. Whether these important peptides with opposing roles on food intake interact to regulate energy balance in fish is currently unknown. The aim of this study was to characterize the putative crosstalk between ghrelin and CCK, PYY and GLP-1 in goldfish (Carassius auratus). We first determined the localization of CCK, PYY and GLP-1 in relation to ghrelin and its main receptor GHS-R1a (growth hormone secretagogue 1a) in the goldfish intestine by immunohistochemistry. Colocalization of ghrelin/GHS-R1a and CCK/PYY/GLP-1 was found primarily in the luminal border of the intestinal mucosa. In an intestinal explant culture, a significant decrease in prepro-cck, prepro-pyy and proglucagon transcript levels was observed after 60min of incubation with ghrelin, which was abolished by preincubation with the GHS-R1a ghrelin receptor antagonist [D-Lys3]-GHRP-6 (except for proglucagon). The protein expression of PYY and GLP-1 was also downregulated by ghrelin. Finally, intraperitoneal co-administration of CCK, PYY or GLP-1 with ghrelin results in no modification of food intake in goldfish. Overall, results of the present study show for the first time in fish that ghrelin exerts repressive effects on enteric anorexigens. It is likely that these interactions mediate the stimulatory effects of ghrelin on feeding and metabolism in fish. Copyright © 2017 Elsevier Inc. All rights reserved.

  3. The Association of Serum Total Peptide YY (PYY) with Obesity and Body Fat Measures in the CODING Study.

    Science.gov (United States)

    Cahill, Farrell; Ji, Yunqi; Wadden, Danny; Amini, Peyvand; Randell, Edward; Vasdev, Sudesh; Gulliver, Wayne; Sun, Guang

    2014-01-01

    PYY is an appetite suppressing hormone. Low circulating PYY has been linked to greater BMI. However data is controversial and this association has not been verified in large human populations. The purpose of this study was to investigate if fasting serum total PYY is associated with obesity status and/or adiposity at the population level. A total of 2094 subjects (Male-523, Female-1571) participated in this investigation. Total PYY was measured in fasting serum by enzyme-linked immunosorbent assay. Obesity status (NW-normal-weight, OW-overweight and OB-obese) was determined by the Bray Criteria according to body fat percentage measured by dual-energy x-ray absorptiometry and the WHO criteria according to BMI. One-way ANOVA and multiple regression was used to assess the adiposity-specific association between PYY and the following; weight, BMI, waist-circumference, hip-circumference, waist-hip ratio, percent body fat (%BF), trunk fat (%TF), android fat (%AF) and gynoid fat (%GF). PYY was not significantly different among NW, OW and OB groups defined by neither %BF nor BMI for both men and women. However among women, fasting PYY was positively associated with adiposity measures. Women with the highest (Top 33%) waist-circumference, %BF and %TF had significantly higher PYY (10.5%, 8.3% and 9.2% respectively) than women with the lowest (Bottom 33%). Age, smoking, medication use and menopause were all positively associated with PYY levels in women but not in men. To our knowledge this is the largest population based study, with the most comprehensive analysis and measures of confounding factors, to explore the relationship of circulating PYY with obesity. Contrary to initial findings in the literature we discovered that PYY was positively associated with body fat measures (waist-circumference, %BF and %TF) in women. Although the effect size of the positive association of PYY with obesity in women is small, and potentially negligible, it may in fact represent a protective

  4. Salivary PYY: a putative bypass to satiety.

    Directory of Open Access Journals (Sweden)

    Andres Acosta

    Full Text Available Peptide YY(3-36 is a satiation hormone released postprandially into the bloodstream from L-endocrine cells in the gut epithelia. In the current report, we demonstrate PYY(3-36 is also present in murine as well as in human saliva. In mice, salivary PYY(3-36 derives from plasma and is also synthesized in the taste cells in taste buds of the tongue. Moreover, the cognate receptor Y2R is abundantly expressed in the basal layer of the progenitor cells of the tongue epithelia and von Ebner's gland. The acute augmentation of salivary PYY(3-36 induced stronger satiation as demonstrated in feeding behavioral studies. The effect is mediated through the activation of the specific Y2 receptor expressed in the lingual epithelial cells. In a long-term study involving diet-induced obese (DIO mice, a sustained increase in PYY(3-36 was achieved using viral vector-mediated gene delivery targeting salivary glands. The chronic increase in salivary PYY(3-36 resulted in a significant long-term reduction in food intake (FI and body weight (BW. Thus this study provides evidence for new functions of the previously characterized gut peptide PYY(3-36 suggesting a potential simple and efficient alternative therapeutic approach for the treatment of obesity.

  5. Effects of PYY1-36 and PYY3-36 on appetite, energy intake, energy expenditure, glucose and fat metabolism in obese and lean subjects

    DEFF Research Database (Denmark)

    Sloth, Birgitte; Holst, Jens Juul; Flint, Anne

    2006-01-01

    Peptide YY (PYY)(3-36) has been shown to produce dramatic reductions in energy intake (EI), but no human data exist regarding energy expenditure (EE), glucose and fat metabolism. Nothing is known regarding PYY1-36. To compare effects of PYY(1-36) and PYY(3-36) on appetite, EI, EE, insulin, glucose...... and eight obese participants completed 0.2 pmol x kg(-1) x min(-1) PYY(3-36) and 1.6 pmol x kg(-1) x min(-1) PYY(1-36) infusions. PYY(3-36) [corrected] produced [corrected] lower ratings of well-being and [corrected] increases in heart rate, [corrected] FFA, and [corrected] postprandial [corrected] insulin...

  6. Differential effect of PYY1-36 and PYY3-36 on gastric emptying in man

    DEFF Research Database (Denmark)

    Witte, A-B; Grybäck, P; Holst, Jens Juul

    2009-01-01

    Peptide tyrosine-tyrosine (PYY) is a prandially controlled hormone in endocrine ileal and colonic mucosa cells. In plasma, PYY appears as full-length PYY1-36 and truncated PYY3-36. Both have different pharmacological profile, and PYY3-36 seems to inhibit food intake. We aimed at investigating...... the effect of intravenously administered PYY1-36 and PYY3-36 on gastric emptying and short-term metabolic control. Eight healthy adults were studied in single-blinded, randomized design. At separate occasions, intravenous infusion of saline, PYY1-36 or PYY3-36 (0.8 pmol kg(-1) min(-1)) and a radio......-labelled omelette were given. Gastric emptying (scintigraphy), appetite ratings (VAS), and plasma concentrations of insulin, glucose, GLP-1 and PYY were measured. PYY3-36 and PYY1-36 both inhibited gastric emptying, PYY3-36 most effectively. Half-emptying time was prolonged from 63.1+/-5.2 (saline) to 87...

  7. NPY modulates PYY function in the regulation of energy balance and glucose homeostasis.

    Science.gov (United States)

    Zhang, L; Nguyen, A D; Lee, I-C J; Yulyaningsih, E; Riepler, S J; Stehrer, B; Enriquez, R F; Lin, S; Shi, Y-C; Baldock, P A; Sainsbury, A; Herzog, H

    2012-08-01

    Both the neuronal-derived neuropeptide Y (NPY) and the gut hormone peptide YY (PYY) have been implicated in the regulation of energy balance and glucose homeostasis. However, despite similar affinities for the same Y receptors, the co-ordinated actions of these two peptides in energy and glucose homeostasis remain largely unknown. To investigate the mechanisms and possible interactions between PYY with NPY in the regulation of these processes, we utilized NPY/PYY single and double mutant mouse models and examined parameters of energy balance and glucose homeostasis. PYY(-/-) mice exhibited increased fasting-induced food intake, enhanced fasting and oral glucose-induced serum insulin levels, and an impaired insulin tolerance, - changes not observed in NPY(-/-) mice. Interestingly, whereas PYY deficiency-induced impairment in insulin tolerance remained in NPY(-/-) PYY(-/-) mice, effects of PYY deficiency on fasting-induced food intake and serum insulin concentrations at baseline and after the oral glucose bolus were absent in NPY(-/-) PYY(-/-) mice, suggesting that NPY signalling may be required for PYY's action on insulin secretion and fasting-induced hyperphagia. Moreover, NPY(-/-) PYY(-/-) , but not NPY(-/-) or PYY(-/-) mice had significantly decreased daily food intake, indicating interactive control by NPY and PYY on spontaneous food intake. Furthermore, both NPY(-/-) and PYY(-/-) mice showed significantly reduced respiratory exchange ratio during the light phase, with no additive effects observed in NPY(-/-) PYY(-/-) mice, indicating that NPY and PYY may regulate oxidative fuel selection via partly shared mechanisms. Overall, physical activity and energy expenditure, however, are not significantly altered by NPY and PYY single or double deficiencies. These findings show significant and diverse interactions between NPY and PYY signalling in the regulation of different aspects of energy balance and glucose homeostasis. © 2012 Blackwell Publishing Ltd.

  8. Appetite-related peptides in childhood and adolescence: role of ghrelin, PYY, and GLP-1.

    Science.gov (United States)

    Horner, Katy; Lee, SoJung

    2015-11-01

    During childhood and adolescence, a number of factors, including age, puberty, sex, race, and body composition, may contribute to differences in satiety, food intake, and appetite-related peptides. These peptides include the orexigenic peptide ghrelin and anorexigenic gut peptides peptide YY (PYY) and glucagon-like peptide-1 (GLP-1). For example, lower fasting ghrelin levels, lower postprandial ghrelin suppression, and blunted PYY and GLP-1 responses to food intake could contribute to a dysregulation of appetite in already obese children and adolescents. Whereas, changes in these peptides observed during puberty could facilitate growth. A greater understanding of the major moderating factors of appetite-related peptides in the pediatric population is essential to improve interpretation of study findings and for effective tailoring of strategies targeting appetite control to individuals. While more studies are needed, there is some evidence to suggest that exercise-based lifestyle interventions could be a potential therapeutic strategy to improve appetite-peptide profiles in overweight and obese children and adolescents. The aim of this review is (i) to discuss the potential moderating factors of ghrelin, PYY, and GLP-1, including age and puberty, sex, race and body composition; and (ii) to examine the effects of exercise interventions on these appetite-related gut peptides in children and adolescents.

  9. Coffee, hunger, and peptide YY.

    Science.gov (United States)

    Greenberg, James A; Geliebter, Allan

    2012-06-01

    There is evidence from several empirical studies suggesting that coffee may help people control body weight. Our objective was to assess the effects of caffeine, caffeinated coffee, and decaffeinated coffee, both alone and in combination with 75 g of glucose, on perceived hunger and satiety and related peptides. We conducted a placebo-controlled single-blinded randomized 4-way crossover trial. Eleven healthy male volunteers (mean age, 23.5 ± 5.7 years; mean BMI, 23.6 ± 4.2 kg/m(2)) ingested 1 of 3 test beverages (caffeine in water, caffeinated coffee, or decaffeinated coffee) or placebo (water), and 60 minutes later they ingested the glucose. Eight times during each laboratory visit, hunger and satiety were assessed by visual analog scales, and blood samples were drawn to measure 3 endogenous peptides associated with hunger and satiety: ghrelin, peptide YY (PYY), and leptin. Compared to placebo, decaffeinated coffee yielded significantly lower hunger during the whole 180-minute study period and higher plasma PYY for the first 90 minutes (p hunger or PYY. Caffeinated coffee showed a pattern between that of decaffeinated coffee and caffeine in water. These findings suggest that one or more noncaffeine ingredients in coffee may have the potential to decrease body weight. Glucose ingestion did not change the effects of the beverages. Our randomized human trial showed that decaffeinated coffee can acutely decrease hunger and increase the satiety hormone PYY.

  10. Physiological Regulation of Gut Peptide Hormone (PYY) Levels by Age, Sex, Hormonal and Nutritional Status in Rats

    International Nuclear Information System (INIS)

    Hebashy, M.I.A.; Mazen, G.M.A.

    2007-01-01

    Peptide YY hormone (PYY) was recently appreciated as an important gut hormonal regulator of appetite. PYY is produced by the gut and released into the circulation after food intake and is found to decrease appetite. The main form of PYY, both stored and circulated, is PYY(3-36), the N-terminal truncated form of the full length peptide so, peripheral injections of PYY(3-36) in rats inhibit food intake in experimental animals as well as in lean and obese human subjects. Also, this hormone has been suggested to be an attractive therapeutic option for obesity. PYY levels are influenced by age and the highest hormone level is achieved in early postnatal life (day 30) and is decreased thereafter. PYY levels were also dependent on thyroid hormone status and being decreased in hyperthyroid rats. The PYY levels observed in acute and chronic food restricted rats indicated that, in situations of decreased energy intake, the lower PYY levels could serve to regulate central pathways and facilitate food intake. Contrary, in pregnant rats, PYY levels were enhanced at late gestation. The aim of this study was to assess the influence of age, sex, thyroid status, pregnancy and food restriction on PYY levels in rats. The underling mechanisms through which PYY levels alternated as a result of sex, age, pregnancy, thyroidal and nutritional status were discussed in the light of recent research outcomes

  11. Modulation of taste responsiveness by the satiation hormone peptide YY

    Science.gov (United States)

    La Sala, Michael S.; Hurtado, Maria D.; Brown, Alicia R.; Bohórquez, Diego V.; Liddle, Rodger A.; Herzog, Herbert; Zolotukhin, Sergei; Dotson, Cedrick D.

    2013-01-01

    It has been hypothesized that the peripheral taste system may be modulated in the context of an animal's metabolic state. One purported mechanism for this phenomenon is that circulating gastrointestinal peptides modulate the functioning of the peripheral gustatory system. Recent evidence suggests endocrine signaling in the oral cavity can influence food intake (FI) and satiety. We hypothesized that these hormones may be affecting FI by influencing taste perception. We used immunohistochemistry along with genetic knockout models and the specific reconstitution of peptide YY (PYY) in saliva using gene therapy protocols to identify a role for PYY signaling in taste. We show that PYY is expressed in subsets of taste cells in murine taste buds. We also show, using brief-access testing with PYY knockouts, that PYY signaling modulates responsiveness to bitter-tasting stimuli, as well as to lipid emulsions. We show that salivary PYY augmentation, via viral vector therapy, rescues behavioral responsiveness to a lipid emulsion but not to bitter stimuli and that this response is likely mediated via activation of Y2 receptors localized apically in taste cells. Our findings suggest distinct functions for PYY produced locally in taste cells vs. that circulating systemically.—La Sala, M. S., Hurtado, M. D., Brown, A. R., Bohórquez, D. V., Liddle, R. A., Herzog, H., Zolotukhin, S., Dotson, C. D. Modulation of taste responsiveness by the satiation hormone peptide YY. PMID:24043261

  12. PYY(3-36) reduces food intake and body weight and improves insulin sensitivity in rodent models of diet-induced obesity

    DEFF Research Database (Denmark)

    Vrang, Niels; Madsen, Andreas Nygaard; Tang-Christensen, Mads

    2006-01-01

    The gut hormone peptide YY (PYY) was recently proposed to comprise an endogenous satiety factor. We have studied acute anorectic functions of PYY(3-36) in mice and rats, as well as metabolic effects of chronic PYY(3-36) administration to diet-induced obese (DIO) mice and rats. A single intraperit......The gut hormone peptide YY (PYY) was recently proposed to comprise an endogenous satiety factor. We have studied acute anorectic functions of PYY(3-36) in mice and rats, as well as metabolic effects of chronic PYY(3-36) administration to diet-induced obese (DIO) mice and rats. A single...... intraperitoneal injection of PYY(3-36) inhibited food intake in mice, but not in rats. We next investigated the effects of increasing doses (100, 300, and 1,000 microg.kg-1.day-1) of PYY(3-36) administered subcutaneously via osmotic minipumps on food intake and body weight in DIO C57BL/6J mice. Whereas only...... the highest dose (1,000 microg.kg-1.day-1) of PYY(3-36) significantly reduced food intake over the first 3 days, body weight gain was dose dependently reduced, and on day 28 the group treated with 1,000 microg.kg-1.day-1 PYY(3-36) weighed approximately 10% less than the vehicle-treated group. Mesenteric...

  13. Molecular cloning, expression analysis, and potential food intake attenuation effect of peptide YY in grass carp (Ctenopharyngodon idellus).

    Science.gov (United States)

    Chen, Yong; Shen, Yubang; Pandit, Narayan Prasad; Fu, Jianjun; Li, Da; Li, Jiale

    2013-06-15

    The peptide YY (PYY) is a 36 amino acid peptide involved in the food intake control in vertebrates. We have cloned and characterized a PYY gene from grass carp Ctenopharyngodon idellus. The full-length cDNA encodes a precursor protein of grass carp PYY (gcPYY) that consists of a putative 28-amino acid signal peptide, a 36-amino acid mature peptide, an amidation-proteolytic site, and a 30-amino acid carboxy-terminal extension. The gcPYY gene is comprised of 4 exons interspaced by 3 introns as seen in PYYs from other species. Amino acid alignment and gene structure comparison indicate that the structure of PYY is well preserved throughout vertebrate phylogeny. The tissue distribution and postprandial changes in gcPYY mRNA expression were evaluated by real-time PCR, which showed that the gcPYY is expressed abundantly in the central nervous system, with significantly increased expression following a single meal. During embryogenesis, the presence of gcPYY mRNA was detected in early developing embryos, and high expression levels were observed when most larvae completed their switch from endogenous nourishment to exogenous feeding. Reduced food intake by juveniles during a single meal after giving perpheral injection of gcPYY1-36 suggests a potentially important role of PYY in the food intake attenuation in grass carp. Copyright © 2013 Elsevier Inc. All rights reserved.

  14. Steviol Glycoside Rebaudioside A Induces Glucagon-like Peptide-1 and Peptide YY Release in a Porcine ex Vivo Intestinal Model

    NARCIS (Netherlands)

    Ripken, D.; Wielen, N. van der; Wortelboer, H.M.; Meijerink, J.; Witkamp, R.F.; Hendriks, H.F.J.

    2014-01-01

    Glucagon-like peptide-1 (GLP-1) and peptide YY (PYY) are hormones important for satiation and are involved in the process called “ileal brake”. The aim of this study was to investigate the GLP-1- and PYY-stimulating efficacy of rebaudioside A, casein, and sucrose. This was studied using tissue

  15. Steviol glycoside rebaudioside A induces glucagon-like peptide-1 and peptide YY release in a porcine ex vivo intestinal model

    NARCIS (Netherlands)

    Ripken, D.; Wielen, van der N.; Wortelboer, H.M.; Meijerink, J.; Witkamp, R.F.; Hendriks, H.F.

    2014-01-01

    Glucagon-like peptide-1 (GLP-1) and peptide YY (PYY) are hormones important for satiation and are involved in the process called "ileal brake". The aim of this study was to investigate the GLP-1- and PYY-stimulating efficacy of rebaudioside A, casein, and sucrose. This was studied using tissue

  16. Peptide YY induces characteristic meal patterns of aged mice.

    Science.gov (United States)

    Mogami, Sachiko; Yamada, Chihiro; Fujitsuka, Naoki; Hattori, Tomohisa

    2017-11-01

    Changes in eating behavior occur in the elderly due to oral and swallowing dysfunctions. We aimed to clarify the difference between basal meal patterns of young and aged mice in relation to appetite regulating hormones. Thirty two of young (7-week-old) and aged (23-25-month-old) C57BL/6 male mice were acclimated to a single housing and then transferred to a highly sensitive automated feeding monitoring device. Feeding behavior was monitored from the onset of the dark phase after habituation to the device. Plasma peptide YY (PYY) levels were assessed under the several feeding status or after treatment of PYY. PYY and its receptor (NPY Y2 receptor, Y2R) antagonist were intraperitoneally administered 30min before the monitoring. Although the basal 24-h meal amounts did not differ by age, the total meal time and frequency of minimum feeding activity (bout) were significantly increased and the average bout size and time per bout were significantly decreased in aged mice. PYY dynamics were abnormal and the temporal reduction in food intake by exogenous PYY was more prominent in aged mice than in young mice. PYY administration to young mice induced aged-like meal patterns, and Y2R antagonist administration to aged mice induced young-like meal patterns. Aged mice exhibited characteristic meal patterns probably due to PYY metabolism dysfunction and/or enhanced PYY-Y2R signaling, suggesting a novel method for assessing eating difficulties in aged animals and a potential target for the remedy. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. Impact of restraint and disinhibition on PYY plasma levels and subjective feelings of appetite.

    Science.gov (United States)

    Martins, C; Robertson, M D; Morgan, L M

    2010-10-01

    The impact of eating behaviours on circulating levels of appetite-regulating hormones remains largely unknown. The aims of this study were to assess the role of restraint and disinhibition on fasting/postprandial peptide YY (PYY) plasma levels and subjective feelings of appetite in normal-weight individuals and to determine whether the effect was energy load dependent. 33 participants (12 men) were classified as restrained/unrestrained and low/high in disinhibition based on Three Factor Eating Questionnaire-18R and Dutch Eating Behaviour Questionnaire. The impact of restraint/disinhibition on PYY plasma levels and feelings of appetite was measured, after a 500kcal and 1000kcal breakfast, using a randomised crossover design. Restraint did not impact on either fasting or postprandial PYY plasma levels, but participants with high disinhibition had a tendency towards a blunted postprandial PYY response. Moreover, restrained eaters reported lower ratings of prospective food consumption postprandially, and a tendency towards higher fullness/lower hunger. In conclusion, circulating PYY is unaffected by restrained eating behaviour, despite being associated with increased fullness and reduced hunger in the fed state. High levels of disinhibition tend to be associated with a blunted PYY response and this may contribute towards the susceptibility to overconsumption and increased risk of weight gain characteristic of this trait.

  18. Glucagon-like peptide-1 7-36 amide and peptide YY from the L-cell of the ileal mucosa are potent inhibitors of vagally induced gastric acid secretion in man

    DEFF Research Database (Denmark)

    Wettergren, A; Petersen, H; Orskov, C

    1994-01-01

    BACKGROUND: Glucagon-like peptide (GLP-1) 7-36 amide and peptide YY (PYY) from the L-cell of the ileal mucosa are potent inhibitors of gastric acid secretion in man. It is not clear, however, by which mechanism(s) they inhibit acid secretion. In dogs the inhibitory effect of PYY on acid secretion...

  19. Peptide YY3-36 and glucagon-like peptide-1 in functional dyspepsia. Secretion and role in symptom generation

    DEFF Research Database (Denmark)

    Witte, Anne-Barbara; Hilsted, Linda; Holst, Jens Juul

    2016-01-01

    method. Secondly, participants drank 75 mL (90 kcal) per five min until maximal satiety. PYY3-36, GLP-1, glucose, and insulin concentrations were assessed. Satiety measures and dyspeptic symptoms were registered using visual analogue scales. RESULTS: Gastric emptying, glucose, PYY3-36, and GLP-1......OBJECTIVE: The role of peptide YY3-36 (PYY3-36), glucagon-like peptide-1 (GLP-1), and glucose homoeostasis in symptom development in functional dyspepsia (FD) is unclear. The aim was to investigate postprandial changes in plasma PYY3-36, GLP-1, glucose and insulin, and the relationship between PYY3......-36, GLP-1, dyspeptic symptoms, and satiety measurements. MATERIALS AND METHODS: Thirty-six patients with functional dyspepsia and 18 healthy controls consumed a liquid meal at two occasions. Firstly, a fixed amount of 250 mL (300 kcal) was consumed and gastric emptying was assessed using the paracetamol...

  20. Autoradiographic localization of peptide YY and neuropeptide Y binding sites in the medulla oblongata

    International Nuclear Information System (INIS)

    Leslie, R.A.; McDonald, T.J.; Robertson, H.A.

    1988-01-01

    Peptide YY is a highly potent emetic when given intravenously in dogs. We hypothesized that the area postrema, a small brain stem nucleus that acts as a chemoreceptive trigger zone for vomiting and lies outside the blood-brain barrier, might have receptors that PYY would bind to, in order to mediate the emetic response. We prepared [ 125 I]PYY and used autoradiography to show that high affinity binding sites for this ligand were highly localized in the area postrema and related nuclei of the dog medulla oblongata. Furthermore, the distribution of [ 125 I]PYY binding sites in the rat medulla oblongata was very similar to that in the dog; the distribution of [ 125 I]PYY binding sites throughout the rat brain was seen to be similar to the distribution of [ 125 I]NPY binding sites

  1. PYY[3-36] administration decreases the respiratory quotient and reduces adiposity in diet-induced obese mice.

    Science.gov (United States)

    Adams, Sean H; Lei, Chunli; Jodka, Carolyn M; Nikoulina, Svetlana E; Hoyt, Julie A; Gedulin, Bronislava; Mack, Christine M; Kendall, Eric S

    2006-01-01

    In rodents, weight reduction after peptide YY[3-36] (PYY[3-36]) administration may be due largely to decreased food consumption. Effects on other processes affecting energy balance (energy expenditure, fuel partitioning, gut nutrient uptake) remain poorly understood. We examined whether s.c. infusion of 1 mg/(kg x d) PYY[3-36] (for up to 7 d) increased metabolic rate, fat combustion, and/or fecal energy loss in obese mice fed a high-fat diet. PYY[3-36] transiently reduced food intake (e.g., 25-43% lower at d 2 relative to pretreatment baseline) and decreased body weight (e.g., 9-10% reduction at d 2 vs. baseline) in 3 separate studies. Mass-specific metabolic rate in kJ/(kg x h) in PYY[3-36]-treated mice did not differ from controls. The dark cycle respiratory quotient (RQ) was transiently decreased. On d 2, it was 0.747 +/- 0.008 compared with 0.786 +/- 0.004 for controls (P light cycle RQ was reduced throughout the study in PYY[3-36]-treated mice (0.730 +/- 0.006) compared with controls (0.750 +/- 0.009; P energy loss was negligible ( approximately 2% of ingested energy) and did not differ between PYY[3-36]-treated mice and controls. Thus, negative energy balance after PYY[3-36] administration in diet-induced obese mice results from reduced food intake with a relative maintenance of mass-specific energy expenditure. Fat loss and reduced RQ highlight the potential for PYY[3-36] to drive increased mobilization of fat stores to help meet energy requirements in this model.

  2. Presence and dynamics of leptin, GLP-1, and PYY in human breast milk at early postpartum.

    Science.gov (United States)

    Schueler, Jessica; Alexander, Brenda; Hart, Ann Marie; Austin, Kathleen; Larson-Meyer, D Enette

    2013-07-01

    The presence of appetite hormones, namely glucagon-like peptide-1 (GLP-1), peptide YY (PYY), and leptin in breast milk may be important in infant feeding regulation and infant growth. This study evaluated whether concentrations of GLP-1, PYY, and leptin change across a single feeding (from fore- to hindmilk), and are associated with maternal and infant anthropometrics. Thirteen postpartum women (mean ± SD: 25.6 ± 4.5 years, 72.0 ± 11.9 kg) provided fore- and hindmilk samples 4-5 weeks after delivery and underwent measurements of body weight and composition by Dual X-ray Absorptiometry. GLP-1, PYY, and leptin concentrations were measured using radioimmunoassay, and milk fat content was determined by creamatocrit. Concentration of GLP-1 and content of milk fat was higher in hindmilk than foremilk (P ≤ 0.05). PYY and leptin concentrations did not change between fore- and hindmilk. Both leptin concentration and milk fat content were correlated with indices of maternal adiposity, including body mass index (r = 0.65-0.85, P milk may be important in infant appetite and growth regulation. Copyright © 2013 The Obesity Society.

  3. Ghrelin and PYY levels in adolescents with severe obesity: effects of weight loss induced by long-term exercise training and modified food habits.

    Science.gov (United States)

    Gueugnon, Carine; Mougin, Fabienne; Nguyen, Nhu Uyen; Bouhaddi, Malika; Nicolet-Guénat, Marie; Dumoulin, Gilles

    2012-05-01

    This study investigated (a) changes in ghrelin and peptide YY (PYY) concentrations during a weight reduction programme and (b) baseline ghrelin and PYY levels as predictors of weight loss in 32 severely obese adolescents (BMI z score = 4.1). Subjects spent an academic year in an institution for childhood obesity. Fasting ghrelin and PYY, leptin, insulin levels and insulin resistance were measured at baseline (month 0) and during the programme (months 3, 6, 9). In addition, 15 normal-weight teenagers served as reference for the baseline assessments. At baseline, obese teenagers had lower ghrelin and PYY concentrations than normal-weight adolescents (P modification, there was a significant decrease in body weight among obese teenagers, associated with an increase in ghrelin (apparent from month 6; P modification. However, higher baseline PYY tended to correlate with greater anthropometrical changes (P < 0.1). In adolescents with severe obesity, a long-term combination of supervised aerobic exercises and a balanced diet led to weight reduction and increased ghrelin concentrations, without any change in PYY concentrations. Moreover, baseline PYY concentrations might be considered as predictors of weight loss.

  4. Peptide YY (3-36) modulates intracellular calcium through activation of the phosphatidylinositol pathway in hippocampal neurons.

    Science.gov (United States)

    Domingues, Michelle Flores; de Assis, Dênis Reis; Piovesan, Angela Regina; Belo, Cháriston André Dal; da Costa, Jaderson Costa

    2018-02-01

    Peptide YY (PYY) belongs to the neuropeptide Y (NPY) family, which also includes the pancreatic polypeptide (PP) and NPY. PYY is secreted by the intestinal L cells, being present in the blood stream in two active forms capable of crossing the blood brain barrier, PYY (1-36) and its cleavage product, PYY (3-36). PYY is a selective agonist for the Y2 receptor (Y2R) and these receptors are abundant in the hippocampus. Here we investigated the mechanisms by which PYY (3-36) regulates intracellular Ca 2+ concentrations ([Ca 2+ ] i ) in hippocampal neurons by employing a calcium imaging technique in hippocampal cultures. Alterations in [Ca 2+ ] i were detected by changes in the Fluo-4 AM reagent emission. PYY (3-36) significantly increased [Ca 2+ ] from the concentration of 10 -11 M as compared to the controls (infusion of HEPES-buffered solution (HBS) solution alone). The PYY (3-36)-increase in [Ca 2+ ] i remained unchanged even in Ca 2+ -free extracellular solutions. Sarcoplasmic/endoplasmic reticulum Ca 2+ -ATPase pump (SERCA pump) inhibition partially prevent the PYY (3-36)-increase of [Ca 2+ ] i and inositol 1,4,5-triphosphate receptor (IP3R) inhibition also decreased the PYY (3-36)-increase of [Ca 2+ ] i . Taken together, our data strongly suggest that PYY (3-36) mobilizes calcium from the neuronal endoplasmic reticulum (ER) stores towards the cytoplasm. Next, we showed that PYY (3-36) inhibited high K + -induced increases of [Ca 2+ ] i , suggesting that PYY (3-36) could also act by activating G-protein coupled inwardly rectifying potassium K + channels. Finally, the co-infusion of the Y2 receptor (Y2R) antagonist BIIE0246 with PYY (3-36) abolished the [Ca 2+ ] i increase induced by the peptide, suggesting that PYY (3-36)-induced [Ca 2+ ] i increase in hippocampal neurons occurs via Y2Rs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. High serum fasting peptide YY (3-36) is associated with obesity-associated insulin resistance and type 2 diabetes.

    Science.gov (United States)

    Ukkola, Olavi H; Puurunen, Veli-Pekka; Piira, Olli-Pekka; Niva, Jarkko T; Lepojärvi, E Samuli; Tulppo, Mikko P; Huikuri, Heikki V

    2011-10-10

    We studied whether serum fasting levels of active form of peptide YY (PYY), PYY(3-36), are associated with obesity and related phenotypes. The study population consisted of 428 patients with coronary artery disease and diagnosed type 2 diabetes and 440 patients with coronary artery disease but without evidence of diabetes from the ARTEMIS study. The patients were recruited from the consecutive series of patients undergoing coronary angiography in the Oulu University Hospital. The patients without diabetes underwent a 2-hour oral glucose tolerance test. PYY(3-36) levels were analyzed by human PYY(3-36) specific radioimmunoassay. Result suggested that when PYY(3-36) tertiles were considered, high serum fasting PYY(3-36) concentration was associated with high body mass index, waist circumference, hemoglobin A1c, fasting blood glucose, leptin, triglyceride (p for all p ≤ 0.001), serum insulin (p=0.013) and with a low high-density lipoprotein cholesterol (p=0.004) concentrations in the analyses adjusted for age, sex and study group. The link high PYY(3-36)-high insulin level was evident in subjects with normal glucose tolerance (pfasting glucose, impaired glucose tolerance and normal glucose tolerance (pfasting PYY(3-36) concentrations in type 2 diabetic subjects are high. Although high PYY(3-36) is strongly linked to obesity and associated insulin resistance, the relation between PYY(3-36) and type 2 diabetes is independent of body fatness. Copyright © 2011 Elsevier B.V. All rights reserved.

  6. Peptide YY, neuropeptide Y and corticotrophin-releasing factor modulate gastrointestinal motility and food intake during acute stress.

    Science.gov (United States)

    Forbes, Sarah C; Cox, Helen M

    2014-11-01

    Peripheral neuropeptide Y (NPY) provides protection against the endocrine, feeding and gastrointestinal (GI) responses to stress; however, it is not yet established how it interacts with corticotrophin-releasing factor (CRF) to mediate these effects. Peptide YY (PYY) also has significant roles in GI motility and food intake but little is known about its role in stress responses. Upper GI transit, fecal pellet output (FPO) and feeding responses, and the role of CRF1 receptors, during restraint or a novel environment stress, were ascertained in PYY-/-, NPY-/- and wild type (WT) mice, with CRF and the CRF1 antagonist, antalarmin, injected intraperitoneally. Upper GI transit and FPO were significantly increased in PYY-/- mice during restraint stress. Exogenous CRF increased defecation during placement in a novel environment in WT mice through CRF1 , while CRF1 blockade reduced defecation in WT and NPY-/- mice but had no effect in PYY-/- mice. In addition, CRF1 blockade had no effect on upper GI transit in WT mice, or on food intake in PYY-/- or NPY-/- mice, but it significantly increased food intake in WT mice. Endogenous NPY appears to inhibit the colonic motor response induced by CRF1 activation, unlike PYY, while both peptides are required for CRF1 modulation of feeding behavior during stress. Overall, these results provide new insights into the mechanism by which PYY and NPY affect stress responses. © 2014 John Wiley & Sons Ltd.

  7. YY Sex: a Polar Candidate

    Science.gov (United States)

    Gabdeev, M. M.; Shimanskiy, V. V.; Borisov, N. V.; Tazieva, Z. R.

    2017-06-01

    We present spectroscopic investigations of a cataclysmic variable star, YY Sex. There are some uncertainties in the classification of this object. We calculate Doppler maps for Hβ and HeII λ4686Å and show that there is no sign of disk accretion in YY Sex. Consequently, we conclude that YY Sex is a polar.

  8. On the relationship between glucose absorption and glucose‐stimulated secretion of GLP‐1, neurotensin, and PYY from different intestinal segments in the rat

    DEFF Research Database (Denmark)

    Kuhre, Rune Ehrenreich; Christiansen, Charlotte Bayer; Saltiel, Monika Yosifova

    2017-01-01

    luminal glucose (20%, w/v) increased GLP‐1 and NT secretion five to eightfold compared to basal secretion. Compared to the USI, basal and stimulated GLP‐1 secretion from the colon was 8–10 times lower and no NT secretion was detected. Luminal glucose stimulated secretion of PYY four to fivefold from......Ingested glucose powerfully stimulates the secretion of appetite‐ and metabolism‐regulating peptide hormones from the gut – including glucagon‐like peptide‐1 (GLP‐1), neurotensin (NT), and polypeptide YY (PYY). However, the regional origin of these secretions after glucose stimulation is not well...

  9. Changes in circulating peptide YY and ghrelin are associated with early smoking relapse.

    Science.gov (United States)

    Lemieux, Andrine M; al'Absi, Mustafa

    2018-01-01

    Ghrelin and peptide YY (PYY) during ad libitum smoking have been associated with decreased reported craving (ghrelin) and increased positive affect (PYY), and higher baseline ghrelin levels predicted subsequent increased risk of smoking relapse. The current study assessed PYY and ghrelin during ad libitum smoking and again after the initial 48h of a smoking cessation attempt. The data compared smokers who abstained for 28days (n=37), smokers who relapsed (n=54), and nonsmokers (n=37). Plasma samples and subjective measures assessing craving and mood were collected at the beginning of each session. Results showed that relapsers experienced greater levels of distress (ps <0.01). While nonsmokers and abstainers showed no change in ghrelin across the initial 48h, relapsers declined (p <0.01). With PYY, relapsers increased (p <0.05) across the early abstinent phase. PYY and ghrelin may be useful predictors of relapse, specifically in reference to early withdrawal. Copyright © 2017. Published by Elsevier B.V.

  10. YY1 modulates taxane response in epithelial ovarian cancer

    Energy Technology Data Exchange (ETDEWEB)

    Matsumura, Noriomi; Huang, Zhiqing; Baba, Tsukasa; Lee, Paula S.; Barnett, Jason C.; Mori, Seiichi; Chang, Jeffrey T.; Kuo, Wen-Lin; Gusberg, Alison H.; Whitaker, Regina S.; Gray, JoeW.; Fujii, Shingo; Berchuck, Andrew; Murphy, Susan K.

    2008-10-10

    The results of this study show that a high YY1 gene signature (characterized by coordinate elevated expression of transcription factor YY1 and putative YY1 target genes) within serous epithelial ovarian cancers is associated with enhanced response to taxane-based chemotherapy and improved survival. If confirmed in a prospective study, these results have important implications for the potential future use of individualized therapy in treating patients with ovarian cancer. Identification of the YY1 gene signature profile within a tumor prior to initiation of chemotherapy may provide valuable information about the anticipated response of these tumors to taxane-based drugs, leading to better informed decisions regarding chemotherapeutic choice. Survival of ovarian cancer patients is largely dictated by their response to chemotherapy, which depends on underlying molecular features of the malignancy. We previously identified YIN YANG 1 (YY1) as a gene whose expression is positively correlated with ovarian cancer survival. Herein we investigated the mechanistic basis of this association. Epigenetic and genetic characteristics of YY1 in serous epithelial ovarian cancer (SEOC) were analyzed along with YY1 mRNA and protein. Patterns of gene expression in primary SEOC and in the NCI60 database were investigated using computational methods. YY1 function and modulation of chemotherapeutic response in vitro was studied using siRNA knockdown. Microarray analysis showed strong positive correlation between expression of YY1 and genes with YY1 and transcription factor E2F binding motifs in SEOC and in the NCI60 cancer cell lines. Clustering of microarray data for these genes revealed that high YY1/E2F3 activity positively correlates with survival of patients treated with the microtubule stabilizing drug paclitaxel. Increased sensitivity to taxanes, but not to DNA crosslinking platinum agents, was also characteristic of NCI60 cancer cell lines with a high YY1/E2F signature. YY1

  11. Peptide YY in Adolescent Athletes with Amenorrhea, Eumenorrheic Athletes and Non-Athletic Controls

    Science.gov (United States)

    Russell, Melissa; Stark, Jenna; Nayak, Shriddha; Miller, Karen K.; Herzog, David B.; Klibanski, Anne; Misra, Madhusmita

    2009-01-01

    Background Bone mineral density (BMD) is lower in amenorrheic athletes (AA) compared with eumenorrheic athletes (EA). Decreased energy availability and altered levels of appetite regulating hormones (ghrelin and leptin) in AA contribute to hypogonadism, an important cause of low BMD. The role of other nutritionally regulated hormones such as peptide YY (PYY) and adiponectin in mediating gonadal status and bone metabolism remains to be determined. Objectives Our objective was to determine whether PYY and adiponectin are higher in AA compared with EA and contribute to hypogonadism and impaired bone metabolism in AA. Methods We determined PYY and adiponectin in 16 AA, 15 EA and 16 non-athletic controls 12–18 years old, and other nutritionally dependent hormones including ghrelin, leptin and IGF-1. We also measured testosterone, estradiol, PINP and NTX (markers of bone formation and resorption) and BMD. Results PYY was higher in AA than EA (111±52 vs. 61±29 ng/ml, p<0.05), whereas adiponectin did not differ between groups. Although activity scores did not differ, BMI was lower in AA than EA and a larger proportion (62.5% vs. 6.7%) reported disordered eating, indicating lower energy availability. PYY and adiponectin were independent predictors of testosterone in a regression model (p=0.01 and 0.04), but did not predict estradiol. PYY, but not adiponectin, was an independent and negative predictor of PINP (p=0.002) and lumbar bone mineral apparent density Z-scores (p=0.045) in this model. Conclusion High PYY levels (but not adiponectin) differentiate AA from EA, and may be an important factor contributing to low bone density in athletes. PMID:19344792

  12. Anorexia induction by the trichothecene deoxynivalenol (vomitoxin) is mediated by the release of the gut satiety hormone peptide YY.

    Science.gov (United States)

    Flannery, Brenna M; Clark, Erica S; Pestka, James J

    2012-12-01

    Consumption of deoxynivalenol (DON), a trichothecene mycotoxin known to commonly contaminate grain-based foods, suppresses growth of experimental animals, thus raising concerns over its potential to adversely affect young children. Although this growth impairment is believed to result from anorexia, the initiating mechanisms for appetite suppression remain unknown. Here, we tested the hypothesis that DON induces the release of satiety hormones and that this response corresponds to the toxin's anorectic action. Acute ip exposure to DON had no effect on plasma glucagon-like peptide-1, leptin, amylin, pancreatic polypeptide, gastric inhibitory peptide, or ghrelin; however, the toxin was found to robustly elevate peptide YY (PYY) and cholecystokinin (CCK). Specifically, ip exposure to DON at 1 and 5mg/kg bw induced PYY by up to 2.5-fold and CCK by up to 4.1-fold. These responses peaked within 15-120 min and lasted up to 120 min (CCK) and 240 min (PPY), corresponding with depressed rates of food intake. Direct administration of exogenous PYY or CCK similarly caused reduced food intake. Food intake experiments using the NPY2 receptor antagonist BIIE0246 and the CCK1A receptor antagonist devazepide, individually, suggested that PYY mediated DON-induced anorexia but CCK did not. Orolingual exposure to DON induced plasma PYY and CCK elevation and anorexia comparable with that observed for ip exposure. Taken together, these findings suggest that PYY might be one critical mediator of DON-induced anorexia and, ultimately, growth suppression.

  13. The effect of pancreatic polypeptide and peptide YY on pancreatic blood flow and pancreatic exocrine secretion in the anesthetized dog

    International Nuclear Information System (INIS)

    DeMar, A.R.; Lake, R.; Fink, A.S.

    1991-01-01

    Pancreatic polypeptide (PP) and peptide YY (PYY) are inhibitors of pancreatic exocrine secretion in vivo but not in vitro, which suggests intermediate mechanisms of action. To examine the role of pancreatic blood flow in these inhibitory effects, xenon-133 gas clearance was used to measure pancreatic blood flow while simultaneously measuring pancreatic exocrine secretion. PP or PYY (400 pmol/kg/h) was administered during the intermediate hour of a 3-h secretin (125 ng/kg/h)/cholecystokinin octapeptide (CCK-8) (50 ng/kg/h) infusion. Exocrine secretion and pancreatic blood flow during the PP or PYY hours were compared with that observed in the first and third hours of the secretin/CCK-8 infusion. PP and PYY significantly inhibited secretin/CCK-8-induced pancreatic exocrine secretion. In addition, PYY (but not PP) significantly reduced pancreatic blood flow during secretin/CCK-8 stimulation. Nevertheless, there was no correlation between pancreatic blood flow and bicarbonate or protein outputs. It is concluded that changes in pancreatic blood flow do not mediate the inhibitory effects of PP or PYY on the exocrine pancreas

  14. Serum lipase activity and concentration during intravenous infusions of GLP-1 and PYY3-36 and after ad libitum meal ingestion in overweight men

    DEFF Research Database (Denmark)

    Schmidt, Julie Berg; Sjödin, Anders Mikael; Stevner, Lene Susanne

    2016-01-01

    To examine the effect on serum lipase activity and protein concentration of intravenous infusions of glucagon-like peptide-1 (GLP-1) and peptide YY (PYY3-36) and of an ad libitum meal in healthy overweight men. Twenty-five healthy, male subjects participated in this randomized, double-blinded, pl......To examine the effect on serum lipase activity and protein concentration of intravenous infusions of glucagon-like peptide-1 (GLP-1) and peptide YY (PYY3-36) and of an ad libitum meal in healthy overweight men. Twenty-five healthy, male subjects participated in this randomized, double...... the infusion and after intake of an ad libitum meal for measurement of serum lipase. Serum lipase levels measured by enzyme-linked immunosorbent assay (ELISA) following mono-infusions of GLP-1 and PYY3-36 were comparable to serum lipase levels following placebo (P = 0.054 and P = 0.873, respectively......). Following the co-infusion of GLP-1 and PYY3-36, serum lipase levels measured by ELISA decreased over time compared to placebo (P = 0.012). However, the between-group difference was not consistent when each time point was analyzed separately. On the placebo day, serum lipase levels measured by ELISA after...

  15. The effect of a subcutaneous infusion of GLP-1, OXM and PYY on Energy intake and Expenditure in Obese volunteers

    DEFF Research Database (Denmark)

    Tan, Tricia; Behary, Preeshila; Tharakan, George

    2017-01-01

    has been postulated to contribute to its metabolic benefits. Objective: We hypothesised that infusion of the three gut hormones to achieve levels similar to those encountered post-prandially in RYGB patients might be effective in suppressing appetite. The aim of this study was to investigate...... the effect of a continuous infusion of GLP-1, OXM and PYY (GOP) on energy intake and expenditure in obese volunteers. Methods: Obese volunteers were randomised to receive an infusion of GOP or placebo in a single-blinded randomised placebo-controlled cross-over study for 10.5 hours a day. This was delivered......Background: Roux-en-Y gastric bypass (RYGB) surgery is currently the most effective treatment for obesity, although limited by availability and operative risk. The gut hormones Glucagon-like peptide-1 (GLP-1), Peptide YY (PYY) and Oxyntomodulin (OXM) are elevated post-prandially after RYGB, which...

  16. Short term aerobic exercise training increases postprandial pancreatic polypeptide but not peptide YY concentrations in obese individuals

    OpenAIRE

    Kanaley, Jill A.; Heden, Timothy D.; Liu, Ying; Whaley-Connell, Adam T.; Chockalingam, Anand; Dellsperger, Kevin C.; Fairchild, Timothy J.

    2013-01-01

    Objective Short-term exercise training improves glycemic control, but the effect of short-term training on postprandial satiety peptide responses or perceived satiety remains unknown. We tested the hypothesis that short-term aerobic exercise training (15 days) would alter postprandial pancreatic and gut peptide [pancreatic polypeptide (PP) and peptide YY (PYY)] responses and perceived appetite and satiety in obese individuals. Subjects Thirteen healthy obese men and women (age: 42±2 y; BMI: 3...

  17. Estrogen and peptide YY are associated with bone mineral density in premenopausal exercising women.

    Science.gov (United States)

    Scheid, J L; Toombs, R J; Ducher, G; Gibbs, J C; Williams, N I; De Souza, M J

    2011-08-01

    In women with anorexia nervosa, elevated fasting peptide YY (PYY) is associated with decreased bone mineral density (BMD). Prior research from our lab has demonstrated that fasting total PYY concentrations are elevated in exercising women with amenorrhea compared to ovulatory exercising women. The purpose of this study was to assess the association between fasting total PYY, average monthly estrogen exposure and BMD in non-obese premenopausal exercising women. Daily urine samples were collected and assessed for metabolites of estrone 1-glucuronide (E1G) and pregnandiol glucuronide (PdG) for at least one menstrual cycle if ovulatory or a 28-day monitoring period if amenorrheic. Fasting serum samples were pooled over the measurement period and analyzed for total PYY and leptin. BMD and body composition were assessed by dual-energy X-ray absorptiometry. Multiple regression analyses were performed to determine whether measures of body composition, estrogen status, exercise minutes, leptin and PYY explained a significant amount of the variance in BMD at multiple sites. Premenopausal exercising women aged 23.8±0.9years with a mean BMI of 21.2±0.4kg/m(2) exercised 346±48min/week and had a peak oxygen uptake of 49.1±1.8mL/kg/min. Thirty-nine percent (17/44) of the women had amenorrhea. Fasting total PYY concentrations were negatively associated with total body BMD (p=0.033) and total hip BMD (p=0.043). Mean E1G concentrations were positively associated with total body BMD (p=0.033) and lumbar spine (L2-L4) BMD (p=0.047). The proportion of variance in lumbar spine (L2-L4) BMD explained by body weight and E1G cycle mean was 16.4% (R(2)=0.204, p=0.012). The proportion of variance in hip BMD explained by PYY cycle mean was 8.6% (R(2)=0.109, p=0.033). The proportion of variance in total body BMD explained by body weight and E1G cycle mean was 21.9% (R(2)=0.257, p=0.003). PYY, mean E1G and body weight are associated with BMD in premenopausal exercising women. Thus, elevated

  18. Basal and meal-stimulated ghrelin, PYY, CCK levels and satiety in lean women with polycystic ovary syndrome: effect of low-dose oral contraceptive.

    Science.gov (United States)

    Arusoglu, Gulcan; Koksal, Gulden; Cinar, Nese; Tapan, Serkan; Aksoy, Duygu Yazgan; Yildiz, Bulent O

    2013-11-01

    Ghrelin is an orexigenic peptide that stimulates food intake, whereas peptide YY (PYY) and cholecystokinin (CCK) are anorexigenic gut hormones. Patients with polycystic ovary syndrome (PCOS) appear to have alterations in appetite regulation. We aimed to determine whether fasting or meal-stimulated ghrelin, PYY, CCK, and satiety responses are different between lean PCOS patients and healthy women. We also aimed to assess the potential effect of oral contraceptive use on these hormones and satiety response. We conducted a prospective observational study in a university practice. Eighteen lean PCOS patients and 18 healthy control women matched for age and body mass index underwent measurements of circulating ghrelin, PYY, CCK, and satiety index (SI) before and after a standardized mixed meal at 0, 15, 30, 45, 60, 90, 120, and 180 minutes. For PCOS patients who were treated with ethinyl estradiol 30 μg/drospirenone 3 mg for 3 months, measurements were repeated. We measured ghrelin, PYY, and CCK levels and SI. At baseline, fasting ghrelin, PYY, CCK, and SI values in PCOS patients were not different from controls. Meal-stimulated PYY, CCK, and SI were also not different between the groups, whereas PCOS patients had significantly lower meal-stimulated ghrelin levels compared to controls (P = .04). Ghrelin, PYY, CCK, and SI did not show a significant change after treatment with ethinyl estradiol/drospirenone for 3 months. Basal and stimulated hunger and satiety hormones in lean PCOS patients are not different from lean healthy women, except for a lower meal-stimulated ghrelin response. Short-term use of a low-dose oral contraceptive does not have an effect on appetite regulation of PCOS.

  19. Orlistat inhibition of intestinal lipase acutely increases appetite and attenuates postprandial glucagon-like peptide-1-(7-36)-amide-1, cholecystokinin, and peptide YY concentrations

    DEFF Research Database (Denmark)

    Ellrichmann, Mark; Kapelle, Mario; Ritter, Peter R

    2008-01-01

    of Orlistat or placebo. Gastric emptying, gallbladder volume and the plasma levels of CCK, PYY, GLP-1, and ghrelin were determined and appetite sensations were measured using visual analogue scales. RESULTS: Gastric emptying was accelerated by Orlistat administration (P emptying.......0001), whereas appetite and prospective food consumption increased (P gastric and gallbladder emptying and reduces...... whether Orlistat alters the secretion of glucagon-like peptide-1-(7-36)-amide (GLP-1), cholecystokinin (CCK), peptide YY (PYY), and ghrelin as well as postprandial appetite sensations. METHODS: Twenty-five healthy human volunteers were examined with a solid-liquid test meal after the oral administration...

  20. Wheat-fibre-induced changes of postprandial peptide YY and ghrelin responses are not associated with acute alterations of satiety

    DEFF Research Database (Denmark)

    Weickert, Martin O; Spranger, Joachim; Holst, Jens Juul

    2006-01-01

    of plasma peptide YY (PYY), serum ghrelin and satiety as secondary outcome measures of a study investigating effects of cereal fibres on parameters of glucose metabolism. Fourteen healthy women were studied on six occasions in a randomized, single-blind, controlled crossover design. After 24 h run......-in periods and 10 h overnight fasts, subjects ingested isoenergetic and macronutrient matched portions of control white bread or fibre-enriched bread (wheat-fibre or oat-fibre) at 08.15 hours. Gut hormones and hunger scores were measured for 300 min. Basal PYY and ghrelin concentrations were not different...... between the test meals (P>0.15). Postprandial responses of PYY and ghrelin were blunted after the intake of wheat-fibre (total area under the curve (AUC) PYY, 177.9 (SEM 8.1) (pmol/l) min; P=0.016; ghrelin 51.0 (SEM 2.5) (pmol/l) min; P=0.003), but not after oat-fibre (PYY 226.7 (SEM 25.7) (pmol/l) min; P...

  1. Correlations of circulating peptide YY and ghrelin with body weight, rate of weight gain, and time required to achieve the recommended daily intake in preterm infants.

    Science.gov (United States)

    Chen, XiaFang; Du, XueLiang; Zhu, JianXing; Xie, LiJuan; Zhang, YongJun; He, ZhenJuan

    2012-07-01

    The objective was to elucidate the relationships between serum concentrations of the gut hormone peptide YY (PYY) and ghrelin and growth development in infants for potential application to the clinical observation index. Serum concentrations of PYY and ghrelin were measured using radioimmunoassay from samples collected at the clinic. For each patient, gestational age, birth weight, time required to return to birth weight, rate of weight gain, time required to achieve recommended daily intake (RDI) standards, time required for full-gastric feeding, duration of hospitalization, and time of administration of total parenteral nutrition were recorded. Serum PYY and ghrelin concentrations were significantly higher in the preterm group (N = 20) than in the full-term group (N = 20; P weight, and the degree of correlation varied with age. Serum ghrelin concentration correlated negatively with birth weight and positively with the time required to achieve RDI (P newborns and to determine the usefulness of measuring these hormones in clinical practice.

  2. Elevated PYY is associated with energy deficiency and indices of subclinical disordered eating in exercising women with hypothalamic amenorrhea.

    Science.gov (United States)

    Scheid, Jennifer L; Williams, Nancy I; West, Sarah L; VanHeest, Jaci L; De Souza, Mary Jane

    2009-02-01

    The purpose of this study was twofold: (1) to determine if gastrointestinal hormones, associated with energy intake and energy balance, are altered in exercising women with hypothalamic amenorrhea and (2) to assess the association between gastrointestinal hormones and behavioural indicators of subclinical disordered eating in exercising women with hypothalamic amenorrhea. This cross-sectional study analyzed serum ghrelin, peptide YY (PYY), glucagon-like peptide-1 (GLP-1), menstrual status (by E1G and PdG), resting energy expenditure (REE), and subclinical eating behaviours in sedentary ovulatory (SedOv), exercising ovulatory (ExOv), and exercising amenorrheic (ExAmen) women. Groups were similar with respect to age (23.8+/-0.6 years) and BMI (21.4+/-0.3 kg/m(2)). The ratio of REE to predicted REE (REE:predicted REE) was 0.94+/-0.02, 0.94+/-0.02, and 0.88+/-0.02 in the SedOv, ExOv, and ExAmen groups, respectively. The REE:predicted REE in the ExAmen group was consistent with an energy deficiency. LogPYY, ghrelin, dietary cognitive restraint, and drive for thinness were elevated in the ExAmen group compared to other groups. GLP-1 concentrations were similar among groups. LogPYY correlated with drive for thinness and REE/FFM. In conclusion, fasting PYY and ghrelin concentrations are elevated in exercising women with FHA and both gastrointestinal peptides may serve as a proxy indicator of energy deficiency in this population.

  3. Anorectic response to the trichothecene T-2 toxin correspond to plasma elevations of the satiety hormone glucose-dependent insulinotropic polypeptide and peptide YY3-36.

    Science.gov (United States)

    Sheng, Kun; Zhang, Hua; Yue, Jianming; Gu, Wei; Gu, Chao; Zhang, Haibin; Wu, Wenda

    2018-04-22

    T-2 toxin, a potent type A trichothecene mycotoxin, is produced by various Fusarium species and can negatively impact animal and human health. Although anorexia induction is a common hallmark of T-2 toxin-induced toxicity, the underlying mechanisms for this adverse effect are not fully understood. The goal of this study was to determine the roles of two gut satiety hormones, glucose-dependent insulinotropic polypeptide (GIP) and Peptide YY 3-36 (PYY 3-36 ) in anorexia induction by T-2 toxin. Elevations of plasma GIP and PYY 3-36 markedly corresponded to anorexia induction following oral exposure to T-2 toxin using a nocturnal mouse anorexia model. Direct administration of exogenous GIP and PYY 3-36 similarly induced anorectic responses. Furthermore, the GIP receptor antagonist Pro3GIP dose-dependently attenuated both GIP- and T-2 toxin-induced anorectic responses. Pretreatment with NPY2 receptor antagonist JNJ-31020028 induced a dose-dependent attenuation of both PYY 3-36 - and T-2 toxin-induced anorectic responses. To summarize, these findings suggest that both GIP and PYY 3-36 might be critical mediators of anorexia induction by T-2 toxin. Copyright © 2018 Elsevier B.V. All rights reserved.

  4. A case of severe anorexia, excessive weight loss and high peptide YY levels after sleeve gastrectomy.

    Science.gov (United States)

    Pucci, Andrea; Cheung, Wui Hang; Jones, Jenny; Manning, Sean; Kingett, Helen; Adamo, Marco; Elkalaawy, Mohamed; Jenkinson, Andrew; Finer, Nicholas; Doyle, Jacqueline; Hashemi, Majid; Batterham, Rachel L

    2015-01-01

    Sleeve gastrectomy (SG) is the second most commonly performed bariatric procedure worldwide. Altered circulating gut hormones have been suggested to contribute post-operatively to appetite suppression, decreased caloric intake and weight reduction. In the present study, we report a 22-year-old woman who underwent laparoscopic SG for obesity (BMI 46 kg/m(2)). Post-operatively, she reported marked appetite reduction, which resulted in excessive weight loss (1-year post-SG: BMI 22 kg/m(2), weight loss 52%, >99th centile of 1-year percentage of weight loss from 453 SG patients). Gastrointestinal (GI) imaging, GI physiology/motility studies and endoscopy revealed no anatomical cause for her symptoms, and psychological assessments excluded an eating disorder. Despite nutritional supplements and anti-emetics, her weight loss continued (BMI 19 kg/m(2)), and she required nasogastric feeding. A random gut hormone assessment revealed high plasma peptide YY (PYY) levels. She underwent a 3 h meal study following an overnight fast to assess her subjective appetite and circulating gut hormone levels. Her fasted nausea scores were high, with low hunger, and these worsened with nutrient ingestion. Compared to ten other post-SG female patients, her fasted circulating PYY and nutrient-stimulated PYY and active glucagon-like peptide 1 (GLP1) levels were markedly elevated. Octreotide treatment was associated with suppressed circulating PYY and GLP1 levels, increased appetite, increased caloric intake and weight gain (BMI 22 kg/m(2) after 6 months). The present case highlights the value of measuring gut hormones in patients following bariatric surgery who present with anorexia and excessive weight loss and suggests that octreotide treatment can produce symptomatic relief and weight regain in this setting. Roux-en-Y gastric bypass and SG produce marked sustained weight reduction. However, there is a marked individual variability in this reduction, and post-operative weight loss

  5. Effect of weight loss by a low-fat diet and a low-carbohydrate diet on peptide YY levels

    OpenAIRE

    Essah, P. A.; Levy, J. R.; Sistrun, S. N.; Kelly, S. M.; Nestler, J. E.

    2010-01-01

    Objective To compare the effects of weight loss by an energy-restricted low-fat diet versus low-carbohydrate diet on serum peptide YY (PYY) levels. Design 8-week prospective study of 30 obese adults (mean age: 42.8 ± 2.0 years, mean BMI 35.5 ± 0.6 kg/m2). Results After 8 weeks, subjects on the low-carbohydrate diet lost substantially more weight than those on the low-fat diet (5.8 kg vs. 0.99 kg, p

  6. Plasma glucagon-like peptide 1 and peptide YY levels are not altered in symptomatic fructose-sorbitol malabsorption

    DEFF Research Database (Denmark)

    Valeur, Jørgen; Øines, Eliann; Morken, Mette Helvik

    2008-01-01

    consecutive patients with functional abdominal complaints, referred to our clinic for investigation of self-reported food hypersensitivity, were included in the study and compared with 15 healthy volunteers. All subjects ingested a mixture of 25 g fructose and 5 g sorbitol. Pulmonary hydrogen and methane...... excretion and plasma glucagon-like peptide 1 (GLP-1) and peptide YY (PYY) levels were measured during the next 3 h. Both habitual and post-test symptoms were assessed. RESULTS: Malabsorption of fructose and sorbitol was present in 61% of the patients and 73% of the controls. Nevertheless, the patients...

  7. A high carbohydrate, but not fat or protein meal attenuates postprandial ghrelin, PYY and GLP-1 responses in Chinese men.

    Directory of Open Access Journals (Sweden)

    Ehsan Parvaresh Rizi

    Full Text Available It is known that the macronutrient content of a meal has different impacts on the postprandial satiety and appetite hormonal responses. Whether obesity interacts with such nutrient-dependent responses is not well characterized. We examined the postprandial appetite and satiety hormonal responses after a high-protein (HP, high-carbohydrate (HC, or high-fat (HF mixed meal. This was a randomized cross-over study of 9 lean insulin-sensitive (mean±SEM HOMA-IR 0.83±0.10 and 9 obese insulin-resistant (HOMA-IR 4.34±0.41 young (age 21-40 years, normoglycaemic Chinese men. We measured fasting and postprandial plasma concentration of glucose, insulin, active glucagon-like peptide-1 (GLP-1, total peptide-YY (PYY, and acyl-ghrelin in response to HP, HF, or HC meals. Overall postprandial plasma insulin response was more robust in the lean compared to obese subjects. The postprandial GLP-1 response after HF or HP meal was higher than HC meal in both lean and obese subjects. In obese subjects, HF meal induced higher response in postprandial PYY compared to HC meal. HP and HF meals also suppressed ghrelin greater compared to HC meal in the obese than lean subjects. In conclusion, a high-protein or high-fat meal induces a more favorable postprandial satiety and appetite hormonal response than a high-carbohydrate meal in obese insulin-resistant subjects.

  8. A high carbohydrate, but not fat or protein meal attenuates postprandial ghrelin, PYY and GLP-1 responses in Chinese men

    Science.gov (United States)

    Parvaresh Rizi, Ehsan; Loh, Tze Ping; Baig, Sonia; Chhay, Vanna; Huang, Shiqi; Caleb Quek, Jonathan; Tai, E. Shyong; Toh, Sue-Anne

    2018-01-01

    It is known that the macronutrient content of a meal has different impacts on the postprandial satiety and appetite hormonal responses. Whether obesity interacts with such nutrient-dependent responses is not well characterized. We examined the postprandial appetite and satiety hormonal responses after a high-protein (HP), high-carbohydrate (HC), or high-fat (HF) mixed meal. This was a randomized cross-over study of 9 lean insulin-sensitive (mean±SEM HOMA-IR 0.83±0.10) and 9 obese insulin-resistant (HOMA-IR 4.34±0.41) young (age 21–40 years), normoglycaemic Chinese men. We measured fasting and postprandial plasma concentration of glucose, insulin, active glucagon-like peptide-1 (GLP-1), total peptide-YY (PYY), and acyl-ghrelin in response to HP, HF, or HC meals. Overall postprandial plasma insulin response was more robust in the lean compared to obese subjects. The postprandial GLP-1 response after HF or HP meal was higher than HC meal in both lean and obese subjects. In obese subjects, HF meal induced higher response in postprandial PYY compared to HC meal. HP and HF meals also suppressed ghrelin greater compared to HC meal in the obese than lean subjects. In conclusion, a high-protein or high-fat meal induces a more favorable postprandial satiety and appetite hormonal response than a high-carbohydrate meal in obese insulin-resistant subjects. PMID:29385178

  9. Peptide YY receptors in the brain

    International Nuclear Information System (INIS)

    Inui, A.; Oya, M.; Okita, M.

    1988-01-01

    Radiolabelled ligand binding studies demonstrated that specific receptors for peptide YY are present in the porcine as well as the canine brains. Peptide YY was bound to brain tissue membranes via high-affinity (dissociation constant, 1.39 X 10(-10)M) and low-affinity (dissociation constant, 3.72 X 10(-8)M) components. The binding sites showed a high specificity for peptide YY and neuropeptide Y, but not for pancreatic polypeptide or structurally unrelated peptides. The specific activity of peptide YY binding was highest in the hippocampus, followed by the pituitary gland, the hypothalamus, and the amygdala of the porcine brain, this pattern being similarly observed in the canine brain. The results suggest that peptide YY and neuropeptide Y may regulate the function of these regions of the brain through interaction with a common receptor site

  10. Peptide YY: a potential therapy for obesity.

    Science.gov (United States)

    Renshaw, D; Batterham, R L

    2005-03-01

    Obesity now represents a modern epidemic in western society with major health and economic consequences. Unfortunately, previous pharmacological approaches to the treatment of obesity have been associated with life-threatening side effects and limited efficacy. Over recent years there has been a marked increase in our understanding of the physiological mechanisms that regulate body weight and how these are perturbed in obesity. One therapeutic strategy is to develop drugs which both mimic and enhance the body's own satiety signals. The gut hormone peptide tyrosine tyrosine (PYY), which is released postprandially from the gastrointestinal tract, has recently been shown to be a physiological regulator of food intake. Peripheral administration of PYY reduces feeding in rodents via a mechanism which requires the Y2 receptor and is thought to primarily involve modulation of the hypothalamic arcuate nucleus (ARC) circuitry. In humans a single 90-minute infusion of PYY has been shown to markedly reduce subsequent 24-hour caloric intake in lean, normal-weight and obese subjects. Moreover, obese subjects have been found to have low levels of fasting and postprandial PYY suggesting a role for this hormone in the pathogenesis of obesity. Although studies examining the effects of chronic peripheral administration of PYY to humans are awaited, the results from continuous infusion studies in a number of obese rodent models are encouraging with reductions in food intake, body weight and adiposity observed. Potential therapeutic manipulations based on the PYY system include development of Y2 agonists, exogenously administration of PYY or increased endogenous release from the gastrointestinal tract.

  11. Role of Peptide YY3-36 and Glucose-Dependent Insulinotropic Polypeptide in Anorexia Induction by Trichothecences T-2 Toxin, HT-2 Toxin, Diacetoxyscirpenol, and Neosolaniol.

    Science.gov (United States)

    Zhang, Jie; Jia, Hui; Wang, Qingqing; Zhang, Yajie; Wu, Wenda; Zhang, Haibin

    2017-09-01

    Trichothecences, secondary metabolites produced by Fusarium, are serious health risks to humans and animals worldwide. Although type A trichothecence-induced food refusal has been observed, the mechanism underlying the anorexia caused by these compounds is not fully understood. In this study, we hypothesized that anorexia induced by type A trichothecenes, including T-2 toxin (T-2), HT-2 toxin (HT-2), diacetoxyscirpenol (DAS), and neosolaniol (NEO), in mice corresponds to the changes in the gut satiety hormones peptide YY3-36 (PYY3-36) and glucose-dependent insulinotropic polypeptide (GIP) in plasma. A well-characterized mouse food refusal model was used in this assay. Oral exposure to or intraperitoneal (ip) injection of 1 mg/kg bw T-2, HT-2, DAS, or NEO resulted in dramatically decreased food intake, and PYY3-36 and GIP concentrations were elevated accordingly. Specifically, the PYY3-36 and GIP concentrations peaked at 2 h following oral exposure to these 4 toxins individually, although the durations were not identical. After ip administration of T-2 or HT-2, PYY3-36 significantly increased within 6 h. However, no significant difference was found in the DAS and NEO groups. The GIP levels peaked within 2, 2, 0.5, and 0.5 h, respectively, and remained increased up to 6, 6, 2, and 6 h, respectively, following T-2, HT-2, DAS, or NEO ip exposure. The increase in GIP was greater than that of PYY3-36 after exposure to the 4 toxins using 2 administration routes. Together, these findings suggest that PYY3-36 and GIP play a role in T-2-, HT-2-, DAS-, and NEO-induced anorexia. © The Author 2017. Published by Oxford University Press on behalf of the Society of Toxicology. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  12. Evidence of an association between the Arg72 allele of the peptide YY and increased risk of type 2 diabetes

    DEFF Research Database (Denmark)

    Torekov, Signe S; Larsen, Lesli H; Glümer, Charlotte

    2005-01-01

    We tested the hypothesis that variants in the gene encoding the prepropeptide YY (PYY) associate with type 2 diabetes and/or obesity. Mutation analyses of DNA from 84 patients with obesity and familial type 2 diabetes identified two polymorphisms, IVS3 + 68C>T and Arg72Thr, and one rare variant......, +151C>A of PYY. The common allele of the Arg72Thr variant associated with type 2 diabetes with an allele frequency of the Arg allele of 0.667 (95% CI 0.658-0.677) among 4,639 glucose-tolerant subjects and 0.692 (0.674-0.710) among 1,326 patients with type 2 diabetes (P = 0.005, odds ratio 1.19 [95% CI...... tolerance test (OGTT) (P = 0.03), an increased area under the curve for the post-OGTT plasma glucose level (P = 0.03), and a lower insulinogenic index (P = 0.01). In conclusion, the common Arg allele of the PYY Arg72Thr variant modestly associates with type 2 diabetes and with type 2 diabetes...

  13. Release of PYY from pig intestinal mucosa; luminal and neural regulation

    DEFF Research Database (Denmark)

    Sheikh, S P; Holst, J J; Orskov, C

    1989-01-01

    in release of PYY into the circulation. Stimulation of the splanchnic nerves did not affect the basal release of PYY. PYY-immunoreactivity extracted from ileal tissue or released to plasma or perfusate from the ileum was indistinguishable from synthetic porcine PYY by gel filtration and reverse phase HPLC...... of PYY was observed in isolated perfused pig ileum in response to luminal stimulation with glucose and vascular administration of the neuropeptide gastrin-releasing peptide (GRP). Electrical stimulation of the vagus nerve supply to the distal small intestine in intact anaesthetized pigs resulted...

  14. A PYY Q62P variant linked to human obesity

    Energy Technology Data Exchange (ETDEWEB)

    Ahituv, Nadav; Kavaslar, Nihan; Schackwitz, Wendy; Ustaszewska,Anna; Collier, John Michael; Hebert, Sybil; Doelle, Heather; Dent,Robert; Pennacchio, Len A.; McPherson, Ruth

    2005-06-27

    Members of the pancreatic polypeptide family and the irreceptors have been implicated in the control of food intake in rodents and humans. To investigate whether nucleotide changes in these candidate genes result in abnormal weight in humans, we sequenced the coding exons and splice sites of seven family members (NPY, PYY, PPY, NPY1R, NPY2R, NPY4R, and NPY5R) in a large cohort of extremely obese (n=379) and lean (n=378) individuals. In total we found eleven rare non-synonymous variants, four of which exhibited familial segregation, NPY1R L53P and PPY P63L with leanness and NPY2R D42G and PYY Q62P with obesity. Functional analysis of the obese variants revealed NPY2R D42G to have reduced cell surface expression, while previous cell culture based studies indicated variant PYY Q62P to have altered receptor binding selectivity and we show that it fails to reduce food intake through mouse peptide injection experiments. These results support that rare non-synonymous variants within these genes can alter susceptibility to human body mass index extremes.

  15. Anorexigenic postprandial responses of PYY and GLP1 to slow ice cream consumption: preservation in obese adolescents, but not in obese adults.

    Science.gov (United States)

    Rigamonti, A E; Agosti, F; Compri, E; Giunta, M; Marazzi, N; Muller, E E; Cella, S G; Sartorio, A

    2013-03-01

    Eating slowly increases the postprandial responses of some anorexigenic gut hormones in healthy lean subjects. As the rate of food intake is positively associated with obesity, the aim of the study was to determine whether eating the same meal at different rates evokes different postprandial anorexigenic responses in obese adolescent and adult subjects. Eighteen obese adolescents and adults were enrolled. A test meal was consumed on two different sessions by each subject, meal duration taking either 5  min (fast feeding) or 30  min (slow feeding). Circulating levels of glucagon-like peptide 1 (GLP1), peptide YY (PYY), glucose, insulin, and triglycerides were measured over 210  min. Visual analog scales were used to evaluate the subjective feelings of hunger and satiety. fast feeding did not stimulate GLP1 release in obese adolescent and adults, whereas slow feeding increased circulating levels of GLP1 only in obese adolescents. Plasma PYY concentrations increased both in obese adolescents and in adults, irrespective of the eating rate, but slow feeding was more effective in stimulating PYY release in obese adolescents than in adults. simultaneously, slow feeding evoked a higher satiety only in obese adolescents compared with fast feeding but not in obese adults. in obese adolescents, slow feeding decreased hunger (only at 210 min). irrespective of the eating rate, postprandial responses of insulin and triglycerides were higher in obese adults than in obese adolescents. Slow feeding leads to higher concentrations of anorexigenic gut peptides and favors satiety in obese adolescents, but this physiological control of food intake is lost in obese adults.

  16. Effect of weight loss by a low-fat diet and a low-carbohydrate diet on peptide YY levels.

    Science.gov (United States)

    Essah, P A; Levy, J R; Sistrun, S N; Kelly, S M; Nestler, J E

    2010-08-01

    To compare the effects of weight loss by an energy-restricted low-fat diet vs low-carbohydrate diet on serum peptide YY (PYY) levels. 8-Week prospective study of 30 obese adults (mean age: 42.8+/-2.0 years, mean body mass index 35.5+/-0.6 kg m(-2)). After 8 weeks, subjects on the low-carbohydrate diet lost substantially more weight than those on the low-fat diet (5.8 vs 0.99 kg, Plow-fat or low-carbohydrate diet likely represents a compensatory response to maintain energy homeostasis and contributes to difficulty in weight loss during energy-restricted diets.

  17. Immunohistochemical study on the ontogenetic development of the regional distribution of peptide YY, pancreatic polypeptide, and glucagon-like peptide 1 endocrine cells in bovine gastrointestinal tract.

    Science.gov (United States)

    Pyarokhil, Asadullah Hamid; Ishihara, Miyuki; Sasaki, Motoki; Kitamura, Nobuo

    2012-04-10

    The regional distribution and relative frequency of peptide YY (PYY)-, pancreatic polypeptide (PP)-, and glucagon-like peptide 1 (GLP-1)-immunoreactive (IR) cells were determined immunohistochemically in the gastrointestinal tract at seven ontogenetic stages in pre- and postnatal cattle. Different frequencies of PYY-, PP-, and GLP-1-IR cells were found in the intestines at all stages; they were not found in the esophagus and stomach. The frequencies varied depending on the intestinal segment and the developmental stage. The frequencies of PYY- and PP-IR cells were lower in the small intestine and increased from ileum to rectum, whereas GLP-1-IR cells were more numerous in duodenum and jejunum, decreased in ileum and cecum, and increased again in colon and rectum. The frequencies also varied according to pre- and postnatal stages. All three cell types were most numerous in fetus, and decreased in calf and adult groups, indicating that the frequencies of these three types of endocrine cells decrease with postnatal development. The results suggest that these changes vary depending on feeding habits and adaptation of growth, secretion, and motility of intestine at different ontogenetic stages of cattle. Copyright © 2011 Elsevier B.V. All rights reserved.

  18. Promoter-region hypermethylation and expression downregulation of Yy1 (Yin yang 1) in preneoplastic liver lesions in a thioacetamide rat hepatocarcinogenesis model

    International Nuclear Information System (INIS)

    Abe, Hajime; Ogawa, Takashi; Wang, Liyun; Kimura, Masayuki; Tanaka, Takeshi; Morita, Reiko; Yoshida, Toshinori; Shibutani, Makoto

    2014-01-01

    Thioacetamide (TAA) has been used to develop a rodent model for hepatocarcinogenesis. To determine the genes with epigenetic modifications in early hepatocarcinogenesis, we did a genome-wide scan for hypermethylated promoter regions using CpG island microarrays in TAA-promoted rat liver tissue. Eight genes were selected based on the microarray profile; of these, Yy1 and Wdr45b were confirmed to be hypermethylated by methylation-specific polymerase chain reaction (PCR) and pyrosequencing and downregulated by real-time reverse transcription PCR. Non-neoplastic liver cells had nuclear Yy1 immunoreactivity, while preneoplastic foci with glutathione S-transferase placental form (GST-P) immunoreactivity had decreased Yy1 immunoreactivity. The incidence of these foci was proportional to the dose of TAA administered. Co-expression analysis of gene products downstream of Yy1 revealed increased nuclear phospho-c-Myc + foci as well as nuclear and cytoplasmic p21 Cip1+ foci in Yy1 − or GST-P + foci in response to TAA-promotion dose. Although the absolute number of cells was low, the incidence of death receptor 5 − foci was increased in Yy1 − foci in proportion to the TAA dose. Yy1 − /GST-P + foci revealed a higher number of proliferating cell nuclear antigen (PCNA)-immunoreactive cells than Yy1 + /GST-P + foci, while cleaved caspase-3 + cells were unchanged between Yy1 – /GST-P + and Yy1 + /GST-P + foci. In the case of Wdr45b, most GST-P + foci were Wdr45b – and were not increased by TAA promotion. These results suggest involvement of Yy1 in the epigenetic gene regulation at the early stages of TAA promoted cell proliferation and concomitant cell cycle arrest in preneoplastic lesions. - Highlights: • Epigenetically downregulated genes were searched in TAA-promnoted rat livers. • Yy1 and Wdr45b showed promoter-region hypermethylation and mRNA downregulation. • TAA promoted increase of preneoplastic Yy1 – /GST-P + foci showing high proliferation. • TAA

  19. LX4211 increases serum glucagon-like peptide 1 and peptide YY levels by reducing sodium/glucose cotransporter 1 (SGLT1)-mediated absorption of intestinal glucose.

    Science.gov (United States)

    Powell, David R; Smith, Melinda; Greer, Jennifer; Harris, Angela; Zhao, Sharon; DaCosta, Christopher; Mseeh, Faika; Shadoan, Melanie K; Sands, Arthur; Zambrowicz, Brian; Ding, Zhi-Ming

    2013-05-01

    LX4211 [(2S,3R,4R,5S,6R)-2-(4-chloro-3-(4-ethoxybenzyl)phenyl)-6-(methylthio)tetrahydro-2H-pyran-3,4,5-triol], a dual sodium/glucose cotransporter 1 (SGLT1) and SGLT2 inhibitor, is thought to decrease both renal glucose reabsorption by inhibiting SGLT2 and intestinal glucose absorption by inhibiting SGLT1. In clinical trials in patients with type 2 diabetes mellitus (T2DM), LX4211 treatment improved glycemic control while increasing circulating levels of glucagon-like peptide 1 (GLP-1) and peptide YY (PYY). To better understand how LX4211 increases GLP-1 and PYY levels, we challenged SGLT1 knockout (-/-) mice, SGLT2-/- mice, and LX4211-treated mice with oral glucose. LX4211-treated mice and SGLT1-/- mice had increased levels of plasma GLP-1, plasma PYY, and intestinal glucose during the 6 hours after a glucose-containing meal, as reflected by area under the curve (AUC) values, whereas SGLT2-/- mice showed no response. LX4211-treated mice and SGLT1-/- mice also had increased GLP-1 AUC values, decreased glucose-dependent insulinotropic polypeptide (GIP) AUC values, and decreased blood glucose excursions during the 6 hours after a challenge with oral glucose alone. However, GLP-1 and GIP levels were not increased in LX4211-treated mice and were decreased in SGLT1-/- mice, 5 minutes after oral glucose, consistent with studies linking decreased intestinal SGLT1 activity with reduced GLP-1 and GIP levels 5 minutes after oral glucose. These data suggest that LX4211 reduces intestinal glucose absorption by inhibiting SGLT1, resulting in net increases in GLP-1 and PYY release and decreases in GIP release and blood glucose excursions. The ability to inhibit both intestinal SGLT1 and renal SGLT2 provides LX4211 with a novel dual mechanism of action for improving glycemic control in patients with T2DM.

  20. Postprandial response of ghrelin and PYY and indices of low-grade chronic inflammation in lean young women with polycystic ovary syndrome.

    Science.gov (United States)

    Zwirska-Korczala, K; Sodowski, K; Konturek, S J; Kuka, D; Kukla, M; Brzozowski, T; Cnota, W; Woźniak-Grygiel, E; Jaworek, J; Bułdak, R; Rybus-Kalinowska, B; Fryczowski, M

    2008-08-01

    The aim of the study were to answer the question 1.) Whether circulating pro-inflammatory markers of endothelial dysfunction and due to chronic low-grade inflammation of obesity, are altered in untreated lean, young relatively healthy polycystic ovary syndrome (PCOS) patients in comparison with healthy controls; 2.) Whether postprandial plasma concentration pattern of ghrelin and PYY can be predictable as risk factors for atherosclerosis and depend of obesity. Forty young women with PCOS were divided in two groups: 19 lean and 21 obese. The control group included 20 lean, healthy volunteers. Plasma total and active ghrelin, total PYY and PYY(3-36), serum adiponectin and insulin were measured using RIA technique, serum sCD40L, visfatin, sP-, sE-selectins, resistin by EIA. Composition of test meal was: 527 kcal total and consisted of 24.1% fat, 54.4% carbohydrate and 21.5% protein. Total and active ghrelin and total PYY were significantly lower in obese PCOS women, whereas active ghrelin was also significantly lower in lean PCOS women compared to controls. Postprandial plasma total ghrelin levels decrease were blunted in lean and obese compared to controls (12.8 % and 18.2% vs 28.2 %). Postprandial plasma active ghrelin decreased in lean and obese PCOS groups (49.9 % and 44.1 %) and controls (63.8 %). PCOS subjects exhibited smaller rises in postprandial levels of total PYY. Postprandial plasma PYY(3-36) levels increased in obese PCOS women (30.9 %) and controls (41%), whereas lean PCOS women exhibited blunted increase (11.5%). sCD40L levels increased, whereas adiponectin decreased in PCOS groups independently, whereas rise in visfatin, sE- and sP-selectin and the fall in adiponectin was associated with obesity. sP- and sE -selectins correlated positively with obesity. In summary, our study provides the first evidence that lean untreated young PCOS women contribute to the so called "pancreatic islet adaptation to insulin resistance" because of ghrelin and PYY

  1. YY1 Haploinsufficiency Causes an Intellectual Disability Syndrome Featuring Transcriptional and Chromatin Dysfunction

    DEFF Research Database (Denmark)

    Gabriele, Michele; Vulto-van Silfhout, Anneke T; Germain, Pierre-Luc

    2017-01-01

    that define a syndrome of cognitive impairment, behavioral alterations, intrauterine growth restriction, feeding problems, and various congenital malformations. Our combined clinical and molecular data define "YY1 syndrome" as a haploinsufficiency syndrome. Through immunoprecipitation of YY1-bound chromatin...... on the YY1-bound enhancers, underscoring a crucial role for YY1 in enhancer regulation. Collectively, these results define a clinical syndrome caused by haploinsufficiency of YY1 through dysregulation of key transcriptional regulators....

  2. Subjective satiety and plasma PYY concentration after wholemeal pasta.

    Science.gov (United States)

    Costabile, Giuseppina; Griffo, Ettore; Cipriano, Paola; Vetrani, Claudia; Vitale, Marilena; Mamone, Gianfranco; Rivellese, Angela A; Riccardi, Gabriele; Giacco, Rosalba

    2018-06-01

    Dietary fiber and whole grain foods may contribute to the regulation of appetite; however, evidence has produced inconclusive findings. The objective was to evaluate the effects of an experimental wholemeal pasta on appetite ratings, plasma concentrations of gastrointestinal hormones involved in appetite control, and postprandial glucose/insulin responses in healthy adults. Fourteen healthy adults (7M/7F), mean age 30±2 yrs (mean±SEM), participated in a randomized, controlled, crossover trial. Participants consumed on two different days, at one week interval, 117g of wholemeal pasta or 100g of refined wheat pasta (control pasta), similar in energy and macronutrient composition except for fiber amount, which was higher in wholemeal pasta (11 vs 3 g). Appetite ratings, glucose/insulin/lipid and gastrointestinal hormone responses were measured at fasting and for 4-h after the ingestion of the pasta tests, after which self-reported energy intake for 8-h was evaluated. After the wholemeal pasta, the desire to eat and the sensation of hunger were lower (-16%, p=0.04 and -23%, p=0.004, respectively) and satiety was higher (+13%; p=0.08) compared with the control pasta; no effect on self-reported energy intake at subsequent meal was observed. After wholemeal pasta, glucose, triglyceride increased and GLP-1 responses were not different compared to control pasta but insulin response at 30 min (ppasta contributed to appetite control but did not seem to influence acute energy balance. Appetite ratings were associated with modifications in PYY hormone concentrations. Copyright © 2018 Elsevier Ltd. All rights reserved.

  3. The anorexic hormone Peptide YY3-36 is rapidly metabolized to inactive Peptide YY3-34 in vivo

    DEFF Research Database (Denmark)

    Toräng, Signe; Veedfald, Simon; Rosenkilde, Mette Marie

    2015-01-01

    (RIA) and HPLC anal. A metabolite, corresponding to PYY3-34 was formed after incubation in plasma and blood and during the infusion study. When taking the C-terminal degrdn. into account, the half-life (T1/2) of PYY in blood and plasma amounted to 3.4 ± 0.2 and 6.2 ± 0.2 h, resp. After PYY3-36 infusion....... A related peptide, Neuropeptide Y (NPY), may be degraded from the C-terminus. We therefore investigated PYY degrdn. after in vitro incubations in porcine plasma and blood and in vivo by infusing PYY3-36 into multicatheterized pigs (n = 7) (2 pmol/kg/min). Plasma samples were analyzed by region-specific RIAs...

  4. YY1 positively regulates human UBIAD1 expression

    Energy Technology Data Exchange (ETDEWEB)

    Funahashi, Nobuaki, E-mail: nfunahashi@ri.ncgm.go.jp [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Department of Metabolic Disorder, Diabetes Research Center, Research Institute, National Center for Global Health and Medicine, Tokyo (Japan); Hirota, Yoshihisa [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Faculty of Pharmaceutical Sciences, Suzuka University of Medical Science, Suzuka (Japan); Nakagawa, Kimie; Sawada, Natumi; Watanabe, Masato [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Suhara, Yoshitomo [Department of Bioscience and Engineering, Shibaura Institute of Technology, Saitama (Japan); Okano, Toshio [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan)

    2015-05-01

    Vitamin K is involved in bone formation and blood coagulation. Natural vitamin K compounds are composed of the plant form phylloquinone (vitamin K{sub 1}) and a series of bacterial menaquionones (MK-n; vitamin K{sub 2}). Menadione (vitamin K{sub 3}) is an artificial vitamin K compound. MK-4 contains 4-isoprenyl as a side group in the 2-methyl-1,4-naphthoquinone common structure and has various bioactivities. UbiA prenyltransferase domain containing 1 (UBIAD1 or TERE1) is the menaquinone-4 biosynthetic enzyme. UBIAD1 transcript expression significantly decreases in patients with prostate carcinoma and overexpressing UBIAD1 inhibits proliferation of a tumour cell line. UBIAD1 mRNA expression is ubiquitous in mouse tissues, and higher UBIAD1 mRNA expression levels are detected in the brain, heart, kidneys and pancreas. Several functions of UBIAD1 have been reported; however, regulation of the human UBIAD1 gene has not been elucidated. Here we report cloning and characterisation of the human UBIAD1 promoter. A 5′ rapid amplification of cDNA ends analysis revealed that the main transcriptional start site was 306 nucleotides upstream of the translation initiation codon. Deletion and mutation analyses revealed the functional importance of the YY1 consensus motif. Electrophoretic gel mobility shift and chromatin immunoprecipitation assays demonstrated that YY1 binds the UBIAD1 promoter in vitro and in vivo. In addition, YY1 small interfering RNA decreased endogenous UBIAD1 mRNA expression and UBIAD1 conversion activity. These results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter. - Highlights: • We cloned the human UBIAD1 promoter. • The functional importance of the YY1 motif was identified in the UBIAD1 promoter. • YY1 binds the UBIAD1 promoter in vitro and in vivo. • Knockdown of YY1 significantly decreased UBIAD1 expression. • YY1 up-regulates UBIAD1 conversion activity through the UBIAD1

  5. YY1 positively regulates human UBIAD1 expression

    International Nuclear Information System (INIS)

    Funahashi, Nobuaki; Hirota, Yoshihisa; Nakagawa, Kimie; Sawada, Natumi; Watanabe, Masato; Suhara, Yoshitomo; Okano, Toshio

    2015-01-01

    Vitamin K is involved in bone formation and blood coagulation. Natural vitamin K compounds are composed of the plant form phylloquinone (vitamin K 1 ) and a series of bacterial menaquionones (MK-n; vitamin K 2 ). Menadione (vitamin K 3 ) is an artificial vitamin K compound. MK-4 contains 4-isoprenyl as a side group in the 2-methyl-1,4-naphthoquinone common structure and has various bioactivities. UbiA prenyltransferase domain containing 1 (UBIAD1 or TERE1) is the menaquinone-4 biosynthetic enzyme. UBIAD1 transcript expression significantly decreases in patients with prostate carcinoma and overexpressing UBIAD1 inhibits proliferation of a tumour cell line. UBIAD1 mRNA expression is ubiquitous in mouse tissues, and higher UBIAD1 mRNA expression levels are detected in the brain, heart, kidneys and pancreas. Several functions of UBIAD1 have been reported; however, regulation of the human UBIAD1 gene has not been elucidated. Here we report cloning and characterisation of the human UBIAD1 promoter. A 5′ rapid amplification of cDNA ends analysis revealed that the main transcriptional start site was 306 nucleotides upstream of the translation initiation codon. Deletion and mutation analyses revealed the functional importance of the YY1 consensus motif. Electrophoretic gel mobility shift and chromatin immunoprecipitation assays demonstrated that YY1 binds the UBIAD1 promoter in vitro and in vivo. In addition, YY1 small interfering RNA decreased endogenous UBIAD1 mRNA expression and UBIAD1 conversion activity. These results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter. - Highlights: • We cloned the human UBIAD1 promoter. • The functional importance of the YY1 motif was identified in the UBIAD1 promoter. • YY1 binds the UBIAD1 promoter in vitro and in vivo. • Knockdown of YY1 significantly decreased UBIAD1 expression. • YY1 up-regulates UBIAD1 conversion activity through the UBIAD1 promoter

  6. Impaired postprandial releases/syntheses of ghrelin and PYY(3-36) and blunted responses to exogenous ghrelin and PYY(3-36) in a rodent model of diet-induced obesity.

    Science.gov (United States)

    Xu, Junying; McNearney, Terry A; Chen, J D Z

    2011-04-01

    This study investigated the effects of peripheral administration of ghrelin and PYY(3-36) on food intake and plasma and tissue fasting and postprandial ghrelin and PYY(3-36) levels in normal-weight (NW) and diet-induced-obese (DIO) rats. In experiment one, NW and DIO rats received a single intraperitoneal injection of saline, PYY(3-36) or ghrelin; food intake was measured for 4 h. In experiment two, total plasma ghrelin and PYY(3-36), gastric fundus ghrelin, and ascending colon PYY(3-36) were measured either after a 20-h fast or 2 h after refeeding in NW and DIO rats by radioimmunoassay. Compared to the NW rats, findings in the DIO rats revealed: (i) a reduced sensitivity to both the anorectic effect of exogenous PYY(3-36) and the orexigenic effect of exogenous ghrelin; (ii) the postprandial plasma ghrelin levels were significantly higher; and (iii) refeeding decreased endogenous plasma ghrelin levels by 53% in the NW rats and 39% in DIO rats. Refeeding increased the plasma PYY(3-36) level by 58% in the NW rats versus 9% in the DIO rats (P=0.003). Compared with regular rats, DIO rats exhibit blunted responses in food intake to exogenous ghrelin and PYY(3-36). Although endogenous ghrelin and PYY(3-36) in DIO rats are not altered in the fasting state, their responses to food ingestion are blunted in comparison with regular rats. © 2011 Journal of Gastroenterology and Hepatology Foundation and Blackwell Publishing Asia Pty Ltd.

  7. YY1 Protects Cardiac Myocytes from Pathologic Hypertrophy by Interacting with HDAC5

    Science.gov (United States)

    Dockstader, Karen; McKinsey, Timothy A.

    2008-01-01

    YY1 is a transcription factor that can repress or activate the transcription of a variety of genes. Here, we show that the function of YY1 as a repressor in cardiac myocytes is tightly dependent on its ability to interact with histone deacetylase 5 (HDAC5). YY1 interacts with HDAC5, and overexpression of YY1 prevents HDAC5 nuclear export in response to hypertrophic stimuli and the increase in cell size and re-expression of fetal genes that accompany pathological cardiac hypertrophy. Knockdown of YY1 results in up-regulation of all genes present during fetal development and increases the cell size of neonatal cardiac myocytes. Moreover, overexpression of a YY1 deletion construct that does not interact with HDAC5 results in transcription activation, suggesting that HDAC5 is necessary for YY1 function as a transcription repressor. In support of this relationship, we show that knockdown of HDAC5 results in transcription activation by YY1. Finally, we show that YY1 interaction with HDAC5 is dependent on the HDAC5 phosphorylation domain and that overexpression of YY1 reduces HDAC5 phosphorylation in response to hypertrophic stimuli. Our results strongly suggest that YY1 functions as an antihypertrophic factor by preventing HDAC5 nuclear export and that up-regulation of YY1 in human heart failure may be a protective mechanism against pathological hypertrophy. PMID:18632988

  8. A parallel semisynthetic approach for structure-activity relationship studies of peptide YY

    DEFF Research Database (Denmark)

    Albertsen, Louise; Østergaard, Søren; Paulsson, Johan F

    2013-01-01

    -terminally modified PYY(3-36) analogues. By using an intein-based expression system, PYY(3-29) was generated as a C-terminal peptide α-thioester. Heptapeptides bearing an N-terminal cysteine and modifications at one of the four C-terminal positions were synthesized in a 96-well plate by parallel solid-phase synthesis...

  9. An integral projection model with YY-males and application to evaluating grass carp control

    Science.gov (United States)

    Erickson, Richard A.; Eager, Eric A.; Brey, Marybeth; Hansen, Michael J.; Kocovsky, Patrick

    2017-01-01

    Invasive fish species disrupt ecosystems and cause economic damage. Several methods have been discussed to control populations of invasive fish including the release of YY-males. YY-males are fish that have 2 male chromosomes compared to a XY-male. When YY-males mate, they only produce male (XY) offspring. This decreases the female proportion of the population and can, in theory, eradicate local populations by biasing the sex-ratio. YY-males have been used as a population control tool for brook trout in montane streams and lakes in Idaho, USA. The YY-male control method has been discussed for grass carp in Lake Erie, North America. We developed and presented an integral projection model for grass carp to model the use of YY-males as a control method for populations in this lake. Using only the YY-male control method, we found that high levels of YY-males would need to be release annually to control the species. Specifically, these levels were the same order of magnitude as the baseline adult population (e.g., 1000 YY-males needed to be released annual for 20 years to control a baseline adult population of 2500 grass carp). These levels may not be reasonable or obtainable for fisheries managers given the impacts of YY-males on aquatic vegetation and other constraints of natural resource management.

  10. Neurotensin Is Co-Expressed, Co-Released And Acts Together With Glp-1 And Pyy In Enteroendocrine Control Of Metabolism

    DEFF Research Database (Denmark)

    Grunddal, Kaare Villum; Ratner, Cecilia F; Svendsen, Berit

    2016-01-01

    increasingly multi-hormonal, i.e. co-expressing PYY and neurotensin as they move up the villus. Pro-glucagon promoter and pertussis toxin receptor driven cell ablation and reappearance studies indicated that although all the cells die, the GLP-1 cells reappear more quickly than PYY and neurotensin positive...

  11. Effects of PYY3-36 and GLP-1 on energy intake, energy expenditure and appetite in overweight men

    DEFF Research Database (Denmark)

    Schmidt, Julie Berg; Gregersen, Nikolaj Ture; Pedersen, Sue D

    2014-01-01

    Aim: To examine the effects of GLP-1 and PYY3-36, separately and in combination, on energy intake, energy expenditure, appetite sensations, glucose and fat metabolism, ghrelin and vital signs in healthy overweight men. Methods: 25 healthy, male subjects participated in this randomized, double...... of appetite sensations, energy expenditure and fat oxidation, vital signs and blood variables were collected throughout the infusion period. Results: No effect on energy intake was found after monoinfusions of PYY3-36 (-4.2±4.8%, P=0.8) or GLP-1 (-3.0±4.5%, P=0.9). However, the co-infusion reduced energy...

  12. Bidirectional GPR119 agonism requires peptide YY and glucose for activity in mouse and human colon mucosa

    DEFF Research Database (Denmark)

    Tough, Iain R; Forbes, Sarah; Herzog, Herbert

    2018-01-01

    motility in wild-type (WT), GPR119-/- and PYY-/- mice.The water-soluble GPR119 agonist, AR440006 (that cannot traverse epithelial tight-junctions) elicited responses when added apically or basolaterally in mouse and human colonic mucosas. In both species, GPR119 responses were PYY, Y1 receptor...

  13. Polycomb Group Protein YY1 Is an Essential Regulator of Hematopoietic Stem Cell Quiescence

    Directory of Open Access Journals (Sweden)

    Zhanping Lu

    2018-02-01

    Full Text Available Yin yang 1 (YY1 is a ubiquitous transcription factor and mammalian polycomb group protein (PcG with important functions to regulate embryonic development, lineage differentiation, and cell proliferation. YY1 mediates stable PcG-dependent transcriptional repression via recruitment of PcG proteins that catalyze histone modifications. Many questions remain unanswered regarding how cell- and tissue-specificity is achieved by PcG proteins. Here, we demonstrate that a conditional knockout of Yy1 in hematopoietic stem cells (HSCs decreases long-term repopulating activity and ectopic YY1 expression expands HSCs. Although the YY1 PcG domain is required for Igκ chain rearrangement in B cells, the YY1 mutant lacking the PcG domain retained the capacity to stimulate HSC self-renewal. YY1 deficiency deregulated the genetic network governing HSC cell proliferation and impaired stem cell factor/c-Kit signaling, disrupting mechanisms conferring HSC quiescence. These results reveal a mechanism for how a ubiquitously expressed transcriptional repressor mediates lineage-specific functions to control adult hematopoiesis.

  14. Transcription factor YY1 can control AID-mediated mutagenesis in mice.

    Science.gov (United States)

    Zaprazna, Kristina; Basu, Arindam; Tom, Nikola; Jha, Vibha; Hodawadekar, Suchita; Radova, Lenka; Malcikova, Jitka; Tichy, Boris; Pospisilova, Sarka; Atchison, Michael L

    2018-02-01

    Activation-induced cytidine deminase (AID) is crucial for controlling the immunoglobulin (Ig) diversification processes of somatic hypermutation (SHM) and class switch recombination (CSR). AID initiates these processes by deamination of cytosine, ultimately resulting in mutations or double strand DNA breaks needed for SHM and CSR. Levels of AID control mutation rates, and off-target non-Ig gene mutations can contribute to lymphomagenesis. Therefore, factors that control AID levels in the nucleus can regulate SHM and CSR, and may contribute to disease. We previously showed that transcription factor YY1 can regulate the level of AID in the nucleus and Ig CSR. Therefore, we hypothesized that conditional knock-out of YY1 would lead to reduction in AID localization at the Ig locus, and reduced AID-mediated mutations. Using mice that overexpress AID (IgκAID yy1 f/f ) or that express normal AID levels (yy1 f/f ), we found that conditional knock-out of YY1 results in reduced AID nuclear levels, reduced localization of AID to the Sμ switch region, and reduced AID-mediated mutations. We find that the mechanism of YY1 control of AID nuclear accumulation is likely due to YY1-AID physical interaction which blocks AID ubiquitination. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Postprandial PYY increase by resistant starch supplementation is independent of net portal appearance of short-chain fatty acids in pigs

    DEFF Research Database (Denmark)

    Ingerslev, Anne Krog; Jagalur Mutt, Shivaprakash; Lærke, Helle Nygaard

    2017-01-01

    Increased dietary fiber (DF) fermentation and short-chain fatty acid (SCFA) production may stimulate peptide tyrosine-tyrosine (PYY) secretion. In this study, the effects of hindgut SCFA production on postprandial PYY plasma levels were assessed using different experimental diets in a porto.......001), but similar among diets (P > 0.10). In conclusion, the increased postprandial PYY responses in pigs fed with different levels and sources of DF are not caused by an increased SCFA absorption and suggest that other mechanisms such as neural reflexes and possibly an increased flow of digesta in the small...

  16. Individually timing high-protein preloads has no effect on daily energy intake, peptide YY and glucagon-like peptide-1.

    Science.gov (United States)

    Willbond, S M; Doucet, É

    2011-01-01

    Gut hormones have been shown to influence energy intake (EI). To our knowledge, no study has investigated the effects of dietary patterns aimed at optimizing fullness on EI, appetite and gut hormones. To determine whether individually timing high-protein preloads would impact EI, appetite, and peptide YY and glucagon-like peptide-1 (GLP-1) levels. Ten men (body mass index = 25.5 ± 2.6 kg/m(2)) participated in a randomized crossover trial. The three conditions consisted of the self-selection of snacks (condition 1), or the consumption of a preload (300 kcal: 40% protein, 40% carbohydrates and 20% fat) at either 15 min (condition 2) or ∼ 50 min (individually set) (condition 3) before lunch and dinner. During each condition, a standardized breakfast was served, whereas lunch and dinner were self-selected from a five-item menu, and eaten ad libitum. Mealtime and daily EI were measured. Appetite, peptide YY and GLP-1 were sampled over 9 h. No differences in daily EI were noted across conditions (1 = 3078 ± 720 kcal; 2 = 2929 ± 264 kcal; 3 = 2998 ± 437 kcal; not significant). For the most part, daily profiles as well as premeal levels of peptide YY and GLP-1 were not different between conditions. Desire to eat, hunger and prospective food consumption were found to be lowest during condition 1 (P daily EI in healthy human subjects.

  17. YY1 regulates melanocyte development and function by cooperating with MITF.

    Directory of Open Access Journals (Sweden)

    Juying Li

    Full Text Available Studies of coat color mutants have greatly contributed to the discovery of genes that regulate melanocyte development and function. Here, we generated Yy1 conditional knockout mice in the melanocyte-lineage and observed profound melanocyte deficiency and premature gray hair, similar to the loss of melanocytes in human piebaldism and Waardenburg syndrome. Although YY1 is a ubiquitous transcription factor, YY1 interacts with M-MITF, the Waardenburg Syndrome IIA gene and a master transcriptional regulator of melanocytes. YY1 cooperates with M-MITF in regulating the expression of piebaldism gene KIT and multiple additional pigmentation genes. Moreover, ChIP-seq identified genome-wide YY1 targets in the melanocyte lineage. These studies mechanistically link genes implicated in human conditions of melanocyte deficiency and reveal how a ubiquitous factor (YY1 gains lineage-specific functions by co-regulating gene expression with a lineage-restricted factor (M-MITF-a general mechanism which may confer tissue-specific gene expression in multiple lineages.

  18. Expression of YY1 correlates with progression and metastasis in esophageal squamous cell carcinomas

    Directory of Open Access Journals (Sweden)

    Luo J

    2014-09-01

    Full Text Available Judong Luo,1,* Xin Jiang,1,* LiLi Cao,2,* Kejun Dai,1 Shuyu Zhang,3,4 Xin Ge,3,4 Xifa Zhou,1 Xujing Lu1 1Department of Radiotherapy, Changzhou Tumor Hospital, Soochow University, Changzhou, People's Republic of China; 2Department of Molecular Radiobiology, Research Institute for Radiation Biology and Medicine, Hiroshima University, Hiroshima, Japan; 3School of Radiation Medicine and Protection and Jiangsu Provincial Key Laboratory of Radiation Medicine and Protection, 4Collaborative Innovation Center of Radiation Medicine of Jiangsu Higher Education Institutions and School for Radiological and Interdisciplinary Sciences (RAD-X, Soochow University, Suzhou, People's Republic of China  *These authors contributed equally to this work Objective: Esophageal squamous cell carcinoma (ESCC is one of the deadliest cancers worldwide. Yin Yang 1 (YY1 is a ubiquitous and multifunctional zinc-finger transcription factor that plays important biological functions in cell homeostasis and tumorigenesis. The purpose of this study was to investigate the expression of YY1 in different ESCC tissues and the potential relationship with clinicopathological features. Methods: One hundred and four ESCC tissues were collected in this study. The protein levels of YY1 were measured by immunohistochemistry. TE-1 cell invasion in vitro was assessed using the Transwell assay. Results: There were no obvious differences between expression levels in patients over age 64 and those younger than 64, and no noticeable distinction was observed between males and females. However, the YY1 protein level was significantly higher in ESCC tissues with lymph node metastasis than those without lymph node metastasis (P=0.042. Furthermore, the expression of the YY1 protein was stronger in stage III–IV patients than in stage I–II patients (P=0.002, but the protein levels between different histological grades (well, moderate, or poor showed no statistical significance. Similarly, there was no

  19. The Effect of Peptide YY3-36 in Body Mass Regulation in Patients with Exogenous Constitutional Obesity

    Directory of Open Access Journals (Sweden)

    Alexander S. Ametov PhD, ScD³

    2012-03-01

    Full Text Available The article deals with PYY3-36 level in the blood serum of patients suffering from exogenous constitutional obesity and overweight, as well as its role in the process of the body mass growth. Among the 327 patients diagnosed with obesity and overweight, particularly those with Class I and II degrees of obesity (p<0.05 showed a significantly increased level of PYY 3 -36. The highest PYY3-36 level was observed in those with the Class II or second degree of obesity (p<0.05. Exogenous Constitutional Obesity is accompanied by a significant increase in PYY3-36 in patients with Class I and II degrees of obesity.

  20. Essential and Unexpected Role of YY1 to Promote Mesodermal Cardiac Differentiation

    Science.gov (United States)

    Gregoire, Serge; Karra, Ravi; Passer, Derek; Deutsch, Marcus-Andre; Krane, Markus; Feistritzer, Rebecca; Sturzu, Anthony; Domian, Ibrahim; Saga, Yumiko; Wu, Sean M.

    2013-01-01

    Rational Cardiogenesis is regulated by a complex interplay between transcription factors. However, little is known about how these interactions regulate the transition from mesodermal precursors to cardiac progenitor cells (CPCs). Objective To identify novel regulators of mesodermal cardiac lineage commitment. Methods and Results We performed a bioinformatic-based transcription factor binding site analysis on upstream promoter regions of genes that are enriched in embryonic stem cell (ESC)-derived CPCs. From 32 candidate transcription factors screened, we found that YY1, a repressor of sarcomeric gene expression, is present in CPCs in vivo. Interestingly, we uncovered the ability of YY1 to transcriptionally activate Nkx2.5, a key marker of early cardiogenic commitment. YY1 regulates Nkx2.5 expression via a 2.1 kb cardiac-specific enhancer as demonstrated by in vitro luciferase-based assays and in vivo chromatin immunoprecipitation (ChIP) and genome-wide sequencing analysis. Furthermore, the ability of YY1 to activate Nkx2.5 expression depends on its cooperative interaction with Gata4 at a nearby chromatin. Cardiac mesoderm-specific loss-of-function of YY1 resulted in early embryonic lethality. This was corroborated in vitro by ESC-based assays where we show that the overexpression of YY1 enhanced the cardiogenic differentiation of ESCs into CPCs. Conclusion These results demonstrate an essential and unexpected role for YY1 to promote cardiogenesis as a transcriptional activator of Nkx2.5 and other CPC-enriched genes. PMID:23307821

  1. NF-κB–YY1–miR-29 Regulatory Circuitry in Skeletal Myogenesis and Rhabdomyosarcoma

    Science.gov (United States)

    Wang, Huating; Garzon, Ramiro; Sun, Hao; Ladner, Katherine J.; Singh, Ravi; Dahlman, Jason; Cheng, Alfred; Hall, Brett M.; Qualman, Stephen J.; Chandler, Dawn S.; Croce, Carlo M.; Guttridge, Denis C.

    2008-01-01

    SUMMARY Studies support the importance of microRNAs in physiological and pathological processes. Here we describe the regulation and function of miR-29 in myogenesis and Rhabdomyosarcoma (RMS). Results demonstrate that in myoblasts miR-29 is repressed by NF-κB acting through YY1 and the Polycomb. During myogenesis, NF-κB and YY1 downregulation causes derepression of miR-29, which in turn accelerates differentiation by targeting its repressor YY1. However, in RMS cells and primary tumors that possess impaired differentiation, miR-29 is epigenetically silenced by an activated NF-κB-YY1 pathway. Reconstitution of miR-29 in RMS in mice inhibits tumor growth and stimulates differentiation, suggesting that miR-29 acts as a tumor suppressor through its pro-myogenic function. Together, results identify a NF-κB–YY1–miR-29 regulatory circuit whose disruption may contribute to RMS. SIGNIFICANCE MicroRNAs regulate skeletal myogenesis, but their impact in muscle diseases is not well understood. Here we describe miR-29 as an enhancer of myogenic differentiation and a suppressor of RMS. We find that miR-29 exists in a regulatory circuit involving NF-κB and YY1. In myoblasts NF-B acts through YY1 to epigenetically suppress miR-29, while during differentiation miR-29 is induced to facilitate myogenesis by a negative feedback on YY1. Significantly, RMS tumors lose miR-29 due to an elevation in NF-B and YY1, and readjustment of miR-29 levels in RMS stimulates differentiation. Thus, myogenesis is dependent on NF-κB–YY1–miR-29 circuitry whose dysfunction may contribute to RMS pathogenesis. Such findings offer potential avenues for the diagnosis and treatment of muscle relevant cancers. PMID:18977326

  2. YY-39, a tick anti-thrombosis peptide containing RGD domain.

    Science.gov (United States)

    Tang, Jing; Fang, Yaqun; Han, Yajun; Bai, Xuewei; Yan, Xiuwen; Zhang, Yun; Lai, Ren; Zhang, Zhiye

    2015-06-01

    Ticks are obligatory blood feeding ectoparasites, which continuously attach to their hosts for 1-2 weeks. There are many biologically active compounds in tick salivary glands interfering host haemostatic system and to successfully obtain blood meal. Several platelet aggregation inhibitors have been identified from ticks. A family of conserved peptides, which were identified from transcriptome analysis of many tick salivary glands, were found to contain unique primary structure including predicted mature peptides of 39-47 amino acid residues in length and a Pro/Glu(P/E)-Pro/His(P/H)-Lys-Gly-Asp(RGD) domain. Given their unique structure and RGD domain, they are considered a novel family of disintegrins that inhibit platelet aggregation. One of them (YY-39) was tested for its effects on platelets and thrombosis in vivo. YY-39 was found effectively to inhibit platelet aggregation induced by adenosine diphosphate (ADP), thrombin and thromboxane A2 (TXA2). Furthermore, YY-39 blocked platelet adhesion to soluble collagen and bound to purified GPIIb/IIIa in a dose-dependent manner. In in vivo experiments, YY-39 reduced thrombus weight effectively in a rat arteriovenous shunt model and inhibited thrombosis in a carrageenan-induced mouse tail thrombosis model. Combined with their prevalence in ticks and platelet inhibitory functions, this family of peptides might be conserved tick anti-haemostatic molecules. Copyright © 2014 Elsevier Inc. All rights reserved.

  3. Transgenic over-expression of YY1 induces pathologic cardiac hypertrophy in a sex-specific manner

    Science.gov (United States)

    Stauffer, Brian L.; Dockstader, Karen; Russell, Gloria; Hijmans, Jamie; Walker, Lisa; Cecil, Mackenzie; Demos-Davies, Kimberly; Medway, Allen; McKinsey, Timothy A.; Sucharov, Carmen C.

    2015-01-01

    YY1 can activate or repress transcription of various genes. In cardiac myocytes in culture YY1 has been shown to regulate expression of several genes involved in myocyte pathology. YY1 can also acutely protect the heart against detrimental changes in gene expression. In this study we show that cardiac over-expression of YY1 induces pathologic cardiac hypertrophy in male mice, measured by changes in gene expression and lower ejection fraction/fractional shortening. In contrast, female animals are protected against pathologic gene expression changes and cardiac dysfunction. Furthermore, we show that YY1 regulates, in a sex-specific manner, the expression of mammalian enable (Mena), a factor that regulates cytoskeletal actin dynamics and whose expression is increased in several models of cardiac pathology, and that Mena expression in humans with heart failure is sex-dependent. Finally, we show that sex differences in YY1 expression are also observed in human heart failure. In summary, this is the first work to show that YY1 has a sex-specific effect in the regulation of cardiac pathology. PMID:25935483

  4. Essential Roles of Raf/Extracellular Signal-regulated Kinase/Mitogen-activated Protein Kinase Pathway, YY1, and Ca2+ Influx in Growth Arrest of Human Vascular Smooth Muscle Cells by Bilirubin*

    Science.gov (United States)

    Stoeckius, Marlon; Erat, Anna; Fujikawa, Tatsuya; Hiromura, Makoto; Koulova, Anna; Otterbein, Leo; Bianchi, Cesario; Tobiasch, Edda; Dagon, Yossi; Sellke, Frank W.; Usheva, Anny

    2012-01-01

    The biological effects of bilirubin, still poorly understood, are concentration-dependent ranging from cell protection to toxicity. Here we present data that at high nontoxic physiological concentrations, bilirubin inhibits growth of proliferating human coronary artery smooth muscle cells by three events. It impairs the activation of Raf/ERK/MAPK pathway and the cellular Raf and cyclin D1 content that results in retinoblastoma protein hypophosphorylation on amino acids S608 and S780. These events impede the release of YY1 to the nuclei and its availability to regulate the expression of genes and to support cellular proliferation. Moreover, altered calcium influx and calpain II protease activation leads to proteolytical degradation of transcription factor YY1. We conclude that in the serum-stimulated human vascular smooth muscle primary cell cultures, bilirubin favors growth arrest, and we propose that this activity is regulated by its interaction with the Raf/ERK/MAPK pathway, effect on cyclin D1 and Raf content, altered retinoblastoma protein profile of hypophosphorylation, calcium influx, and YY1 proteolysis. We propose that these activities together culminate in diminished 5 S and 45 S ribosomal RNA synthesis and cell growth arrest. The observations provide important mechanistic insight into the molecular mechanisms underlying the transition of human vascular smooth muscle cells from proliferative to contractile phenotype and the role of bilirubin in this transition. PMID:22262839

  5. A major lineage of enteroendocrine cells coexpress CCK, secretin, GIP, GLP-1, PYY, and neurotensin but not somatostatin

    DEFF Research Database (Denmark)

    Egerod, Kristoffer Lihme; Engelstoft, Maja Storm; Grunddal, Kaare Villum

    2012-01-01

    Enteroendocrine cells such as duodenal cholecystokinin (CCK cells) are generally thought to be confined to certain segments of the gastrointestinal (GI) tract and to store and release peptides derived from only a single peptide precursor. In the current study, however, transgenic mice expressing...... enhanced green fluorescent protein (eGFP) under the control of the CCK promoter demonstrated a distribution pattern of CCK-eGFP positive cells that extended throughout the intestine. Quantitative PCR and liquid chromatography-mass spectrometry proteomic analyses of isolated, FACS-purified CCK-eGFP-positive...... to coexpress members of a group of functionally related peptides: CCK, secretin, GIP, GLP-1, PYY, and neurotensin, suggesting a potential therapeutic target for the treatment and prevention of diabetes and obesity....

  6. The Effect of Peptide YY3-36 in Body Mass Regulation in Patients with Exogenous Constitutional Obesity

    OpenAIRE

    Alexander S. Ametov PhD, ScD³; Yuliya Y. Vlasova, PhD¹²

    2012-01-01

    The article deals with PYY3-36 level in the blood serum of patients suffering from exogenous constitutional obesity and overweight, as well as its role in the process of the body mass growth. Among the 327 patients diagnosed with obesity and overweight, particularly those with Class I and II degrees of obesity (p

  7. PARP-1 and YY1 are important novel regulators of CXCL12 gene transcription in rat pancreatic beta cells.

    Directory of Open Access Journals (Sweden)

    Jelena Marković

    Full Text Available Despite significant progress, the molecular mechanisms responsible for pancreatic beta cell depletion and development of diabetes remain poorly defined. At present, there is no preventive measure against diabetes. The positive impact of CXCL12 expression on the pancreatic beta cell prosurvival phenotype initiated this study. Our aim was to provide novel insight into the regulation of rat CXCL12 gene (Cxcl12 transcription. The roles of poly(ADP-ribose polymerase-1 (PARP-1 and transcription factor Yin Yang 1 (YY1 in Cxcl12 transcription were studied by examining their in vitro and in vivo binding affinities for the Cxcl12 promoter in a pancreatic beta cell line by the electrophoretic mobility shift assay and chromatin immunoprecipitation. The regulatory activities of PARP-1 and YY1 were assessed in transfection experiments using a reporter vector with a Cxcl12 promoter sequence driving luciferase gene expression. Experimental evidence for PARP-1 and YY1 revealed their trans-acting potential, wherein PARP-1 displayed an inhibitory, and YY1 a strong activating effect on Cxcl12 transcription. Streptozotocin (STZ-induced general toxicity in pancreatic beta cells was followed by changes in Cxcl12 promoter regulation. PARP-1 binding to the Cxcl12 promoter during basal and in STZ-compromised conditions led us to conclude that PARP-1 regulates constitutive Cxcl12 expression. During the early stage of oxidative stress, YY1 exhibited less affinity toward the Cxcl12 promoter while PARP-1 displayed strong binding. These interactions were accompanied by Cxcl12 downregulation. In the later stages of oxidative stress and intensive pancreatic beta cell injury, YY1 was highly expressed and firmly bound to Cxcl12 promoter in contrast to PARP-1. These interactions resulted in higher Cxcl12 expression. The observed ability of PARP-1 to downregulate, and of YY1 to upregulate Cxcl12 promoter activity anticipates corresponding effects in the natural context where the

  8. No association of peptide tyrosine-tyrosine (PYY) gene R72T variant with obesity in the Kampar Health Clinic cohort, Malaysia.

    Science.gov (United States)

    Chan, P M; Fan, S H; Say, Y H

    2011-08-01

    Peptide Tyrosine-Tyrosine (PYY) is a 36-amino acid peptide hormone released post-prandially from the endocrine cells in the intestinal tract to suppress pancreatic secretions and eventually reduce appetite. The R72T variant in the PYY gene (rs1058046) has been associated with increased susceptibility to obesity. Therefore, the objective of this study was to investigate the association of this variant with obesity and its related anthropometric measurements among the Kampar Health Clinic cohort, Malaysia. A total of 197 (78 males, 119 females; 98 non-obese, 99 obese) subjects were recruited by convenience sampling and anthropometric measurements were taken. Genotyping was performed using StuI Polymerase Chain Reaction-Restriction Fragment Length Polymorphism (PCR-RFLP), revealing 61 RR, 94 RT and 42 TT subjects. Most of the obese subjects had the RT genotype (50.5%), while only 18.2% were TT. PYY R72T genotypes and alleles had no association with obesity (p = 0.535; 0.074, respectively), gender (p = 0.767; p = 0.100, respectively) but were associated with ethnicity (p = 0.003; p = 0.002, respectively). Among the 13 anthropometric measurements taken, significant difference was only found in Waist Circumference (WC) and Visceral Fat Level (VFL) among the alleles, suggesting that subjects with T allele will have an increment of 1.82 cm in WC and 1.32% in VFL. The R72T variant in PYY gene was not associated with obesity and most of its related anthropometric measurements. This suggests that other genes and/or environmental factors like dietary habits and lifestyle factors may be the contributors of obesity.

  9. Sperm quality analysis in XX, XY and YY males of the Nile tilapia (Oreochromis niloticus).

    Science.gov (United States)

    Gennotte, V; François, E; Rougeot, C; Ponthier, J; Deleuze, S; Mélard, C

    2012-07-01

    In Nile tilapia (Oreochromis niloticus), individuals with atypical sexual genotype are commonly used in farming (use of YY males to produce all-male offspring), but they also constitute major tools to study sex determinism mechanisms. In other species, sexual genotype and sex reversal procedures affect different aspects of biology, such as growth, behavior and reproductive success. The aim of this study was to assess the influence of sexual genotype on sperm quality in Nile tilapia. Milt characteristics were compared in XX (sex-reversed), XY and YY males in terms of gonadosomatic index, sperm count, sperm motility and duration of sperm motility. Sperm motility was measured by computer-assisted sperm analysis (CASA) quantifying several parameters: total motility, progressive motility, curvilinear velocity, straight line velocity, average path velocity and linearity. None of the sperm traits measured significantly differed between the three genotypes. Mean values of gonadosomatic index, sperm concentration and sperm motility duration of XX, XY and YY males, respectively ranged from 0.92 to 1.33%, from 1.69 to 2.22 ×10(9) cells mL(-1) and from 18'04″ to 27'32″. Mean values of total motility and curvilinear velocity 1 min after sperm activation, respectively ranged from 53 to 58% and from 71 to 76 μm s(-1) for the three genotypes. After 3 min of activity, all the sperm motility and velocity parameters dropped by half and continued to slowly decrease thereafter. Seven min after activation, only 9 to 13% of spermatozoa were still progressive. Our results prove that neither sexual genotype nor hormonal sex reversal treatments affect sperm quality in male Nile tilapias with atypical sexual genotype. Copyright © 2012 Elsevier Inc. All rights reserved.

  10. Profiles

    International Nuclear Information System (INIS)

    2004-01-01

    Profiles is a synthetic overview of more than 100 national energy markets in the world, providing insightful facts and key energy statistics. A Profile is structured around 6 main items and completed by key statistics: Ministries, public agencies, energy policy are concerned; main companies in the oil, gas, electricity and coal sectors, status, shareholders; reserve, production, imports and exports, electricity and refining capacities; deregulation of prices, subsidies, taxes; consumption trends by sector, energy market shares; main energy projects, production and consumption prospects. Statistical Profiles are present in about 3 pages the main data and indicators on oil, gas, coal and electricity. (A.L.B.)

  11. Comparison of a high-carbohydrate and high-protein breakfast effect on plasma ghrelin, obestatin, NPY and PYY levels in women with anorexia and bulimia nervosa

    Directory of Open Access Journals (Sweden)

    Sedlackova Dana

    2012-06-01

    Full Text Available Abstract Background The present study investigated plasma levels of gut-brain axis peptides ghrelin, obestatin, NPY and PYY after consumption of a high-carbohydrate (HC and high-protein (HP breakfast in patients with anorexia nervosa, bulimia nervosa and in healthy controls. These peptides play an important role in regulation of energy homeostasis and their secretion is disturbed under condition of eating disorders. As various types of consumed macronutrients may induce different plasma hormone responses, so we examined these responses in women patients with eating disorders and compared them with those of healthy controls. Methods We examined plasma hormone responses to HC and HP breakfast in patients with AN (n = 14; age: 24.6 ± 1.8 years, BMI: 15.3 ± 0.7, BN (n = 15; age: 23.2 ± 1.7 years, BMI: 20.5 ± 0.9 and healthy controls (n = 14; age: 24.9 ± 1.4 years, BMI: 21.1 ± 0.8. Blood samples were drawn from the cubital vein, the first blood drawn was collected before meal, and then 30, 60, 90, 120 and 150 min after breakfast consumption. Plasma hormone levels were determined by commercially available RIA kits. Results Fasting and postprandial plasma obestatin levels were significantly increased in both AN and BN patients, while plasma ghrelin levels were significantly increased in AN patients only. After breakfast consumption, plasma levels of ghrelin and obestatin decreased, although they were still above the range of values of healthy controls. Fasting NPY plasma levels were significantly increased in AN and BN patients and did not change postprandially. Fasting PYY levels were comparable in AN, BN and healthy controls, but postprandially significantly increased after HP breakfast in AN and BN patients. Different reactions to breakfast consumption was found for ghrelin and PYY among investigated groups, while for obestatin and NPY these reactions were similar in all groups. Conclusions Significant

  12. Failure of sucrose replacement with the non-nutritive sweetener erythritol to alter GLP-1 or PYY release or test meal size in lean or obese people.

    Science.gov (United States)

    Overduin, Joost; Collet, Tinh-Hai; Medic, Nenad; Henning, Elana; Keogh, Julia M; Forsyth, Faye; Stephenson, Cheryl; Kanning, Marja W; Ruijschop, Rianne M A J; Farooqi, I Sadaf; van der Klaauw, Agatha A

    2016-12-01

    There is considerable interest in the effect of foods containing high intensity sweeteners on satiation. However, less is known about low-calorie bulk sweeteners such as erythritol. In this randomized three-way crossover study, we studied 10 lean and 10 obese volunteers who consumed three test meals on separate occasions: (a) control sucrose meal; (b) isovolumic meal with partial replacement of sucrose by erythritol; (c) isocaloric meal which contained more erythritol but equivalent calories to the control meal. We measured gut hormone levels, hunger and satiety scores, ad libitum food intake, sucrose preference and intake after the manipulations. There was a greater post-prandial excursion in glucose and insulin levels after sucrose than after the erythritol meals. There was no difference in GLP-1/PYY levels or subsequent energy intake and sucrose preference between sucrose control and isovolumic erythritol meals. In lean (but not obese) participants, hunger decreased to a greater extent after the isocaloric erythritol meal compared to the control meal (p = 0.003) reflecting the larger volume of this meal. Replacing sucrose with erythritol leads to comparable hunger and satiety scores, GLP-1 and PYY levels, and subsequent sucrose preference and intake. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  13. Impact of bread making on fructan chain integrity and effect of fructan enriched breads on breath hydrogen, satiety, energy intake, PYY and ghrelin.

    Science.gov (United States)

    Morris, C; Lynn, A; Neveux, C; Hall, A C; Morris, G A

    2015-08-01

    Recently, there has been considerable interest in the satiety inducing properties of inulin type fructans (ITF) as a tool for weight management. As a staple food, breads provide an excellent vehicle for ITF supplementation however the integrity of the ITF chains and properties upon bread making need to be assessed. Breads enriched with 12% fructooligosaccharides (FOS) and 12% inulin were baked and the degree of polymerisation of fructans extracted from the breads were compared to those of pure compounds. An acute feeding study with a single blind cross-over design was conducted with 11 participants to investigate the effect of ITF enriched breads on breath hydrogen, self-reported satiety levels, active ghrelin, total PYY and energy intake. Size exclusion chromatography indicated that little or no depolymerisation of inulin occurred during bread making, however, there was evidence of modest FOS depolymerisation. Additionally, ITF enriched breads resulted in increased concentrations of exhaled hydrogen although statistical significance was reached only for the inulin enriched bread (p = 0.001). There were no significant differences between bread types in reported satiety (p = 0.129), plasma active ghrelin (p = 0.684), plasma PYY (p = 0.793) and energy intake (p = 0.240). These preliminary results indicate that inulin enriched bread may be a suitable staple food to increase ITF intake. Longer intervention trials are required to assess the impact of inulin enriched breads on energy intake and body weight.

  14. YY1 binding association with sex-biased transcription revealed through X-linked transcript levels and allelic binding analyses.

    Science.gov (United States)

    Chen, Chih-Yu; Shi, Wenqiang; Balaton, Bradley P; Matthews, Allison M; Li, Yifeng; Arenillas, David J; Mathelier, Anthony; Itoh, Masayoshi; Kawaji, Hideya; Lassmann, Timo; Hayashizaki, Yoshihide; Carninci, Piero; Forrest, Alistair R R; Brown, Carolyn J; Wasserman, Wyeth W

    2016-11-18

    Sex differences in susceptibility and progression have been reported in numerous diseases. Female cells have two copies of the X chromosome with X-chromosome inactivation imparting mono-allelic gene silencing for dosage compensation. However, a subset of genes, named escapees, escape silencing and are transcribed bi-allelically resulting in sexual dimorphism. Here we conducted in silico analyses of the sexes using human datasets to gain perspectives into such regulation. We identified transcription start sites of escapees (escTSSs) based on higher transcription levels in female cells using FANTOM5 CAGE data. Significant over-representations of YY1 transcription factor binding motif and ChIP-seq peaks around escTSSs highlighted its positive association with escapees. Furthermore, YY1 occupancy is significantly biased towards the inactive X (Xi) at long non-coding RNA loci that are frequent contacts of Xi-specific superloops. Our study suggests a role for YY1 in transcriptional activity on Xi in general through sequence-specific binding, and its involvement at superloop anchors.

  15. Production and evaluation of YY-male Brook Trout to eradicate nonnative wild brook trout populations

    Science.gov (United States)

    Kennedy, Patrick; Schill, Daniel J.; Meyer, Kevin A.; Campbell, Matthew R.; Vu, Ninh V.; Hansen, Michael J.

    2017-01-01

    Nonnative Brook Trout Salvelinus fontinalis were introduced throughout western North America in the early 1900s, resulting in widespread self-sustaining populations that are difficult to eradicate and often threaten native salmonid populations. A novel approach for their eradication involves use of YY male (MYY) Brook Trout (created in the hatchery by feminizing XY males and crossing them with normal XY males). If MYY Brook Trout survive after stocking, and reproduce successfully with wild females, in theory this could eventually drive the sex ratio of the wild population to 100% males, at which point the population would not be able to reproduce and would be eradicated. This study represents the first successful development of a FYY and MYY salmonid broodstock, which was produced in four years at relatively low cost. Field trials demonstrated that stocked hatchery MYY Brook Trout survived and produced viable MYY offspring in streams, although reproductive fitness appeared to have been lower than their wild conspecifics. Even if reduced fitness is the norm in both streams and alpine lakes, our population simulations suggest that eradication can be achieved in reasonable time periods under some MYY stocking scenarios, especially when wild Brook Trout are simultaneously suppressed in the population.

  16. Analysis of the genome sequence of the pathogenic Muscovy duck parvovirus strain YY reveals a 14-nucleotide-pair deletion in the inverted terminal repeats.

    Science.gov (United States)

    Wang, Jianye; Huang, Yu; Zhou, Mingxu; Zhu, Guoqiang

    2016-09-01

    Genomic information about Muscovy duck parvovirus is still limited. In this study, the genome of the pathogenic MDPV strain YY was sequenced. The full-length genome of YY is 5075 nucleotides (nt) long, 57 nt shorter than that of strain FM. Sequence alignment indicates that the 5' and 3' inverted terminal repeats (ITR) of strain YY contain a 14-nucleotide-pair deletion in the stem of the palindromic hairpin structure in comparison to strain FM and FZ91-30. The deleted region contains one "E-box" site and one repeated motif with the sequence "TTCCGGT" or "ACCGGAA". Phylogenetic trees constructed based the protein coding genes concordantly showed that YY, together with nine other MDPV isolates from various places, clustered in a separate branch, distinct from the branch formed by goose parvovirus (GPV) strains. These results demonstrate that, despite the distinctive deletion, the YY strain still belongs to the classical MDPV group. Moreover, the deletion of ITR may contribute to the genome evolution of MDPV under immunization pressure.

  17. Effects of prepartum fat supplementation on plasma concentrations of glucagon-like peptide-1, peptide YY, adropin, insulin, and leptin in periparturient dairy cows.

    Science.gov (United States)

    Zapata, Rizaldy C; Salehi, Reza; Ambrose, Divakar J; Chelikani, Prasanth K

    2015-10-01

    Dietary fat supplementation during the periparturient period is one strategy to increase energy intake and attenuate the degree of negative energy balance during early lactation; however, little is known of the underlying hormonal and metabolic adaptations. We evaluated the effects of prepartum fat supplementation on energy-balance parameters and plasma concentrations of glucagon-like peptide-1, peptide tyrosine-tyrosine (PYY), adropin, insulin, leptin, glucose, nonesterified fatty acid, and β-hydroxybutyric acid in dairy cows. Twenty-four pregnant dairy cows were randomized to diets containing either rolled canola or sunflower seed at 8% of dry matter, or no oilseed supplementation, during the last 5 wk of gestation and then assigned to a common lactation diet postpartum. Blood samples were collected at -2, +2, and +14 h relative to feeding, at 2 wk after the initiation of the diets, and at 2 wk postpartum. Dietary canola and sunflower supplementation alone did not affect energy balance, body weight, and plasma concentrations of glucagon-like peptide-1, PYY, adropin, insulin, leptin, nonesterified fatty acid, and β-hydroxybutyric acid; however, canola decreased and sunflower tended to decrease dry matter intake. We also observed that the physiological stage had a significant, but divergent, effect on circulating hormones and metabolite concentrations. Plasma glucagon-like peptide-1, PYY, adropin, nonesterified fatty acid, and β-hydroxybutyric acid concentrations were greater postpartum than prepartum, whereas glucose, insulin, leptin, body weight, and energy balance were greater prepartum than postpartum. Furthermore, the interaction of treatment and stage was significant for leptin and adropin, and tended toward significance for PYY and insulin; only insulin exhibited an apparent postprandial increase. Postpartum PYY concentrations exhibited a strong negative correlation with body weight, suggesting that PYY may be associated with body weight regulation during

  18. [Effect of sibutramine (meridia) on body composition, peptide YY3-36 and serotonin levels in patients with exogenous constitutional obesity].

    Science.gov (United States)

    Vlasova, Iu Iu; Ametov, A S

    2010-01-01

    To evaluate the impact of gradual weight loss and the positive effect of sibutramine on metabolic parameters and the levels of serotonin and neuropeptide YY3-36 levels in patients with exogenous constitutional obesity (ECO). The study included 36 patients (24 women and 12 men; mean age 37.56 +/- 0.9 years) with a verified diagnosis of ECO. The height, body weight, waist and hip circumference (WC and HC), and body mass index (BMI) were determined. Adipose tissue content was estimated by a bioimpedance method using an adipose mass analyzer. Serum peptide YY3-36 levels were measured by enzyme immunoassay and blood serotonin concentrations were estimated by high performance liquid chromatography with an electrochemical method. 12-week sibutramine therapy caused a significant reduction in body weight, WC, HC, and BMI (p < 0.05) in all the patients. At the same time they were found to have a considerable body composition change (total body and visceral fat was decreased, total body water increased, and systemic metabolism was lowered). The mean peptide YY3-36 level was significantly decreased. Sibutramine did not affect the serum content of total serotonin in the sera of patients. Sibutramine used in the combined therapy in patients with ECO contributes to an effective and steady-state weight loss. Sibutramine treatment causes a reduction in total neuropeptide YY3-36, systemic metabolism, and adipose tissue at the expense of the visceral depot.

  19. The Ku Protein Complex Interacts with YY1, Is Up-Regulated in Human Heart Failure, and Represses α Myosin Heavy-Chain Gene Expression

    Science.gov (United States)

    Sucharov, Carmen C.; Helmke, Steve M.; Langer, Stephen J.; Perryman, M. Benjamin; Bristow, Michael; Leinwand, Leslie

    2004-01-01

    Human heart failure is accompanied by repression of genes such as α myosin heavy chain (αMyHC) and SERCA2A and the induction of fetal genes such as βMyHC and atrial natriuretic factor. It seems likely that changes in MyHC isoforms contribute to the poor contractility seen in heart failure, because small changes in isoform composition can have a major effect on the contractility of cardiac myocytes and the heart. Our laboratory has recently shown that YY1 protein levels are increased in human heart failure and that YY1 represses the activity of the human αMyHC promoter. We have now identified a region of the αMyHC promoter that binds a factor whose expression is increased sixfold in failing human hearts. Through peptide mass spectrometry, we identified this binding activity to be a heterodimer of Ku70 and Ku80. Expression of Ku represses the human αMyHC promoter in neonatal rat ventricular myocytes. Moreover, overexpression of Ku70/80 decreases αMyHC mRNA expression and increases skeletal α-actin. Interestingly, YY1 interacts with Ku70 and Ku80 in HeLa cells. Together, YY1, Ku70, and Ku80 repress the αMyHC promoter to an extent that is greater than that with YY1 or Ku70/80 alone. Our results suggest that Ku is an important factor in the repression of the human αMyHC promoter during heart failure. PMID:15367688

  20. Spin correlation parameters A{sub xx} and A{sub yy} measurements in p-p scattering from 11 to 26 MeV; Mesure des coefficients de correlation de spins A{sub xx} et A{sub yy} dans la diffusion p-p de 11 a 26 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Catillon, Ph; Chapellier, M; Garreta, D [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-07-01

    The A{sub xx} and A{sub yy} spin correlation coefficients of the proton-proton scattering have been measured at the laboratory energies of 11,40 - 19,15 - 23,45 and 26,50 MeV for the center of mass scattering angle 90 degrees. These measurements have been made by scattering a polarized proton beam on a polarized proton target. (authors) [French] Les coefficients de correlation de spins A{sub xx} et A{sub yy} de la diffusion proton-proton ont ete mesures aux energies laboratoire de 11,40 - 19,15 - 23,45 et 26,50 MeV pour un angle de diffusion dans le centre de masse egal a 90 degres. Ces mesures ont ete effectuees par la diffusion d'un faisceau de protons polarises sur une cible de protons polarises. (auteur)

  1. Recruitment of HDAC4 by transcription factor YY1 represses HOXB13 to affect cell growth in AR-negative prostate cancers

    DEFF Research Database (Denmark)

    Ren, Guoling; Zhang, Guocui; Dong, Zhixiong

    2008-01-01

    HOXB13 is a homeodomain protein implicated to play a role in growth arrest in AR (androgen receptor)-negative prostate cancer cells. Expression of HOXB13 is restricted to the AR-expressing prostate cells. In this report, we demonstrate that the HDAC inhibitor NaB (sodium butyrate) was able...... to induce cell growth arrest and to increase HOXB13 expression in AR-negative prostate cancer cells. We also show that both HDAC4 and YY1 participated in the repression of HOXB13 expression through an epigenetic mechanism involving histone acetylation modification. Specifically, co...

  2. Semisolid meal enriched in oat bran decreases plasma glucose and insulin levels, but does not change gastrointestinal peptide responses or short-term appetite in healthy subjects

    DEFF Research Database (Denmark)

    Juvonen, Kristiina R.; Salmenkallio-Marttila, Marjatta; Lyly, Marika

    2011-01-01

    types and amounts of DF exert are still poorly understood. METHODS AND RESULTS: We investigated the effects of wheat and oat brans alone and as combination in semisolid food matrix on postprandial appetite profile and gastrointestinal (GI) hormonal responses. Twenty healthy, normal-weight subjects (5...... including 5 g wheat bran DF + 5 g oat bran DF. Blood samples were drawn before and 15, 30, 45, 60, 90, 120 and 180 min after the test meals to determine plasma glucose, ghrelin, peptide YY (PYY) and serum insulin concentrations. Subjective profiles of appetite were assessed using visual analogue scales (VAS...

  3. A model describing the effect of sex-reversed YY fish in an established wild population: The use of a Trojan Y chromosome to cause extinction of an introduced exotic species.

    Science.gov (United States)

    Gutierrez, Juan B; Teem, John L

    2006-07-21

    A novel means of inducing extinction of an exotic fish population is proposed using a genetic approach to shift the ratio of male to females within a population. In the proposed strategy, sex-reversed fish containing two Y chromosomes are introduced into a normal fish population. These YY fish result in the production of a disproportionate number of male fish in subsequent generations. Mathematical modeling of the system following introduction of YY fish at a constant rate reveals that female fish decline in numbers over time, leading to eventual extinction of the population.

  4. The microRNA, miR-29c, participates in muscle development through targeting the YY1 gene and is associated with postmortem muscle pH in pigs

    Directory of Open Access Journals (Sweden)

    Weiya ZHANG,Wei WEI,Yuanyuan ZHAO,Shuhong ZHAO,Xinyun LI

    2015-12-01

    Full Text Available Previous studies indicated that miR-29c is important for muscle development in mice and human, but its role in pigs is unknown. In this study, we detected the expression of miR-29c in Meishan longissimus lumborum (LL muscle. The results showed that miR-29c was gradually upregulated during development of skeletal muscle in pig. Moreover, the expression of YY1 and Akt3 genes, which were confirmed to be targeted by miR-29c in mice, was decreased along with muscle development. Furthermore, the expression level of miR-29c was significantly higher in adult Meishan pigs than Large White pigs, while the expression of YY1 and Akt3 genes was significantly lower in Meishan pigs. These results indicated that the expression pattern of miR-29c was opposite to that of YY1 and Akt3 genes in pigs. Also, the luciferase assay indicated that miR-29s can target the YY1 gene in pigs. In addition, we identified a T to C mutation in the primary transcript of miR-29c, which was associated with the postmortem muscle pH in pigs. Based on these results, we concluded that miR-29c is also important in skeletal muscle development of pigs.

  5. Do Lactation-Induced Changes in Ghrelin, Glucagon-Like Peptide-1, and Peptide YY Influence Appetite and Body Weight Regulation during the First Postpartum Year?

    Directory of Open Access Journals (Sweden)

    D. Enette Larson-Meyer

    2016-01-01

    Full Text Available To determine whether fasting and meal-induced appetite-regulating hormones are altered during lactation and associated with body weight retention after childbearing, we studied 24 exclusively breastfeeding women (BMI = 25.2 ± 3.6 kg/m2 at 4-5 weeks postpartum and 20 never-pregnant controls (BMI = 24.0 ± 3.1 kg/m2. Ghrelin, PYY, GLP-1, and appetite ratings were measured before/and 150 minutes after a standardized breakfast and 60 minutes after an ad libitum lunch. Body weight/composition were measured at 6 and 12 months. Fasting and area under-the-curve responses for appetite-regulating hormones did not differ between lactating and control groups; ghrelinacyl, however, tended to track higher after the standardized breakfast in lactating women and was higher (p6.0 kg. The retainers had greater (p<0.05 postmeal ghrelin rebound responses following breakfast. Overall these studies do not support the hypothesis that appetite-regulating hormones are altered during lactation and associated with postpartum weight retention. Altered ghrelin responses, however, deserve further exploration.

  6. Jejunal feeding is followed by a greater rise in plasma cholecystokinin, peptide YY, glucagon-like peptide 1, and glucagon-like peptide 2 concentrations compared with gastric feeding in vivo in humans

    DEFF Research Database (Denmark)

    Luttikhold, Joanna; van Norren, Klaske; Rijna, Herman

    2016-01-01

    and the associated endocrine response in vivo in humans remains largely unexplored. OBJECTIVE: We compared the impact of administering enteral nutrition as either gastric feeding or jejunal feeding on endocrine responses in vivo in humans. DESIGN: In a randomized, crossover study design, 12 healthy young men (mean...... and a greater postprandial incremental AUC for GLP-1 and cholecystokinin (all P young men results in similar postprandial plasma amino acid and glucose concentrations....... However, the endocrine response differs substantially, with higher peak plasma cholecystokinin, PYY, GLP-1, and GLP-2 concentrations being attained after jejunal feeding. This effect may result in an improved anabolic response, greater insulin sensitivity, and an improved intestinotropic effect...

  7. Triple basepair changes within and adjacent to the conserved YY1 motif upstream of the U3 enhancer repeats of SL3-3 murine leukemia virus cause a small but significant shortening of latency of T-lymphoma induction

    International Nuclear Information System (INIS)

    Ma Shiliang; Lovmand, Jette; Soerensen, Annette Balle; Luz, Arne; Schmidt, Joerg; Pedersen, Finn Skou

    2003-01-01

    A highly conserved sequence upstream of the transcriptional enhancer in the U3 of murine leukemia viruses (MLVs) was reported to mediate negative regulation of their expression. In transient expression studies, negative regulation was reported to be conferred by coexpression of the transcription factor YY1, which binds to a motif in the upstream conserved region (UCR). To address the function of the UCR and its YY1-motif in an in vivo model of MLV-host interactions we introduced six consecutive triple basepair mutations into this region of the potent T-lymphomagenic SL3-3 MLV. We report that all mutants have retained their replication competence and that they all, like the SL3-3 wild type (wt), induce T-cell lymphomas when injected into newborn mice of the SWR strain. However, all mutants induced disease with slightly shorter latency periods than the wt SL3-3, suggesting that the YY1 motif as well as its immediate context in the UCR have a negative effect on the pathogenicity of the virus. This result may have implications for the design of retroviral vectors

  8. Single crystal growth and structural evolution across the 1st order valence transition in (Pr1-yYy)1-xCaxCoO3-δ

    Science.gov (United States)

    Schreiber, N. J.; Zhang, Junjie; Zheng, Hong; Freeland, J. W.; Chen, Yu-Sheng; Mitchell, J. F.; Phelan, D.

    2017-10-01

    Praseodymium-containing cobalt perovskites, such as (Pr1-yYy)1-xCaxCoO3-δ, have been argued to undergo a first-order charge shift between Pr and hybridized Co-O orbitals that leads to a metal-insulator transition at a temperature, TVT. Magnetization and x-ray absorption spectroscopy measurements on single crystals of (Pr0.85Y0.15)0.7Ca0.3CoO3-δ grown in an IR image furnace under 40-60 bar of oxygen confirm the presence of this valence transition. Single crystal x-ray synchrotron diffraction measurements are consistent with an isomorphic phase transition at TVT. No evidence of charge ordering was revealed by the single crystal diffraction. Dissimilar to analytical transmission electron microscopy measurements performed on a grain from a polycrystalline sample that revealed an oxygen vacancy order-disorder transition at TVT, the present single-crystal measurements did not evidence such a transition, likely reflecting a lower density of oxygen vacancies in the high-pO2 grown single crystals.

  9. Tensor and vector analysing powers A{sub yy} and A{sub y} in the {sup 12}C(d, p)X and {sup 12}C(d, d)X reactions at initial deuteron momentum of 9 GeV/c and emission angle of 85 mrad

    Energy Technology Data Exchange (ETDEWEB)

    Afanas` ev, S V; Arkhipov, V V; Azhgirej, L S [Joint Institute for Nuclear Research, Dubna (Russian Federation); and others

    1998-12-01

    The first data on tensor and vector analysing powers A{sub yy} and A{sub y} in the {sup 12}C(d, p)X and {sup 12}C(d, d)X reactions have been obtained at incident deuteron momentum of 9 GeV/c and emission angle for the secondary particles of 85 mrad. The value of A{sub yy} in inclusive deuteron breakup remains positive at the highest measured momentum of proton, that is in contradiction with the predictions of the model using conventional deuteron wave functions. The values of A{sub y} in this reaction are small but non-negligible. The data on A{sub yy} and A{sub y} in deuteron inelastic scattering could bring new important information on the baryonic resonance properties in the vicinity of masses {approx}2.2 GeV/c{sup 2} 34 refs., 24 figs., 9 tabs.

  10. Co-delivery of a hydrophobic small molecule and a hydrophilic peptide by porous silicon nanoparticles.

    Science.gov (United States)

    Liu, Dongfei; Bimbo, Luis M; Mäkilä, Ermei; Villanova, Francesca; Kaasalainen, Martti; Herranz-Blanco, Barbara; Caramella, Carla M; Lehto, Vesa-Pekka; Salonen, Jarno; Herzig, Karl-Heinz; Hirvonen, Jouni; Santos, Hélder A

    2013-09-10

    Nanoparticulate drug delivery systems offer remarkable opportunities for clinical treatment. However, there are several challenges when they are employed to deliver multiple cargos/payloads, particularly concerning the synchronous delivery of small molecular weight drugs and relatively larger peptides. Since porous silicon (PSi) nanoparticles (NPs) can easily contain high payloads of drugs with various properties, we evaluated their carrier potential in multi-drug delivery for co-loading of the hydrophobic drug indomethacin and the hydrophilic human peptide YY3-36 (PYY3-36). Sequential loading of these two drugs into the PSi NPs enhanced the drug release rate of each drug and also their amount permeated across Caco-2 and Caco-2/HT29 cell monolayers. Regardless of the loading approach used, dual or single, the drug permeation profiles were in good correlation with their drug release behaviour. Furthermore, the permeation studies indicated the critical role of the mucus intestinal layer and the paracellular resistance in the permeation of the therapeutic compounds across the intestinal wall. Loading with PYY3-36 also greatly improved the cytocompatibility of the PSi NPs. Conformational analysis indicated that the PYY3-36 could still display biological activity after release from the PSi NPs and permeation across the intestinal cell monolayers. These results are the first demonstration of the promising potential of PSi NPs for simultaneous multi-drug delivery of both hydrophobic and hydrophilic compounds. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. Data Profiling

    OpenAIRE

    Hladíková, Radka

    2010-01-01

    Title: Data Profiling Author: Radka Hladíková Department: Department of Software Engineering Supervisor: Ing. Vladimír Kyjonka Supervisor's e-mail address: Abstract: This thesis puts mind on problems with data quality and data profiling. This Work analyses and summarizes problems of data quality, data defects, process of data quality, data quality assessment and data profiling. The main topic is data profiling as a process of researching data available in existing...

  12. Effect of a herbal extract powder (YY-312) from Imperata cylindrica Beauvois, Citrus unshiu Markovich, and Evodia officinalis Dode on body fat mass in overweight adults: a 12-week, randomized, double-blind, placebo-controlled, parallel-group clinical trial.

    Science.gov (United States)

    Cho, Young-Gyu; Jung, Ji-Hye; Kang, Jae-Heon; Kwon, Jin Soo; Yu, Seung Pil; Baik, Tae Gon

    2017-07-28

    YY-312 is a herbal extract powder from Imperata cylindrica Beauvois, Citrus unshiu Markovich, and Evodia officinalis Dode, which have health promoting effects, including body fat reduction. We aimed to evaluate the efficacy and safety of YY-312 for body fat reduction in overweight adults. This was a 12-week, randomized, double-blind, placebo-controlled, parallel-group clinical trial performed in overweight Korean adults aged 19-60 years with a body mass index of 25.0-29.9 kg/m 2 . The daily dose of YY-312 was 2400 mg (containing 1800 mg of active herbal extract and 600 mg of cyclodextrin). Primary outcomes were reductions in body fat mass (BFM) and body fat percentage (BF%) after 12 weeks. Secondary outcomes included reductions in body weight and waist circumference (WC) after 12 weeks. After 12 weeks, BFM (1.6 kg vs. 0.1 kg; P = 0.023) and BF% (1.5% vs. -0.2%; P = 0.018) decreased significantly more in the YY-312 group than in the placebo group, as did body weight (2.7 kg vs. 1.0 kg; P = 0.014) and WC (2.2 cm vs. 0.8 cm; P = 0.049). All safety parameters were within normal limits; no serious adverse events occurred in either group. In a 12-week clinical trial in overweight adults, YY-312 resulted in significantly greater reduction in body fat vs. placebo, while being safe and well tolerated. cris.nih.go.kr: ( KCT0001225 ).

  13. Karolinske psychodynamic profile (KAPP)

    DEFF Research Database (Denmark)

    Mathiesen, Birgit Bork; Søgaard, Ulf

    2006-01-01

    psykologiske testmetoder, assesment, Karolinska psychodynamic profile (KAPP), psykodynamisk profil......psykologiske testmetoder, assesment, Karolinska psychodynamic profile (KAPP), psykodynamisk profil...

  14. Profiling cancer

    DEFF Research Database (Denmark)

    Ciro, Marco; Bracken, Adrian P; Helin, Kristian

    2003-01-01

    In the past couple of years, several very exciting studies have demonstrated the enormous power of gene-expression profiling for cancer classification and prediction of patient survival. In addition to promising a more accurate classification of cancer and therefore better treatment of patients......, gene-expression profiling can result in the identification of novel potential targets for cancer therapy and a better understanding of the molecular mechanisms leading to cancer....

  15. The Role of Episodic Postprandial Peptides in Exercise-Induced Compensatory Eating.

    Science.gov (United States)

    Gibbons, Catherine; Blundell, John E; Caudwell, Phillipa; Webb, Dominic-Luc; Hellström, Per M; Näslund, Erik; Finlayson, Graham

    2017-11-01

    Prolonged physical activity gives rise to variable degrees of body weight and fat loss, and is associated with variability in appetite control. Whether these effects are modulated by postprandial, peptides is unclear. We examined the role of postprandial peptide response in compensatory eating during 12 weeks of aerobic exercise and in response to high-fat, low-carbohydrate (HFLC) and low-fat, high-carbohydrate (LFHC) meals. Of the 32 overweight/obese individuals, 16 completed 12 weeks of aerobic exercise and 16 nonexercising control subjects were matched for age and body mass index. Exercisers were classified as responders or nonresponders depending on net energy balance from observed compared with expected body composition changes from measured energy expenditure. Plasma samples were collected before and after meals to compare profiles of total and acylated ghrelin, insulin, cholecystokinin, glucagon-like peptide 1 (GLP-1), and total peptide YY (PYY) between HFLC and LFHC meals, pre- and postexercise, and between groups. No differences between pre- and postintervention peptide release. Responders had greater suppression of acylated ghrelin (P exercise. Responders to exercise-induced weight loss showed greater suppression of acylated ghrelin and greater release of GLP-1 and total PYY at baseline. Therefore, episodic postprandial peptide profiles appear to form part of the pre-existing physiology of exercise responders and suggest differences in satiety potential may underlie exercise-induced compensatory eating. Copyright © 2017 Endocrine Society

  16. Correlation between hyperuricemia and lipid profile in untreated ...

    African Journals Online (AJOL)

    Arun Kumar Agnihotri

    planning the treatment strategy for dyslipidemia to reduce the cardiovascular morbidity. KEY WORDS: ..... comprehensive strategic management of risk factors. Visa-versa ... Johnson RJ, Perez-Pozo SE, Sautin YY, et al. Hypothesis: could ...

  17. Gut transit is associated with gastrointestinal symptoms and gut hormone profile in patients with cirrhosis

    DEFF Research Database (Denmark)

    Kalaitzakis, Evangelos; Sadik, Riadh; Holst, Jens Juul

    2008-01-01

    BACKGROUND & AIMS: Liver cirrhosis is associated with increased prevalence of gastrointestinal symptoms, insulin resistance, and altered gut transit. We aimed to assess the prevalence of gut transit abnormalities in patients with cirrhosis, compared with healthy controls, and to evaluate the rela......BACKGROUND & AIMS: Liver cirrhosis is associated with increased prevalence of gastrointestinal symptoms, insulin resistance, and altered gut transit. We aimed to assess the prevalence of gut transit abnormalities in patients with cirrhosis, compared with healthy controls, and to evaluate...... the relation of gut transit with gastrointestinal symptoms and postprandial glucose and hormone profiles. METHODS: Half gastric emptying, small bowel residence, and colonic filling times were measured with a validated radiologic procedure in 42 consecutive patients with cirrhosis. In a subgroup of 25 patients......, gastrointestinal symptoms were evaluated by using a validated questionnaire and a caloric satiation test. Postprandial glucose, insulin, leptin, ghrelin, glucagon-like peptide 1, and PYY responses were also studied. Eighty-three healthy subjects served as controls for the transit studies and 10 for the hormone...

  18. Physiology and pathophysiology of the ileal brake in humans

    NARCIS (Netherlands)

    Vu, My Kieu

    2007-01-01

    The ileal brake is an intraluminal nutrient-triggered feedback control from the distal to the proximal gut with fat being the most potent trigger. Peptide YY (PYY) is one of the hormonal mediators of the ileal brake. Effects of the fat induced ileal brake on proximal small intestine, postprandial

  19. The Noncaloric Sweetener Rebaudioside A Stimulates Glucagon-Like Peptide 1 Release and Increases Enteroendocrine Cell Numbers in 2-Dimensional Mouse Organoids Derived from Different Locations of the Intestine

    NARCIS (Netherlands)

    van der Wielen, Nikkie; Ten Klooster, Jean Paul; Muckenschnabl, Susanne; Pieters, Raymond; Hendriks, Henk Fj; Witkamp, Renger F; Meijerink, Jocelijn

    2016-01-01

    BACKGROUND: Glucagon-like peptide 1 (GLP-1) contributes to satiety and plays a pivotal role in insulin secretion and glucose homeostasis. Similar to GLP-1, peptide YY (PYY) and cholecystokinin also influence food intake. The secretion of these hormones by enteroendocrine cells along the intestine is

  20. The noncaloric sweetener rebaudioside a stimulates glucagon-like peptide 1 release and increases enteroendocrine cell numbers in 2-dimensional mouse organoids derived from different locations of the intestine

    NARCIS (Netherlands)

    Wielen, van der Nikkie; Klooster, ten Jean Paul; Muckenschnabl, Susanne; Pieters, Raymond; Hendriks, Henk F.J.; Witkamp, Renger F.; Meijerink, Jocelijn

    2016-01-01

    Background: Glucagon-like peptide 1 (GLP-1) contributes to satiety and plays a pivotal role in insulin secretion and glucose homeostasis. Similar to GLP-1, peptide YY (PYY) and cholecystokinin also influence food intake. The secretion of these hormones by enteroendocrine cells along the intestine

  1. Neuropeptide Y-stimulated [(35) S]GTPγs functional binding is reduced in the hippocampus after kainate-induced seizures in mice

    DEFF Research Database (Denmark)

    Elbrønd-Bek, Heidi; Olling, Janne Damm; Gøtzsche, Casper René

    2014-01-01

    , in this study, we explored functional NPY receptor activity in the mouse hippocampus and neocortex after kainate-induced seizures using NPY-stimulated [(35) S]GTPγS binding. Moreover, we also studied levels of [(125) I]-peptide YY (PYY) binding and NPY, Y1, Y2, and Y5 receptor mRNA in these kainate-treated mice...

  2. Detailed characterisation of STC-1 cells and the pGIP/Neo sub-clone suggests the incretin hormones are translationally regulated.

    Science.gov (United States)

    Gillespie, Anna L; Pan, Xiaobei; Marco-Ramell, Anna; Meharg, Caroline; Green, Brian D

    2017-10-01

    STC-1 is a heterogeneous plurihormonal cell line producing several prominent gut peptide hormones. pGIP/Neo is a genetically selected sub-clone of STC-1 with augmented levels of glucose-dependent insulinotropic peptide (GIP). Morphometric parameters, hormone concentrations, mRNA transcripts, hormone immunocytochemistry and nutrient utilisation/production of these two cell lines were compared. Proglucagon-derived peptides (Glucagon-like peptide-1 (GLP-1) and - 2(GLP-2)) were lower in sub-clone cells than progenitor cells. High Content Analysis found altered intracellular GLP-1, GIP, cholecystokinin (CCK) and peptide YY (PYY) levels and differing hormone co-localisation. The proportion pGIP/Neo cells containing GIP immunoreactivity (82%) was greater than STC-1 (65%), as were the proportion with 'GIP only', 'GLP-1+GIP' or 'GIP+PYY' immunoreactivity. Most surprisingly mRNA transcripts of the proglucagon and GIP genes were inversely correlated to the levels of their translated peptides. This strongly suggests that proglucagon and GIP are encoded on 'translationally regulated genes' - a characteristic possessed by other endocrine hormones. Metabolomic profiling revealed differences in cellular nutrient utilisation/production and that under normal culture conditions both cell lines exhibit signs of overflow metabolism. These studies provide an insight into the metabolism and properties of these valuable cells, suggesting for the first time that incretin hormone genes are translationally regulated. Copyright © 2017 Elsevier Inc. All rights reserved.

  3. Transfection of embryonated Muscovy duck eggs with a recombinant plasmid is suitable for rescue of infectious Muscovy duck parvovirus.

    Science.gov (United States)

    Wang, Jianye; Huang, Yu; Ling, Jueyi; Wang, Zhixiang; Zhu, Guoqiang

    2017-12-01

    For members of the family Parvoviridae, rescue of infectious virus from recombinant plasmid is usually done in cultured cells. In this study, the whole genome of the pathogenic Muscovy duck parvovirus (MDPV) strain YY was cloned into the pBluescript II (SK) vector, generating recombinant plasmid pYY. With the aid of a transfection reagent, pYY plasmid was inoculated into 11-day-old embryonated Muscovy duck eggs via the chorioallantoic membrane route, resulting in the successful rescue of infectious virus and death of the embryos. The rescued virus exhibited pathogenicity in Muscovy ducklings similar to that of its parental strain, as evaluated based on the mortality rate. The results demonstrate that plasmid transfection in embryonated Muscovy duck eggs is a convenient and efficacious method for rescue of infectious MDPV in comparison to transfection of primary cells, which is somewhat time-consuming and laborious.

  4. YY1 Control of AID Dependent Lymphomagenesis

    Science.gov (United States)

    2016-09-01

    Molecular Devices). Immunohistochemistry Spleens from NP-CGG immunized mice were collected on day 14 and immersed in O.C.T. (Tissue Tek), flash frozen using...70. Yildirim E, et al. (2013) Xist RNA is a potent suppressor of hematologic cancer in mice. Cell 152(4):727–742. 71. Hwang SH, et al. (2012) B cell

  5. Gut Hormones, Appetite Suppression and Cachexia in Patients with Pulmonary TB

    Science.gov (United States)

    Chang, Suzanne W.; Pan, William S.; Lozano Beltran, Daniel; Oleyda Baldelomar, Lizet; Solano, Marco Antonio; Tuero, Iskra; Friedland, Jon S.; Torrico, Faustino; Gilman, Robert H.

    2013-01-01

    Background Cachexia is a hallmark of pulmonary tuberculosis and is associated with poor prognosis. A better understanding of the mechanisms behind such weight loss could reveal targets for therapeutic intervention. The role of appetite-regulatory hormones in tuberculosis is unknown. Methods and Findings 41 subjects with newly-diagnosed pulmonary TB (cases) were compared to 82 healthy controls. We measured appetite, body mass index (BMI), % body fat (BF), plasma peptide YY (PYY), leptin, ghrelin, and resistin for all subjects. Measurements were taken at baseline for controls and at treatment days 0, 30, and 60 for cases. Baseline appetite, BMI, and BF were lower in cases than in controls and improved during treatment. PYY, ghrelin, and resistin were significantly elevated in cases and fell during treatment. Leptin was lower in cases and rose with treatment. Appetite was inversely related to PYY in cases. High pre-treatment PYY predicted reduced gains in appetite and BF. PYY was the strongest independent predictor of appetite in cases across all time points. Conclusions Appetite-regulatory hormones are altered in TB patients. As hormones normalize during treatment, appetite is restored and nutritional status improves. High baseline PYY is an indicator of poor prognosis for improvement in appetite and nutrition during treatment. Wasting in TB patients may partly be mediated by upregulation of PYY with resulting appetite suppression. PMID:23358528

  6. Profile: Asian Americans

    Science.gov (United States)

    ... and Data > Minority Population Profiles > Asian American Profile: Asian Americans Asian American Profile (Map of the US with the top 10 states displaying the largest Asian American population according to the Census Bureau) CA - ...

  7. Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius).

    Science.gov (United States)

    Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L

    1986-12-30

    The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

  8. HOPWA Performance Profiles

    Data.gov (United States)

    Department of Housing and Urban Development — HOPWA Performance Profiles are generated quarterly for all agencies receiving HOPWA formula or competitive grants. Performance Profiles are available at the national...

  9. Spectral backward radiation profile

    International Nuclear Information System (INIS)

    Kwon, Sung Duck; Lee, Keun Hyun; Kim, Bo Ra; Yoon, Suk Soo

    2004-01-01

    Ultrasonic backward radiation profile is frequency-dependent when incident region has deptional gradient of acoustical properties or multi-layers. Until now, we have measured the profiles of principal frequencies of used transducers so that it was not easy to understand the change of the frequency component and spectrum of backward radiation from the profile. We tried to measure the spectral backward radiation profiles using DFP(digital filer package) Lecroy DSO. The very big changes in the shape and pattern of spectral backward radiation profiles leads to the conclusion that this new try could be very effective tool to evaluate frequency dependent surface area.

  10. YOUNG ATHLETES' MOTIVATIONAL PROFILES

    Directory of Open Access Journals (Sweden)

    Juan Antonio Moreno Murcia

    2007-06-01

    Full Text Available The aim of this study was to examine the relationship between motivational characteristics and dispositional flow. In order to accomplish this goal, motivational profiles emerging from key constructs within Achievement Goal Theory and Self-Determination Theory were related to the dispositional flow measures. A sample of 413 young athletes (Age range 12 to 16 years completed the PMCSQ-2, POSQ, SMS and DFS measures. Cluster analysis results revealed three profiles: a "self-determined profile" characterised by higher scores on the task-involving climate perception and on the task orientation; a "non-self-determined profile", characterised by higher scores on ego-involving climate perception and ego orientation; and a "low self-determined and low non-self-determined profile" which had the lowest dispositional flow. No meaningful differences were found between the "self-determined profile" and the "non-self-determined profile" in dispositional flow. The "self-determined profile" was more commonly associated with females, athletes practising individual sports and those training more than three days a week. The "non-self-determined profile" was more customary of males and athletes practising team sports as well as those training just two or three days a week

  11. Changes in Gastrointestinal Hormone Responses, Insulin Sensitivity, and Beta-Cell Function Within 2 Weeks After Gastric Bypass in Non-diabetic Subjects

    DEFF Research Database (Denmark)

    Jacobsen, Siv Hesse; Olesen, S C; Dirksen, C

    2012-01-01

    measured fasting and postprandial glucose, insulin, C-peptide, glucagon, total and intact glucagon-like peptide-1 (GLP-1), glucose-dependent insulinotropic polypeptide (GIP), glucagon-like peptide-2 (GLP-2), peptide YY(3-36) (PYY), cholecystokinin (CCK), total and active ghrelin, gastrin, somatostatin......, pancreatic polypeptide (PP), amylin, leptin, free fatty acids (FFA), and registered postprandial dumping. Insulin sensitivity was measured by homeostasis model assessment of insulin resistance. RESULTS: Fasting glucose, insulin, ghrelin, and PYY were significantly decreased and FFA was elevated...... postoperatively. Insulin sensitivity increased after surgery. The postprandial response increased for C-peptide, GLP-1, GLP-2, PYY, CCK, and glucagon (in response to the mixed meal) and decreased for total and active ghrelin, leptin, and gastrin, but were unchanged for GIP, amylin, PP, and somatostatin after...

  12. Timeline of changes in appetite during weight loss with a ketogenic diet

    OpenAIRE

    Nymo, Siren

    2017-01-01

    Background/objective: Diet-induced weight loss (WL) leads to increased hunger and reduced fullness feelings, increased ghrelin and reduced satiety peptides concentration (glucagon-like peptide-1 (GLP-1), cholecystokinin (CCK) and peptide YY (PYY)). Ketogenic diets seem to minimise or supress some of these responses. The aim of this study was to determine the timeline over which changes in appetite occur during progressive WL with a ketogenic very-low-energy diet (VLED). Subjects/methods: T...

  13. Polar measurements on profiles

    Energy Technology Data Exchange (ETDEWEB)

    Althaus, D.

    1985-03-01

    Wind tunnel models with a profile depth of t=0.5 m were measured in a laminar wind tunnel by the usual measuring processes. The profile resistance was determined by integration along the width of span. The smooth profiles were examined at Re=0.7/1.0 and 1.5 million. At Re=1.0 million, the position of the changeover points were determined with a stethoscope. Also at this Reynolds number measurements were taken with a trip wire of d=2 mm diameter, directly on the profile nose. The tables contain the co-ordinates of the profiles, the contours, the theoretical speed distributions for 4 different angles of attack, the csub(a)-csub(w) polar measurements and changeover points, and the torque coefficients around the t/4 point. (BR).

  14. Implicit User Interest Profile

    CERN Document Server

    Chan, K

    2002-01-01

    User interest profile presents items that the users are interested in. Typically those items can be listed or grouped. Listing is good but it does not possess interests at different abstraction levels - the higher-level interests are more general, while the lower-level ones are more specific. Furthermore, more general interests, in some sense, correspond to longer-term interests, while more specific interests correspond to shorter-term interests. This hierarchical user interest profile has obvious advantages: specifying user's specific interests and general interests and representing their relationships. Current user interest profile structures mostly do not use implicit method, nor use an appropriate clustering algorithm especially for conceptually hierarchical structures. This research studies building a hierarchical user interest profile (HUIP) and the hierarchical divisive algorithm (HDC). Several users visit hundreds of web pages and each page is recorded in each users profile. These web pages are used t...

  15. A predictable Java profile

    DEFF Research Database (Denmark)

    Bøgholm, Thomas; Hansen, Rene Rydhof; Ravn, Anders Peter

    2009-01-01

    A Java profile suitable for development of high integrity embedded systems is presented. It is based on event handlers which are grouped in missions and equipped with respectively private handler memory and shared mission memory. This is a result of our previous work on developing a Java profile......, and is directly inspired by interactions with the Open Group on their on-going work on a safety critical Java profile (JSR-302). The main contribution is an arrangement of the class hierarchy such that the proposal is a generalization of Real-Time Specification for Java (RTSJ). A further contribution...

  16. Profiling the Mobile Customer

    DEFF Research Database (Denmark)

    Jessen, Pernille Wegener; King, Nancy J.

    2010-01-01

    of significant concerns about privacy and data protection. This second article in a two part series on "Profiling the Mobile Customer" explores how to best protect consumers' privacy and personal data through available mechanisms that include industry self-regulation, privacy-enhancing technologies...... discusses the current limitations of using technology to protect consumers from privacy abuses related to profiling. Concluding that industry self-regulation and available privacy-enhancing technologies will not be adequate to close important privacy gaps related to consumer profiling without legislative...

  17. Wind Profiling Radar

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Clutter present in radar return signals as used for wind profiling is substantially removed by carrying out a Daubechies wavelet transformation on a time series of...

  18. Fishing fleet profiling methodology

    National Research Council Canada - National Science Library

    Ferraris, Jocelyne

    2002-01-01

    A fishing fleet profile aims tho assist in understanding the complexity and structure of fisheries from a technical and socio-economic point of view, or from the point of view of fishing strategies...

  19. Beach Profile Locations

    Data.gov (United States)

    California Natural Resource Agency — Beaches are commonly characterized by cross-shore surveys. The resulting profiles represent the elevation of the beach surface and nearshore seabed from the back of...

  20. Secretaries: A Profile.

    Science.gov (United States)

    Fusselman, Kay

    1987-01-01

    Consists of the results of a profile survey completed by more than 12,000 members of Professional Secretaries International. Information is included on secretarial titles, salaries, employer types, and secretaries' personal characteristics. (CH)

  1. Prescription Drug Profiles PUF

    Data.gov (United States)

    U.S. Department of Health & Human Services — This release contains the Prescription Drug Profiles Public Use Files (PUFs) drawn from Medicare prescription drug claims for the year of the date on which the...

  2. Fishing Community Profiles

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To enable fisheries managers to comply with National Standard 8 (NS8), NMFS social scientists around the nation are preparing fishing community profiles that present...

  3. Global oil company profiles

    International Nuclear Information System (INIS)

    1997-01-01

    Global Oil Company Profiles provides a comprehensive review of 50 of the top oil companies in the world. Each chapter is devoted to an individual company, providing an invaluable insight into the organisation, its structure and operations. Using the most recent data available, the report offers an up-to-date analysis of performance and future direction, as well as a unique benchmarking system for each company profiled. (author)

  4. Laquinimod Safety Profile

    DEFF Research Database (Denmark)

    Sørensen, Per Soelberg; Comi, Giancarlo; Vollmer, Timothy L

    2017-01-01

    the safety profile of laquinimod versus placebo. Adverse events (AEs), laboratory value changes, and potential risks identified in preclinical studies were evaluated in participants in ALLEGRO and BRAVO treated with at least one dose of laquinimod or matching placebo (1:1 random assignment). RESULTS...... laquinimod studies demonstrate a safety profile comprising benign or manageable AEs and asymptomatic laboratory findings with a clear temporal pattern. Potential risks noted in preclinical studies were not observed....

  5. Household electricity demand profiles

    DEFF Research Database (Denmark)

    Marszal, Anna Joanna; Heiselberg, Per Kvols; Larsen, Olena Kalyanova

    2016-01-01

    Highlights •A 1-min resolution household electricity load model is presented. •Model adapts a bottom-up approach with single appliance as the main building block. •Load profiles are used to analyse the flexibility potential of household appliances. •Load profiles can be applied in other domains, .......g. building energy simulations. •The demand level of houses with different number of occupants is well captured....

  6. Country nuclear power profiles

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    The preparation of Country Nuclear Power Profiles was initiated within the framework of the IAEA`s programme for nuclear power plant performance assessment and feedback. It responded to a need for a database and a technical document containing a description of the energy and economic situation and the primary organizations involved in nuclear power in IAEA Member States. The task was included in the IAEA`s programmes for 1993/1994 and 1995/1996. In March 1993, the IAEA organized a Technical Committee meeting to discuss the establishment of country data ``profiles``, to define the information to be included in the profiles and to review the information already available in the IAEA. Two expert meetings were convened in November 1994 to provide guidance to the IAEA on the establishment of the country nuclear profiles, on the structure and content of the profiles, and on the preparation of the publication and the electronic database. In June 1995, an Advisory Group meeting provided the IAEA with comprehensive guidance on the establishment and dissemination of an information package on industrial and organizational aspects of nuclear power to be included in the profiles. The group of experts recommended that the profiles focus on the overall economic, energy and electricity situation in the country and on its nuclear power industrial structure and organizational framework. In its first release, the compilation would cover all countries with operating power plants by the end of 1995. It was also recommended to further promote information exchange on the lessons learned from the countries engaged in nuclear programmes. For the preparation of this publication, the IAEA received contributions from the 29 countries operating nuclear power plants and Italy. A database has been implemented and the profiles are supporting programmatic needs within the IAEA; it is expected that the database will be publicly accessible in the future. Refs, figs, tabs.

  7. Country nuclear power profiles

    International Nuclear Information System (INIS)

    1998-03-01

    The preparation of Country Nuclear Power Profiles was initiated within the framework of the IAEA's programme for nuclear power plant performance assessment and feedback. It responded to a need for a database and a technical document containing a description of the energy and economic situation and the primary organizations involved in nuclear power in IAEA Member States. The task was included in the IAEA's programmes for 1993/1994 and 1995/1996. In March 1993, the IAEA organized a Technical Committee meeting to discuss the establishment of country data ''profiles'', to define the information to be included in the profiles and to review the information already available in the IAEA. Two expert meetings were convened in November 1994 to provide guidance to the IAEA on the establishment of the country nuclear profiles, on the structure and content of the profiles, and on the preparation of the publication and the electronic database. In June 1995, an Advisory Group meeting provided the IAEA with comprehensive guidance on the establishment and dissemination of an information package on industrial and organizational aspects of nuclear power to be included in the profiles. The group of experts recommended that the profiles focus on the overall economic, energy and electricity situation in the country and on its nuclear power industrial structure and organizational framework. In its first release, the compilation would cover all countries with operating power plants by the end of 1995. It was also recommended to further promote information exchange on the lessons learned from the countries engaged in nuclear programmes. For the preparation of this publication, the IAEA received contributions from the 29 countries operating nuclear power plants and Italy. A database has been implemented and the profiles are supporting programmatic needs within the IAEA; it is expected that the database will be publicly accessible in the future

  8. BWR AXIAL PROFILE

    International Nuclear Information System (INIS)

    Huffer, J.

    2004-01-01

    The purpose of this calculation is to develop axial profiles for estimating the axial variation in burnup of a boiling water reactor (BWR) assembly spent nuclear fuel (SNF) given the average burnup of an assembly. A discharged fuel assembly typically exhibits higher burnup in the center and lower burnup at the ends of the assembly. Criticality safety analyses taking credit for SNF burnup must account for axially varying burnup relative to calculations based on uniformly distributed assembly average burnup due to the under-burned tips. Thus, accounting for axially varying burnup in criticality analyses is also referred to as accounting for the ''end effect'' reactivity. The magnitude of the reactivity change due to ''end effect'' is dependent on the initial assembly enrichment, the assembly average burnup, and the particular axial profile characterizing the burnup distribution. The set of bounding axial profiles should incorporate multiple BWR core designs and provide statistical confidence (95 percent confidence that 95 percent of the population is bound by the profile) that end nodes are conservatively represented. The profiles should also conserve the overall burnup of the fuel assembly. More background on BWR axial profiles is provided in Attachment I

  9. Accelerated Profile HMM Searches.

    Directory of Open Access Journals (Sweden)

    Sean R Eddy

    2011-10-01

    Full Text Available Profile hidden Markov models (profile HMMs and probabilistic inference methods have made important contributions to the theory of sequence database homology search. However, practical use of profile HMM methods has been hindered by the computational expense of existing software implementations. Here I describe an acceleration heuristic for profile HMMs, the "multiple segment Viterbi" (MSV algorithm. The MSV algorithm computes an optimal sum of multiple ungapped local alignment segments using a striped vector-parallel approach previously described for fast Smith/Waterman alignment. MSV scores follow the same statistical distribution as gapped optimal local alignment scores, allowing rapid evaluation of significance of an MSV score and thus facilitating its use as a heuristic filter. I also describe a 20-fold acceleration of the standard profile HMM Forward/Backward algorithms using a method I call "sparse rescaling". These methods are assembled in a pipeline in which high-scoring MSV hits are passed on for reanalysis with the full HMM Forward/Backward algorithm. This accelerated pipeline is implemented in the freely available HMMER3 software package. Performance benchmarks show that the use of the heuristic MSV filter sacrifices negligible sensitivity compared to unaccelerated profile HMM searches. HMMER3 is substantially more sensitive and 100- to 1000-fold faster than HMMER2. HMMER3 is now about as fast as BLAST for protein searches.

  10. Convolution based profile fitting

    International Nuclear Information System (INIS)

    Kern, A.; Coelho, A.A.; Cheary, R.W.

    2002-01-01

    Full text: In convolution based profile fitting, profiles are generated by convoluting functions together to form the observed profile shape. For a convolution of 'n' functions this process can be written as, Y(2θ)=F 1 (2θ)x F 2 (2θ)x... x F i (2θ)x....xF n (2θ). In powder diffractometry the functions F i (2θ) can be interpreted as the aberration functions of the diffractometer, but in general any combination of appropriate functions for F i (2θ) may be used in this context. Most direct convolution fitting methods are restricted to combinations of F i (2θ) that can be convoluted analytically (e.g. GSAS) such as Lorentzians, Gaussians, the hat (impulse) function and the exponential function. However, software such as TOPAS is now available that can accurately convolute and refine a wide variety of profile shapes numerically, including user defined profiles, without the need to convolute analytically. Some of the most important advantages of modern convolution based profile fitting are: 1) virtually any peak shape and angle dependence can normally be described using minimal profile parameters in laboratory and synchrotron X-ray data as well as in CW and TOF neutron data. This is possible because numerical convolution and numerical differentiation is used within the refinement procedure so that a wide range of functions can easily be incorporated into the convolution equation; 2) it can use physically based diffractometer models by convoluting the instrument aberration functions. This can be done for most laboratory based X-ray powder diffractometer configurations including conventional divergent beam instruments, parallel beam instruments, and diffractometers used for asymmetric diffraction. It can also accommodate various optical elements (e.g. multilayers and monochromators) and detector systems (e.g. point and position sensitive detectors) and has already been applied to neutron powder diffraction systems (e.g. ANSTO) as well as synchrotron based

  11. Country profile: Hungary

    Energy Technology Data Exchange (ETDEWEB)

    1991-09-01

    Country Profile: Hungary has been prepared as a background document for use by US Government agencies and US businesses interested in becoming involved with the new democracies of Eastern Europe as they pursue sustainable economic development. The focus of the Profile is on energy and highlights information on Hungary`s energy supply, demand, and utilization. It identifies patterns of energy usage in the important economic sectors, especially industry, and provides a preliminary assessment for opportunities to improve efficiencies in energy production, distribution and use by introducing more efficient technologies. The use of more efficient technologies would have the added benefit of reducing the environmental impact which, although is not the focus of the report, is an issue that effects energy choices. The Profile also presents considerable economic information, primarily in the context of how economic restructuring may affect energy supply, demand, and the introduction of more efficient technologies.

  12. Country profile: Hungary

    Energy Technology Data Exchange (ETDEWEB)

    1991-09-01

    Country Profile: Hungary has been prepared as a background document for use by US Government agencies and US businesses interested in becoming involved with the new democracies of Eastern Europe as they pursue sustainable economic development. The focus of the Profile is on energy and highlights information on Hungary's energy supply, demand, and utilization. It identifies patterns of energy usage in the important economic sectors, especially industry, and provides a preliminary assessment for opportunities to improve efficiencies in energy production, distribution and use by introducing more efficient technologies. The use of more efficient technologies would have the added benefit of reducing the environmental impact which, although is not the focus of the report, is an issue that effects energy choices. The Profile also presents considerable economic information, primarily in the context of how economic restructuring may affect energy supply, demand, and the introduction of more efficient technologies.

  13. Qualitative Value Profiling

    DEFF Research Database (Denmark)

    Duus, Henrik Johannsen; Bjerre, Mogens

    2015-01-01

    allows the development of 1) profiles of the target country in which operations are to take place, 2) profiles of the buying center (i.e. the group of decision makers) in the partner company, and 3) profiles of the product/service offering. It also allows the development of a semantic scaling method...... for deeper analysis of all involved factors. This paper presents the method and compares and contrasts it with other similar methods like the PESTELE method known from corporate strategy, the STEEPAL method known from scenario analysis, and the Politics-Institutions-Economy (PIE) framework known from...... International Business. This comparison suggests that QVP on most accounts provides deeper insights than alternative methods and thus lays the foundation for better strategic planning in international business-to-business markets. Hence, it is a valuable addition to the toolbox of business strategists...

  14. Detonation Wave Profile

    Energy Technology Data Exchange (ETDEWEB)

    Menikoff, Ralph [Los Alamos National Laboratory

    2015-12-14

    The Zel’dovich-von Neumann-Doering (ZND) profile of a detonation wave is derived. Two basic assumptions are required: i. An equation of state (EOS) for a partly burned explosive; P(V, e, λ). ii. A burn rate for the reaction progress variable; d/dt λ = R(V, e, λ). For a steady planar detonation wave the reactive flow PDEs can be reduced to ODEs. The detonation wave profile can be determined from an ODE plus algebraic equations for points on the partly burned detonation loci with a specified wave speed. Furthermore, for the CJ detonation speed the end of the reaction zone is sonic. A solution to the reactive flow equations can be constructed with a rarefaction wave following the detonation wave profile. This corresponds to an underdriven detonation wave, and the rarefaction is know as a Taylor wave.

  15. Constructing Data Curation Profiles

    Directory of Open Access Journals (Sweden)

    Michael Witt

    2009-12-01

    Full Text Available This paper presents a brief literature review and then introduces the methods, design, and construction of the Data Curation Profile, an instrument that can be used to provide detailed information on particular data forms that might be curated by an academic library. These data forms are presented in the context of the related sub-disciplinary research area, and they provide the flow of the research process from which these data are generated. The profiles also represent the needs for data curation from the perspective of the data producers, using their own language. As such, they support the exploration of data curation across different research domains in real and practical terms. With the sponsorship of the Institute of Museum and Library Services, investigators from Purdue University and the University of Illinois interviewed 19 faculty subjects to identify needs for discovery, access, preservation, and reuse of their research data. For each subject, a profile was constructed that includes information about his or her general research, data forms and stages, value of data, data ingest, intellectual property, organization and description of data, tools, interoperability, impact and prestige, data management, and preservation. Each profile also presents a specific dataset supplied by the subject to serve as a concrete example. The Data Curation Profiles are being published to a public wiki for questions and discussion, and a blank template will be disseminated with guidelines for others to create and share their own profiles. This study was conducted primarily from the viewpoint of librarians interacting with faculty researchers; however, it is expected that these findings will complement a wide variety of data curation research and practice outside of librarianship and the university environment.

  16. Equilibrium shoreface profiles

    DEFF Research Database (Denmark)

    Aagaard, Troels; Hughes, Michael G

    2017-01-01

    Large-scale coastal behaviour models use the shoreface profile of equilibrium as a fundamental morphological unit that is translated in space to simulate coastal response to, for example, sea level oscillations and variability in sediment supply. Despite a longstanding focus on the shoreface...... profile and its relevance to predicting coastal response to changing environmental conditions, the processes and dynamics involved in shoreface equilibrium are still not fully understood. Here, we apply a process-based empirical sediment transport model, combined with morphodynamic principles to provide......; there is no tuning or calibration and computation times are short. It is therefore easily implemented with repeated iterations to manage uncertainty....

  17. Economy Profile of Argentina

    OpenAIRE

    World Bank Group

    2017-01-01

    Doing Business 2018 is the 15th in a series of annual reports investigating the regulations that enhance business activity and those that constrain it. This economy profile presents the Doing Business indicators for Argentina. Doing Business presents quantitative indicators on business regulation and the protection of property rights that can be compared across 190 economies; for 2018 Arge...

  18. Economy Profile of Estonia

    OpenAIRE

    World Bank Group

    2017-01-01

    Doing Business 2018 is the 15th in a series of annual reports investigating the regulations that enhance business activity and those that constrain it. This economy profile presents the Doing Business indicators for Estonia. Doing Business presents quantitative indicators on business regulation and the protection of property rights that can be compared across 190 economies; for 2018 Estonia ...

  19. Economy Profile of Australia

    OpenAIRE

    World Bank Group

    2017-01-01

    Doing Business 2018 is the 15th in a series of annual reports investigating the regulations that enhance business activity and those that constrain it. This economy profile presents the Doing Business indicators for Australia. Doing Business presents quantitative indicators on business regulation and the protection of property rights that can be compared across 190 economies; for 2018 Aust...

  20. Profiling & Utilizing Learning Style.

    Science.gov (United States)

    Keefe, James W., Ed.

    The purpose of the National Association of Secondary School Principals (NASSP) Learning Style Profile is to provide educators with a well-validated and easy-to-use instrument for diagnosing the cognitive styles, perceptual response tendencies, and study/instructional preferences of middle level and senior high school students. The Learning Style…

  1. Country Profiles, Malaysia.

    Science.gov (United States)

    Marzuki, Ariffin Bin; Peng, J. Y.

    A profile of Malaysia is sketched in this paper. Emphasis is placed on the nature, scope, and accomplishments of population activities in the country. Topics and sub-topics include: location and description of the country; population (size, growth patterns, age structure, urban/rural distribution, ethnic and religious composition, migration,…

  2. Economy Profile of Bolivia

    OpenAIRE

    World Bank Group

    2017-01-01

    Doing Business 2018 is the 15th in a series of annual reports investigating the regulations that enhance business activity and those that constrain it. This economy profile presents the Doing Business indicators for Bolivia. Doing Business presents quantitative indicators on business regulation and the protection of property rights that can be compared across 190 economies; for 2018 Bolivia ...

  3. Culinary Arts Profile.

    Science.gov (United States)

    Missouri Univ., Columbia. Instructional Materials Lab.

    This chart is intended for use in documenting the fact that a student participating in a culinary arts program has achieved the performance standards specified in the Missouri Competency Profile for culinary arts. The chart includes space for recording basic student and instructor information and the student's on-the-job training and work…

  4. Beam profile monitor

    International Nuclear Information System (INIS)

    Krausse, G.J.; Gram, P.A.M.

    1978-05-01

    A system used to monitor secondary beam profiles at the LAMPF Linac for channel tune-up and diagnostics is described. The multiwire proportional chamber design is discussed, and descriptions and drawings of the gate card, the amplifier/multiplexer card, the output amplifier card, and the overall system are given

  5. Simple beam profile monitor

    Energy Technology Data Exchange (ETDEWEB)

    Gelbart, W.; Johnson, R. R.; Abeysekera, B. [ASD Inc. Garden Bay, BC (Canada); Best Theratronics Ltd Ottawa Ontario (Canada); PharmaSpect Ltd., Burnaby BC (Canada)

    2012-12-19

    An inexpensive beam profile monitor is based on the well proven rotating wire method. The monitor can display beam position and shape in real time for particle beams of most energies and beam currents up to 200{mu}A. Beam shape, position cross-section and other parameters are displayed on a computer screen.

  6. Modeling shoreface profile evolution

    NARCIS (Netherlands)

    Stive, M.J.F.; De Vriend, H.J.

    1995-01-01

    Current knowledge of hydro-, sediment and morpho-dynamics in the shoreface environment is insufficient to undertake shoreface-profile evolution modelling on the basis of first physical principles. We propose a simple, panel-type model to map observed behaviour. The internal dynamics are determined

  7. Modelling shoreface profile evolution

    NARCIS (Netherlands)

    Stive, Marcel J.F.; de Vriend, Huib J.

    1995-01-01

    Current knowledge of hydro-, sediment and morpho-dynamics in the shoreface environment is insufficient to undertake shoreface-profile evolution modelling on the basis of first physical principles. We propose a simple, panel-type model to map observed behaviour. The internal dynamics are determined

  8. A temperature profiler

    Digital Repository Service at National Institute of Oceanography (India)

    Peshwe, V.B.; Desa, E.

    An instrument developed for measuring temperature profiles at sea in depth or time scales is described. PC-based programming offers flexibility in setting up the instrument for the mode of operation prior to each cast. A real time clock built...

  9. Country Demographic Profiles: Thailand.

    Science.gov (United States)

    Bureau of the Census (DOC), Suitland, MD. Population Div.

    This profile of the population of Thailand contains 35 tables of selected demographic information, including size of population and estimates of fertility and mortality, beginning in 1950. An adjusted distribution of the population by age and sex is given for the latest census year, as well as for 1976. Projections of the number of women of…

  10. Polysome Profile Analysis - Yeast

    Czech Academy of Sciences Publication Activity Database

    Pospíšek, M.; Valášek, Leoš Shivaya

    2013-01-01

    Roč. 530, č. 2013 (2013), s. 173-181 ISSN 0076-6879 Institutional support: RVO:61388971 Keywords : grow yeast cultures * polysome profile analysis * sucrose density gradient centrifugation Subject RIV: CE - Biochemistry Impact factor: 2.194, year: 2013

  11. A Danish Profiling System

    DEFF Research Database (Denmark)

    Rosholm, Michael; Staghøj, Jonas; Svarer, Michael

    2006-01-01

    This paper describes the statistical model used for profiling new unemployed workers in Denmark. When a worker – during his or her first six months in unemployment – enters the employment office for the first time, this model predicts whether or not he or she will be unemployed for more than six ...

  12. [Safety profile of dolutegravir].

    Science.gov (United States)

    Rivero, Antonio; Domingo, Pere

    2015-03-01

    Integrase inhibitors are the latest drug family to be added to the therapeutic arsenal against human immunodeficiency virus infection. Drugs in this family that do not require pharmacological boosting are characterized by a very good safety profile. The latest integrase inhibitor to be approved for use is dolutegravir. In clinical trials, dolutegravir has shown an excellent tolerability profile, both in antiretroviral-naïve and previously treated patients. Discontinuation rates due to adverse effects were 2% and 3%, respectively. The most frequent adverse effects were nausea, headache, diarrhea and sleep disturbance. A severe hypersensitivity reaction has been reported in only one patient. In patients coinfected with hepatropic viruses, the safety profile is similar to that in patients without coinfection. The lipid profile of dolutegravir is similar to that of raltegravir and superior to those of Atripla® and darunavir/ritonavir. Dolutegravir induces an early, predictable and non-progressive increase in serum creatinine of around 10% of baseline values in treatment-naïve patients and of 14% in treatment-experienced patients. This increase is due to inhibition of tubular creatinine secretion through the OCT2 receptor and does not lead to a real decrease in estimated glomerular filtration rate with algorithms that include serum creatinine. The effect of the combination of dolutegravir plus Kivexa(®) on biomarkers of bone remodeling is lower than that of Atripla(®). Dolutegravir has an excellent tolerability profile with no current evidence of long-term adverse effects. Its use is accompanied by an early and non-progressive increase in serum creatinine due to OCT2 receptor inhibition. In combination with abacavir/lamivudine, dolutegravir has a lower impact than enofovir/emtricitabine/efavirenz on bone remodelling markers. Copyright © 2015 Elsevier España, S.L.U. All rights reserved.

  13. Spiking the expectancy profiles

    DEFF Research Database (Denmark)

    Hansen, Niels Chr.; Loui, Psyche; Vuust, Peter

    Melodic expectations have long been quantified using expectedness ratings. Motivated by statistical learning and sharper key profiles in musicians, we model musical learning as a process of reducing the relative entropy between listeners' prior expectancy profiles and probability distributions...... of a given musical style or of stimuli used in short-term experiments. Five previous probe-tone experiments with musicians and non-musicians are revisited. Exp. 1-2 used jazz, classical and hymn melodies. Exp. 3-5 collected ratings before and after exposure to 5, 15 or 400 novel melodies generated from...... a finite-state grammar using the Bohlen-Pierce scale. We find group differences in entropy corresponding to degree and relevance of musical training and within-participant decreases after short-term exposure. Thus, whereas inexperienced listeners make high-entropy predictions by default, statistical...

  14. Profile of success

    DEFF Research Database (Denmark)

    Dahlgaard, Jens Jørn; Nørgaard, Anders; Jakobsen, Søren

    1998-01-01

    What management skills must Europe's business leaders improve to achieve business excellence? Which country's leaders are best placed for success? Does the next generation have what it takes to compete? In the second half of their study of the leadership styles that drive business excellence, Jens...... Dahlgaard, Anders Nørgaard and Søren Jakobsen describe an excellent leadership profile that provides the answers....

  15. Global gas company profiles

    International Nuclear Information System (INIS)

    1997-01-01

    This report provides a detailed assessment of 60 of the top gas companies form around the world, analysing them according to their internal dynamics and in relation to their competitors. It devotes each chapter to an individual company, providing invaluable insight into the organisation's operational background, financial performance and strategic goals. Using the most up-to-date information available, Global Gas Company Profiles allows you to make detailed analysis of each company's performance and future direction. (author)

  16. Controlling magnetic field profiles

    International Nuclear Information System (INIS)

    Freeman, J.R.

    1979-04-01

    A method for designing solenoid magnets with controlled field profiles is discussed. The method, originated by D.B. Montgomery, minimizes both the field errors and the power consumption. An NOS time-sharing computer program for the CDC-6600, entitled MAGCOR, was constructed to provide an interactive magnet design capability. Results obtained during the design of magnets for a radial line electron accelerator are presented. 9 figures

  17. Fitting the IRI F2-profile function to measured profiles

    International Nuclear Information System (INIS)

    Reinisch, B.W.; Huang Xueqin

    1997-01-01

    Comparison with profile data from ionosondes shows that the IRI bottomside F2-profiles can be improved by using better B0 and B1 parameters. The best parameters (in a least-squares sense) can be easily calculated in a numerical procedure from measured profiles presented as a sum of Chebyshev polynomials. 7 refs, 5 figs, 1 tab

  18. Natural current profiles in tokamaks

    International Nuclear Information System (INIS)

    Biskamp, D.

    1986-01-01

    It is proposed that a certain class of equilibrium, which follow from an elementary variational principle, are the natural current profiles in tokamaks, to which actual discharge profiles tend to relax. (orig.)

  19. GHGRP Minerals Sector Industrial Profile

    Science.gov (United States)

    EPA's Greenhouse Gas Reporting Program periodically produces detailed profiles of the various industries that report under the program. The profiles available for download below contain detailed analyses for the Minerals industry.

  20. Synthesis of national risk profile

    Science.gov (United States)

    1979-01-01

    The methodology used and results obtained in computing the national risk profile for carbon fibers (CF) released after an aircraft accident (fire or explosion) are presented. The computation was performed by use of twenty-six individual conditional risk profiles, together with the extrapolation of these profiles to other U.S. airports. The risk profile was obtained using 1993 CF utilization forecasts, but numbers of facilities were taken from 1972 and 1975 census data, while losses were expressed in 1977 dollars.

  1. Deflagration Wave Profiles

    Energy Technology Data Exchange (ETDEWEB)

    Menikoff, Ralph [Los Alamos National Laboratory

    2012-04-03

    Shock initiation in a plastic-bonded explosives (PBX) is due to hot spots. Current reactive burn models are based, at least heuristically, on the ignition and growth concept. The ignition phase occurs when a small localized region of high temperature (or hot spot) burns on a fast time scale. This is followed by a growth phase in which a reactive front spreads out from the hot spot. Propagating reactive fronts are deflagration waves. A key question is the deflagration speed in a PBX compressed and heated by a shock wave that generated the hot spot. Here, the ODEs for a steady deflagration wave profile in a compressible fluid are derived, along with the needed thermodynamic quantities of realistic equations of state corresponding to the reactants and products of a PBX. The properties of the wave profile equations are analyzed and an algorithm is derived for computing the deflagration speed. As an illustrative example, the algorithm is applied to compute the deflagration speed in shock compressed PBX 9501 as a function of shock pressure. The calculated deflagration speed, even at the CJ pressure, is low compared to the detonation speed. The implication of this are briefly discussed.

  2. Profile analysis of microparticles

    International Nuclear Information System (INIS)

    Konarski, P.; Iwanejko, I.; Mierzejewska, A.

    2001-01-01

    Depth resolved analyses of several types of microparticles are presented. Particles for secondary ion mass spectrometry (SIMS) depth profile analysis were collected in the working environment of glass plant, steelworks and welding station using eight-stage cascade impactor with particle size range of 0.3 μm to 15 μm. Ion beam sputtering and sample rotation technique allowed to describe morphology i.e. the elemental structure of collected sub-micrometer particles. Also model particles Iriodin 221 (Merck) were depth profiled. The core-shell structure is found for all types of investigated particles. Steelworks particles consist mainly of iron and manganese cores. At the shells of these microparticles: lead, chlorine and fluorine are found. The particles collected in the glass-works consist mainly of lead-zirconium glass cores covered by carbon and copper. Stainless-steel welding particles compose of iron, manganese and chromium cores covered by a shell rich in carbon, chlorine and fluorine. Sample rotation technique applied in SIMS appears to be an effective tool for environmental microparticle morphology studies

  3. Autoantibody profiling in APS.

    Science.gov (United States)

    Roggenbuck, D; Somma, V; Schierack, P; Borghi, M O; Meroni, P L

    2014-10-01

    The international consensus for the classification of antiphospholipid syndrome (APS) requires clinical and laboratory criteria to be considered at an equal level for diagnosing APS. Thus, detection of antiphospholipid antibodies (aPL) being a hallmark of APS has been the object of intensive investigation over the past 40 years. However, appropriate detection of aPL still remains a laboratory challenge due to their heterogeneity comprising autoantibodies reactive to different phospholipid-binding plasma proteins, such as beta-2 glycoprotein I (β2GPI) and prothrombin. The relevance of aPL interacting with phospholipids other than cardiolipin (CL, diphosphatidylglycerol), such as phosphatidylserine (PS), remains elusive with regard to the diagnosis of APS. Recently, the concept of aPL profiling has been introduced to assess the risk of thrombotic complications in patients with APS. New assay techniques, apart from enzyme-linked immunosorbent assays (ELISAs) recommended by the international consensus for the classification of APS, have been proposed for multiplexing of aPL testing. Line immunoassays (LIAs) employing a novel hydrophobic solid phase for the simultaneous detection of different aPL seem to be an intriguing alternative. We evaluated a novel multiplex LIA employing a hydrophobic membrane coated with different phospholipid (PL)-binding proteins or PLs. The performance characteristics of this new multiplexing assay technique demonstrated its usefulness for aPL profiling. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  4. Petroleum software profiles

    International Nuclear Information System (INIS)

    Anon.

    1996-01-01

    A profile of twenty-two software packages designed for petroleum exploration and production was provided. Some focussed on the oil and gas engineering industry, and others on mapping systems containing well history files and well data summaries. Still other programs provided accounting systems designed to address the complexities of the oil and gas industry. The software packages reviewed were developed by some of the best-known groups involved in software development for the oil and gas industry, including among others, Geoquest, the Can Tek Group, Applied Terravision Systems Inc., Neotechnology Consultants Ltd., (12) OGCI Software Inc., Oracle Energy, Production Revenue Information Systems Management, Virtual Computing Services Ltd., and geoLogic Systems Ltd

  5. Lebanon: country profile.

    Science.gov (United States)

    Marfleet, P

    1988-05-01

    A brief profile of Lebanon's economy, people, health, culture and political situation is presented. Lebanon has an estimated 3.5 million people, with a Maronite Christian elite, a Muslim Shiite majority, and Muslim Sunnis and Druze groups. The infant mortality is estimated at 41/1000; literacy is 69% among women and 86% among men; life expectancy was 66 years, 10 years ago. The economy, previously thriving on banking, manufacturing and agriculture, is now decimated, and Lebanon's once active tourist industry, based on elegant facilities in Beirut and neighboring beaches and ski slopes, is the victim of 15 years of civil strife. Israel has invaded, supporting Maronite Christians, Syria has invaded in support Muslim and Druze militias, and Iran has aggressively supported Shiite factions.

  6. Paper, Profile, Petrarch

    DEFF Research Database (Denmark)

    Foote, Jonathan

    2018-01-01

    , the antique lexicon). By working them out together on the same sheet, the boundaries erode between whittling lines of poetry and carving blocks of stone. Unlike previous attempts to connect Michelangelo's architecture and poetry, this paper focuses on the materiality of the paper as a meeting point between...... the question of what might be discovered by looking closer at these three paper modani (Corpus 536, 538, 539). The verses on the modani are merely fragments and revisions, part of a lineage of multiple and incomplete sources. At the same time, as 1:1 scaled templates, the modani empowered in a unique way...... Michelangelo's well-known propensity toward the fragmentation and re-assembly of the profile line. What emerges is how the paper enabled parallel processes of iteration, cutting and substitution, each operating within rather strict formal boundaries (for the poem, the Petrarchan sonnet; for the architecture...

  7. Three dimensional energy profile:

    International Nuclear Information System (INIS)

    Kowsari, Reza; Zerriffi, Hisham

    2011-01-01

    The provision of adequate, reliable, and affordable energy has been considered as a cornerstone of development. More than one-third of the world's population has a very limited access to modern energy services and suffers from its various negative consequences. Researchers have been exploring various dimensions of household energy use in order to design strategies to provide secure access to modern energy services. However, despite more than three decades of effort, our understanding of household energy use patterns is very limited, particularly in the context of rural regions of the developing world. Through this paper, the past and the current trends in the field of energy analysis are investigated. The literature on rural energy and energy transition in developing world has been explored and the factors affecting households' decisions on energy use are listed. The and the factors affecting households' decisions on energy use are listed. The gaps identified in the literature on rural household energy analysis provide a basis for developing an alternative model that can create a more realistic view of household energy use. The three dimensional energy profile is presented as a new conceptual model for assessment of household energy use. This framework acts as a basis for building new theoretical and empirical models of rural household energy use. - Highlights: ► Reviews literature on household energy, energy transitions and decision-making in developing countries. ► Identifies gaps in rural household energy analysis and develops a new conceptual framework. ► The 3-d energy profile provides a holistic view of household energy system characteristics. ► Illustrates the use of the framework for understanding household energy transitions.

  8. Beam profile measurements on RHIC

    International Nuclear Information System (INIS)

    Connolly, R.; Michnoff, R.; Moore, T.; Shea, T.; Tepikian, S.

    2000-01-01

    The Relativistic Heavy Ion Collider (RHIC) at Brookhaven National Lab was commissioned during the summer of 1999. Transverse beam profiles on RHIC are measured with ionization profile monitors (IPMs). An IPM measures beam profiles by collecting the electrons liberated by residual gas ionization by the beam. The detector is placed in the gap of a dipole magnet to force the electrons to travel in straight lines from the beamline center to the collector. One IPM was tested and it measured the profiles of a single gold bunch containing 10 8 ions on consecutive turns. We show an example of one of these profiles giving transverse emittance. Also several profiles are combined into a mountain-range plot which shows betatron oscillations at injection

  9. Competency profile of Fitness Instructor

    OpenAIRE

    Peterová, Marta

    2011-01-01

    Title: COMPETENCY PROFILE OF FITNESS INSTRUCTOR Objectives: The aim of this work is to find out competencies of fitness instructor and make a competency profile, containing competencies, which are important for excellent fitness instructor. Methods: I applied the method of interview and the method of research in my thesis. The interview was used to make a list of competencies of fitness instructor. The research was applied in the final part of making competency profile, for an attestation of ...

  10. Institutional Profiles: Some Strategic Tools

    Directory of Open Access Journals (Sweden)

    Frans van Vught

    2014-04-01

    Full Text Available In this paper we argue that both internal and external pressures and conditions urge contemporary higher education institutions to carefully think through their institutional profiles positions in domestic and global higher education contexts. We subsequently analyse strategic positioning from the strategic management literature and offer four tools — mapping, multi-dimensional ranking, benchmarking and degree profiling — to assist higher education institutions in their profiling and positioning strategies.

  11. Sensing the wind profile

    Energy Technology Data Exchange (ETDEWEB)

    Pena, A.

    2009-03-15

    This thesis consists of two parts. The first is a synopsis of the theoretical progress of the study that is based on a number of journal papers. The papers, which constitute the second part of the report, aim to analyze, measure, and model the wind prole in and beyond the surface layer by combining observations from cup anemometers with lidars. The lidar is necessary to extend the measurements on masts at the Horns Rev offshore wind farm and over at land at Hoevsoere, Denmark. Both sensing techniques show a high degree of agreement for wind speed measurements performed at either sites. The wind speed measurements are averaged for several stability conditions and compare well with the surface-layer wind profile. At Hoevsoere, it is sufficient to scale the wind speed with the surface friction velocity, whereas at Horns Rev a new scaling is added, due to the variant roughness length. This new scaling is coupled to wind prole models derived for flow over the sea and tested against the wind proles up to 160 m at Horns Rev. The models, which account for the boundary-layer height in stable conditions, show better agreement with the measurements than compared to the traditional theory. Mixing-length parameterizations for the neutral wind prole compare well with length-scale measurements up to 300 m at Hoevsoere and 950 m at Leipzig. The mixing-length-derived wind proles strongly deviate from the logarithmic wind prole, but agree better with the wind speed measurements. The length-scale measurements are compared to the length scale derived from a spectral analysis performed up to 160 m at Hoevsoere showing high agreement. Mixing-length parameterizations are corrected to account for stability and used to derive wind prole models. These compared better to wind speed measurements up to 300 m at Hoevsoere than the surface-layer wind prole. The boundary-layer height is derived in nearneutral and stable conditions based on turbulent momentum uxes only and in unstable conditions

  12. USGIN ISO metadata profile

    Science.gov (United States)

    Richard, S. M.

    2011-12-01

    The USGIN project has drafted and is using a specification for use of ISO 19115/19/39 metadata, recommendations for simple metadata content, and a proposal for a URI scheme to identify resources using resolvable http URI's(see http://lab.usgin.org/usgin-profiles). The principal target use case is a catalog in which resources can be registered and described by data providers for discovery by users. We are currently using the ESRI Geoportal (Open Source), with configuration files for the USGIN profile. The metadata offered by the catalog must provide sufficient content to guide search engines to locate requested resources, to describe the resource content, provenance, and quality so users can determine if the resource will serve for intended usage, and finally to enable human users and sofware clients to obtain or access the resource. In order to achieve an operational federated catalog system, provisions in the ISO specification must be restricted and usage clarified to reduce the heterogeneity of 'standard' metadata and service implementations such that a single client can search against different catalogs, and the metadata returned by catalogs can be parsed reliably to locate required information. Usage of the complex ISO 19139 XML schema allows for a great deal of structured metadata content, but the heterogenity in approaches to content encoding has hampered development of sophisticated client software that can take advantage of the rich metadata; the lack of such clients in turn reduces motivation for metadata producers to produce content-rich metadata. If the only significant use of the detailed, structured metadata is to format into text for people to read, then the detailed information could be put in free text elements and be just as useful. In order for complex metadata encoding and content to be useful, there must be clear and unambiguous conventions on the encoding that are utilized by the community that wishes to take advantage of advanced metadata

  13. Ethnosocial profile of Tuvans

    Directory of Open Access Journals (Sweden)

    Valeriya S. Kan

    2016-06-01

    Full Text Available The article examines the ethnosocial profile of contemporary Tuvans, with a focus on the dynamics of population change, human environment, self-consciousness, interethnic relations and language command. Our study was based on the official data of the Federal Census and the current statistics we obtained from Tuva territorial branch of the Federal State Statistics Service, as well as on the outcomes of the opinion polls held by a team lead by the author in 2008-2015. Due to traditionally high birth rate, the Tuvan population of Russia continues to grow (243422 in 2002, 263934 in 2010. This is also true for their share in the total population of Russia (0.17% in 2002, 0.19% in 2010. The main features of Tuvan human environment are their compact settlement within the Republic of Tuva (249299, or 95% of overall population, as well as living largely in a monoethnic environment, low level of ethnocultural and linguistic diversity and prevalence of rural population. The share of indigenous population in the region has been steadily increasing (64% in 1989, 77% in 2002, 82% in 2002, while those of other groups have been decreasing over time. The net migration remains negative due to ethnic Russians leaving the socially and economically dysfunctional region. Tuvans account for 92% of rural population, and 73% of the urban. The rural-urban balance in Tuva is shifting towards the latter slower than in the national average. Interethnic relations in the region can be described as stable, with a slight degree of tension. Problems mainly happen on the level of day-to-day communication. The sub-ethnicity of Tojin Tuvans is decreasing in numbers (4435 people in 2002, and 1856 in 2010. We believe the reason lies in the change of self-consciousness which accompanied the complete abandonment of nomadic lifestyle. In the article, we also define and describe the factors which contribute to the reproduction of Tuvan ethnicity, including the policy of the regional

  14. [Profile of silodosin].

    Science.gov (United States)

    Montorsi, Francesco

    2013-01-01

    Silodosin is a highly selective alpha1A-adrenoceptor antagonist approved for the treatment of the signs and symptoms of benign prostatic hyperplasia. Its clinical pharmacology profile offers a number of advantages, including uroselectivity, once-daily (QD) dosing, a standard dose of 8 mg QD that does not need to be adjusted according to age, and the feasibility of concomitant treatment with phosphodiesterase type 5 (PDE5) inhibitors and antihypertensive agents. Three phase 3 double-blind, randomised trials using the dosage regimen of 8 mg QD in > 800 patients have shown that silodosin is significantly more effective than placebo (p nocturia (p = 0.03). Safety data collected in 1581 patients exposed to chronic treatment with silodosin 8 mg QD have shown that the drug is safe and well tolerated. As was to be expected with a uroselective compound, cardiovascular effects have been minimal. The most common adverse reaction is "retrograde ejaculation" (anejaculation), which led to treatment discontinuation in only 3.9% of patients. The rare, drug class-related safety issue of intraocular floppy iris syndrome can be satisfactorily managed by warning patients simply to inform their ophthalmologist that they are or were on treatment with an alpha1-adrenoceptor blocker.

  15. Aliskiren: a clinical profile

    Directory of Open Access Journals (Sweden)

    Roland E Schmieder

    2006-06-01

    Full Text Available Aliskiren is a novel oral antihypertensive agent, and the first in the new class of direct renin inhibitors. Here we review the key criteria that a new antihypertensive drug should possess, notably effective blood pressure lowering as monotherapy and combination therapy, 24-hour blood pressure control, safety and tolerability, end-organ protective effects, minimal drug interaction and efficacy during long-term use.Aliskiren fulfils key criteria for a new antihypertensive agent.The drug demonstrates effective blood lowering in a number of studies as monotherapy and in combination with a thiazide diuretic (hydrochlorothiazide, an angiotensin-converting enzyme inhibitor (ramipril and a calcium channel blocker (amlodipine. Other studies applying ambulatory blood pressure monitoring show that aliskiren maintains blood pressure control for more than 24 hours. Aliskiren, 150 mg and 300 mg have demonstrated a placebo-like safety and tolerability profile, with no interactions with a wide range of commonly used drugs. Three studies (AVOID, ALOFT and ALLAY are ongoing properties. with aliskiren to assess end-organ protective properties.

  16. The worker profile autocontrolled

    Directory of Open Access Journals (Sweden)

    Jairo Omar Delgado Mora

    2015-06-01

    Full Text Available This document is part of two deliveries. In this first paper is to make an approach to the concept of self-control from the very beginning with Sakichi Toyoda, founder of what the industry Toyota Motor Company, additionally taking some excerpts of the concept issued by teachers and the psychologist Henry Murray, a professor at the university Harvard precursor test TAT personality test creator, pen applied world wide by psychologists David McCllelan, also a psychologist and a pioneer in the study of human needs and the concept of competence; Professor Jeffrey Pfeffer of Stanford University organizational behavior and theory, Frederick Hertzberg, Psychologist and strong influential in business management, Kronfly Cruz, lawyer and investigator of social and administrative sciences, Charles Perrow, a sociologist at Yale University and Stanford , who studies the impact of large organizations in society, among others. The study reflects the need to meet organizational objectives related to the physicochemical characteristics of the finished product in a plant of the company’s main beers in the country. In this paper, we intend to make an approximation of worker self -controlled, which when compared with the powers, generic, specific and technical area established by the brewery, will allow generating a methodology to adjust these competencies and to obtain the target profile drawn. This comparison and development of the methodology proposed is the subject of the second work planned.

  17. A channel profile analyser

    International Nuclear Information System (INIS)

    Gobbur, S.G.

    1983-01-01

    It is well understood that due to the wide band noise present in a nuclear analog-to-digital converter, events at the boundaries of adjacent channels are shared. It is a difficult and laborious process to exactly find out the shape of the channels at the boundaries. A simple scheme has been developed for the direct display of channel shape of any type of ADC on a cathode ray oscilliscope display. This has been accomplished by sequentially incrementing the reference voltage of a precision pulse generator by a fraction of a channel and storing ADC data in alternative memory locations of a multichannel pulse height analyser. Alternative channels are needed due to the sharing at the boundaries of channels. In the flat region of the profile alternate memory locations are channels with zero counts and channels with the full scale counts. At the boundaries all memory locations will have counts. The shape of this is a direct display of the channel boundaries. (orig.)

  18. GANIL beam profile detectors

    International Nuclear Information System (INIS)

    Tribouillard, C.

    1997-01-01

    In the design phase of GANIL which started in 1977, one of the priorities of the project management was equipping the beamlines with a fast and efficient system for visualizing the beam position, thus making possible adjustment of the beam transport lines optics and facilitating beam control. The implantation of some thirty detectors was foreseen in the initial design. The assembly of installed detectors (around 190) proves the advantages of these detectors for displaying all the beams extracted from GANIL: transfer and transport lines, beam extracted from SISSI, very high intensity beam, secondary ion beams from the production target of the LISE and SPEG spectrometers, different SPIRAL project lines. All of these detectors are based on standard characteristics: - standard flange diameter (DN 160) with a standard booster for all the sensors; - identical analog electronics for all the detectors, with networking; - unique display system. The new micro-channel plate non-interceptive detectors (beam profile and ion packet lengths) make possible in-line control of the beam quality and accelerator stability. (author)

  19. Steroid profiling in doping analysis

    NARCIS (Netherlands)

    Kerkhof, Daniël Henri van de

    2001-01-01

    Profiling androgens in urine samples is used in doping analysis for the detection of abused steroids of endogenous origin. These profiling techniques were originally developed for the analysis of testosterone, mostly by means of the ratio of testosterone to epitestosterone (T/E ratio). A study was

  20. Commitment Profiles and Employee Turnover

    Science.gov (United States)

    Stanley, Laura; Vandenberghe, Christian; Vandenberg, Robert; Bentein, Kathleen

    2013-01-01

    We examined how affective (AC), normative (NC), perceived sacrifice (PS), and few alternatives (FA) commitments combine to form profiles and determine turnover intention and turnover. We theorized that three mechanisms account for how profiles operate, i.e., the degree to which membership is internally regulated, the perceived desirability and…

  1. Personal summarization from profile networks

    Institute of Scientific and Technical Information of China (English)

    Zhongqing WANG; Shoushan LI; Guodong ZHOU

    2017-01-01

    Personal profile information on social media like Linkedln.com and Facebook.com is at the core of many interesting applications,such as talent recommendation and contextual advertising.However,personal profiles usually lack consistent organization confronted with the large amount of available information.Therefore,it is always a challenge for people to quickly find desired information from them.In this paper,we address the task of personal profile summarization by leveraging both textual information and social connection information in social networks from both unsupervised and supervised learning paradigms.Here,using social connection information is motivated by the intuition that people with similar academic,business or social background (e.g.,comajor,co-university,and co-corporation) tend to have similar experiences and should have similar summaries.For unsupervised learning,we propose a collective ranking approach,called SocialRank,to combine textual information in an individual profile and social context information from relevant profiles in generating a personal profile summary.For supervised learning,we propose a collective factor graph model,called CoFG,to summarize personal profiles with local textual attribute functions and social connection factors.Extensive evaluation on a large dataset from LinkedIn.com demonstrates the usefulness of social connection information in personal profile summarization and the effectiveness of our proposed unsupervised and supervised learning approaches.

  2. Steel Energy and Environmental Profile

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2000-08-01

    Major steelmaking processes (from ironmaking through fabrication and forming) and their associated energy requirements have been profiled in this 2001 report (PDF 582 KB). This profile by Energetics, Inc. also describes the waste streams generated by each process and estimates annual emissions of CO2 and criteria pollutants.

  3. The influence of Stark shift and plasma inhomogeneity on half width of self-absorbed line profiles in the plasma emission spectrum

    International Nuclear Information System (INIS)

    Catsalap, K.Yu.; Ershov-Pavlov, E.A.

    2005-01-01

    distribution is presented as T(y)=T 0 [1+(y/y 0 ) α ] -1 , where T 0 - maximum temperature on the line of sight, 2y 0 and a are the effective size and the inhomogeneity parameter, respectively. The value a influence strongly the t(τ) dependence. For example, when α=2 the difference t and t h can rise up to 20% even at a moderate τ ∼ 2. It is shown, the ratio C=t/t h is practically independent on τ for τ>2. Thus for τ>2, the value C can be replaced by an averaged one. If one knows a and function C(α) averaged by τ, then t can be found as t=C(α)t h . At the errors of 10% in Δλ, the coefficient C(α) can be used for τ>1. It has been also found, that when the ratio d/w grows, the inhomogeneity does not practically influence on t(t) and C(α) dependencies. For d/w>0.5, the t(τ) dependence is not affected by the plasma inhomogeneity. These results are supported by the experimental data for Si II spectral lines. Most of the lines have d/w=0.5-1.0. Thus, for lines with a strong shift the inhomogeneity influence on profile half width can be neglected. The results obtained can be used at spectroscopic diagnostics of semi-transparent plasmas. (author)

  4. Searching mixed DNA profiles directly against profile databases.

    Science.gov (United States)

    Bright, Jo-Anne; Taylor, Duncan; Curran, James; Buckleton, John

    2014-03-01

    DNA databases have revolutionised forensic science. They are a powerful investigative tool as they have the potential to identify persons of interest in criminal investigations. Routinely, a DNA profile generated from a crime sample could only be searched for in a database of individuals if the stain was from single contributor (single source) or if a contributor could unambiguously be determined from a mixed DNA profile. This meant that a significant number of samples were unsuitable for database searching. The advent of continuous methods for the interpretation of DNA profiles offers an advanced way to draw inferential power from the considerable investment made in DNA databases. Using these methods, each profile on the database may be considered a possible contributor to a mixture and a likelihood ratio (LR) can be formed. Those profiles which produce a sufficiently large LR can serve as an investigative lead. In this paper empirical studies are described to determine what constitutes a large LR. We investigate the effect on a database search of complex mixed DNA profiles with contributors in equal proportions with dropout as a consideration, and also the effect of an incorrect assignment of the number of contributors to a profile. In addition, we give, as a demonstration of the method, the results using two crime samples that were previously unsuitable for database comparison. We show that effective management of the selection of samples for searching and the interpretation of the output can be highly informative. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  5. Performance profiling for brachytherapy applications

    Science.gov (United States)

    Choi, Wonqook; Cho, Kihyeon; Yeo, Insung

    2018-05-01

    In many physics applications, a significant amount of software (e.g. R, ROOT and Geant4) is developed on novel computing architectures, and much effort is expended to ensure the software is efficient in terms of central processing unit (CPU) time and memory usage. Profiling tools are used during the evaluation process to evaluate the efficiency; however, few such tools are able to accommodate low-energy physics regions. To address this limitation, we developed a low-energy physics profiling system in Geant4 to profile the CPU time and memory of software applications in brachytherapy applications. This paper describes and evaluates specific models that are applied to brachytherapy applications in Geant4, such as QGSP_BIC_LIV, QGSP_BIC_EMZ, and QGSP_BIC_EMY. The physics range in this tool allows it to be used to generate low energy profiles in brachytherapy applications. This was a limitation in previous studies, which caused us to develop a new profiling tool that supports profiling in the MeV range, in contrast to the TeV range that is supported by existing high-energy profiling tools. In order to easily compare the profiling results between low-energy and high-energy modes, we employed the same software architecture as that in the SimpliCarlo tool developed at the Fermilab National Accelerator Laboratory (FNAL) for the Large Hadron Collider (LHC). The results show that the newly developed profiling system for low-energy physics (less than MeV) complements the current profiling system used for high-energy physics (greater than TeV) applications.

  6. Agricultural Pilot's Audiological Profile

    Directory of Open Access Journals (Sweden)

    Foltz, Lucas

    2010-09-01

    Full Text Available Introduction: The agricultural airplane pilot are daily exposed to intense noises, being susceptible to the noise-induced hearing loss (NIHL and its auditory and extra auditory effects. Objective: To analyze the audiological profile of this population, verifying the work's influence on its hearing. Method: It was realized a retrospective, individual, observational, and cross-sectional study through the data obtained by means of a questionnaire and audiometric thresholds of 41 agricultural pilots. To the statistical analysis were utilized the chi-square, Spearman, and Wilcoxon tests with significance level of 5%. Results: It was verified that 95,1% of the pilots use PPE ( personal protective equipment during flight and 58,5% have contact with pesticides. More than half of individuals referred to feel auditory and extra auditory symptoms, being the buzz the more frequent (29,1%. It has the occurrence of 29,3% of NIHL suggestive hearing loss and 68,3% of normality, taking this presence of unilateral notch in 24,4% and bilateral notch in 31,7%. It was found correlation statistically significant in the associations between time of service and the average of the acute frequencies in the right ear (p=0038, and in the left ear (p=0,010. It has a statistical tendency in the association between audiometric configuration and contact with pesticides (p=0,088. Conclusion: The hearing loss prevalence in this study was showed high. More than half of the sample has normal audiometric thresholds with notch configuration. Such data lead to the conclusion that the agricultural pilots, even with PPE use, they still suffer with the damages caused by noise, needing best proposals of hearing loss prevention.

  7. Character profiles and life satisfaction.

    Science.gov (United States)

    Park, Hwanjin; Suh, Byung Seong; Kim, Won Sool; Lee, Hye-Kyung; Park, Seon-Cheol; Lee, Kounseok

    2015-04-01

    There is a surge of interest in subjective well-being (SWB), which concerns how individuals feel about their happiness. Life satisfaction tends to be influenced by individual psychological traits and external social factors. The aim of this study was to examine the relationship between individual character and SWB. Data from 3522 university students were analyzed in this study. Character profiles were evaluated using the Temperament and Character Inventory-Revised Short version (TCI-RS). Life satisfaction was assessed using the Satisfaction with Life Scale (SWLS). All statistical tests regarding the correlations between each character profile and life satisfaction were conducted using ANOVAs, t-tests, multiple linear regression models and correlation analyses. The creative (SCT) profile was associated with the highest levels of life satisfaction, whereas the depressive (sct) profile was associated with the lowest levels of life satisfaction. Additionally, high self-directedness, self-transcendence and cooperation were associated with high life satisfaction. The results of gender-adjusted multiple regression analysis showed that the effects of self-directedness were the strongest in the assessment of one's quality of life, followed by self-transcendence and cooperativeness, in that order. All of the three-character profiles were significantly correlated with one's quality of life, and the character profiles of TCI-RS explained 27.6% of life satisfaction in total. Among the three-character profiles, the self-directedness profile was most associated with life satisfaction. Our study was cross-sectional, and self-reported data from students at a single university were analyzed. The results of this study showed that, among the character profiles, the effects of self-directedness were the strongest for predicting life satisfaction. Copyright © 2014 Elsevier Inc. All rights reserved.

  8. SURFACE BRIGHTNESS PROFILES OF DWARF GALAXIES. I. PROFILES AND STATISTICS

    International Nuclear Information System (INIS)

    Herrmann, Kimberly A.; Hunter, Deidre A.; Elmegreen, Bruce G.

    2013-01-01

    Radial surface brightness profiles of spiral galaxies are classified into three types: (I) single exponential, or the light falls off with one exponential to a break before falling off (II) more steeply, or (III) less steeply. Profile breaks are also found in dwarf disks, but some dwarf Type IIs are flat or increasing out to a break before falling off. Here we re-examine the stellar disk profiles of 141 dwarfs: 96 dwarf irregulars (dIms), 26 Blue Compact Dwarfs (BCDs), and 19 Magellanic-type spirals (Sms). We fit single, double, or even triple exponential profiles in up to 11 passbands: GALEX FUV and NUV, ground-based UBVJHK and Hα, and Spitzer 3.6 and 4.5 μm. We find that more luminous galaxies have brighter centers, larger inner and outer scale lengths, and breaks at larger radii; dwarf trends with M B extend to spirals. However, the V-band break surface brightness is independent of break type, M B , and Hubble type. Dwarf Type II and III profiles fall off similarly beyond the breaks but have different interiors and IIs break ∼twice as far as IIIs. Outer Type II and III scale lengths may have weak trends with wavelength, but pure Type II inner scale lengths clearly decrease from the FUV to visible bands whereas Type III inner scale lengths increase with redder bands. This suggests the influence of different star formation histories on profile type, but nonetheless the break location is approximately the same in all passbands. Dwarfs continue trends between profile and Hubble types such that later-type galaxies have more Type II but fewer Type I and III profiles than early-type spirals. BCDs and Sms are over-represented as Types III and II, respectively, compared to dIms

  9. Diacylglycerol acyltransferase-1 (DGAT1 inhibition perturbs postprandial gut hormone release.

    Directory of Open Access Journals (Sweden)

    Hua V Lin

    Full Text Available Diacylglycerol acyltransferase-1 (DGAT1 is a potential therapeutic target for treatment of obesity and related metabolic diseases. However, the degree of DGAT1 inhibition required for metabolic benefits is unclear. Here we show that partial DGAT1 deficiency in mice suppressed postprandial triglyceridemia, led to elevations in glucagon-like peptide-1 (GLP-1 and peptide YY (PYY only following meals with very high lipid content, and did not protect from diet-induced obesity. Maximal DGAT1 inhibition led to enhanced GLP-1 and PYY secretion following meals with physiologically relevant lipid content. Finally, combination of DGAT1 inhibition with dipeptidyl-peptidase-4 (DPP-4 inhibition led to further enhancements in active GLP-1 in mice and dogs. The current study suggests that targeting DGAT1 to enhance postprandial gut hormone secretion requires maximal inhibition, and suggests combination with DPP-4i as a potential strategy to develop DGAT1 inhibitors for treatment of metabolic diseases.

  10. Timeline of changes in appetite during weight loss with a ketogenic diet

    DEFF Research Database (Denmark)

    Nymo, S; Coutinho, S R; Jørgensen, J

    2017-01-01

    BACKGROUND/OBJECTIVE: Diet-induced weight loss (WL) leads to increased hunger and reduced fullness feelings, increased ghrelin and reduced satiety peptides concentration (glucagon-like peptide-1 (GLP-1), cholecystokinin (CCK) and peptide YY (PYY)). Ketogenic diets seem to minimise or supress some...... of these responses. The aim of this study was to determine the timeline over which changes in appetite occur during progressive WL with a ketogenic very-low-energy diet (VLED). SUBJECTS/METHODS: Thirty-one sedentary adults (18 men), with obesity (body mass index: 37±4.5 kg m-2) underwent 8 weeks (wks) of a VLED...... followed by 4 wks of weight maintenance. Body weight and composition, subjective feelings of appetite and appetite-related hormones (insulin, active ghrelin (AG), active GLP-1, total PYY and CCK) were measured in fasting and postprandially, at baseline, on day 3 of the diet, 5 and 10% WL, and at wks 9...

  11. SPLC Sustainable Purchasing Guidance Profile

    Science.gov (United States)

    To help you find the resource that is right for your organization, EPA conducted a scan of the landscape and developed summary profiles of some of the leading sources of sustainable purchasing guidance around the globe.

  12. Monitor of SC beam profiles

    CERN Document Server

    CERN PhotoLab

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  13. Autonomous vertical profiler data management

    Digital Repository Service at National Institute of Oceanography (India)

    Afzulpurkar, S.; Navelkar, G.S.; Desa, E.S.; Madhan, R.; Dabholkar, N.; Prabhudesai, S.P.; Mascarenhas, A.A.M.Q.

    the data management. It is expected that there would be multiple profilers operating at various locations, such as coastal seas, dams and other water bodies. Data would be relayed for archival, processing and be made available to the communities who...

  14. CDBG Performance Profiles - PY12

    Data.gov (United States)

    Department of Housing and Urban Development — These profiles significantly increase the amount of information that is available about the performance of CDBG grantees. It is important that our grantees, all our...

  15. Profile of organic food consumers

    Directory of Open Access Journals (Sweden)

    Kranjac Mirjana

    2017-01-01

    Full Text Available The aim of this study is to prove that profile of organic food consumers is dependent on their socio-demographic characteristics as well as to shape universal organic food consumer profile. The survey included 398 consumers in Serbia. Results indicate existence of typical consumer's profile. The findings could be generalized proving that socio-demographic profiles in a larger population are strictly related to the decision to utilize organic food. The study finally contributes to the stakeholders in general, since the knowledge of the attributes can help all of them to play more active role in this supply chain. It should stimulate the personalized approach to the particular groups of consumers based on socio-demographic characteristics in order to intensify consumption of organic food and to create different marketing plans dependent on the particular countries or areas.

  16. LCA profiles for building components:

    DEFF Research Database (Denmark)

    Marsh, Rob

    2016-01-01

    . A full bivariate linear regression analysis is performed, showing statistically significant correlations with strong direct relationships between environmental impact categories. A simplified LCA profile consisting of total primary energy, global warming potential and acidification potential is developed...

  17. State Cancer Profiles Web site

    Data.gov (United States)

    U.S. Department of Health & Human Services — The State Cancer Profiles (SCP) web site provides statistics to help guide and prioritize cancer control activities at the state and local levels. SCP is a...

  18. Automotive Refinishing Industry: Isocyanates Profile

    Science.gov (United States)

    The isocyanates profile document is part of the DfE Auto Refinishing Shop Project and is intended to provide information on refinishing, control technologies, and regulatory status regarding isocyanate compounds

  19. Metropolitan Lima: area profile.

    Science.gov (United States)

    Hakkert, R

    1986-11-01

    This profile of metropolitan Lima, Peru, covers administrative divisions; population growth; age distribution; ethnicity and religion; housing and households; education and health care; economic activity, income, and consumption; transport and communication; and sources of information. Nearly 30% of Peru's entire population and 42% of its urban population live in Lima. The trend continues, yet Lima's urban primacy is waning due to the growth of some regional centers like Trujillo and Chimbote. Lima is still almost 10 times as large as the country's next ranking cities, Trujillo on the northern coast and Arequipa in the south. Peru's main administrative divisions are the 24 departments, of which the Department of Lima is one. These departments are further divided into 156 provinces. Greater Lima consists of 2 such provinces, the province of Lima and the constitutional province of Callao. Although the population of Lima continues to grow, its rate of growth slowed from about 5.5% during the 1960s to about 3.9% in the 1970s. Current projections estimate a metropolitan population of 6.7 million by 1990. On the whole, Lima's age structure is somewhat older than that of the rest of Peru. The median age of the population is 22.3 years, compared to a national figure of 20.4. The proportion of persons over age 65 is only 3.6%, lower than the national average of 4.1%, due to the tendency of in-migration to concentrate people of intermediate ages in the cities. Almost 400,000 inhabitants of greater Lima are bilingual in Spanish and an indigenous language. As elsewhere in Peru, the dominant religion is Roman Catholicism. Lima is a spread out city with few high rise buildings due to the danger of earthquakes. Only 12% of Lima's households are found in apartment buildings. As in other cities of Latin America, the formal housing market is beyond the reach of a major segment of the population. Consequently, much of the urban settlement has occurred through informal self

  20. Grinding Wheel Profile

    Science.gov (United States)

    2004-01-01

    This graphic dubbed by engineers as the 'Grinding Wheel Profile' is the detective's tool used by the Opportunity team to help them understand one of the processes that formed the interior of a rock called 'McKittrick.' Scientists are looking for clues as to how layers, grains and minerals helped create this rock, and the engineers who built the rock abrasion tool (RAT) wanted to ensure that their instrument's handiwork did not get confused with natural processes.In the original microscopic image underlaying the graphics, engineers and scientists noticed 'layers' or 'scratches' on the spherical object nicknamed 'blueberry' in the lower right part of the image. The designers of the rock abrasion tool noticed that the arc length and width of the scratches were similar to the shape and size of the rock abrasion tool's grinding wheel, which is made out of a pad of diamond teeth.The scrapes on the bottom right blueberry appear to be caused by the fact that the berry got dislodged slightly and its surface was scraped with the grinding pad. In this image, the largest yellow circle is the overall diameter of the hole ground by the rock abrasion tool and the largest yellow rectangular shape is the area of the grinding wheel bit. The smaller yellow semi-circle is the path that the center of the grinding tool follows. The orange arrow arcing around the solid yellow circle (center of grinding tool) indicates the direction that the grinding tool spins around its own center at 3,000 revolutions per minute. The tool simultaneously spins in an orbit around the center of the hole, indicated by the larger orange arrow to the left.The grinding tool is 22 millimeters (0.9 inches) in length and the actual grinding surface, which consists of the diamond pad, is 1.5 millimeters (0.06 inches) in length, indicated by the two smaller rectangles. You can see that the smaller bottom rectangle fits exactly the width of the scrape marks.The grooves on the blueberry are also the same as the

  1. Racial Profiling and Criminal Justice

    DEFF Research Database (Denmark)

    Ryberg, Jesper

    2011-01-01

    According to the main argument in favour of the practice of racial profiling as a low enforcement tactic, the use of race as a targeting factor helps the police to apprehend more criminals. In the following, this argument is challenged. It is argued that, given the assumption that criminals...... are currently being punished too severely in Western countries, the apprehension of more criminals may not constitute a reason in favour of racial profiling at all....

  2. Approximate Stokes Drift Profiles in Deep Water

    Science.gov (United States)

    Breivik, Øyvind; Janssen, Peter A. E. M.; Bidlot, Jean-Raymond

    2014-09-01

    A deep-water approximation to the Stokes drift velocity profile is explored as an alternative to the monochromatic profile. The alternative profile investigated relies on the same two quantities required for the monochromatic profile, viz the Stokes transport and the surface Stokes drift velocity. Comparisons with parametric spectra and profiles under wave spectra from the ERA-Interim reanalysis and buoy observations reveal much better agreement than the monochromatic profile even for complex sea states. That the profile gives a closer match and a more correct shear has implications for ocean circulation models since the Coriolis-Stokes force depends on the magnitude and direction of the Stokes drift profile and Langmuir turbulence parameterizations depend sensitively on the shear of the profile. The alternative profile comes at no added numerical cost compared to the monochromatic profile.

  3. An appraisal profile of nostalgia.

    Science.gov (United States)

    van Tilburg, Wijnand A P; Bruder, Martin; Wildschut, Tim; Sedikides, Constantine; Göritz, Anja S

    2018-03-05

    The authors aimed to (a) identify the cognitive appraisals underlying nostalgia and (b) compare nostalgia with other emotions in terms of its appraisal profile. In Study 1, participants (N = 1,125) generated narratives. Next, they reported the level of nostalgia and 31 other emotions that these narratives elicited. Subsequently, participants evaluated the narrative events on several cognitive appraisals. Events that elicited nostalgia were pleasant, involved an irretrievable loss, felt psychologically distant, and were unique-an appraisal profile that differed from all other emotions. In Study 2 (N = 1,261), the authors experimentally varied these appraisals in a vignette paradigm and measured anticipated nostalgia and 10 other emotions. Participants anticipated most nostalgia when events were pleasant, involved irretrievable loss, were distant, and were unique-a profile shared only with longing. In Study 3 (N = 994), the authors used a guided autobiographical recall procedure in which they manipulated appraisals and measured the resultant emotions. Corroborating Studies 1-2, nostalgia was most intense for events that were pleasant, irretrievably lost, temporally distant, and unique. This appraisal profile was not shared by other emotions. The findings delineate the distinguishing cognitive appraisal profile of nostalgia. Nostalgia occupies a special place in the pantheon of emotions. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  4. School Health Profiles 2014: West Virginia Rankings

    Science.gov (United States)

    West Virginia Department of Education Office of Research, Accountability, and Data Governance, 2015

    2015-01-01

    The School Health Profiles (Profiles) is a system of surveys assessing school health policies and practices in states, large urban school districts, and territories. Profiles surveys are conducted biennially by education and health agencies among middle and high school principals and lead health education teachers. Profiles monitors the current…

  5. Secondary maxima in ozone profiles

    Directory of Open Access Journals (Sweden)

    R. Lemoine

    2004-01-01

    Full Text Available Ozone profiles from balloon soundings as well as SAGEII ozone profiles were used to detect anomalous large ozone concentrations of ozone in the lower stratosphere. These secondary ozone maxima are found to be the result of differential advection of ozone-poor and ozone-rich air associated with Rossby wave breaking events. The frequency and intensity of secondary ozone maxima and their geographical distribution is presented. The occurrence and amplitude of ozone secondary maxima is connected to ozone variability and trend at Uccle and account for a large part of the total ozone and lower stratospheric ozone variability.

  6. Individual Profiling Using Text Analysis

    Science.gov (United States)

    2016-04-15

    AFRL-AFOSR-UK-TR-2016-0011 Individual Profiling using Text Analysis 140333 Mark Stevenson UNIVERSITY OF SHEFFIELD, DEPARTMENT OF PSYCHOLOGY Final...REPORT TYPE      Final 3.  DATES COVERED (From - To)      15 Sep 2014 to 14 Sep 2015 4.  TITLE AND SUBTITLE Individual Profiling using Text Analysis ...consisted of collections of tweets for a number of Twitter users whose gender, age and personality scores are known. The task was to construct some system

  7. Electron shower transverse profile measurement

    International Nuclear Information System (INIS)

    Lednev, A.A.

    1993-01-01

    A method to measure the shower transverse profile is described. Calibration data of the lead-glass spectrometer GAMS collected in a wide electron beam without any additional coordinate detector are used. The method may be used for the measurements in both cellular- and projective-type spectrometers. The results of measuring the 10 GeV electron shower profile in the GAMS spectrometer, without optical grease between the lead-glass radiators and photomultipliers, are approximated with an analytical function. The estimate of the coordinate accuracy is obtained. 5 refs., 8 figs

  8. Measurement of whole tire profile

    Science.gov (United States)

    Yang, Yongyue; Jiao, Wenguang

    2010-08-01

    In this paper, a precision measuring device is developed for obtaining characteristic curve of tire profile and its geometric parameters. It consists of a laser displacement measurement unit, a closed-loop precision two-dimensional coordinate table, a step motor control system and a fast data acquisition and analysis system. Based on the laser trigonometry, a data map of tire profile and coordinate values of all points can be obtained through corresponding data transformation. This device has a compact structure, a convenient control, a simple hardware circuit design and a high measurement precision. Experimental results indicate that measurement precision can meet the customer accuracy requirement of +/-0.02 mm.

  9. Renewable Energy Country Profiles. Caribbean

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-09-15

    IRENA Renewable Energy Country Profiles take stock of the latest developments in the field of renewables at country level around the world. Each profile combines analysis by IRENA's specialists with the latest available country data and additional information from a wide array of sources. The resulting reports provide a brief yet comprehensive picture of the situation with regard to renewable energy, including energy supply, electrical generation and grid capacity, and access. Energy policies, targets and projects are also considered, along with each country's investment climate and endowment with renewable energy resources. The energy statistics presented here span the period from 2009 until 2012, reflecting varying timelines in the source material. Since data availability differs from country to country, wider regional comparisons are possible only for the latest year with figures available for every country included. Despite the time lag in some cases, the evident differences and disparities between countries and regions around the world remain striking. The current package of country profiles is just a starting point. The geographic scope will continue to expand, and existing profiles will be enhanced with new indicators, with the whole series maintained as a live product on the IRENA website (www.irena.org)

  10. Profiling Mobile English Language Learners

    Science.gov (United States)

    Byrne, Jason; Diem, Robert

    2014-01-01

    The purpose of this study was to use an app-embedded survey to profile language learner demographics. A total of 3,759 EFL language learners from primarily eight L1 backgrounds (French, German, Italian, Japanese, Korean, Russian, Spanish and Thai) responded to the survey embedded within a popular English grammar app. This app has over 500,000…

  11. English Language Teaching Profile: Sweden.

    Science.gov (United States)

    British Council, London (England). English-Teaching Information Centre.

    This profile in outline form of the English language teaching situation in Sweden discusses the role of English within Swedish society and within the Swedish educational system. The status of English as the principal foreign language since 1945 for use in business, the media and tourism is pointed out. The system of English instruction in the…

  12. Ohio Special Education Profile, 2011

    Science.gov (United States)

    Ohio Coalition for the Education of Children with Disabilities, 2011

    2011-01-01

    This report provides a brief, but substantive, profile of the special needs student population in Ohio, including academic performance and graduation trends and an overview of special education funding and related policy issues. The report's central message is that investments in students with special educational needs produce substantial results…

  13. ARL Profiles: Research Libraries 2010

    Science.gov (United States)

    Potter, William Gray; Cook, Colleen; Kyrillidou, Martha

    2011-01-01

    The current ARL report summarizes a multi-year effort that captures evidence in the form of narrative profiles as it delivers the message of the value and contributions of research libraries during transformative times. When ARL library directors were interviewed in 2005 and asked to describe a research library in the 21st century, there was…

  14. Metabolic Profiles of Brain Metastases

    Directory of Open Access Journals (Sweden)

    Tone F. Bathen

    2013-01-01

    Full Text Available Metastasis to the brain is a feared complication of systemic cancer, associated with significant morbidity and poor prognosis. A better understanding of the tumor metabolism might help us meet the challenges in controlling brain metastases. The study aims to characterize the metabolic profile of brain metastases of different origin using high resolution magic angle spinning (HR-MAS magnetic resonance spectroscopy (MRS to correlate the metabolic profiles to clinical and pathological information. Biopsy samples of human brain metastases (n = 49 were investigated. A significant correlation between lipid signals and necrosis in brain metastases was observed (p < 0.01, irrespective of their primary origin. The principal component analysis (PCA showed that brain metastases from malignant melanomas cluster together, while lung carcinomas were metabolically heterogeneous and overlap with other subtypes. Metastatic melanomas have higher amounts of glycerophosphocholine than other brain metastases. A significant correlation between microscopically visible lipid droplets estimated by Nile Red staining and MR visible lipid signals was observed in metastatic lung carcinomas (p = 0.01, indicating that the proton MR visible lipid signals arise from cytoplasmic lipid droplets. MRS-based metabolomic profiling is a useful tool for exploring the metabolic profiles of metastatic brain tumors.

  15. 3D Terahertz Beam Profiling

    DEFF Research Database (Denmark)

    Pedersen, Pernille Klarskov; Strikwerda, Andrew; Jepsen, Peter Uhd

    2013-01-01

    We present a characterization of THz beams generated in both a two-color air plasma and in a LiNbO3 crystal. Using a commercial THz camera, we record intensity images as a function of distance through the beam waist, from which we extract 2D beam profiles and visualize our measurements into 3D beam...

  16. Lipid profile in cerebrovascular accidents.

    Science.gov (United States)

    Togha, Mansoureh; Gheini, Mohamad Reza; Ahmadi, Babak; Khashaiar, Patricia; Razeghi, Soodeh

    2011-01-01

    Changes in the lipid profile have been suggested as a risk factor for developing ischemic stroke. Their role in intra-cerebral hemorrhage, however, is not clear. The present study was designed to evaluate the lipid profile levels of patients who had experienced an acute stroke during the first 24-hour and to compare these levels in different patients suffering from the stroke, either hemorrhagic or ischemic, and healthy individuals. In this cross-sectional study, 258 consecutive patients with acute stroke admitted to the neurology department of our center during September 2006 and September 2007 were studied. As for the control group, 187 apparently healthy subjects living in the same community and matched for age and sex were selected. Lipid profile was measured and compared between the three groups. In the patients' group, 65 suffered from hemorrhagic stroke (group 1) and the other 193 had ischemic stroke (group 2). Except for TG values, there was no significant difference among the ischemic and hemorrhagic lipid profile. Age, cholesterol, and LDL influenced the risk of developing an ischemic stroke; TG was not reported as a risk factor or a protective one. While the comparison of data retrieved from patients suffering from hemorrhagic strokes with the controls, revealed LDL as the risk factor contributing to the development of ICH whereas TG was reported as a protective factor. It could be concluded that LDL level can be considered as a risk factor for both ischemic and hemorrhagic cerebral events.

  17. Modeling of Changing Electrode Profiles

    Energy Technology Data Exchange (ETDEWEB)

    Prentice, Geoffrey Allen [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Materials and Molecular Research Division; Univ. of California, Berkeley, CA (United States). Dept. of Chemical Engineering

    1980-12-01

    A model for simulating the transient behavior of solid electrodes undergoing deposition or dissolution has been developed. The model accounts for ohmic drop, charge transfer overpotential, and mass transport limitations. The finite difference method, coupled with successive overrelaxation, was used as the basis of the solution technique. An algorithm was devised to overcome the computational instabilities associated with the calculations of the secondary and tertiary current distributions. Simulations were performed on several model electrode profiles: the sinusoid, the rounded corner, and the notch. Quantitative copper deposition data were obtained in a contoured rotating cylinder system, Sinusoidal cross-sections, machined on stainless steel cylinders, were used as model geometries, Kinetic parameters for use in the simulation were determined from polarization curves obtained on copper rotating cylinders, These parameters, along with other physical property and geometric data, were incorporated in simulations of growing sinusoidal profiles. The copper distributions on the sinusoidal cross-sections were measured and found to compare favorably with the simulated results. At low Wagner numbers the formation of a slight depression at the profile peak was predicted by the simulation and observed on the profile. At higher Wagner numbers, the simulated and experimental results showed that the formation of a depression was suppressed. This phenomenon was shown to result from the competition between ohmic drop and electrode curvature.

  18. Cognitive Profile of Turner Syndrome

    Science.gov (United States)

    Hong, David; Kent, Jamie Scaletta; Kesler, Shelli

    2009-01-01

    Turner syndrome (TS) is a relatively common neurogenetic disorder characterized by complete or partial monosomy-X in a phenotypic female. TS is associated with a cognitive profile that typically includes intact intellectual function and verbal abilities with relative weaknesses in visual-spatial, executive, and social cognitive domains. In this…

  19. Country Energy Profile, South Africa

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-08-01

    This country energy profile provides energy and economic information about South Africa. Areas covered include: Economics, demographics, and environment; Energy situation; Energy structure; Energy investment opportunities; Department of Energy (DOE) programs in South Africa; and a listing of International aid to South Africa.

  20. Country Energy Profile, South Africa

    International Nuclear Information System (INIS)

    1995-08-01

    This country energy profile provides energy and economic information about South Africa. Areas covered include: Economics, demographics, and environment; Energy situation; Energy structure; Energy investment opportunities; Department of Energy (DOE) programs in South Africa; and a listing of International aid to South Africa

  1. English Teaching Profile (Provisional): Venezuela.

    Science.gov (United States)

    British Council, London (England). English Language and Literature Div.

    This profile of the English language teaching situation in Venezuela discusses the status of English in society and in the educational system. It also gives an account of Venezuelan political, economic, and social life. A description is given of the education system and reforms that have been proposed for nursery school through higher education.…

  2. The effects of Ankaferd® Blood Stopper on transcription factors in HUVEC and the erythrocyte protein profile

    Directory of Open Access Journals (Sweden)

    Erkan Yılmaz

    2011-12-01

    Full Text Available Objective: Ankaferd® Blood Stopper (ABS is an herbal extract that has historically been used as a hemostatic agent in traditional Turkish medicine. ABS is comprised of a standardized herbal mixture of T. vulgaris, G. glabra, V. vinifera, A. officinarum, and U. dioica. ABS’s basic mechanism of action is the formation of an encapsulated protein web, which represents the focal point for vital erythrocyte masses. The hemostatic effects of ABS have been observed in vitro and in vivo. ABS was registered as a hemostatic agent for external hemorrhages and dental bleeding following phase I randomized, double-blind crossover placebo-controlled clinical research, and safety and efficacy reports. In terms of the potential use of ABS, transcription factors may be novel factors that play a role in the hemostatic and other pleiotropic effects of ABS. Materials and Methods: Hence, the present study aimed to investigate the effects of ABS on endothelium, and possible transcription factor changes in HUVEC (human umbilical vein endothelial cells and the erythrocyte membrane profile. ABS (5 μL and 50 μL was administered to HUVEC (in 75 cm2; ~75% fullness for 5 min and 15 min. Results: ABS caused significant increases in the level of activation of the following transcription factors; AP2, AR, CRE/ATF1, CREB, E2F1-5, E2F6, EGR, GATA, HNF-1, ISRE, Myc-Max, NF-1, NFkB, p53, PPAR, SMAD 2/3, SP1, TRE/AP1, and YY1. Following erythrocyte membrane isolation, protein complexes were undissolved, but denatured. The protein complex formed was resistant to heat and detergent. Trypsin and sonication were used in order to break this complex; the complex dissolved and erythrocyte membrane proteins were released in SDS-PAGE.Conclusion: ABS established a very fast and solid protein web, and increased the level of transcription factor activation. Therefore the cellular effects of ABS could be related to different intracellular biological pathways.

  3. Disturbance of gut satiety peptide in purging disorder.

    Science.gov (United States)

    Keel, Pamela K; Eckel, Lisa A; Hildebrandt, Britny A; Haedt-Matt, Alissa A; Appelbaum, Jonathan; Jimerson, David C

    2018-01-01

    Little is known about biological factors that contribute to purging after normal amounts of food-the central feature of purging disorder (PD). This study comes from a series of nested studies examining ingestive behaviors in bulimic syndromes and specifically evaluated the satiety peptide YY (PYY) and the hunger peptide ghrelin in women with PD (n = 25), bulimia nervosa-purging (BNp) (n = 26), and controls (n = 26). Based on distinct subjective responses to a fixed meal in PD (Keel, Wolfe, Liddle, DeYoung, & Jimerson, ), we tested whether postprandial PYY response was significantly greater and ghrelin levels significantly lower in women with PD compared to controls and women with BNp. Participants completed structured clinical interviews, self-report questionnaires, and laboratory assessments of gut peptide and subjective responses to a fixed meal. Women with PD demonstrated a significantly greater postprandial PYY response compared to women with BNp and controls, who did not differ significantly. PD women also endorsed significantly greater gastrointestinal distress, and PYY predicted gastrointestinal intestinal distress. Ghrelin levels were significantly greater in PD and BNp compared to controls, but did not differ significantly between eating disorders. Women with BNp endorsed significantly greater postprandial hunger, and ghrelin predicted hunger. PD is associated with a unique disturbance in PYY response. Findings contribute to growing evidence of physiological distinctions between PD and BNp. Future research should examine whether these distinctions account for differences in clinical presentation as this could inform the development of specific interventions for patients with PD. © 2017 Wiley Periodicals, Inc.

  4. Effects of targeted delivery of propionate to the human colon on appetite regulation, body weight maintenance and adiposity in overweight adults

    Science.gov (United States)

    Chambers, Edward S; Viardot, Alexander; Psichas, Arianna; Morrison, Douglas J; Murphy, Kevin G; Zac-Varghese, Sagen E K; MacDougall, Kenneth; Preston, Tom; Tedford, Catriona; Finlayson, Graham S; Blundell, John E; Bell, Jimmy D; Thomas, E Louise; Mt-Isa, Shahrul; Ashby, Deborah; Gibson, Glen R; Kolida, Sofia; Dhillo, Waljit S; Bloom, Stephen R; Morley, Wayne; Clegg, Stuart; Frost, Gary

    2015-01-01

    Objective The colonic microbiota ferment dietary fibres, producing short chain fatty acids. Recent evidence suggests that the short chain fatty acid propionate may play an important role in appetite regulation. We hypothesised that colonic delivery of propionate would increase peptide YY (PYY) and glucagon like peptide-1 (GLP-1) secretion in humans, and reduce energy intake and weight gain in overweight adults. Design To investigate whether propionate promotes PYY and GLP-1 secretion, a primary cultured human colonic cell model was developed. To deliver propionate specifically to the colon, we developed a novel inulin-propionate ester. An acute randomised, controlled cross-over study was used to assess the effects of this inulin-propionate ester on energy intake and plasma PYY and GLP-1 concentrations. The long-term effects of inulin-propionate ester on weight gain were subsequently assessed in a randomised, controlled 24-week study involving 60 overweight adults. Results Propionate significantly stimulated the release of PYY and GLP-1 from human colonic cells. Acute ingestion of 10 g inulin-propionate ester significantly increased postprandial plasma PYY and GLP-1 and reduced energy intake. Over 24 weeks, 10 g/day inulin-propionate ester supplementation significantly reduced weight gain, intra-abdominal adipose tissue distribution, intrahepatocellular lipid content and prevented the deterioration in insulin sensitivity observed in the inulin-control group. Conclusions These data demonstrate for the first time that increasing colonic propionate prevents weight gain in overweight adult humans. Trial registration number NCT00750438. PMID:25500202

  5. In situ profiling of eastern Arabian Sea coastal waters using a new autonomous vertical profiler

    Digital Repository Service at National Institute of Oceanography (India)

    Desa, E.S.; Madhan, R.; Dabholkar, N.A.; Prabhudesai, S.P.; Navelkar, G.S.; Mascarenhas, A.A.M.Q.; Afzulpurkar, S.; Phaldesai, M.; Maurya, P.

    The autonomous vertical profiler (AVP) presented here offers a fast, cost-effective, optimized approach to profiling in coastal waters. It consists of a hands-free, slightly buoyant, motor-driven in situ robot profiler that requires no operator...

  6. A Ravenscar-Java profile implementation

    DEFF Research Database (Denmark)

    Thomsen, Bent; Ravn, Anders Peter; Søndergaard, Hans

    2006-01-01

    This paper presents an implementation of the Ravenscar-Java profile. While most implementations of the profile are reference-implementations showing that it is possible to implement the profile, our implementation is aimed at industrial applications. It uses a dedicated real-time Java processor......, since we want to investigate if the Ravenscar-Java profile, implemented on a Java processor, is efficient for real applications. During the implementation some ambiguities and weaknesses of the profile were uncovered. However, test examples indicate that the profile is suitable for development...... of realistic real-time programs....

  7. Electron Density Profile Data Contains Virtual Height/Frequency Pairs from a Profile or Profiles (Composite Months) of Ionograms

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Electron Density Profile, N(h), data set contains both individual profiles and composite months. The data consist of virtual height/frequency pairs from a...

  8. Wind profiler installed in Antarctica

    Science.gov (United States)

    Balsley, B. B.; Carey, J.; Woodman, R. F.; Sarango, M.; Urbina, J.; Rodriguez, R.; Ragaini, E.

    A VHF (50 MHz) wind profiler was installed in Antarctica at the Peruvian Base “Machu Picchu” on King George Island from January 21 to 26. The wind profiler will provide a first look at atmospheric dynamics over the region.The profiler—the first of its kind in Antarctica—is a National Science Foundationsponsored cooperative project of the University of Colorado, the Geophysical Institute of Peru, the University of Piura (Peru), and the Peruvian Navy. This venture was also greatly facilitated by Peru's Comision Nacional de Asuntos Antartidos and Consejo Nacional de Ciencias y Tecnologia, with additional logis tics support provided by the Argentinean Navy and the Uruguayan Air Force.

  9. Molecular profiling of intrahepatic cholangiocarcinoma

    DEFF Research Database (Denmark)

    Oliveira, Douglas V N P; Zhang, Shanshan; Chen, Xin

    2017-01-01

    . Areas covered: The present review article outlines the main studies and resulting discoveries on the molecular profiling of iCCA, with a special emphasis on the different techniques used for this purpose, the diagnostic and prognostic markers identified, as well as the genes and pathways that could......INTRODUCTION: Intrahepatic cholangiocarcinoma (iCCA) is the second most frequent primary tumor of the liver and a highly lethal disease. Therapeutic options for advanced iCCA are limited and ineffective due to the largely incomplete understanding of the molecular pathogenesis of this deadly tumor...... be potentially targeted with innovative therapies. Expert commentary: Molecular profiling has led to the identification of distinct iCCA subtypes, characterized by peculiar genetic alterations and transcriptomic features. Targeted therapies against some of the identified genes are ongoing and hold great promise...

  10. Applications of positron depth profiling

    International Nuclear Information System (INIS)

    Hakvoort, R.A.

    1993-01-01

    In this thesis some contributions of the positron-depth profiling technique to materials science have been described. Following studies are carried out: Positron-annihilation measurements on neon-implanted steel; Void creation in silicon by helium implantation; Density of vacancy-type defects present in amorphous silicon prepared by ion implantation; Measurements of other types of amorphous silicon; Epitaxial cobalt disilicide prepared by cobalt outdiffusion. Positron-annihilation experiments on low-pressure CVD silicon-nitride films. (orig./MM)

  11. Ion temperature profiles in JET

    International Nuclear Information System (INIS)

    Hellermann, M. von; Mandl, W.; Summers, H.P.; Weisen, H.

    1989-01-01

    The results presented in this paper have shown some extreme cases of ion temperature profiles illustrating the different operation modes of the JET tokamak. In the three examples of low-density high temperature, high-density moderates and high-density high-confinement plasmas comparable values of a maximum fusion product n d T i τ E in the order of 10 20 keV m -3 sec are achieved. (author) 1 ref., 7 figs

  12. Metabolite Profiles of Diabetes Risk

    OpenAIRE

    Gerszten, Robert E.

    2013-01-01

    Metabolic diseases present particular difficulty for clinicians because they are often present for years before becoming clinically apparent. We investigated whether metabolite profiles can predict the development of diabetes in the Framingham Heart Study. Five branched-chain and aromatic amino acids had highly-significant associations with future diabetes, while a combination of three amino acids strongly predicted future diabetes by up to 12 years (>5-fold increased risk for individuals in ...

  13. Applications of positron depth profiling

    Energy Technology Data Exchange (ETDEWEB)

    Hakvoort, R A

    1993-12-23

    In this thesis some contributions of the positron-depth profiling technique to materials science have been described. Following studies are carried out: Positron-annihilation measurements on neon-implanted steel; Void creation in silicon by helium implantation; Density of vacancy-type defects present in amorphous silicon prepared by ion implantation; Measurements of other types of amorphous silicon; Epitaxial cobalt disilicide prepared by cobalt outdiffusion. Positron-annihilation experiments on low-pressure CVD silicon-nitride films. (orig./MM).

  14. Projektrapport Delprojekt Rekruttering og Profilering

    DEFF Research Database (Denmark)

    Rosenørn, Torben; Morell, Tove Nørgaard

    2013-01-01

    Denne rapport er udarbejdet som afsluttende projektrapport for delprojektet Rekruttering og profilering (R&P), som i perioden 1.3.2010 til 28.02 2013 har været en del af projektet Energi på havet. Offshore Center Danmark har været projektleder på Energi på havet. Projekt Energi på havet er finans...

  15. Profile updating for information systems

    International Nuclear Information System (INIS)

    Abrantes, J.F.

    1983-02-01

    Profiles updating methods were analysed. A method suitable to the characteristics of the system used in the research (SDI/CIN/CNEN) that uses as the selection criterio the threshold and weights criterion, was determined. Relevance weighting theory was described and experiments to verify precision were carried out. The improvements obtained were good nevertheless more significant tests are required to attain more reliable results. (Author) [pt

  16. Disease Vector Ecology Profile: Ecuador

    Science.gov (United States)

    1998-12-01

    years occurred in Peru in the northern departments bordering Ecuador in 1992-1994. Sylvatic plague is endemic in the southern provinces of Loja and... Ecuador ) Micrurus bocourti (Pacific lowlands of western Ecuador ) Micrurus catamayensis (Catamayo Valley, Loja Province) Micrurus dumerilii spp...Disease Vector Ecology Profile Ecuador -~· ""’ -.. ~ """ Defense Pest Management Information Analysis Center’ Armed Forces Pest Management

  17. UNDERSTANDING CUSTOMERS - PROFILING AND SEGMENTATION

    OpenAIRE

    Mircea Andrei SCRIDON

    2008-01-01

    In any industry, the first step to finding and creating profitable customers isdetermining what drives profitability. This leads to better prospecting andmore successful customer relationship management. Any company cansegment and profile their customer base to uncover those profit drivers usingthe knowledge of their customers, products, and markets. Or they can usedata-driven techniques to find natural clusters in their customer or prospectbase. Whatever the method, the process will lead to ...

  18. Renewable Energy Country Profiles. Pacific

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-09-15

    The IRENA Renewable Energy Country Profiles take stock of the latest development of renewable energy in two regions where renewable energy can make a significant contribution to combat climate change and bring modern energy services to everyone: Africa and the Pacific. These two regions are presented separately in this volume and its sister publication. The country profiles combine elements of IRENA analysis with the latest information available from a vast array of sources in order to give a brief yet comprehensive and up-to-date picture of the situation of renewable energy that includes energy supply, electrical capacity, energy access, policies, targets, investment climate, projects and endowment in renewable energy resources. Because of the different timelines of these sources, data presented here refer to years between 2008 and 2012. Data availability also differs from country to country, which makes comparison with a wider regional group possible only for the year for which figures are available for all the members of the group; while this may not be the most recent year, the differences between countries, regions and the world remain striking. The current country profiles are just a starting point; they will be extended upon with new indicators to make them more informative, and maintained as a live product on the IRENA website as a key source of information on renewable energy.

  19. Kinetic Profiles in NSTX Plasmas

    International Nuclear Information System (INIS)

    Bell, R.E.; LeBlanc, B.P.; Bourdelle, C.; Ernst, D.R.; Fredrickson, E.D.; Gates, D.A.; Hosea, J.C.; Johnson, D.W.; Kaye, S.M.; Maingi, R.; Medley, S.; Menard, J.E.; Mueller, D.; Ono, M.; Paoletti, F.; Peng, M.; Sabbagh, S.A.; Stutman, D.; Swain, D.W.; Synakowski, E.J.; Wilson, J.R.

    2001-01-01

    The National Spherical Torus Experiment (NSTX) is a low aspect ratio (R/a approximately 1.3) device with auxiliary heating from neutral-beam injection (NBI) and high-harmonic fast-wave heating (HHFW). Typical NSTX parameters are R(subscript ''0'') = 85 cm, a = 67 cm, I(subscript ''p'') = 0.7-1.4 MA, B(subscript ''phi'') = 0.25-0.45 T. Three co-directed deuterium neutral-beam sources have injected P(subscript ''NB'') less than or equal to 4.7 MW. HHFW plasmas typically have delivered P(subscript ''RF'') less than or equal to 3 MW. Important to the understanding of NSTX confinement are the new kinetic profile diagnostics: a multi-pulse Thomson scattering system (MPTS) and a charge-exchange recombination spectroscopy (CHERS) system. The MPTS diagnostic currently measures electron density and temperature profiles at 30 Hz at ten spatial locations. The CHERS system has recently become available to measure carbon ion temperature and toroidal flow at 17 radial positions spanning the outer half of the minor radius with 20 msec time resolution during NBI. Experiments conducted during the last year have produced a wide range of kinetic profiles in NSTX. Some interesting examples are presented below

  20. Phytohormone Profiling across the Bryophytes.

    Directory of Open Access Journals (Sweden)

    Lenka Záveská Drábková

    Full Text Available Bryophytes represent a very diverse group of non-vascular plants such as mosses, liverworts and hornworts and the oldest extant lineage of land plants. Determination of endogenous phytohormone profiles in bryophytes can provide substantial information about early land plant evolution. In this study, we screened thirty bryophyte species including six liverworts and twenty-four mosses for their phytohormone profiles in order to relate the hormonome with phylogeny in the plant kingdom.Samples belonging to nine orders (Pelliales, Jungermanniales, Porellales, Sphagnales, Tetraphidales, Polytrichales, Dicranales, Bryales, Hypnales were collected in Central and Northern Bohemia. The phytohormone content was analysed with a high performance liquid chromatography electrospray tandem-mass spectrometry (HPLC-ESI-MS/MS.As revealed for growth hormones, some common traits such as weak conjugation of both cytokinins and auxins, intensive production of cisZ-type cytokinins and strong oxidative degradation of auxins with abundance of a major primary catabolite 2-oxindole-3-acetic acid were pronounced in all bryophytes. Whereas apparent dissimilarities in growth hormones profiles between liverworts and mosses were evident, no obvious trends in stress hormone levels (abscisic acid, jasmonic acid, salicylic acid were found with respect to the phylogeny.The apparent differences in conjugation and/or degradation strategies of growth hormones between liverworts and mosses might potentially show a hidden link between vascular plants and liverworts. On the other hand, the complement of stress hormones in bryophytes probably correlate rather with prevailing environmental conditions and plant survival strategy than with plant evolution.

  1. Renewable Energy Country Profiles. Africa

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-02-15

    The IRENA Renewable Energy Country Profiles take stock of the latest development of renewable energy in two regions where renewable energy can make a significant contribution to combat climate change and bring modern energy services to everyone: Africa and the Pacific. These two regions are presented separately in this volume and its sister publication. The country profiles combine elements of IRENA analysis with the latest information available from a vast array of sources in order to give a brief yet comprehensive and up-to-date picture of the situation of renewable energy that includes energy supply, electrical capacity, energy access, policies, targets, investment climate, projects and endowment in renewable energy resources. Because of the different timelines of these sources, data presented here refer to years between 2008 and 2012. Data availability also differs from country to country, which makes comparison with a wider regional group possible only for the year for which figures are available for all the members of the group; while this may not be the most recent year, the differences between countries, regions and the world remain striking. The current country profiles are just a starting point; they will be extended upon with new indicators to make them more informative, and maintained as a live product on the IRENA website as a key source of information on renewable energy.

  2. State coal profiles, January 1994

    Energy Technology Data Exchange (ETDEWEB)

    1994-02-02

    The purpose of State Coal Profiles is to provide basic information about the deposits, production, and use of coal in each of the 27 States with coal production in 1992. Although considerable information on coal has been published on a national level, there is a lack of a uniform overview for the individual States. This report is intended to help fill that gap and also to serve as a framework for more detailed studies. While focusing on coal output, State Coal Profiles shows that the coal-producing States are major users of coal, together accounting for about three-fourths of total US coal consumption in 1992. Each coal-producing State is profiled with a description of its coal deposits and a discussion of the development of its coal industry. Estimates of coal reserves in 1992 are categorized by mining method and sulfur content. Trends, patterns, and other information concerning production, number of mines, miners, productivity, mine price of coal, disposition, and consumption of coal are detailed in statistical tables for selected years from 1980 through 1992. In addition, coal`s contribution to the State`s estimated total energy consumption is given for 1991, the latest year for which data are available. A US summary of all data is provided for comparing individual States with the Nation as a whole. Sources of information are given at the end of the tables.

  3. DNA Replication Profiling Using Deep Sequencing.

    Science.gov (United States)

    Saayman, Xanita; Ramos-Pérez, Cristina; Brown, Grant W

    2018-01-01

    Profiling of DNA replication during progression through S phase allows a quantitative snap-shot of replication origin usage and DNA replication fork progression. We present a method for using deep sequencing data to profile DNA replication in S. cerevisiae.

  4. Urban logistics profile – Yogyakarta city, Indonesia

    Directory of Open Access Journals (Sweden)

    Maria Sri Asih Anna

    2018-01-01

    Full Text Available In recent years, more rural areas are becoming urban areas accompanied by escalation of logistics activities. Unlike passenger transport, the planning, policy and control of freight transport in developing countries have not been integrated into a reliable and efficient logistics system. Therefore, generating city logistics profile is necessary in order to support the planning of urban logistics system. This study aims to establish a logistics profile of Yogyakarta city, Indonesia, by dividing urban zones into several homogeneous groups, judging from several aspects, including city area features, product characteristics and agents/delivery profile. Logistics profile variables were calculated based on administrative boundaries, resulting in 45 areas to be investigated. Profiles were matched in groups of homogeneous stores (A, large commercial stores (C and residential areas with local trade (D,with one overlapping profile, i.e. profile A and profile D, in some locations in the middle of the city.

  5. On Active Current Selection for Lagrangian Profilers

    Directory of Open Access Journals (Sweden)

    J. Jouffroy

    2013-01-01

    Full Text Available Autonomous Lagrangian profilers are now widely used as measurement and monitoring platforms, notably in observation programs as Argo. In a typical mode of operation, the profilers drift passively at their parking depthbefore making a vertical profile to go back to the surface. This paperpresents simple and computationally-efficient control strategies to activelyselect and use ocean currents so that a profiler can autonomously reach adesired destination. After briefly presenting a typical profiler andpossible mechanical modifications for a coastal environment, we introducesimple mathematical models for the profiler and the currents it will use. Wethen present simple feedback controllers that, using the direction of thecurrents and taking into account the configuration of the environment(coastal or deep-sea, is able to steer the profiler to any desiredhorizontal location. To illustrate the approach, a few results are presentedusing both simulated currents and real current velocity profiles from theNorth Sea.

  6. Salmonella Typhimurium transcription profiles in space flight

    Data.gov (United States)

    National Aeronautics and Space Administration — Salmonella transcription profiles were obtained from samples flown on space shuttle mission STS-115 and compared to profiles from Salmonella grown under identical...

  7. Differential Effects of Two Fermentable Carbohydrates on Central Appetite Regulation and Body Composition

    Science.gov (United States)

    Gibson, Glenn R.; Tuohy, Kieran M.; Sharma, Raj Kumar; Swann, Jonathan R.; Deaville, Eddie R.; Sleeth, Michele L.; Thomas, E. Louise; Holmes, Elaine; Bell, Jimmy D.; Frost, Gary

    2012-01-01

    Background Obesity is rising at an alarming rate globally. Different fermentable carbohydrates have been shown to reduce obesity. The aim of the present study was to investigate if two different fermentable carbohydrates (inulin and β-glucan) exert similar effects on body composition and central appetite regulation in high fat fed mice. Methodology/Principal Findings Thirty six C57BL/6 male mice were randomized and maintained for 8 weeks on a high fat diet containing 0% (w/w) fermentable carbohydrate, 10% (w/w) inulin or 10% (w/w) β-glucan individually. Fecal and cecal microbial changes were measured using fluorescent in situ hybridization, fecal metabolic profiling was obtained by proton nuclear magnetic resonance (1H NMR), colonic short chain fatty acids were measured by gas chromatography, body composition and hypothalamic neuronal activation were measured using magnetic resonance imaging (MRI) and manganese enhanced MRI (MEMRI), respectively, PYY (peptide YY) concentration was determined by radioimmunoassay, adipocyte cell size and number were also measured. Both inulin and β-glucan fed groups revealed significantly lower cumulative body weight gain compared with high fat controls. Energy intake was significantly lower in β-glucan than inulin fed mice, with the latter having the greatest effect on total adipose tissue content. Both groups also showed an increase in the numbers of Bifidobacterium and Lactobacillus-Enterococcus in cecal contents as well as feces. β- glucan appeared to have marked effects on suppressing MEMRI associated neuronal signals in the arcuate nucleus, ventromedial hypothalamus, paraventricular nucleus, periventricular nucleus and the nucleus of the tractus solitarius, suggesting a satiated state. Conclusions/Significance Although both fermentable carbohydrates are protective against increased body weight gain, the lower body fat content induced by inulin may be metabolically advantageous. β-glucan appears to suppress neuronal

  8. Differential effects of two fermentable carbohydrates on central appetite regulation and body composition.

    Directory of Open Access Journals (Sweden)

    Tulika Arora

    Full Text Available Obesity is rising at an alarming rate globally. Different fermentable carbohydrates have been shown to reduce obesity. The aim of the present study was to investigate if two different fermentable carbohydrates (inulin and β-glucan exert similar effects on body composition and central appetite regulation in high fat fed mice.Thirty six C57BL/6 male mice were randomized and maintained for 8 weeks on a high fat diet containing 0% (w/w fermentable carbohydrate, 10% (w/w inulin or 10% (w/w β-glucan individually. Fecal and cecal microbial changes were measured using fluorescent in situ hybridization, fecal metabolic profiling was obtained by proton nuclear magnetic resonance ((1H NMR, colonic short chain fatty acids were measured by gas chromatography, body composition and hypothalamic neuronal activation were measured using magnetic resonance imaging (MRI and manganese enhanced MRI (MEMRI, respectively, PYY (peptide YY concentration was determined by radioimmunoassay, adipocyte cell size and number were also measured. Both inulin and β-glucan fed groups revealed significantly lower cumulative body weight gain compared with high fat controls. Energy intake was significantly lower in β-glucan than inulin fed mice, with the latter having the greatest effect on total adipose tissue content. Both groups also showed an increase in the numbers of Bifidobacterium and Lactobacillus-Enterococcus in cecal contents as well as feces. β-Glucan appeared to have marked effects on suppressing MEMRI associated neuronal signals in the arcuate nucleus, ventromedial hypothalamus, paraventricular nucleus, periventricular nucleus and the nucleus of the tractus solitarius, suggesting a satiated state.Although both fermentable carbohydrates are protective against increased body weight gain, the lower body fat content induced by inulin may be metabolically advantageous. β-Glucan appears to suppress neuronal activity in the hypothalamic appetite centers. Differential

  9. Competency profile of PR professional in sport

    OpenAIRE

    Gazdíková, Lenka

    2013-01-01

    Title: Competency profile of PR professional in sport Objective: The objective is to identify competencies required to a position of PR professional in sport. The aim of a survey is to verify the level of competencies which follows compiling competency profile and comparison with existing profile of PR specialist. Methods: The objective is achieved using survey, interview and analysis of competency models database. Results: The result of this paper is competency profile of PR professional in ...

  10. Acquisition and display of beam profilers

    International Nuclear Information System (INIS)

    David, L.; Duneau, P.; Lecorche, E.; Lermine, P.; Vila, J.; Maugeais, C.; Ulrich, M.

    1995-01-01

    The ion beam adjustment requires the knowledge of its shape (its profile). A new electronic interface has been developed for the older multiwire profiles, while an other electronic equipment has been developed for the gas profiles and the microchannel plates. The data from these interfaces are computed to get numerical values and profile shapes, then transmitted by the network to the main control room to be displayed (shapes and data) on every workstation, by different beam tuning programs. (author)

  11. Computer Profiling Based Model for Investigation

    OpenAIRE

    Neeraj Choudhary; Nikhil Kumar Singh; Parmalik Singh

    2011-01-01

    Computer profiling is used for computer forensic analysis, and proposes and elaborates on a novel model for use in computer profiling, the computer profiling object model. The computer profiling object model is an information model which models a computer as objects with various attributes and inter-relationships. These together provide the information necessary for a human investigator or an automated reasoning engine to make judgments as to the probable usage and evidentiary value of a comp...

  12. Modal Profiles for the WISC-III.

    Science.gov (United States)

    Pritchard, David A.; Livingston, Ronald B.; Reynolds, Cecil R.; Moses, James A., Jr.

    2000-01-01

    Presents a normative typology for classifying the Wechsler Intelligence Scale for Children-Third Edition (WISC-III) factor index profiles according to profile shape. Current analyses indicate that overall profile level accounted for a majority of the variance in WISC-III index scores, but a considerable proportion of the variance was because of…

  13. Professional assessment of facial profile attractiveness.

    Science.gov (United States)

    Soh, Jen; Chew, Ming Tak; Wong, Hwee Bee

    2005-08-01

    The aim of this study was to compare the assessments of Chinese facial profile attractiveness by orthodontists and oral surgeons. The sample comprised 31 dental professionals (20 orthodontists, 11 oral surgeons) in an Asian community. Facial profile photographs and lateral cephalometric radiographs of 2 Chinese adults (1 man, 1 woman) with normal profiles, Class I incisor relationships, and Class I skeletal patterns were digitized. The digital images were modified by altering cephalometric skeletal and dental hard tissue Chinese normative values in increments of 2 standard deviations in the anteroposterior plane to obtain 7 facial profiles for each sex. The images were bimaxillary protrusion, protrusive mandible, retrusive mandible, normal profile (Class I incisor with Class I skeletal pattern), retrusive maxilla, protrusive maxilla, and bimaxillary retrusion. The Mann-Whitney U test was used to determine professional differences in assessment. Multiple regression analysis was performed with age, professional status, sex, and number of years in practice as independent variables. A strong correlation was found in the profile assessment between orthodontists and oral surgeons. Normal and bimaxillary retrusive Chinese male and female profiles were judged to be highly attractive by orthodontists and oral surgeons. Chinese male and female profiles with protrusive mandibles were judged the least attractive. There was a difference in professional opinion about the most attractive male profile (P profile and oral surgeons preferring a fuller normal Chinese profile. Sex of dental professionals and number of years in clinical practice were found to affect profile rankings.

  14. Profiling property criminals in Turkey.

    Science.gov (United States)

    Içli, Tülin Günsen; Seydioğullari, Ibrahim; Tatlidil, Hüseyin; Coban, Sevgi; Sever, Hanifi; Süeroğlu, Unal

    2010-08-01

    The main aim of this research is to develop a profile of a thief. Through a comprehensive survey of property crime suspects arrested in the city of Ankara between 2004 and 2005, the authors have attempted to determine the socioeconomic qualities of those involved in these forms of property crimes. Results of the study show that property crimes are a consequence of low education, lack of occupational skills, and alcohol and drug addiction on the part of the offenders. Because of these factors, theft becomes a way of life for offenders after their first act of property crime.

  15. Profiles in congenital heart disease

    International Nuclear Information System (INIS)

    Freed, M.D.; Keane, J.F.

    1986-01-01

    Pediatric cardiology has made great strides in the diagnosis, management, and correction of complex congenital malformations in the past two decades. The foundation of these advances is a more precise understanding of the physiology and anatomy of complex lesions that has been obtained from cardiac catheterization and angiography. The techniques for catheterization of infants and children have been discussed in another paper. This chapter focuses on brief profiles of some of the more important congenital abnormalities. The incidence cited in the discussion of each abnormality pertains to a population comprises of children and adults referred to The Children's Hospital Medical Center and Peter Bent Brigham Hospital, respectively, for evaluation of congenital heart disease

  16. Positron implantation profile in kapton

    International Nuclear Information System (INIS)

    Plotkowski, K.; Panek, T.J.; Kansj, J.

    1988-01-01

    Measurements of positrons' implantation profile were made with geometry as in the majority of PAT experiments, making use of the difference in values of mean lifetimes of positrons in the absorber and in the detector. The function describing the absorption of positrons in the absorber taking into account measurement geometry was fitted to the experimental data. The correction to the exponential relation occurring in this function is the dominating factor for small thicknesses of the absorber. In this analysis various values of positrons' backscatter coefficients of the nickel and of the kapton were also taken into account

  17. Chemical profiling of gaharu oil

    International Nuclear Information System (INIS)

    Mat Rasol Awang; Mohd Fajri Osman; Ahsanulkhaliqin Abd Wahab; Khairuddin Abdul Rahim; Shaiful Azuar Mohamad

    2006-01-01

    Gaharu oil from Aquilaria agallocha and Aquilaria malaccensis Lamk has been reported to contain different phytochemicals components (Ishihara et al., 1993). There are also differences reported by gaharu oil suppliers. The differences suggested they originate from varied of sources of gaharu wood, oleoresin maturity and extraction technology employed. In this study, gaharu oil purchased from different sources were initially analysed and later cross-examined against chemical components of oil extracted from wood sources systematically graded. The gaharu oil components obtained from this work will be presented and discussed. Initiative to profile oil provides impetus to database development and standardisation of gaharu oil. (Author)

  18. Kognitiv profil hos eldre ledere

    OpenAIRE

    Holth, Torill

    2006-01-01

    Når lederen beveger seg inn i senyrkesfasen ser det ut til at svært mange velger å tre ut av lederstillingen sin. Dette har både personlige og organisasjonsmessige konsekvenser. En liten gruppe ledere over 55 år er studert med hensyn til deres kognitive profil som består av kognitiv kompleksitet, feltuavhengighet, visdom og læringshistorie. De eldste lederne hadde flere av disse egenskapene. Ett felles trekk for samtlige deltakere viste seg å være deres subjektive mestringsforventning. ...

  19. UNDERSTANDING CUSTOMERS - PROFILING AND SEGMENTATION

    Directory of Open Access Journals (Sweden)

    Mircea Andrei SCRIDON

    2008-01-01

    Full Text Available In any industry, the first step to finding and creating profitable customers isdetermining what drives profitability. This leads to better prospecting andmore successful customer relationship management. Any company cansegment and profile their customer base to uncover those profit drivers usingthe knowledge of their customers, products, and markets. Or they can usedata-driven techniques to find natural clusters in their customer or prospectbase. Whatever the method, the process will lead to knowledge andunderstanding that is critical to maintaining a competitive edge

  20. The Microwave Temperature Profiler (PERF)

    Science.gov (United States)

    Lim, Boon; Mahoney, Michael; Haggerty, Julie; Denning, Richard

    2013-01-01

    The JPL developed Microwave Temperature Profiler (MTP) has recently participated in GloPac, HIPPO (I to V) and TORERO, and the ongoing ATTREX campaigns. The MTP is now capable of supporting the NASA Global Hawk and a new canister version supports the NCAR G-V. The primary product from the MTP is remote measurements of the atmospheric temperature at, above and below the flight path, providing for the vertical state of the atmosphere. The NCAR-MTP has demonstrated unprecedented instrument performance and calibration with plus or minus 0.2 degrees Kelvin flight level temperature error. Derived products include curtain plots, isentropes, lapse rate, cold point height and tropopause height.

  1. Shave-off depth profiling: Depth profiling with an absolute depth scale

    International Nuclear Information System (INIS)

    Nojima, M.; Maekawa, A.; Yamamoto, T.; Tomiyasu, B.; Sakamoto, T.; Owari, M.; Nihei, Y.

    2006-01-01

    Shave-off depth profiling provides profiling with an absolute depth scale. This method uses a focused ion beam (FIB) micro-machining process to provide the depth profile. We show that the shave-off depth profile of a particle reflected the spherical shape of the sample and signal intensities had no relationship to the depth. Through the introduction of FIB micro-sampling, the shave-off depth profiling of a dynamic random access memory (DRAM) tip was carried out. The shave-off profile agreed with a blue print from the manufacturing process. Finally, shave-off depth profiling is discussed with respect to resolutions and future directions

  2. Revised Line Profile Function for Hydrogenic Species

    Directory of Open Access Journals (Sweden)

    Sapar A.

    2012-09-01

    Full Text Available Analytical series expansions for the hydrogenic spectral line profile functions are derived starting from the three single expressions, obtained by integrating twice the convolution of the Holtsmark, Lorentz and Doppler line profile functions. We get well converging series expansions for the line wings and centers by reducing the number of arguments in the profile function by one, introducing the module of the Holtsmark and Lorentz profiles as a new argument. In the intermediate part of the line, the parabolic cylinder functions expressed via the confluent hypergeometric series, are used. The multi-component Stark splitting of the hydrogenic spectral lines and the modeled stochastic electron transitions in the electric field of the adjacent ions generate wide Doppler plateaux at the line centers, with the characteristic widths estimated from the fit to the characteristic width of the Holtsmark profile. This additional Doppler broadening of the line profile function removes the central dip typical to the Holtsmark profile.

  3. Scaling laws for TEXT plasma profiles

    International Nuclear Information System (INIS)

    McCool, S.C.; Bravenec, R.V.; Chen, J.Y.; Foster, M.S.; Li, W.L.; Ouroura, A.; Phillips, P.E.; Richards, B.; Wenzel, K.W.; Zhang, Z.M.

    1994-01-01

    Regression analysis has been performed on a number of measured profiles including temperature and density vs. nominal macroscopic operating parameters for TEXT tokamak (pre-upgrade) ohmic plasmas. The resulting simple empirical model has enabled the authors to quickly approximate profiles of electron temperature and density, ion temperature, and soft x-ray brightness, as well as the scalar quantities: total radiated power, q=1 radius, sawtooth period and amplitude, and energy confinement time as a power law of toroidal field, plasma current, chord average density, and fueling gas atomic weight. The model profiles are only applicable to the plasma interior, i.e. within the limiter radius. In most cases the predicted model profiles are within the experimental error bars of measured profiles and are more accurate at predicting profile variation for small operating parameter changes than the measured profiles

  4. PWR AXIAL BURNUP PROFILE ANALYSIS

    International Nuclear Information System (INIS)

    J.M. Acaglione

    2003-01-01

    The purpose of this activity is to develop a representative ''limiting'' axial burnup profile for pressurized water reactors (PWRs), which would encompass the isotopic axial variations caused by different assembly irradiation histories, and produce conservative isotopics with respect to criticality. The effect that the low burnup regions near the ends of spent fuel have on system reactivity is termed the ''end-effect''. This calculation will quantify the end-effects associated with Pressurized Water Reactor (PWR) fuel assemblies emplaced in a hypothetical 21 PWR waste package. The scope of this calculation covers an initial enrichment range of 3.0 through 5.0 wt% U-235 and a burnup range of 10 through 50 GWd/MTU. This activity supports the validation of the process for ensuring conservative generation of spent fuel isotopics with respect to criticality safety applications, and the use of burnup credit for commercial spent nuclear fuel. The intended use of these results will be in the development of PWR waste package loading curves, and applications involving burnup credit. Limitations of this evaluation are that the limiting profiles are only confirmed for use with the B andW 15 x 15 fuel assembly design. However, this assembly design is considered bounding of all other typical commercial PWR fuel assembly designs. This calculation is subject to the Quality Assurance Requirements and Description (QARD) because this activity supports investigations of items or barriers on the Q-list (YMP 2001)

  5. Ayurvedic Profiling of Alzheimer's Disease.

    Science.gov (United States)

    Bredesen, Dale E; Rao, Rammohan V

    2017-05-01

    Alzheimer's disease (AD) is an age-associated, progressive neurodegenerative disease that is characterized by severe memory loss, personality changes, and an overall decline in cognitive function. The cause of AD is not yet completely defined and efforts to find a cure for it have so far been disappointing. AD is one of the most significant health care problems nationally and globally. Recently, we described a personalized therapeutic approach called metabolic enhancement for neurodegeneration (MEND) that successfully reversed the cognitive decline in patients with early AD. The magnitude of the improvement was exceptional, providing testimony to the fact that a personalized and programmatic approach to cognitive decline is highly effective. Ayurveda is a personalized system of traditional medicine native to India and the Indian subcontinent. Although a direct reference to AD in the ancient Ayurvedic literature is missing, concepts including forgetfulness, memory loss, and brain cell loss have been described. Using the clinical information and the metabolic profiling of AD individuals we recently reported using the MEND program, we now describe in this commentary, 3 subtypes of AD based on the Ayurvedic interpretation. Ayurvedic profiling of patients with AD reveals 3 readily distinguishable subtypes, namely Vata, Pitta, and Krimi, which will prove useful in patients with cognitive decline and those at risk for such decline from the standpoint of specific subtype-based Ayurvedic intervention.

  6. Psychological profile of laryngectomized patients

    Directory of Open Access Journals (Sweden)

    Bogdan Popescu

    2016-04-01

    Full Text Available Larynx cancer is one of the most susceptible form of cancer susceptible to induce alteration of the patient’s psychological profile due to the social role that the larynx has in communication. Oral communication is severely impaired even after voice rehabilitation of the laryngectomized patients, so that the social rehabilitation is somewhat not only a medical but also a social problem. The psychological profile of these patients is altered in a way that dealing with the disease is sometimes neglected and the interaction with the outside world in terms of oral communication is totally abandoned. The starting point for depression in these cases is the acknowledgement of the disease and is, in some cases, the entire medical environment. Facial scarring, the inability to verbally interact with other human, as well as the presence of the tracheostoma, are all deciding factors in the presence of a low self-esteem for these particular patients. Psychological counseling is a mandatory approach for laryngectomized patients, in order to improve their ability to cope with cancer and providing better recovery chances.

  7. Geographic profiling and animal foraging.

    Science.gov (United States)

    Le Comber, Steven C; Nicholls, Barry; Rossmo, D Kim; Racey, Paul A

    2006-05-21

    Geographic profiling was originally developed as a statistical tool for use in criminal cases, particularly those involving serial killers and rapists. It is designed to help police forces prioritize lists of suspects by using the location of crime scenes to identify the areas in which the criminal is most likely to live. Two important concepts are the buffer zone (criminals are less likely to commit crimes in the immediate vicinity of their home) and distance decay (criminals commit fewer crimes as the distance from their home increases). In this study, we show how the techniques of geographic profiling may be applied to animal data, using as an example foraging patterns in two sympatric colonies of pipistrelle bats, Pipistrellus pipistrellus and P. pygmaeus, in the northeast of Scotland. We show that if model variables are fitted to known roost locations, these variables may be used as numerical descriptors of foraging patterns. We go on to show that these variables can be used to differentiate patterns of foraging in these two species.

  8. New dynamic NNORSY ozone profile climatology

    Science.gov (United States)

    Kaifel, A. K.; Felder, M.; Declercq, C.; Lambert, J.-C.

    2012-01-01

    Climatological ozone profile data are widely used as a-priori information for total ozone using DOAS type retrievals as well as for ozone profile retrieval using optimal estimation, for data assimilation or evaluation of 3-D chemistry-transport models and a lot of other applications in atmospheric sciences and remote sensing. For most applications it is important that the climatology represents not only long term mean values but also the links between ozone and dynamic input parameters. These dynamic input parameters should be easily accessible from auxiliary datasets or easily measureable, and obviously should have a high correlation with ozone. For ozone profile these parameters are mainly total ozone column and temperature profile data. This was the outcome of a user consultation carried out in the framework of developing a new, dynamic ozone profile climatology. The new ozone profile climatology is based on the Neural Network Ozone Retrieval System (NNORSY) widely used for ozone profile retrieval from UV and IR satellite sounder data. NNORSY allows implicit modelling of any non-linear correspondence between input parameters (predictors) and ozone profile target vector. This paper presents the approach, setup and validation of a new family of ozone profile climatologies with static as well as dynamic input parameters (total ozone and temperature profile). The neural network training relies on ozone profile measurement data of well known quality provided by ground based (ozonesondes) and satellite based (SAGE II, HALOE, and POAM-III) measurements over the years 1995-2007. In total, four different combinations (modes) for input parameters (date, geolocation, total ozone column and temperature profile) are available. The geophysical validation spans from pole to pole using independent ozonesonde, lidar and satellite data (ACE-FTS, AURA-MLS) for individual and time series comparisons as well as for analysing the vertical and meridian structure of different modes of

  9. THE BEHAVIORAL PROFILE OF HARVESTER OPERATORS

    Directory of Open Access Journals (Sweden)

    Millana Burger Pagnussat

    Full Text Available ABSTRACT This study aims to characterize the behavioral profile of harvester operators, with the goal of assisting forest managers in selecting and training new teams of employees. A forest company located in central-western Brazil was examined from a sample of 20 harvester operators that did not have experience carrying out the functions of their industry. A behavioral profile evaluation tool was used, consisting of a management system that creates a profile based on behavioral competencies; it was initially used to develop a profile of a high-performing harvester operator; or rather, a reference profile. Next, the behavioral profile of the operators were grouped into distinct classes and compared with the reference profile to identify traits that could positively or negatively affect an operators' performance. An optimal profile had the following qualities: attentive to details, meets deadlines and follows rules, technically-oriented, patient with repetitive tasks, the ability to avoid conflicts, and being an introvert. An improper profile included aspects such as aggressiveness, being argumentative, being persuasive, explosive, and tense at work. The behavioral profile evaluation tool can support the process of choosing forest machine operators; however, it is important to also consider skills and work experience.

  10. Q-profiles in JET

    International Nuclear Information System (INIS)

    Gill, R.D.; Edwards, A.W.; Keegan, B.; Lazzaro, E.; O'Rourke, J.; Weller, A.; Zasche, D.

    1989-01-01

    Tokamak q-profiles play a central role in the determination of plasma stability and q(r) towards the plasma centre is particularly important for the sawtooth instability. On JET, q(r) has been determined from magnetic measurements and Faraday rotation. Further information about the position of the q=1 surface has been found from the sawtooth inversion radius, the position of the snake and the resonance effect observed on visible light and X-ray emission during pellet injection. In addition the shear at the q=1 surface has been measured from pellet ablation. This result is supported by the movement of the snake caused by a sawtooth crash. A summary of these data will be made after presenting the new results from pellet ablation. (author) 5 refs., 8 figs

  11. Career profiles in the oilsands

    Energy Technology Data Exchange (ETDEWEB)

    Ball, C.G.

    2009-07-15

    This career profile provided details of the owner of Detector Dog Services International, a company that uses trained dogs to detect drugs in oil and gas operations. When drugs are detected, the camp manager is informed, and personnel are then required to complete a rehabilitation program. Belgian shepherds, Labrador retrievers, and springer spaniels are used. The dogs are sometimes selected from the local animal protection service and are trained using kits containing controlled substances used by Health Canada for drug detector training purposes. The dogs are typically trained for a period of 4 weeks. It was concluded that a knowledge of law and human rights is required for personnel interested in drug detection careers. Individuals with law enforcement backgrounds are also preferred. 1 fig.

  12. Learning profiles of Master students

    DEFF Research Database (Denmark)

    Sprogøe, Jonas; Hemmingsen, Lis

    2005-01-01

    at DPU in 2001 several evaluations and research have been carried out on several topics relating to form, content, and didactics, but one important focus is missing: the research about the psychological profile and learning style of the master student. Knowledge is lacking on how teaching methods......Master education as a part of lifelong learning/education has over the last years increased in Denmark. Danish Universities now offer more than110 different programmes. One of the characteristics of the master education is that the students get credits for their prior learning and practical work...... experiences, and during the study/education theory and practise is combined. At the Master of Adult Learning and Human Resource Development, one of DPU´s master programmes, the students have a very diverse background and have many different experiences and practises. Since the first programme was introduced...

  13. Physiologic profile of professional cricketers.

    Science.gov (United States)

    Johnstone, James A; Ford, Paul A

    2010-11-01

    This study aims to provide a physiologic profile of professional cricketers and note positional differences at the start of the 2007/08 competitive season. Fifteen participants (9 bowlers, 6 batsmen) aged 25.0 ± 5.0 years (mean ± SD) took part in this study. Participants (bowlers and batsmen) completed a series of field-based fitness assessments: body composition (sum of 7 skinfolds, 72.5 ± 16.5 and 65.5 ± 19.3 mm, respectively), flexibility (sit and reach 8.1 ± 10.3 and 6.0 ± 6.2 cm, respectively), predicted maximal oxygen uptake (multistage shuttle run, 54.1 ± 2.8 and 56.1 ± 4.5 ml-1·kg-1·min-1, respectively), upper- (medicine ball throw, 7.7 ± 0.6 and 7.0 ± 0.1 m, respectively) and lower-body strength (countermovement jump, 45.7 ± 5.8 and 43.9 ± 4.1 cm, respectively), speed (sprint 17.7 m, 2.76 ± 0.6 and 2.77 ± 0.1 s, respectively), and explosive power (repeated jump, 31.0 ± 2.0 and 34.1 ± 4.8 cm, respectively). The data provided the physical fitness profile for each player, which, compared with normative data, identified that this cohort of professional cricketers had some superior fitness parameters compared with the general population, and where applicable, were comparable with other professional athletes. In addition, after effect size calculations, the results showed that some physical fitness differences existed between playing positions. Cricket professionals possess a superior level of physical fitness and strength, and conditioning coaches should seek to progress these physical parameters and further identify position-specific physical requirements to progress the modern game.

  14. Free Sugar Profile in Cycads

    Directory of Open Access Journals (Sweden)

    Thomas Edward Marler

    2014-10-01

    Full Text Available The sugars fructose, glucose, maltose, and sucrose were quantified in seven tissues of Zamia muricata Willd. to determine their distribution throughout various organs of a model cycad species, and in lateral structural roots of 18 cycad species to determine the variation in sugar concentration and composition among species representing every cycad genus. Taproot and lateral structural roots contained more sugars than leaf, stem, female strobilus, or coralloid roots. For example, taproot sugar concentration was 6.4-fold greater than stem sugar concentration. The dominant root sugars were glucose and fructose, and the only detected stem sugar was sucrose. Sucrose also dominated the sugar profile for leaflet and coralloid root tissue, and fructose was the dominant sugar in female strobilus tissue. Maltose was a minor constituent of taproot, leaflet, and female strobilus tissue, but absent in other tissues. The concentration of total free sugars and each of the four sugars did not differ among genera or families. Stoichiometric relationships among the sugars, such as the quotient hexoses/disaccharides, differed among organs and families. Although anecdotal reports on cycad starch have been abundant due to its historical use as human food and the voluminous medical research invested into cycad neurotoxins, this is the first report on the sugar component of the non-structural carbohydrate profile of cycads. Fructose, glucose, and sucrose are abundant in cycad tissues, with their relative abundance highly contrasting among organs. Their importance as forms of carbon storage, messengers of information, or regulators of cycad metabolism have not been determined to date.

  15. The Genetic Activity Profile database.

    Science.gov (United States)

    Waters, M D; Stack, H F; Garrett, N E; Jackson, M A

    1991-12-01

    A graphic approach termed a Genetic Activity Profile (GAP) has been developed to display a matrix of data on the genetic and related effects of selected chemical agents. The profiles provide a visual overview of the quantitative (doses) and qualitative (test results) data for each chemical. Either the lowest effective dose (LED) or highest ineffective dose (HID) is recorded for each agent and bioassay. Up to 200 different test systems are represented across the GAP. Bioassay systems are organized according to the phylogeny of the test organisms and the end points of genetic activity. The methodology for the production and evaluation of GAPs has been developed in collaboration with the International Agency for Research on Cancer. Data on individual chemicals have been compiled by IARC and by the U.S. Environmental Protection Agency. Data are available on 299 compounds selected from volumes 1-50 of the IARC Monographs and on 115 compounds identified as Superfund Priority Substances. Software to display the GAPs on an IBM-compatible personal computer is available from the authors. Structurally similar compounds frequently display qualitatively and quantitatively similar GAPs. By examining the patterns of GAPs of pairs and groups of chemicals, it is possible to make more informed decisions regarding the selection of test batteries to be used in evaluating chemical analogs. GAPs have provided useful data for the development of weight-of-evidence hazard ranking schemes. Also, some knowledge of the potential genetic activity of complex environmental mixtures may be gained from assessing the GAPs of component chemicals. The fundamental techniques and computer programs devised for the GAP database may be used to develop similar databases in other disciplines.

  16. Appetite Regulatory Hormones in Women With Anorexia Nervosa: Binge-Eating/Purging Versus Restricting Type

    Science.gov (United States)

    Eddy, Kamryn T.; Lawson, Elizabeth A.; Meade, Christina; Meenaghan, Erinne; Horton, Sarah E.; Misra, Madhusmita; Klibanski, Anne; Miller, Karen K.

    2015-01-01

    Objective Anorexia nervosa is a psychiatric illness characterized by low weight, disordered eating, and hallmark neuroendocrine dysfunction. Behavioral phenotypes are defined by predominant restriction or bingeing/purging; binge-eating/purging type anorexia nervosa is associated with poorer outcome. The pathophysiology underlying anorexia nervosa types is unknown, but altered hormones, known to be involved in eating behaviors, may play a role. Method To examine the role of anorexigenic hormones in anorexia nervosa subtypes, we examined serum levels of peptide YY (PYY; total and active [3-36] forms), brain-derived neurotrophic factor (BDNF), and leptin as primary outcomes in women with OSM-5 restricting type anorexia nervosa (n=50), binge-eating/purging type anorexia nervosa (n = 22), and healthy controls (n = 22).1n addition, women completed validated secondary outcome measures of eating disorder psychopathology (Eating Disorder Examination-Questionnaire) and depression and anxiety symptoms (Hamilton Rating Scales for Depression [HDRS] and Anxiety [HARS]). The study samples were collected from May 22, 2004, to February 7, 2012. Results Mean PYY 3-36 and leptin levels were lower and BDNF levels higher in binge-eating/purging type anorexia nervosa than in restricting type anorexia nervosa (all Pvalues anorexia nervosa types were significant (Panorexia nervosa, the anorexigenic hormones PYY, BDNF, and leptin are differentially regulated between the restricting and binge/purge types. Whether these hormone pathways play etiologic roles with regard to anorexia nervosa behavioral types or are compensatory merits further study. PMID:25098834

  17. SNP analyses of postprandial responses in (an)orexigenic hormones and feelings of hunger reveal long-term physiological adaptations to facilitate homeostasis.

    Science.gov (United States)

    den Hoed, M; Smeets, A J P G; Veldhorst, M A B; Nieuwenhuizen, A G; Bouwman, F G; Heidema, A G; Mariman, E C M; Westerterp-Plantenga, M S; Westerterp, K R

    2008-12-01

    The postprandial responses in (an)orexigenic hormones and feelings of hunger are characterized by large inter-individual differences. Food intake regulation was shown earlier to be partly under genetic control. This study aimed to determine whether the postprandial responses in (an)orexigenic hormones and parameters of food intake regulation are associated with single nucleotide polymorphisms (SNPs) in genes encoding for satiety hormones and their receptors. Peptide YY (PYY), glucagon-like peptide 1 and ghrelin levels, as well as feelings of hunger and satiety, were determined pre- and postprandially in 62 women and 41 men (age 31+/-14 years; body mass index 25.0+/-3.1 kg/m(2)). Dietary restraint, disinhibition and perceived hunger were determined using the three-factor eating questionnaire. SNPs were determined in the GHRL, GHSR, LEP, LEPR, PYY, NPY, NPY2R and CART genes. The postprandial response in plasma ghrelin levels was associated with SNPs in PYY (215G>C, PG and 688A>G, PGHRL (-501A>C, PA, PG and 585T>C, PA, PA and 204T>C, P<0.05). Part of the inter-individual variability in postprandial responses in (an)orexigenic hormones can be explained by genetic variation. These postprandial responses represent either long-term physiological adaptations to facilitate homeostasis or reinforce direct genetic effects.

  18. Effect of aerobic exercise on hunger feelings and satiety regulating hormones in obese teenage girls.

    Science.gov (United States)

    Prado, Wagner L; Balagopal, P Babu; Lofrano-Prado, Mara C; Oyama, Lila M; Tenório, Thiago Ricardo; Botero, João Paulo; Hill, James O

    2014-11-01

    Exercise is implicated in modifying subsequent energy intake (EI) through alterations in hunger and/or satiety hormones. Our aim was to examine the effects of aerobic exercise on hunger, satiety regulatory peptides, and EI in obese adolescents. Nine obese girls (age: 13-18 years old, BMI: 33.74 ± 4.04 kg/m2) participated in this randomized controlled crossover study. Each participant randomly underwent 2 experimental protocols: control (seated for 150 min) and exercise (exercised for 30 min on a treadmill performed at ventilatory threshold [VT] intensity and then remained seated for 120 min). Leptin, peptide YY(3-36) (PYY(3-36)), and subjective hunger were measured at baseline as well as 30 min and 150 min, followed by 24-hr EI measurement. Exercise session resulted in an acute increase in PYY(3-36) (p hunger scores. The control session increased hunger scores (p < .01) and decreased circulating leptin levels (p = .03). There was a strong effect size for carbohydrate intake (d = 2.14) and a modest effect size for protein intake (d = 0.61) after the exercise compared with the control session. Exercise performed at VT intensity in this study appears to provoke a state of transient anorexia in obese girls. These changes may be linked to an increase in circulating PYY3-36 and maintenance of leptin levels.

  19. Effects of different modes of exercise on appetite and appetite-regulating hormones.

    Science.gov (United States)

    Kawano, Hiroshi; Mineta, Mayuko; Asaka, Meiko; Miyashita, Masashi; Numao, Shigeharu; Gando, Yuko; Ando, Takafumi; Sakamoto, Shizuo; Higuchi, Mitsuru

    2013-07-01

    The present study determined the changes in appetite and appetite-regulating gut hormones during and following bouts of both rope skipping exercise (weight-bearing) and bicycle ergometer exercise (non-weight-bearing). After a 12-h fast, 15 young men (mean ± SD, age 24.4 ± 1.7 yrs, maximal oxygen uptake 47.0 ± 6.5 mL/kg/min) participated in three 160 min trials: (1) rope skipping exercise (295 ± 40 kcal, 3 sets × 10 min with 5-min interval, then rested for 120 min); (2) bicycle ergometer exercise (288 ± 36 kcal, 3 sets × 10 min with 5-min interval, then rested for 120 min); (3) control (rested for 160 min). Ratings of perceived hunger and acylated ghrelin were suppressed and total peptide YY (PYY) were increased during and immediately after exercise in both exercise trials, but glucagon liked peptide-1 was not changed. Furthermore, suppressed hunger during rope skipping exercise was greater than that during bicycle ergometer exercise, but there were no differences in acylated ghrelin and total PYY. These results indicate that weight-bearing exercise has a greater exercise-induced appetite suppressive effect compared with non-weight-bearing exercise, and both forms of exercise lowered acylated ghrelin and increased total PYY, but the changes did not differ significantly between exercise modes. Copyright © 2013 Elsevier Ltd. All rights reserved.

  20. Beam profile monitors in the NLCTA

    International Nuclear Information System (INIS)

    Nantista, C.; Adolphsen, C.; Brown, R.L.; Fuller, R.; Rifkin, J.

    1997-05-01

    The transverse current profile in the Next Linear Collider Test Accelerator (NLCTA) electron beam can be monitored at several locations along the beam line by means of profile monitors. These consist of insertable phosphor screens, light collection and transport systems, CID cameras, a frame-grabber, and PC and VAX based image analysis software. In addition to their usefulness in tuning and steering the accelerator, the profile monitors are utilized for emittance measurement. A description of these systems and their performance is presented

  1. A statistical approach to plasma profile analysis

    International Nuclear Information System (INIS)

    Kardaun, O.J.W.F.; McCarthy, P.J.; Lackner, K.; Riedel, K.S.

    1990-05-01

    A general statistical approach to the parameterisation and analysis of tokamak profiles is presented. The modelling of the profile dependence on both the radius and the plasma parameters is discussed, and pertinent, classical as well as robust, methods of estimation are reviewed. Special attention is given to statistical tests for discriminating between the various models, and to the construction of confidence intervals for the parameterised profiles and the associated global quantities. The statistical approach is shown to provide a rigorous approach to the empirical testing of plasma profile invariance. (orig.)

  2. On active current selection for Lagrangian profilers

    DEFF Research Database (Denmark)

    Jouffroy, Jerome; Zhou, Qiuyang; Zielinski, Oliver

    2013-01-01

    simple and computationally-efficient control strategies to actively select and use ocean currents so that a profiler can autonomously reach a desired destination. After briefly presenting a typical profiler and possible mechanical modifications for a coastal environment, we introduce simple mathematical...... models for the profiler and the currents it will use. We then present simple feedback controllers that, using the direction of the currents and taking into account the configuration of the environment (coastal or deep-sea), is able to steer the profiler to any desired horizontal location. To illustrate...

  3. Adaptive User Profiles in Pervasive Advertising Environments

    Science.gov (United States)

    Alt, Florian; Balz, Moritz; Kristes, Stefanie; Shirazi, Alireza Sahami; Mennenöh, Julian; Schmidt, Albrecht; Schröder, Hendrik; Goedicke, Michael

    Nowadays modern advertising environments try to provide more efficient ads by targeting costumers based on their interests. Various approaches exist today as to how information about the users' interests can be gathered. Users can deliberately and explicitly provide this information or user's shopping behaviors can be analyzed implicitly. We implemented an advertising platform to simulate an advertising environment and present adaptive profiles, which let users setup profiles based on a self-assessment, and enhance those profiles with information about their real shopping behavior as well as about their activity intensity. Additionally, we explain how pervasive technologies such as Bluetooth can be used to create a profile anonymously and unobtrusively.

  4. Triton burnup in JET - profile effects

    International Nuclear Information System (INIS)

    Jarvis, O.N.; Conroy, S.W.; Marcus, F.B.; Sadler, G.J.; Belle, P. van

    1991-01-01

    Measurements of the 14 MeV neutron emission from triton burnup show that the 14 MeV emission profile shadows closely the 2,5 MeV profile but after a delay corresponding to the triton slowing down time. The slightly greater width of the 14 MeV neutron profile is a consequence of the finite Larmor radius of the tritons. It has not so far been possible to identify unambiguously any effects on the triton burnup that are attributable to sawtooth crashes. Finally, the time dependence of the triton profile indicates that the triton diffusion coefficient is very small ( 2 /s). (author) 4 refs., 3 figs

  5. Comparison of rapid descriptive sensory methodologies: Free-Choice Profiling, Flash Profile and modified Flash Profile.

    Science.gov (United States)

    Liu, Jing; Bredie, Wender L P; Sherman, Emma; Harbertson, James F; Heymann, Hildegarde

    2018-04-01

    Rapid sensory methods have been developed as alternatives to traditional sensory descriptive analysis methods. Among them, Free-Choice Profiling (FCP) and Flash Profile (FP) are two that have been known for many years. The objectives of this work were to compare the rating-based FCP and ranking-based FP method; to evaluate the impact of adding adjustments to FP approach; to investigate the influence of the number of assessors on the outcome of modified FP. To achieve these aims, a conventional descriptive analysis (DA), FCP, FP and a modified version of FP were carried out. Red wines made by different grape maturity and ethanol concentration were used for sensory testing. This study showed that DA provided a more detailed and accurate information on products through a quantitative measure of the intensity of sensory attributes than FCP and FP. However, the panel hours for conducting DA were higher than that for rapid methods, and FP was even able to separate the samples to a higher degree than DA. When comparing FCP and FP, this study showed that the ranking-based FP provided a clearer separation of samples than rating-based FCP, but the latter was an easier task for most assessors. When restricting assessors on their use of attributes in FP, the sample space became clearer and the ranking task was simplified. The FP protocol with restricted attribute sets seems to be a promising approach for efficient screening of sensory properties in wine. When increasing the number of assessors from 10 to 20 for conducting the modified FP, the outcome tended to be slightly more stable, however, one should consider the degree of panel training when deciding the optimal number of assessors for conducting FP. Copyright © 2018 Elsevier Ltd. All rights reserved.

  6. Temperature profile data from profiling drifter in the Indian, Southern, and Pacific Ocean (NODC Accession 9700028)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected using the ALACE (Autonomous LAgrangian Circulation Explorer), which is a profiling drifter in the Indian, Southern, and...

  7. Shock compression profiles in ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Grady, D.E.; Moody, R.L.

    1996-03-01

    An investigation of the shock compression properties of high-strength ceramics has been performed using controlled planar impact techniques. In a typical experimental configuration, a ceramic target disc is held stationary, and it is struck by plates of either a similar ceramic or by plates of a well-characterized metal. All tests were performed using either a single-stage propellant gun or a two-stage light-gas gun. Particle velocity histories were measured with laser velocity interferometry (VISAR) at the interface between the back of the target ceramic and a calibrated VISAR window material. Peak impact stresses achieved in these experiments range from about 3 to 70 GPa. Ceramics tested under shock impact loading include: Al{sub 2}O{sub 3}, AlN, B{sub 4}C, SiC, Si{sub 3}N{sub 4}, TiB{sub 2}, WC and ZrO{sub 2}. This report compiles the VISAR wave profiles and experimental impact parameters within a database-useful for response model development, computational model validation studies, and independent assessment of the physics of dynamic deformation on high-strength, brittle solids.

  8. Motivational profile quality players handball

    Directory of Open Access Journals (Sweden)

    Alfonso Martínez Moreno

    2017-06-01

    Full Text Available In the sport context, elite category, it is necessary to know all the factors, which in one way or another, affect the athletes throughout the different competitions. The object of study is to know the motivational profile of elite handball players. The sample consisted of 495 players, of whom 47.8% were boys and 52.2% girls, their ages ranged from 12 to 16 years, with an average of 13.8 years (dt = 1.0. Descriptive statistical analyzes of the sample, absolute and relative frequencies were performed for the qualitative variables and for the quantitative values minimum, maximum, mean, standard deviation, Cronbach's alpha. Correlation between variables, with the Pearson correlation coefficient. The MANCOVA test was performed to determine if there were differences between the dimensions of the questionnaire, according to age and years of practice. The results reveal that handball players elite category of the sample object of study have mainly intrinsic motivation, achieving high scores on general motivation, motivation achievement and motivation stimulation. In addition to moderately high values in introjected regulation and very low values in demotivation.

  9. Childhood vitiligo: Clinical epidemiological profile

    Directory of Open Access Journals (Sweden)

    Asmae Lahlou

    2017-07-01

    Full Text Available Objective: To study the clinical and the epidemiologic profiles of childhood vitiligo. Patients and Methods: We prospectively analyzed the clinical data of children with vitiligo presented to the dermatology derpartement at University Hospital – Fès for 5 years from May 2011 to May 2016. This study included 31 patients. All patients were assessed for the natural history, clinical characteristics, family history, and associated abnormalities of vitiligo. Results: Of the 31 children with vitiligo 9 (29,03% were boys and 21 (67.74% were girls. The mean age of onset of the vitiligo was 10 years. The mean duration of the disease was 38,9 weeks. The most common type of vitiligo was vitiligo vulgaris (49.5% followed by focal vitiligo (39%, acrofacial vitiligo (32%, and segmental vitiligo (16% The most frequent site of onset was the extremities followed by the head and the neck, then the trunk and the genitalia. Of the 31 children with vitiligo, 39% had a family history and 4 % had an antecedent of autoimmune diesease like le diabète, une thyroïdite, l’anémie et le psoriasis, retrouvé. Conclusion: Our children have a strong family history of vitiligo and they are developing the disease at a slightly older age compared with those of other studies; however, other epidemiologic features appear to be similar to those reported in the previously published studies.

  10. Doing Business Economy Profile 2015 : Honduras

    OpenAIRE

    World Bank Group

    2014-01-01

    This economy profile for Doing Business 2015 presents the 11 Doing Business indicators for Honduras. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2015 is the 12th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain it. ...

  11. Doing Business Economy Profile 2015 : Singapore

    OpenAIRE

    World Bank Group

    2014-01-01

    This economy profile for Doing Business 2015 presents the 11 Doing Business indicators for Singapore. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2015 is the 12th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain it....

  12. Doing Business Economy Profile 2015 : Venezuela, RB

    OpenAIRE

    World Bank Group

    2014-01-01

    This economy profile for Doing Business 2015 presents the 11 Doing Business indicators for Venezuela RB. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2015 is the 12th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain ...

  13. Doing Business Economy Profile 2015 : Iceland

    OpenAIRE

    World Bank Group

    2014-01-01

    This economy profile for Doing Business 2015 presents the 11 Doing Business indicators for Iceland. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2015 is the 12th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain it. E...

  14. Doing Business Economy Profile 2015 : Grenada

    OpenAIRE

    World Bank Group

    2014-01-01

    This economy profile for Doing Business 2015 presents the 11 Doing Business indicators for Grenada. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2015 is the 12th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain it. E...

  15. Doing Business Economy Profile 2015 : Ethiopia

    OpenAIRE

    World Bank Group

    2014-01-01

    This economy profile for Doing Business 2015 presents the 11 Doing Business indicators for Ethiopia. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2015 is the 12th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain it. ...

  16. Doing Business Economy Profile 2015 : Slovak Republic

    OpenAIRE

    World Bank Group

    2014-01-01

    This economy profile for Doing Business 2015 presents the 11 Doing Business indicators for Slovak Republic. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2015 is the 12th edition in a series of annual reports measuring the regulations that enhance business activity and those that constra...

  17. Hilson Adolescent Profile (HAP): Hilson Research Abstracts.

    Science.gov (United States)

    Hilson Research Inc., Kew Gardens, NY.

    Abstracts and bibliographic citations are given for the following documents concerned with the use and characteristics of the Hilson Adolescent Profile (HAP): (1) "Use of the Hilson Adolescent Profile To Compare Juvenile Offenders with Junior and Senior High School Students" (R. E. Inwald and K. E. Brobst); (2) "The Effectiveness of…

  18. Refactoring Real-Time Java Profiles

    DEFF Research Database (Denmark)

    Søndergaard, Hans; Thomsen, Bent; Ravn, Anders Peter

    2011-01-01

    Just like other software, Java profiles benefits from refactoring when they have been used and have evolved for some time. This paper presents a refactoring of the Real-Time Specification for Java (RTSJ) and the Safety Critical Java (SCJ) profile (JSR-302). It highlights core concepts and makes...

  19. Profiles and Context for Structured Text Retrieval

    DEFF Research Database (Denmark)

    Koolen, Marijn; Bogers, Toine

    2017-01-01

    The combination of structured information retrieval with user profile information represents the scenario where systems search with an explicit statement of the information need—a search query—as well as a profile of a user, which can contain information about previous interactions, search histor...

  20. Plasma profile recovery by function parameterisation

    International Nuclear Information System (INIS)

    McCarthy, P.J.; Sexton, M.C.

    1986-11-01

    The use of Function Parameterisation for the recovery of plasma profiles as a function of flux surface area from spatial point data directly combined with external magnetic measurements is demonstrated in the case of ASDEX electron temperature and density profiles. The extrapolated temperature on the magnetic axis is shown to be more reliable than that obtained from a conventional fitting procedure. (orig.)

  1. Current density profile evolution in JET

    International Nuclear Information System (INIS)

    Stubberfield, P.M.; Balet, B.; Campbell, D.; Challis, C.D.; Cordey, J.G.; O'Rourke, J.; Hammett, G.; Schmidt, G.L.

    1989-01-01

    Simulation studies have been made of the current density profile evolution in discharges where the bootstrap current is expected to be significant. The changes predicted in the total current profile have been confirmed by comparison with experimental results. (author) 8 refs., 6 figs

  2. Doing Business Economy Profile 2016 : Australia

    OpenAIRE

    World Bank Group

    2015-01-01

    This economy profile for Doing Business 2016 presents the 11 Doing Business indicators for Australia. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2016 is the 13th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain it....

  3. Modelling of the urban wind profile

    DEFF Research Database (Denmark)

    Gryning, Sven-Erik; Batchvarova, Ekaterina

    2008-01-01

    Analysis of meteorological measurements from tall masts in rural and urban areas show that the height of the boundary layer influences the wind profile even in the lowest hundreds of meters. A parameterization of the wind profile for the entire boundary layer is formulated with emphasis on the lo...

  4. Educational and Demographic Profile: Mariposa County.

    Science.gov (United States)

    California Postsecondary Education Commission, 2004

    2004-01-01

    This profile uniquely presents a variety of educational and socioeconomic information for Mariposa County, nearby counties, and the state. The profile highlights the relationship between various factors that affect the economic well-being of individuals and communities. This presentation of information provides a framework for enhanced…

  5. Doing Business Economy Profile 2016 : Uruguay

    OpenAIRE

    World Bank Group

    2015-01-01

    This economy profile for Doing Business 2016 presents the 11 Doing Business indicators for Afghanistan. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2016 is the 13th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain i...

  6. Molecular weight profiles of proanthocyanidin polymers

    Science.gov (United States)

    Vincent M. Williams; Lawrence J. Porter; Richard W. Hemingway

    1983-01-01

    The MW profiles of proanthocyanidin polymers (condensed tannins) from 32 samples representing a wide range of plant tissues of many different species have been obtained by gel permeation chromatography of the peracetate derivatives. The tannins vary widely in MW, with M values for the peracetates in the range 1600-5500. The MW profiles vary greatly from those with...

  7. Temperature profiles from Salt Valley, Utah

    Science.gov (United States)

    Sass, J. H.; Lachenbruch, A. H.; Smith, E. P.

    Temperature profiles were obtained in the nine drilled wells as part of a thermal study of the Salt Valley anticline, Paradox Basin, Utha. Thermal conductivities were also measured on 10 samples judged to be representative of the rocks encountered in the deepest hole. The temperature profiles and thermal conductivities are presented, together with preliminary interpretive remarks and suggestions for additional work.

  8. Estimating Mixing Heights Using Microwave Temperature Profiler

    Science.gov (United States)

    Nielson-Gammon, John; Powell, Christina; Mahoney, Michael; Angevine, Wayne

    2008-01-01

    A paper describes the Microwave Temperature Profiler (MTP) for making measurements of the planetary boundary layer thermal structure data necessary for air quality forecasting as the Mixing Layer (ML) height determines the volume in which daytime pollution is primarily concentrated. This is the first time that an airborne temperature profiler has been used to measure the mixing layer height. Normally, this is done using a radar wind profiler, which is both noisy and large. The MTP was deployed during the Texas 2000 Air Quality Study (TexAQS-2000). An objective technique was developed and tested for estimating the ML height from the MTP vertical temperature profiles. In order to calibrate the technique and evaluate the usefulness of this approach, estimates from a variety of measurements during the TexAQS-2000 were compared. Estimates of ML height were used from radiosondes, radar wind profilers, an aerosol backscatter lidar, and in-situ aircraft measurements in addition to those from the MTP.

  9. Velocity dispersion profiles of clusters of galaxies

    International Nuclear Information System (INIS)

    Struble, M.F.

    1979-01-01

    Velocity dispersion as a function of radius, called sigma/sub ls/ profiles, is presented for 13 clusters of galaxies having > or =30 radial velocities from both published and unpublished lists. A list of probable new members and possible outlying members for these clusters is also given. chi 2 and Kolmogoroff--Smirnoff one-sample tests for the goodness of fit of power laws to portions of the profiles indicate two significant structures in some profiles: (1) a local minimum corresponding to the local minimum noted in surface density or surface brightness profiles, and (2) a decrease in sigma/sub ls/ toward the cores. Both of these features are discussed in terms of a comparison with Wielen's N-body simulations. The sigma/sub ls/ profiles are placed in a new classification scheme which lends itself to interpreting clusters in a dynamical age sequence. The velocity field of galaxies at large distances from cluster centers is also discussed

  10. State electricity profiles, March 1999

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Due to the role electricity plays in the Nation`s economic and social well-being, interested parties have been following the electric power industry`s transition by keeping abreast of the restructuring and deregulation events that are taking place almost daily. Much of the attention centers around the States and how they are restructuring the business of electricity supply within their respective jurisdictions. This report is designed to profile each State and the District of Columbia regarding not only their current restructuring activities, but also their electricity generation and concomitant statistics from 1986 through 1996. Included are data on a number of subject areas including generating capability, generation, revenues, fuel use, capacity factor for nuclear plants, retail sales, and pollutant emissions. Although the Energy Information Administration (EIA) publishes this type of information, there is a lack of a uniform overview for each individual State. This report is intended to help fill that gap and also to serve as a framework for more detailed studies. In addition to basic statistics in tables and graphs, a textual section is provided for each State, discussing some of the points relative to electricity production that are noteworthy in, or unique to, that particular State. Also, each State is ranked according to the place it holds, as compared to the rest of the states, in various relevant areas, such as its average price of electricity per kilowatthour, its population, and its emissions of certain atmospheric pollutants. The final chapter covers the Nation as a whole. 451 figs., 520 tabs.

  11. Importance Profiles for Water Vapor

    Science.gov (United States)

    Mapes, Brian; Chandra, Arunchandra S.; Kuang, Zhiming; Zuidema, Paquita

    2017-11-01

    Motivated by the scientific desire to align observations with quantities of physical interest, we survey how scalar importance functions depend on vertically resolved water vapor. Definitions of importance begin from familiar examples of water mass I m and TOA clear-sky outgoing longwave flux I OLR, in order to establish notation and illustrate graphically how the sensitivity profile or "kernel" depends on whether specific humidity S, relative humidity R, or ln( R) are used as measures of vapor. Then, new results on the sensitivity of convective activity I con to vapor (with implied knock-on effects such as weather prediction skill) are presented. In radiative-convective equilibrium, organized (line-like) convection is much more sensitive to moisture than scattered isotropic convection, but it exists in a drier mean state. The lesson for natural convection may be that organized convection is less susceptible to dryness and can survive and propagate into regions unfavorable for disorganized convection. This counterintuitive interpretive conclusion, with respect to the narrow numerical result behind it, highlights the importance of clarity about what is held constant at what values in sensitivity or susceptibility kernels. Finally, the sensitivities of observable radiance signals I sig for passive remote sensing are considered. While the accuracy of R in the lower free troposphere is crucial for the physical importance scalars, this layer is unfortunately the most difficult to isolate with passive remote sensing: In high emissivity channels, water vapor signals come from too high in the atmosphere (for satellites) or too low (for surface radiometers), while low emissivity channels have poor altitude discrimination and (in the case of satellites) are contaminated by surface emissions. For these reasons, active ranging (LiDAR) is the preferred observing strategy.

  12. Profile of Public Health Leadership.

    Science.gov (United States)

    Little, Ruth Gaskins; Greer, Annette; Clay, Maria; McFadden, Cheryl

    2016-01-01

    Public health leaders play pivotal roles in ensuring the population health for our nation. Since 2000, the number of schools of public health has almost doubled. The scholarly credentials for leaders of public health in academic and practice are important, as they make decisions that shape the future public health workforce and important public health policies. This research brief describes the educational degrees of deans of schools of public health and state health directors, as well as their demographic profiles, providing important information for future public health leadership planning. Data were extracted from a database containing information obtained from multiple Web sites including academic institution Web sites and state government Web sites. Variables describe 2 sets of public health leaders: academic deans of schools of public health and state health directors. Deans of schools of public health were 73% males and 27% females; the PhD degree was held by 40% deans, and the MD degree by 33% deans. Seventy percent of deans obtained their terminal degree more than 35 years ago. State health directors were 60% males and 40% females. Sixty percent of state health directors had an MD degree, 4% a PhD degree, and 26% no terminal degree at all. Sixty-four percent of state health directors received their terminal degree more than 25 years ago. In addition to terminal degrees, 56% of deans and 40% of state health directors held MPH degrees. The findings call into question competencies needed by future public health professionals and leadership and the need to clarify further the level of public health training and degree type that should be required for leadership qualifications in public health.

  13. Lipid profiling in sewage sludge.

    Science.gov (United States)

    Zhu, Fenfen; Wu, Xuemin; Zhao, Luyao; Liu, Xiaohui; Qi, Juanjuan; Wang, Xueying; Wang, Jiawei

    2017-06-01

    High value-added reutilization of sewage sludge from wastewater treatment plants (WWTPs) is essential in sustainable development in WWTPs. However, despite the advantage of high value reutilization, this process must be based on a detailed study of organics in sludge. We used the methods employed in life sciences to determine the profile of lipids (cellular lipids, free fatty acids (FFAs), and wax/gum) in five sludge samples obtained from three typical WWTPs in Beijing; these samples include one sludge sample from a primary sedimentation tank, two activated sludge samples from two Anaerobic-Anoxic-Oxic (A2/O) tanks, and two activated sludge samples from two membrane bioreactor tanks. The percentage of total raw lipids varied from 2.90% to 12.3%. Sludge from the primary sedimentation tank showed the highest concentrations of lipid, FFA, and wax/gum and the second highest concentration of cellular lipids. All activated sludge contained an abundance of cellular lipids (>54%). Cells in sludge can from plants, animals, microbes and so on in wastewater. Approximately 14 species of cellular lipids were identified, including considerable high value-potential ceramide (9567-38774 mg/kg), coenzyme (937-3897 mg/kg), and some phosphatidylcholine (75-548 mg/kg). The presence of those lipid constituents would thus require a wider range of recovery methods for sludge. Both cellular lipids and FFAs contain an abundance of C16-C18 lipids at high saturation level, and they serve as good resources for biodiesel production. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Study on Rail Profile Optimization Based on the Nonlinear Relationship between Profile and Wear Rate

    Directory of Open Access Journals (Sweden)

    Jianxi Wang

    2017-01-01

    Full Text Available This paper proposes a rail profile optimization method that takes account of wear rate within design cycle so as to minimize rail wear at the curve in heavy haul railway and extend the service life of rail. Taking rail wear rate as the object function, the vertical coordinate of rail profile at range optimization as independent variable, and the geometric characteristics and grinding depth of rail profile as constraint conditions, the support vector machine regression theory was used to fit the nonlinear relationship between rail profile and its wear rate. Then, the profile optimization model was built. Based on the optimization principle of genetic algorithm, the profile optimization model was solved to achieve the optimal rail profile. A multibody dynamics model was used to check the dynamic performance of carriage running on optimal rail profile. The result showed that the average relative error of support vector machine regression model remained less than 10% after a number of training processes. The dynamic performance of carriage running on optimized rail profile met the requirements on safety index and stability. The wear rate of optimized profile was lower than that of standard profile by 5.8%; the allowable carrying gross weight increased by 12.7%.

  15. Parent Prevention Communication Profiles and Adolescent Substance Use: A Latent Profile Analysis and Growth Curve Model

    Science.gov (United States)

    Choi, Hye Jeong; Miller-Day, Michelle; Shin, YoungJu; Hecht, Michael L.; Pettigrew, Jonathan; Krieger, Janice L.; Lee, JeongKyu; Graham, John W.

    2017-01-01

    This current study identifies distinct parent prevention communication profiles and examines whether youth with different parental communication profiles have varying substance use trajectories over time. Eleven schools in two rural school districts in the Midwestern United States were selected, and 784 students were surveyed at three time points from the beginning of 7th grade to the end of 8th grade. A series of latent profile analyses were performed to identify discrete profiles/subgroups of substance-specific prevention communication (SSPC). The results revealed a 4-profile model of SSPC: Active-Open, Passive-Open, Active-Silent, and Passive-Silent. A growth curve model revealed different rates of lifetime substance use depending on the youth’s SSPC profile. These findings have implications for parenting interventions and tailoring messages for parents to fit specific SSPC profiles. PMID:29056872

  16. THE LUMINOSITY PROFILES OF BRIGHTEST CLUSTER GALAXIES

    International Nuclear Information System (INIS)

    Donzelli, C. J.; Muriel, H.; Madrid, J. P.

    2011-01-01

    We have derived detailed R-band luminosity profiles and structural parameters for a total of 430 brightest cluster galaxies (BCGs), down to a limiting surface brightness of 24.5 mag arcsec -2 . Light profiles were initially fitted with a Sersic's R 1/n model, but we found that 205 (∼48%) BCGs require a double component model to accurately match their light profiles. The best fit for these 205 galaxies is an inner Sersic model, with indices n ∼ 1-7, plus an outer exponential component. Thus, we establish the existence of two categories of the BCG luminosity profiles: single and double component profiles. We found that double profile BCGs are brighter (∼0.2 mag) than single profile BCGs. In fact, the Kolmogorov-Smirnov test applied to these subsamples indicates that they have different total magnitude distributions, with mean values M R = -23.8 ± 0.6 mag for single profile BCGs and M R = -24.0 ± 0.5 mag for double profile BCGs. We find that partial luminosities for both subsamples are indistinguishable up to r = 15 kpc, while for r > 20 kpc the luminosities we obtain are on average 0.2 mag brighter for double profile BCGs. This result indicates that extra-light for double profile BCGs does not come from the inner region but from the outer regions of these galaxies. The best-fit slope of the Kormendy relation for the whole sample is a = 3.13 ± 0.04. However, when fitted separately, single and double profile BCGs show different slopes: a single = 3.29 ± 0.06 and a double = 2.79 ± 0.08. Also, the logarithmic slope of the metric luminosity α is higher in double profile BCGs (α double = 0.65 ± 0.12) than in single profile BCGs (α single = 0.59 ± 0.14). The mean isophote outer ellipticity (calculated at μ ∼ 24 mag arcsec -2 ) is higher in double profile BCGs (e double = 0.30 ± 0.10) than in single profile BCGs (e single = 0.26 ± 0.11). Similarly, the mean absolute value of inner minus outer ellipticity is also higher in double profile BCGs. From a

  17. Geophysical validation of SCIAMACHY Limb Ozone Profiles

    Directory of Open Access Journals (Sweden)

    E. J. Brinksma

    2006-01-01

    Full Text Available We discuss the quality of the two available SCIAMACHY limb ozone profile products. They were retrieved with the University of Bremen IFE's algorithm version 1.61 (hereafter IFE, and the official ESA offline algorithm (hereafter OL versions 2.4 and 2.5. The ozone profiles were compared to a suite of correlative measurements from ground-based lidar and microwave, sondes, SAGE II and SAGE III (Stratospheric Aerosol and Gas Experiment. To correct for the expected Envisat pointing errors, which have not been corrected implicitly in either of the algorithms, we applied a constant altitude shift of -1.5 km to the SCIAMACHY ozone profiles. The IFE ozone profile data between 16 and 40 km are biased low by 3-6%. The average difference profiles have a typical standard deviation of 10% between 20 and 35 km. We show that more than 20% of the SCIAMACHY official ESA offline (OL ozone profiles version 2.4 and 2.5 have unrealistic ozone values, most of these are north of 15° S. The remaining OL profiles compare well to correlative instruments above 24 km. Between 20 and 24 km, they underestimate ozone by 15±5%.

  18. Acute Exercise and Appetite-Regulating Hormones in Overweight and Obese Individuals: A Meta-Analysis

    Directory of Open Access Journals (Sweden)

    Jessica Anne Douglas

    2016-01-01

    Full Text Available In lean individuals, acute aerobic exercise is reported to transiently suppress sensations of appetite, suppress blood concentrations of acylated ghrelin (AG, and increase glucagon-like peptide-1 (GLP-1 and peptide-YY (PYY. Findings in overweight/obese individuals have yet to be synthesised. In this systematic review and meta-analysis, we quantified the effects that acute exercise has on AG and total PYY and GLP-1 in overweight/obese individuals. The potential for body mass index (BMI to act as a moderator for AG was also explored. Six published studies (73 participants, 78% male, mean BMI: 30.6 kg·m−2 met the inclusion criteria. Standardised mean differences (SMDs and standard errors were extracted for AG and total PYY and GLP-1 concentrations in control and exercise trials and synthesised using a random effects meta-analysis model. BMI was the predictor in metaregression for AG. Exercise moderately suppressed AG area-under-the-curve concentrations (pooled SMD: −0.34, 95% CI: −0.53 to −0.15. The magnitude of this reduction was greater for higher mean BMIs (pooled metaregression slope: −0.04 SMD/kg·m−2 (95% CI: −0.07 to 0.00. Trivial SMDs were obtained for total PYY (0.10, 95% CI: −0.13 to 0.31 and GLP-1 (−0.03, 95% CI: −0.18 to 0.13. This indicates that exercise in overweight/obese individuals moderately alters AG in a direction that could be associated with decreased hunger and energy intake. This trial is registered with PROSPERO: CRD42014006265.

  19. Parametric dependencies of JET electron temperature profiles

    Energy Technology Data Exchange (ETDEWEB)

    Schunke, B [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking; Imre, K; Riedel, K [New York Univ., NY (United States)

    1994-07-01

    The JET Ohmic, L-Mode and H-Mode electron temperature profiles obtained from the LIDAR Thomson Scattering Diagnostic are parameterized in terms of the normalized flux parameter and a set of the engineering parameters like plasma current, toroidal field, line averages electron density... It is shown that the electron temperature profiles fit a log-additive model well. It is intended to use the same model to predict the profile shape for D-T discharges in JET and in ITER. 2 refs., 5 figs.

  20. Design of control system for profile gauge

    International Nuclear Information System (INIS)

    Huang Yibin; Zhang Yu'ai

    2013-01-01

    The profile gauge can on-line get the cross section in the steel strip, so it has been widely used in hot continuous rolling production-line. The structure of profile gauge and its distributed hardware structure based on PLC and software design of its control subsystem were introduced. The method of temperature and humidity measurement was analyzed. The time response of X-ray machine control based on RS232 communication was researched. It is proved that the control system meets the requirements of the profile gauge system. (authors)

  1. Load profiles analysis for electricity market

    Directory of Open Access Journals (Sweden)

    Radu Porumb

    2014-04-01

    Full Text Available In the wake of electric power system transition towards smart grids, and the adoption of the electric market schemes, electric utilities are facing the need of a better load profiles understanding for their customers. In this work, some key objectives were addresses, such as definition of the mathematical model for calculating the hourly energy specific, identification of the three target groups for users who have developed consumer profiles, definition of the two types of significant load and assessment of the impact of using consumer profiles on users.

  2. A prototype ionization profile monitor for RHIC

    International Nuclear Information System (INIS)

    Connolly, R.; Cameron, P.; Ryan, W.

    1997-01-01

    Transverse beam profiles in the Relativistic Heavy-Ion Collider (RHIC) will be measured with ionization profile monitors (IPM's). Each IPM collects and measures the distribution of electrons in the beamline resulting from residual gas ionization during bunch passage. The electrons are swept transversely from the beamline and collected on strip anodes oriented parallel to the beam axis. At each bunch passage the charge pulses are amplified, integrated, and digitized for display as a profile histogram. A prototype detector was tested in the injection line during the RHIC Sextant Test. This paper describes the detector and gives results from the beam tests

  3. A Profile for Safety Critical Java

    DEFF Research Database (Denmark)

    Schoeberl, Martin; Søndergaard, Hans; Thomsen, Bent

    2007-01-01

    We propose a new, minimal specification for real-time Java for safety critical applications. The intention is to provide a profile that supports programming of applications that can be validated against safety critical standards such as DO-178B [15]. The proposed profile is in line with the Java...... specification request JSR-302: Safety Critical Java Technology, which is still under discussion. In contrast to the current direction of the expert group for the JSR-302 we do not subset the rather complex Real-Time Specification for Java (RTSJ). Nevertheless, our profile can be implemented on top of an RTSJ...

  4. A predictable Java profile - rationale and implementations

    DEFF Research Database (Denmark)

    Søndergaard, Hans; Bøgholm, Thomas; Hansen, Rene Rydhof

    A Java profile suitable for development of high integrity embedded systems is presented. It is based on event handlers which are grouped in missions and equipped with respectively private handler memory and shared mission memory. This is a result of our previous work on developing a Java profile......, and is directly inspired by interactions with the Open Group on their on-going work on a safety critical Java profile (JSR-302). The main contribution is an arrangement of the class hierarchy such that the proposal is a generalization of Real-Time Specification for Java (RTSJ). A further contribution...

  5. Doping profile measurement on textured silicon surface

    Science.gov (United States)

    Essa, Zahi; Taleb, Nadjib; Sermage, Bernard; Broussillou, Cédric; Bazer-Bachi, Barbara; Quillec, Maurice

    2018-04-01

    In crystalline silicon solar cells, the front surface is textured in order to lower the reflection of the incident light and increase the efficiency of the cell. This texturing whose dimensions are a few micrometers wide and high, often makes it difficult to determine the doping profile measurement. We have measured by secondary ion mass spectrometry (SIMS) and electrochemical capacitance voltage profiling the doping profile of implanted phosphorus in alkaline textured and in polished monocrystalline silicon wafers. The paper shows that SIMS gives accurate results provided the primary ion impact angle is small enough. Moreover, the comparison between these two techniques gives an estimation of the concentration of electrically inactive phosphorus atoms.

  6. Aerodynamics profile not in stationary flow

    Directory of Open Access Journals (Sweden)

    А.А. Загорулько

    2006-02-01

    Full Text Available  Consider the question about influence of unsteady flight on the size of drag and lift coefficients of theaerodynamic profile. Distinctive features of this investigation are obtaining data about aerodynamic drag chancing in process unsteady on high angle at attack and oscillation profile in subsonic and transonic flight. Given analysis of oscillation profile show, that dynamic loops accompany change of lift and dray force. The researches show that it is necessary to clarity the mathematic model of the airplane flight dynamics by introducing numbers, with take into account unsteady effects.

  7. Video profile monitor diagnostic system for GTA

    International Nuclear Information System (INIS)

    Sandovil, D.P.; Garcia, R.C.; Gilpatrick, J.D.; Johnson, K.F.; Shinas, M.A.; Wright, R.; Yuan, V.; Zander, M.E.

    1992-01-01

    This paper describes a video diagnostic system used to measure the beam profile and position of the Ground Test Accelerator 2.5 MeV H - ion beam as it exits the intermediate matching section. Inelastic collisions between H - ions and residual nitrogen in the vacuum chamber cause the nitrogen to fluoresce. The resulting light is captured through transport optics by an intensified CCD camera and is digitized. Real-time beam profile images are displayed and stored for detailed analysis. Analyzed data showing resolutions for both position and profile measurements will also be presented. (Author) 5 refs., 7 figs

  8. Video profile monitor diagnostic system for GTA

    International Nuclear Information System (INIS)

    Sandoval, D.P.; Garcia, R.C.; Gilpatrick, J.D.; Johnson, K.F.; Shinas, M.A.; Wright, R.; Yuan, V.; Zander, M.E.

    1992-01-01

    This paper describes a video diagnostic system used to measure the beam profile and position of the Ground Test Accelerator 2.5-MeV H - ion beam as it exits the intermediate matching section. Inelastic collisions between H-ions and residual nitrogen to fluoresce. The resulting light is captured through transport optics by an intensified CCD camera and is digitized. Real-time beam-profile images are displayed and stored for detailed analysis. Analyzed data showing resolutions for both position and profile measurements will also be presented

  9. A prototype ionization profile monitor for RHIC

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, R.; Cameron, P.; Ryan, W. [and others

    1997-07-01

    Transverse beam profiles in the Relativistic Heavy-Ion Collider (RHIC) will be measured with ionization profile monitors (IPM`s). Each IPM collects and measures the distribution of electrons in the beamline resulting from residual gas ionization during bunch passage. The electrons are swept transversely from the beamline and collected on strip anodes oriented parallel to the beam axis. At each bunch passage the charge pulses are amplified, integrated, and digitized for display as a profile histogram. A prototype detector was tested in the injection line during the RHIC Sextant Test. This paper describes the detector and gives results from the beam tests.

  10. Fractal Analysis of Rock Joint Profiles

    Science.gov (United States)

    Audy, Ondřej; Ficker, Tomáš

    2017-10-01

    Surface reliefs of rock joints are analyzed in geotechnics when shear strength of rocky slopes is estimated. The rock joint profiles actually are self-affine fractal curves and computations of their fractal dimensions require special methods. Many papers devoted to the fractal properties of these profiles were published in the past but only a few of those papers employed a convenient computational method that would have guaranteed a sound value of that dimension. As a consequence, anomalously low dimensions were presented. This contribution deals with two computational modifications that lead to sound fractal dimensions of the self-affine rock joint profiles. These are the modified box-counting method and the modified yard-stick method sometimes called the compass method. Both these methods are frequently applied to self-similar fractal curves but the self-affine profile curves due to their self-affine nature require modified computational procedures implemented in computer programs.

  11. A Community Profile of Pittsburgh Neighborhoods, 1974

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — These data include four historical datasets that were transcribed from the Community Profiles of Pittsburgh reports, which were published in 1974. The Community...

  12. Effects of fueling profiles on plasma transport

    International Nuclear Information System (INIS)

    Houlberg, W.A.; Mense, A.T.; Attenberger, S.E.; Milora, S.L.

    1977-01-01

    The effects of cold particle fueling profiles on particle and energy transport in an ignition sized tokamak plasma are investigated in this study with a one-dimensional, multifluid transport model. A density gradient driven trapped particle microinstability model for plasma transport is used to demonstrate potential effects of fueling profiles on ignition requirements. Important criteria for the development of improved transport models under the conditions of shallow particle fueling profiles are outlined. A discrete pellet fueling model indicates that large fluctuations in density and temperature may occur in the outer regions of the plasma with large, shallowly penetrating pellets, but fluctuations in the pressure profile are small. The hot central core of the plasma remains unaffected by the large fluctuations near the plasma edge

  13. European Union Sustainable Purchasing Guidance Profile

    Science.gov (United States)

    To help you find the resource that is right for your organization, EPA conducted a scan of the landscape and developed summary profiles of some of the leading sources of sustainable purchasing guidance around the globe.

  14. Responsible Purchasing Network - Sustainable Purchasing Guidance Profile

    Science.gov (United States)

    To help you find the resource that is right for your organization, EPA conducted a scan of the landscape and developed summary profiles of some of the leading sources of sustainable purchasing guidance around the globe.

  15. International Green Purchasing Network - Sustainable Purchasing Profile

    Science.gov (United States)

    To help you find the resource that is right for your organization, EPA conducted a scan of the landscape and developed summary profiles of some of the leading sources of sustainable purchasing guidance around the globe.

  16. Profile of Vietnam War Veterans (2015).

    Data.gov (United States)

    Department of Veterans Affairs — The Profile of Vietnam War Veterans uses the 2015 ACS to provide a view into the demographic characteristics and socioeconomic conditions of the Vietnam War Veteran...

  17. Anterior corneal profile with variable asphericity.

    Science.gov (United States)

    Rosales, Marco A; Juárez-Aubry, Montserrat; López-Olazagasti, Estela; Ibarra, Jorge; Tepichín, Eduardo

    2009-12-10

    We present a corneal profile in which the eccentricity, e(Q=-e(2)), has a nonlinear continuous variation from the center outwards. This nonlinear variation is intended to fit and reproduce our current experimental data in which the anterior corneal surface of the human eye exhibits different values of e at different diameters. According to our clinical data, the variation is similar to an exponential decay. We propose a linear combination of two exponential functions to describe the variation of e. We then calculate the corneal sagittal height by substituting e in the first-order aspherical surface equation to obtain the corneal profile. This corneal profile will be used as a reference to analyze the resultant profiles of the customized corneal ablation in refractive surgery.

  18. Venous thromboembolism: Risk profile and management of ...

    African Journals Online (AJOL)

    surgery in a tertiary hospital and to audit the VTE prophylaxis prescribed. ... This group of patients require formal preoperative VTE risk assessment using a recognised scoring model. ... The aim of this study was to establish the VTE risk profile.

  19. Temperature profiles in the Harwell boreholes

    International Nuclear Information System (INIS)

    Robins, N.S.

    1983-03-01

    Heat flow at Harwell is estimated at 45 mWm -2 (milli Watt per metre squared is the unit of heat flow). Thermal conductivity values for the formations penetrated range from 1.0 to 4.6 Wm -1 K -1 . The temperature profiles recorded in the boreholes enable the vertical groundwater flow patterns within two poorly permeable mudrock units to be evaluated. The two mudrock units act as leaky barriers each separating a pair of aquifer units which induce a vertical hydraulic gradient across the mudrocks. The flow velocity results for the upper mudrock units derived from the temperature profile are compatible with values for groundwater potential derived from hydraulic data (10 -9 ms -1 from the temperature profile and 10 -12 ms -1 from the hydraulic observations). The results from the lower mudrock sequence are incompatible and this may be due to some other overiding influence upon the temperature profile. (author)

  20. Airborne Surface Profiling of Alaskan Glaciers

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set consists of glacier outline, laser altimetry profile, and surface elevation change data for 46 glaciers in Alaska and British Columbia, Canada,...

  1. Cardiorespiratory Fitness Profile of Undergraduate Biomedical ...

    African Journals Online (AJOL)

    ... for developing sedentary habits, which could lead to reduced cardiorespiratory fitness. ... This study therefore examined the cardiorespiratory fitness (CRF) profile of ... A modified sub-maximal cycle ergometer protocol was used to estimate ...

  2. State Profiles: FY 2013 Public Libraries Survey

    Data.gov (United States)

    Institute of Museum and Library Services — Pull up a state's profile to find state-level totals on key data such as numbers of libraries and librarians, revenue and expenditure, and collection sizes.These...

  3. Metabolite Profiling of Red Sea Corals

    KAUST Repository

    Ortega, Jovhana Alejandra

    2016-01-01

    that provide insights into the specific nature of the symbiosis. Our analysis also revealed aquatic pollutants, which suggests that metabolite profiling might be used for monitoring pollution levels and assessing environmental impact.

  4. Overweight, obesity and underweight profile among adolescent ...

    African Journals Online (AJOL)

    Overweight, obesity and underweight profile among adolescent secondary school students ... should be of concern if a healthy and productive future generation is to be ensured. Primary care providers should constantly assess adolescents for ...

  5. Tribal-FERST Environmental Issue Profiles

    Science.gov (United States)

    This page provides links to the 45 issue profiles for Tribal-FERST users, organized with tabs to show issues related to pollutants, environmental media, health effects, other community issues, and all issues.

  6. C-FERST Environmental Issue Profiles

    Science.gov (United States)

    This page provides links to the 45 issue profiles for C-FERST users, organized with tabs to show issues related to pollutants, environmental media, health effects, other community issues, and all issues.

  7. Natural gas annual 1992: Supplement: Company profiles

    Energy Technology Data Exchange (ETDEWEB)

    1994-01-01

    The data for the Natural Gas Annual 1991 Supplement : Company Profiles are taken from Form EIA-176, (open quotes) Annual Report of Natural and Supplemental Gas Supply and Disposition (close quotes). Other sources include industry literature and corporate annual reports to shareholders. The companies appearing in this report are major interstate natural gas pipeline companies, large distribution companies, or combination companies with both pipeline and distribution operations. The report contains profiles of 45 corporate families. The profiles describe briefly each company, where it operates, and any important issues that the company faces. The purpose of this report is to show the movement of natural gas through the various States served by the 45 large companies profiled.

  8. 164 original article profile of institutional infrastructure

    African Journals Online (AJOL)

    Dr Oboro VO

    At this level is the most critical health services delivery point, with an ... Methods: The objectives of this study were to assess the universal precaution profile of primary health care .... Availability of safety training and monitoring schedule.

  9. Profiling classroom reading comprehension development practices ...

    African Journals Online (AJOL)

    teaching practices for reading comprehension development from case study schools with achievement profiles at the PIRLS international .... who can understand the plot, character, setting, point of view ...... A teacher's handbook. Pretoria: DoE.

  10. Mapping Bedrock Topography using Electromagnetic Profiling ...

    African Journals Online (AJOL)

    Mapping Bedrock Topography using Electromagnetic Profiling. ... will be constructed The area under study is within the Abakaliki Shales Geologic Formation. ... micaceous sandstone; micaceous siltstone, sandy shales and shelly limestone.

  11. Characterization of the titanium Kβ spectral profile

    International Nuclear Information System (INIS)

    Chantler, C T; Smale, L F; Kinnane, M N; Illig, A J; Kimpton, J A; Crosby, D N

    2013-01-01

    Transition metals have Kα and Kβ characteristic radiation possessing complex asymmetric spectral profiles. Instrumental broadening normally encountered in x-ray experiments shifts features of profiles used for calibration, such as peak energy, by many times the quoted accuracies. We measure and characterize the titanium Kβ spectral profile. The peak energy of the titanium Kβ spectral profile is found to be 4931.966 ± 0.022 eV prior to instrumental broadening. This 4.5 ppm result decreases the uncertainty over the past literature by a factor of 2.6 and is 2.4 standard deviations from the previous standard. The spectrum is analysed and the resolution-free lineshape is extracted and listed for use in other experiments. We also incorporate improvement in analysis applied to earlier results for V Kβ. (paper)

  12. Hudson River Sub-Bottom Profile Points

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Hudson River Estuary Shallow Water Surveys. Subbottom Profile Points. Subbottom data was collected November 5 to December 15, 2009, in the estuary north from...

  13. Triton burnup in JET - profile effects

    Energy Technology Data Exchange (ETDEWEB)

    Jarvis, O.N.; Conroy, S.W.; Marcus, F.B.; Sadler, G.J.; Belle, P. van (Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking); Adams, J.M.; Watkins, N. (AEA Industrial Technology, Harwell Laboratory (United Kingdom))

    1991-01-01

    Measurements of the 14 MeV neutron emission from triton burnup show that the 14 MeV emission profile shadows closely the 2,5 MeV profile but after a delay corresponding to the triton slowing down time. The slightly greater width of the 14 MeV neutron profile is a consequence of the finite Larmor radius of the tritons. It has not so far been possible to identify unambiguously any effects on the triton burnup that are attributable to sawtooth crashes. Finally, the time dependence of the triton profile indicates that the triton diffusion coefficient is very small (<<0.1 m[sup 2]/s). (author) 4 refs., 3 figs.

  14. Controlling nanowire emission profile using conical taper

    DEFF Research Database (Denmark)

    Gregersen, Niels; Nielsen, Torben Roland; Mørk, Jesper

    2008-01-01

    The influence of a conical taper on nanowire light emission is studied. For nanowires with divergent output beams, the introduction of tapers improves the emission profile and increase the collection efficiency of the detection optics....

  15. Zambia mental health country profile.

    Science.gov (United States)

    Mayeya, John; Chazulwa, Roy; Mayeya, Petronella Ntambo; Mbewe, Edward; Magolo, Lonia Mwape; Kasisi, Friday; Bowa, Annel Chishimba

    2004-01-01

    This country profile for Zambia was compiled between 1998 and 2002. The objectives of the exercise were to first of all avail policymakers, other key decision makers and leaders in Zambia, information about mental health in Zambia in order to assist policy and services development. Secondly, to facilitate comparative analyses of mental health services between countries. The work involved formation of a core group of experts who coordinated the collection of information from the various organizations in Zambia. The information was later shared to a broad spectrum of stakeholders for consensus. A series of focus group discussions (FGDs) supplemented the information collected. There are various factors that contribute to mental health in Zambia. It is clear from the Zambian perspective that social, demographic, economic, political, environmental, cultural and religious influences affect the mental health of the people. With a population of 10.3 million and annual growth rate of 2.9%, Zambia is one of the most urbanized countries in sub-Saharan Africa. Poverty levels stood at 72.9% in 1998. In terms of unemployment, the most urbanized provinces, Lusaka (the capital city), and the copper-belt are the most affected. The gross domestic product (GDP) is US$3.09 billion dollars while per capita income is US$300. The total budget allocation for health in the year 2002 was 15% while the proportion of the GDP per capita expenditure for health was 5.6%. The HIV/AIDS prevalence rates stand at 20% among the reproductive age group 15-49 years. Political instability and wars in neighbouring states has resulted in an influx of refugees. Environmental factors affecting the country include natural and man-made disasters such as floods and drought, mine accidents, and deforestation. To a large extent in Zambia, people who are mentally ill are stigmatized, feared, scorned at, humiliated and condemned. However, caring for mental ill health in old age is positively perceived. It is

  16. Facebook: Personality and privacy on profiles

    OpenAIRE

    Casado Riera, Carla; Oberst, Ursula; Carbonell, Xavier

    2015-01-01

    The aim of this study was to study the possible relationship between the privacy settings in Facebook profiles and two personality dimensions, extraversion and neuroticism, in relation to gender. The Privacy on Facebook Questionnaire and the Eysenck Personality Inventory was applied to a sample of 92 womenand 70 men, all users of Facebook. No significant relationship was found between extraversion or neuroticism and the privacy settings of Facebook profiles, but the results showed significant...

  17. Impact of Minnesota's "Profile of Learning"

    Directory of Open Access Journals (Sweden)

    Patricia G. Avery

    2003-02-01

    Full Text Available In 1990, the Minnesota State Board of Education declared its intention to develop a "results-oriented graduation requirement" based on student achievement as opposed to the usual credit/course completion requirement. In addition to a traditional test of basic skills, the state began developing the Profile of Learning, a set of performance-based standards grounded in a constructivist educational philosophy, an approach that differs from the content-based standards found in many states. The Profile was controversial from its inception. Conservatives characterized the Profile as too process- oriented and as lacking subject-matter content; teachers reported that the Profile required a significant amount of additional teacher preparation time; and parents, who were not adequately informed about the Profile, questioned the purpose of the Profile. Teachers were frustrated with the confusing and sometimes contradictory directions they received from the Minnesota Department of Children, Families, and Learning charged with implementing the Profile. In 2000-2001, we surveyed and interviewed selected secondary English and social studies teachers in the state about their perceptions of the Profile’s impact on teaching and learning. Among the positive perceptions was an increase in students’ higher order thinking, students’ understanding of criteria for quality work, and teachers conversations with one another about instructional issues. Increased teacher preparation time and decreased enjoyment of teaching were among the negative perceptions. Teachers also experienced difficulty adopting performance assessment techniques. When teachers believed they received effective preparation and adequate resources for working with the Profile, they were much more likely to report beneficial effects in terms of teaching and learning. The majority of teachers, however, rated their preparation and resources as "fair" or "poor." Results are discussed in terms of

  18. Personalizing Web Search based on User Profile

    OpenAIRE

    Utage, Sharyu; Ahire, Vijaya

    2016-01-01

    Web Search engine is most widely used for information retrieval from World Wide Web. These Web Search engines help user to find most useful information. When different users Searches for same information, search engine provide same result without understanding who is submitted that query. Personalized web search it is search technique for proving useful result. This paper models preference of users as hierarchical user profiles. a framework is proposed called UPS. It generalizes profile and m...

  19. Hydrogen depth profiling using elastic recoil detection

    International Nuclear Information System (INIS)

    Doyle, B.L.; Peercy, P.S.

    1979-01-01

    The elastic recoil detection (ERD) analysis technique for H profiling in the near surface regions of solids is described. ERD is shown to have the capability of detecting H and its isotopes down to concentrations of approx. 0.01 at. % with a depth resolution of a few hundred angstroms. Is is demonstrated that 2.4-MeV He ions can be used successfully to profile 1 H and 2 D using this technique. 12 figures

  20. Motivation factors of surgical profile nurses work

    OpenAIRE

    Namajuškaitė, Vaida

    2006-01-01

    The aim of the study – investigate the motivation factors of surgical profile nurses work. The objectives of the study: 1. To investigate of satisfaction with work, to identify the motivation positive factors, emotional exhaustion of nurses, which are working in the surgical profile departments and operating-theaters. 2. To investigate negative factors (emotional exhaustion, salary, nursing load). 3. To give the offers for the main problems solutions. Hypothesis – the nurses m...

  1. Employability profile of the Peruvian public accountant

    OpenAIRE

    Tarazona, Silvia; Maisch, Elena; Arias, Hernán

    2014-01-01

    The traditional perspective on the Public Accountant's professional services is running out of time and, although such services are still valuable for enterprises, the survival of the latter demands a more open and aggressive professional attitude in this field (Lebrija, 1998). Employability profiles respond to this demand by acknowledging the new abilities required of the labor force, which go beyond professional competencies. It is also these profiles which will allow coping with employment...

  2. Deconvolution of spectral line profile by FTS

    International Nuclear Information System (INIS)

    Lego, J.

    1977-01-01

    The possibility is studied of determining the components of the spectral line profile using Fourier transformation. The different types of the spectral line profiles are described and the conditions for their generation discussed. The main result is the discovery of the possibility to obtain the parameters of the different components directly from the interferogram without using the Fourier transformation. The method under discussion strongly simplifies evaluation while preserving or increasing accuracy. (author)

  3. Ohmic ion temperature and thermal diffusivity profiles from the JET neutron emission profile monitor

    Energy Technology Data Exchange (ETDEWEB)

    Esposito, B. (ENEA, Frascati (Italy). Centro Ricerche Energia); Marcus, F.B.; Conroy, S.; Jarvis, O.N.; Loughlin, M.J.; Sadler, G.; Belle, P. van (Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking); Adams, J.M.; Watkins, N. (AEA Industrial Technology, Harwell (United Kingdom))

    1993-10-01

    The JET neutron emission profile monitor was used to study ohmically heated deuterium discharges. The radial profile of the neutron emissivity is deduced from the line-integral data. The profiles of ion temperature, T[sub i], and ion thermal diffusivity, [chi][sub i], are derived under steady-state conditions. The ion thermal diffusivity is higher than, and its scaling with plasma current opposite to, that predicted by neoclassical theory. (author).

  4. Ohmic ion temperature and thermal diffusivity profiles from the JET neutron emission profile monitor

    International Nuclear Information System (INIS)

    Esposito, B.

    1993-01-01

    The JET neutron emission profile monitor was used to study ohmically heated deuterium discharges. The radial profile of the neutron emissivity is deduced from the line-integral data. The profiles of ion temperature, T i , and ion thermal diffusivity, χ i , are derived under steady-state conditions. The ion thermal diffusivity is higher than, and its scaling with plasma current opposite to, that predicted by neoclassical theory. (author)

  5. The impact of short chain fatty acids on GLP-1 and PYY secretion from the isolated perfused rat colon

    DEFF Research Database (Denmark)

    Christiansen, Charlotte Bayer; Gabe, Maria Buur Nordskov; Svendsen, Berit

    2018-01-01

    chain fatty acids (SCFAs) produced by local bacterial fermentation are suggested to activate the colonic free fatty acid receptors FFAR2 (GPR43) and FFAR3 (GPR41), stimulating the colonic L-cells. We used the isolated perfused rat colon as a model of colonic endocrine secretion and studied the effects...

  6. A high carbohydrate, but not fat or protein meal attenuates postprandial ghrelin, PYY and GLP-1 responses in Chinese men

    OpenAIRE

    Parvaresh Rizi, Ehsan; Loh, Tze Ping; Baig, Sonia; Chhay, Vanna; Huang, Shiqi; Caleb Quek, Jonathan; Tai, E. Shyong; Toh, Sue-Anne; Khoo, Chin Meng

    2018-01-01

    It is known that the macronutrient content of a meal has different impacts on the postprandial satiety and appetite hormonal responses. Whether obesity interacts with such nutrient-dependent responses is not well characterized. We examined the postprandial appetite and satiety hormonal responses after a high-protein (HP), high-carbohydrate (HC), or high-fat (HF) mixed meal. This was a randomized cross-over study of 9 lean insulin-sensitive (mean±SEM HOMA-IR 0.83±0.10) and 9 obese insulin-resi...

  7. Vertical grid of retrieved atmospheric profiles

    International Nuclear Information System (INIS)

    Ceccherini, Simone; Carli, Bruno; Raspollini, Piera

    2016-01-01

    The choice of the vertical grid of atmospheric profiles retrieved from remote sensing observations is discussed considering the two cases of profiles used to represent the results of individual measurements and of profiles used for subsequent data fusion applications. An ozone measurement of the MIPAS instrument is used to assess, for different vertical grids, the quality of the retrieved profiles in terms of profile values, retrieval errors, vertical resolutions and number of degrees of freedom. In the case of individual retrievals no evident advantage is obtained with the use of a grid finer than the one with a reduced number of grid points, which are optimized according to the information content of the observations. Nevertheless, this instrument dependent vertical grid, which seems to extract all the available information, provides very poor results when used for data fusion applications. A loss of about a quarter of the degrees of freedom is observed when the data fusion is made using the instrument dependent vertical grid relative to the data fusion made using a vertical grid optimized for the data fusion product. This result is explained by the analysis of the eigenvalues of the Fisher information matrix and leads to the conclusion that different vertical grids must be adopted when data fusion is the expected application. - Highlights: • Data fusion application is taken into account for the choice of the vertical grid. • The study is performed using ozone profiles retrieved from MIPAS measurements. • A very fine vertical grid is not needed for the analysis of a single instrument. • The instrument dependent vertical grid is not the best choice for data fusion. • A data fusion dependent vertical grid must be used for profiles that will be fused.

  8. PROFIL PROTEIN SUSU DAN PRODUK OLAHANNYA

    Directory of Open Access Journals (Sweden)

    R. Susanti

    2017-03-01

    Full Text Available Penelitian ini bertujuan untuk menganalisis kadar protein dan profil protein pada beberapa susu (susu kedelai, susu kambing dan olahannya (yogurt, tofu. Kadar protein diukur dengan metode Lowry, sedangkan profil protein dianalisis menggunakan SDS PAGE. Data yang diperoleh dianalisis secara deskriptif. Kadar protein tertinggi pada sampel yang dianalisis terdapat pada produk yogurt A (579,5 mg/ml, disusul susu kedelai (289,99 mg/ml dan susu kambing (133,1 mg/ml. Analisis profil protein terlihat pita protein dengan mobilitas terendah sampai tertinggi terletak pada berat molekul 14-150 KDa. Pita protein khas yang hanya dimiliki susu kambing adalah pita 150kDa. Sementara pita protein khas yang hanya dimiliki susu kedelai adalah pita 44 kDa dan 55kDa. Pita protein yang khas hanya dimiliki yogurt A (dengan bakteri Lactobacillus bulgaricus dan Streptococcus thermophillus adalah pita 65Da. Semua jenis susu dan olahannya memiliki pita 70kDa, kecuali susu kedelai. Profil protein susu kedelai dan tofu menunjukkan profil protein yang sangat berbeda, namun keduanya memiliki pita 18kDa.This study aimed to observe protein level and profiles on some milks (soy milk, goat's milk and dairy (yogurt, tofu product. Protein content was observed by Lowry method, whereas the protein profiles were analyzed by polyacrylamide gel electrophoresis. Data were analyzed descriptively. The highest protein content of the observed sample was in yogurt A products (579,5 mg/ml, followed by soy milk (289,99 mg/ml and goat's milk (133,1 mg/ml. Analysis of protein profiles showed protein bands with lowest to highest mobility lies in the molecular weight of 14-150 KDa. Typical protein band of goat's milk was a 150kDa band. While the typical protein bands of soy milk were 44 kDa and 55kDa band. The typical protein band of yogurt A (with Lactobacillus bulgaricus and Streptococcus thermophillus bacterium was 65Da. All types of milks and dairy had 70kDa band, except for soy milk. Protein

  9. Country nuclear power profiles. 2000 ed

    International Nuclear Information System (INIS)

    2001-03-01

    The preparation of Country Nuclear Power Profiles was initiated within the framework of the IAEA programme on assessment and feedback of nuclear power plant performance. It responded to a need for a database and a technical document containing a description of the economic situation, the energy and the electricity sector and the primary organizations involved in nuclear power in IAEA Member States. In 1998, the first edition of the Country Nuclear Power Profiles was published focusing on the overall economic, energy and electricity situation in the country and on its nuclear power industrial structure and organizational framework. The compilation was made based on of 29 Member States with operating nuclear power plants by the end of 1995 and incorporated the 'Fact Sheets' on international, multilateral and bilateral agreements as collected by EXPO. In May 1999, an Advisory Group Meeting was organized with the purpose of updating the information in the Country Nuclear Power Profiles of each country, to reflect the new approaches and conditions of the national nuclear power programmes. The impact of the open electricity market, privatization and deregulation on the nuclear sector was an important aspect recommended by the experts to be taken in consideration. It was also recommended to periodically review the status and trends of nuclear industries in IAEA Member States and exchange information among experts of the lessons learned from the countries engaged in nuclear programmes, with a view to update the profiles at two year intervals. This second edition covers the changes in the new environment in the electricity as well as in the nuclear sector, be it that the situation differs from country to country. In general, the information is updated to 1999. For the preparation of this second edition, the IAEA received contributions from all 31 countries with operating power plants by the end of 1999, as well as Italy and the Islamic Republic of Iran. A database has been

  10. Sample preparation optimization in fecal metabolic profiling.

    Science.gov (United States)

    Deda, Olga; Chatziioannou, Anastasia Chrysovalantou; Fasoula, Stella; Palachanis, Dimitris; Raikos, Νicolaos; Theodoridis, Georgios A; Gika, Helen G

    2017-03-15

    Metabolomic analysis of feces can provide useful insight on the metabolic status, the health/disease state of the human/animal and the symbiosis with the gut microbiome. As a result, recently there is increased interest on the application of holistic analysis of feces for biomarker discovery. For metabolomics applications, the sample preparation process used prior to the analysis of fecal samples is of high importance, as it greatly affects the obtained metabolic profile, especially since feces, as matrix are diversifying in their physicochemical characteristics and molecular content. However there is still little information in the literature and lack of a universal approach on sample treatment for fecal metabolic profiling. The scope of the present work was to study the conditions for sample preparation of rat feces with the ultimate goal of the acquisition of comprehensive metabolic profiles either untargeted by NMR spectroscopy and GC-MS or targeted by HILIC-MS/MS. A fecal sample pooled from male and female Wistar rats was extracted under various conditions by modifying the pH value, the nature of the organic solvent and the sample weight to solvent volume ratio. It was found that the 1/2 (w f /v s ) ratio provided the highest number of metabolites under neutral and basic conditions in both untargeted profiling techniques. Concerning LC-MS profiles, neutral acetonitrile and propanol provided higher signals and wide metabolite coverage, though extraction efficiency is metabolite dependent. Copyright © 2016 Elsevier B.V. All rights reserved.

  11. Used Fuel Cask Identification through Neutron Profile

    Energy Technology Data Exchange (ETDEWEB)

    Rauch, Eric Benton [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-11-20

    Currently, most spent fuel is stored near reactors. An interim consolidated fuel storage facility would receive fuel from multiple sites and store it in casks on site for decades. For successful operation of such a facility there is need for a way to restore continuity of knowledge if lost as well as a method that will indicate state of fuel inside the cask. Used nuclear fuel is identifiable by its radiation emission, both gamma and neutron. Neutron emission from fission products, multiplication from remaining fissile material, and the unique distribution of both in each cask produce a unique neutron signature. If two signatures taken at different times do not match, either changes within the fuel content or misidentification of a cask occurred. It was found that identification of cask loadings works well through the profile of emitted neutrons in simulated real casks. Even casks with similar overall neutron emission or average counts around the circumference can be distinguished from each other by analyzing the profile. In conclusion, (1) identification of unaltered casks through neutron signature profile is viable; (2) collecting the profile provides insight to the condition and intactness of the fuel stored inside the cask; and (3) the signature profile is stable over time.

  12. A Prototype Ionization Profile Monitor for RHIC

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, R. [Brookhaven National Lab. (BNL), Upton, NY (United States); Cameron, P. [Brookhaven National Lab. (BNL), Upton, NY (United States); Ryan, W. [Brookhaven National Lab. (BNL), Upton, NY (United States); Shea, T. [Brookhaven National Lab. (BNL), Upton, NY (United States); Sikora, R. [Brookhaven National Lab. (BNL), Upton, NY (United States); Tsoupas, N. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    1997-03-17

    The Relativistic Heavy Ion Collider (RHIC) at Brookhaven National Lab will accelerate and store beams of ions ranging from protons to gold nuclei. Transverse beam profiles will be obtained by measuring the distribution of free electrons formed by beam ionization of the residual gas. The electrons are swept from the beamline by a transverse electric field, amplified by a microchannel plate (MCP), and collected on a circuit board with strip anodes oriented parallel to the beam axis. A uniform magnetic field,parallel to the sweep electric field, counters the defocusing effects of space charge and recoil momentum. A single-plane prototype ionization profile montor (IPM) was installed near the end of the AGS-to-RHIC transfer line (ATR) and tested during the sextant commissioning rung. It measured vertical profiles of single bunches of Au nuclei with intensities of 0.6-1.0 x 108 particles. These profiles are compared to profiles on a fluorescent screen (WF3) located 2m downstream from the IPM. This paper describes the detector and gives results from the beam test.

  13. Homogenization of the lipid profile values.

    Science.gov (United States)

    Pedro-Botet, Juan; Rodríguez-Padial, Luis; Brotons, Carlos; Esteban-Salán, Margarita; García-Lerín, Aurora; Pintó, Xavier; Lekuona, Iñaki; Ordóñez-Llanos, Jordi

    Analytical reports from the clinical laboratory are essential to guide clinicians about what lipid profile values should be considered altered and, therefore, require intervention. Unfortunately, there is a great heterogeneity in the lipid values reported as "normal, desirable, recommended or referenced" by clinical laboratories. This can difficult clinical decisions and be a barrier to achieve the therapeutic goals for cardiovascular prevention. A recent international recommendation has added a new heterogeneity factor for the interpretation of lipid profile, such as the possibility of measuring it without previous fasting. All this justifies the need to develop a document that adapts the existing knowledge to the clinical practice of our health system. In this regard, professionals from different scientific societies involved in the measurement and use of lipid profile data have developed this document to establish recommendations that facilitate their homogenization. Copyright © 2017. Publicado por Elsevier España, S.L.U.

  14. Consultant radiographers: Profile of the first generation

    International Nuclear Information System (INIS)

    Forsyth, Lesley J.; Maehle, Valerie

    2010-01-01

    Aim: The aim of this research is to examine the profile of first generation consultant radiographers: their demographics, educational backgrounds, qualifications and training, career experience and progression, teaching, lecturing and research activities. Method: Participant recruitment was drawn from the Society and College of Radiographers consultant radiographer group. Data collection involved a self-administered paper based and web based questionnaire. Results: Participant response rate of 55% (n = 11). Conclusions: The profile of the first consultant radiographer cohort reflects a diverse and eclectic mix. While some aspects of their development such as educational background, clinical training and skills enhancement are comparable to nurse consultants, clinical experience and employment history show some differences. Commitment to development of expert clinical skills is evident within the profile of the first generation cohort of consultant radiographers however research and leadership training are not strong features.

  15. Consultant radiographers: Profile of the first generation

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, Lesley J., E-mail: l.forsyth@rgu.ac.u [School of Health Sciences, Robert Gordon University, Aberdeen, AB10 7QG (United Kingdom); Maehle, Valerie [Faculty of Health and Social Care, Robert Gordon University, Aberdeen, AB10 7QG (United Kingdom)

    2010-11-15

    Aim: The aim of this research is to examine the profile of first generation consultant radiographers: their demographics, educational backgrounds, qualifications and training, career experience and progression, teaching, lecturing and research activities. Method: Participant recruitment was drawn from the Society and College of Radiographers consultant radiographer group. Data collection involved a self-administered paper based and web based questionnaire. Results: Participant response rate of 55% (n = 11). Conclusions: The profile of the first consultant radiographer cohort reflects a diverse and eclectic mix. While some aspects of their development such as educational background, clinical training and skills enhancement are comparable to nurse consultants, clinical experience and employment history show some differences. Commitment to development of expert clinical skills is evident within the profile of the first generation cohort of consultant radiographers however research and leadership training are not strong features.

  16. Toxicological profile for thorium. Draft report (Final)

    International Nuclear Information System (INIS)

    1990-10-01

    The ATSDR Toxicological Profile for Thorium is intended to characterize succinctly the toxicological and health effects information for the substance. It identifies and reviews the key literature that describes the substance's toxicological properties. Other literature is presented but described in less detail. The profile is not intended to be an exhaustive document; however, more comprehensive sources of specialty information are referenced. The profile begins with a public health statement, which describes in nontechnical language the substance's relevant toxicological properties. Following the statement is material that presents levels of significant human exposure and, where known, significant health effects. The adequacy of information to determine the substance's health effects is described. Research gaps in nontoxic and health effects information are described. Research gaps that are of significance to the protection of public health will be identified in a separate effort. The focus of the document is on health and toxicological information

  17. Toxicological profile for uranium. Final report

    International Nuclear Information System (INIS)

    1990-12-01

    The ATSDR Toxicological Profile for Uranium is intended to characterize succinctly the toxicological and health effects information for the substance. It identifies and reviews the key literature that describes the substances's toxicological properties. Other literature is presented but described in less detail. The profile is not intended to be an exhaustive document; however, more comprehensive sources of specialty information are referenced. The profile begins with a public health statement, which describes in nontechnical language the substance's relevant toxicological properties. Following the statement is material that presents levels of significant human exposure and, where known, significant health effects. The adequacy of information to determine the substance's health effects is described. Research gaps in nontoxic and health effects information are described. Research gaps that are of significance to the protection of public health will be identified in a separate effort. The focus of the document is on health and toxicological information

  18. Toxicological profile for radon. Final report

    International Nuclear Information System (INIS)

    1990-12-01

    The ATSDR Toxicological Profile for Radon is intended to characterize succinctly the toxicological and health effects information for the substance. It identifies and reviews the key literature that describes the substance's toxicological properties. Other literature is presented but described in less detail. The profile is not intended to be an exhaustive document; however, more comprehensive sources of specialty information are referenced. The profile begins with a public health statement, which describes in nontechnical language the substance's relevant toxicological properties. Following the statement is material that presents levels of significant human exposure and, where known, significant health effects. The adequacy of information to determine the substance's health effects is described. Research gaps in nontoxic and health effects information are described. Research gaps that are of significance to the protection of public health will be identified in a separate effort. The focus of the document is on health and toxicological information

  19. Toxicological profile for plutonium. Final report

    International Nuclear Information System (INIS)

    1990-12-01

    The ATSDR Toxicological Profile for Plutonium is intended to characterize succinctly the toxicological and health effects information for the substance. It identifies and reviews the key literature that describes the substance's toxicological properties. Other literature is presented but described in less detail. The profile is not intended to be an exhaustive document; however, more comprehensive sources of specialty information are referenced. The profile begins with a public health statement, which describes in nontechnical language the substance's relevant toxicological properties. Following the statement is material that presents levels of significant human exposure and, where known, significant health effects. The adequacy of information to determine the substance's health effects is described. Research gaps in nontoxic and health effects information are described. Research gaps that are of significance to the protection of public health will be identified in a separate effort. The focus of the document is on health and toxicological information

  20. Toxicological profile for radium. Final report

    International Nuclear Information System (INIS)

    1990-12-01

    The ATSDR Toxicological Profile for Radium is intended to characterize succinctly the toxicological and health effects information for the substance. It identifies and reviews the key literature that describes the substances' toxicological properties. Other literature is presented but described in less detail. The profile is not intended to be an exhaustive document; however, more comprehensive sources of specialty information are referenced. The profile begins with a public health statement, which describes in nontechnical language the substance's relevant toxicological properties. Following the statement is material that presents levels of significant human exposure and, where known, significant health effects. The adequacy of information to determine the substance's health effects is described. Research gaps in nontoxic and health effects information are described. Research gaps that are of significance to the protection of public health will be identified in a separate effort. The focus of the document is on health and toxicological information

  1. EPro Non-contact erosion profiling

    DEFF Research Database (Denmark)

    Meinert, Palle

    Pro is a profiling program build to measure the same surface or work piece multiple times and track changes due to erosion. It was developed during 2001 - 2002 at Aalborg University and was part of a Master of Science project dealing with stability of rubble mound breakwaters. The goal was to aut......Pro is a profiling program build to measure the same surface or work piece multiple times and track changes due to erosion. It was developed during 2001 - 2002 at Aalborg University and was part of a Master of Science project dealing with stability of rubble mound breakwaters. The goal...... was to automate the measuring of profiles in order to save manpower and to increase the number of possible measure points. Additional requirement was that measurements should be done in a non-contact way and that the measuring should not be hindered by the presence of water....

  2. BOREAS AFM-06 Mean Wind Profile Data

    Science.gov (United States)

    Wilczak, James; Hall, Forrest G. (Editor); Newcomer, Jeffrey A. (Editor); Smith, David E. (Technical Monitor)

    2000-01-01

    The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-6 team from the National Oceanic and Atmospheric Administration/Environment Technology Laboratory (NOAA/ETL) operated a 915-MHz wind/Radio Acoustic Sounding System (RASS) profiler system in the Southern Study Area (SSA) near the Old Jack Pine (OJP) tower from 21 May 1994 to 20 Sep 1994. The data set provides wind profiles at 38 heights, containing the variables of wind speed; wind direction; and the u-, v-, and w-components of the total wind. The data are stored in tabular ASCII files. The mean wind profile data are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  3. Quantitative sputter profiling at surfaces and interfaces

    International Nuclear Information System (INIS)

    Kirschner, J.; Etzkorn, H.W.

    1981-01-01

    The key problem in quantitative sputter profiling, that of a sliding depth scale has been solved by combined Auger/X-ray microanalysis. By means of this technique and for the model system Ge/Si (amorphous) the following questions are treated quantitatively: shape of the sputter profiles when sputtering through an interface and origin of their asymmetry; precise location of the interface plane on the depth profile; broadening effects due to limited depth of information and their correction; origin and amount of bombardment induced broadening for different primary ions and energies; depth dependence of the broadening, and basic limits to depth resolution. Comparisons are made to recent theoretical calculations based on recoil mixing in the collision cascade and very good agreement is found

  4. Data Transfer Advisor with Transport Profiling Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Rao, Nageswara S. [ORNL; Liu, Qiang [ORNL; Yun, Daqing [Harrisburg University; Wu, Chase Qishi [New Jersey Institute of Technology; Kettimuthu, R. [Argonne National Laboratory (ANL); Jung, Eun-sung [Argonne National Laboratory (ANL)

    2017-11-01

    The network infrastructures have been rapidly upgraded in many high-performance networks (HPNs). However, such infrastructure investment has not led to corresponding performance improvement in big data transfer, especially at the application layer, largely due to the complexity of optimizing transport control on end hosts. We design and implement ProbData, a PRofiling Optimization Based DAta Transfer Advisor, to help users determine the most effective data transfer method with the most appropriate control parameter values to achieve the best data transfer performance. ProbData employs a profiling optimization based approach to exploit the optimal operational zone of various data transfer methods in support of big data transfer in extreme scale scientific applications. We present a theoretical framework of the optimized profiling approach employed in ProbData as wellas its detailed design and implementation. The advising procedure and performance benefits of ProbData are illustrated and evaluated by proof-of-concept experiments in real-life networks.

  5. Sputtering as a means of depth profiling

    International Nuclear Information System (INIS)

    Whitton, J.L.

    1978-01-01

    Probably the most common technique for determination of depth profiles by sputtering is that of secondary ion mass spectrometry. Many problems occur in the important step of converting the time (of sputtering) scale to a depth scale and these problems arise before the secondary ions are ejected. An attempt is made to present a comprehensive list of the effects that should be taken into consideration in the use of sputtering as a means of depth profiling. The various parameters liable to affect the depth profile measurements are listed in four sections: beam conditions; target conditions; experimental environment; and beam-target interactions. The effects are discussed and where interplay occurs, cross-reference is made and examples are provided where possible. (B.R.H.)

  6. Global capital markets: An updated profile

    Directory of Open Access Journals (Sweden)

    Filipović Miroslava

    2007-01-01

    Full Text Available More than two decades after the beginning of the financial revolution globalization of capital flows still attracts considerable attention, from both practitioners and academics. The aim of this paper is to contribute to understanding of some aspects of the global capital scene, as well as to emphasize certain developments which might illustrate its changing profile. Several fundamental perspectives profile the global capital market. A quantitative review provides a sense of sheer volumes, trends, origins and destinations of capital flows; an assessment of the global capital market’s degree of integration follows. The emergence of new (types of actors is another important aspect of the global processes, while illustrations of new market products and emerging segments may add new perspectives on the profile of the global capital market. Finally, the paper concludes with a brief overview of digitalization of the financial supply chain.

  7. Evolution of Edge Pedestal Profiles Between ELMs

    Science.gov (United States)

    Floyd, J. P.; Stacey, W. M.; Groebner, R. J.

    2012-10-01

    The measured edge profile evolution in DIII-D discharges is analyzed in terms of the implied thermal diffusivities, ion diffusion coefficients and pinch velocities, using the momentum-balance methodology of Ref. [1], extended to take into account ion orbit loss and X-point loss. The evolution of the density, temperature, rotation and radial electric field profiles in the edge pedestal between edge localized modes (ELMs) provides information of these diffusive and non-diffusive transport processes in the pedestal of H-mode plasmas. This methodology is incorporated in the GTEDGE code developed for DIII-D data interpretation. Using a smaller integration time for the charge exchange recombination measurements than in Ref. [1] allows a more detailed examination of the time evolution of the ion temperature and rotation profiles. 6pt [1] W.M. Stacey and R.J. Groebner, Nucl. Fusion 51, 063024 (2011).

  8. Natural gas annual 1993 supplement: Company profiles

    Energy Technology Data Exchange (ETDEWEB)

    1995-02-01

    The Natural Gas Annual provides information on the supply and disposition of natural gas to a wide audience including industry, consumers, Federal and State agencies, and educational institutions. This report, the Natural Gas Annual 1993 Supplement: Company Profiles, presents a detailed profile of 45 selected companies in the natural gas industry. The purpose of this report is to show the movement of natural gas through the various States served by the companies profiled. The companies in this report are interstate pipeline companies or local distribution companies (LDC`s). Interstate pipeline companies acquire gas supplies from company owned production, purchases from producers, and receipts for transportation for account of others. Pipeline systems, service area maps, company supply and disposition data are presented.

  9. Surface glycosylation profiles of urine extracellular vesicles.

    Directory of Open Access Journals (Sweden)

    Jared Q Gerlach

    Full Text Available Urinary extracellular vesicles (uEVs are released by cells throughout the nephron and contain biomolecules from their cells of origin. Although uEV-associated proteins and RNA have been studied in detail, little information exists regarding uEV glycosylation characteristics. Surface glycosylation profiling by flow cytometry and lectin microarray was applied to uEVs enriched from urine of healthy adults by ultracentrifugation and centrifugal filtration. The carbohydrate specificity of lectin microarray profiles was confirmed by competitive sugar inhibition and carbohydrate-specific enzyme hydrolysis. Glycosylation profiles of uEVs and purified Tamm Horsfall protein were compared. In both flow cytometry and lectin microarray assays, uEVs demonstrated surface binding, at low to moderate intensities, of a broad range of lectins whether prepared by ultracentrifugation or centrifugal filtration. In general, ultracentrifugation-prepared uEVs demonstrated higher lectin binding intensities than centrifugal filtration-prepared uEVs consistent with lesser amounts of co-purified non-vesicular proteins. The surface glycosylation profiles of uEVs showed little inter-individual variation and were distinct from those of Tamm Horsfall protein, which bound a limited number of lectins. In a pilot study, lectin microarray was used to compare uEVs from individuals with autosomal dominant polycystic kidney disease to those of age-matched controls. The lectin microarray profiles of polycystic kidney disease and healthy uEVs showed differences in binding intensity of 6/43 lectins. Our results reveal a complex surface glycosylation profile of uEVs that is accessible to lectin-based analysis following multiple uEV enrichment techniques, is distinct from co-purified Tamm Horsfall protein and may demonstrate disease-specific modifications.

  10. Fructose intervention for 12 weeks does not impair glycemic control or incretin hormone responses during oral glucose or mixed meal tests in obese men

    DEFF Research Database (Denmark)

    Matikainen, N; Söderlund, S; Björnson, E

    2017-01-01

    were measured during oral glucose tolerance test (OGTT) and triglycerides (TG), GLP-1, GIP and PYY during a mixed meal test before and after fructose intervention. Fructose intervention did not worsen glucose and insulin responses during OGTT, and GLP-1 and GIP responses during OGTT and fat-rich meal...... responses during OGTT or GLP-1, GIP or PYY responses during a mixed meal. Therefore, fructose intake, even accompanied with mild weight gain, increases in liver fat and worsening of postprandial TG profile, does not impair glucose tolerance or gut incretin response to oral glucose or mixed meal challenge....

  11. Influence of absorbed pump profile on the temperature distribution ...

    Indian Academy of Sciences (India)

    2017-01-20

    Jan 20, 2017 ... influence of profile width and super-Gaussian exponent of the profile on temperature distribution are investigated. Consequently, the profile width turns out to have a greater influence on the temperature compared to the type of the profile. Keywords. Side-pumped laser rod; pump cavity; absorbed pump ...

  12. Profiling of the Nigerian Entrepreneurs | Iyayi | African Research ...

    African Journals Online (AJOL)

    This paper took a cursory look on profiling of the Nigerian entrepreneurs because it is understood that entrepreneurs are differing in their behaviour compared to the non-entrepreneurs. To achieve this purpose several issues such the meaning of profile and profiling, theoretical framework of entrepreneurial profile, the ...

  13. The lensing properties of the Einasto profile

    OpenAIRE

    Retana-Montenegro, E.; Frutos-Alfaro, F.

    2011-01-01

    In recent high resolution N-body CDM simulations, it has been had found that nonsingular three-parameter models, e.g. the Einasto profile has a better performance better than the singular two-parameter models, e.g. the Navarro, Frenk and White in the fitting of a wide range of dark matter halos. A problem with this profile is that the surface mass density is non-analytical for general values of the Einasto index. Therefore, its other lensing properties have the same problem. We obtain an exac...

  14. Lidar for Wind and Optical Turbulence Profiling

    Directory of Open Access Journals (Sweden)

    Fastig Shlomo

    2018-01-01

    Full Text Available A field campaign for the comparison investigation of systems to measure wind and optical turbulence profiles was conducted in northern Germany. The experimental effort was to compare the performance of the LIDAR, SODAR-RASS and ultrasonic anemometers for the measurement of the above mentioned atmospheric parameters. Soreq's LIDAR is a fiber laser based system demonstrator for the vertical profiling of the wind and turbulence, based on the correlation of aerosol density variations. It provides measurements up to 350m with 20m resolution.

  15. Unsupervised Power Profiling for Mobile Devices

    DEFF Research Database (Denmark)

    Kjærgaard, Mikkel Baun; Blunck, Henrik

    Today, power consumption is a main limitation for mobile phones. To minimize the power consumption of popular and traditionally power-hungry location-based services requires knowledge of how individual phone features consume power, so that those features can be utilized intelligently for optimal...... power savings while at the same time maintaining good quality of service. This paper proposes an unsupervised API-level method for power profiling mobile phones based on genetic algorithms. The method enables accurate profiling of the power consumption of devices and thereby provides the information...

  16. Unsupervised Power Profiling for Mobile Devices

    DEFF Research Database (Denmark)

    Kjærgaard, Mikkel Baun; Blunck, Henrik

    2011-01-01

    Today, power consumption is a main limitation for mobile phones. To minimize the power consumption of popular and traditionally power-hungry location-based services requires knowledge of how individual phone features consume power, so that those features can be utilized intelligently for optimal...... power savings while at the same time maintaining good quality of service. This paper proposes an unsupervised API-level method for power profiling mobile phones based on genetic algorithms. The method enables accurate profiling of the power consumption of devices and thereby provides the information...

  17. 2004 energy balances and electricity profiles

    International Nuclear Information System (INIS)

    2007-02-01

    The Energy Balances and Electricity Profiles 2004 is the thirteenth issue in an internationally series of comparable energy data for selected developing countries. The data are arranged to show energy production, trade, conversion and consumption for each fuel used in the country. This publication is a source of overall consumption statistics of energy commodities in all sectors. Special electricity profiles for an additional group of countries are published to cover, exclusively, detailed information on production, trade and consumption of electricity, net installed capacity and thermal power plant input for selected developing countries

  18. Criminal psychological profiling of serial arson crimes.

    Science.gov (United States)

    Kocsis, Richard N; Cooksey, Ray W

    2002-12-01

    The practice of criminal psychological profiling is frequently cited as being applicable to serial arson crimes. Despite this claim, there does not appear to be any empirical research that examines serial arson offence behaviors in the context of profiling. This study seeks to develop an empirical model of serial arsonist behaviors that can be systematically associated with probable offender characteristics. Analysis has produced a model of offence behaviors that identify four discrete behavior patterns, all of which share a constellation of common nondiscriminatory behaviors. The inherent behavioral themes of each of these patterns are explored with discussion of their broader implications for our understanding of serial arson and directions for future research.

  19. On the Evaluation of Entity Profiles

    DEFF Research Database (Denmark)

    de Rijke, Maarten; Balog, Krisztian; Bogers, Toine

    be assessed by means of precision and recall values of the descriptive terms produced. However, recent evidence suggests that more sophisticated metrics are needed that go beyond mere lexical matching of system-produced descriptors against a ground truth, allowing for graded relevance and rewarding diversity......Entity profiling is the task of identifying and ranking descriptions of a given entity. The task may be viewed as one where the descriptions being sought are terms that need to be selected from a knowledge source (such as an ontology or thesaurus). In this case, entity profiling systems can...... in the list of descriptors returned. In this note, we motivate and propose such a metric....

  20. Profiling hydrogen in materials using ion beams

    International Nuclear Information System (INIS)

    Ziegler, J.F.; Wu, C.P.; Williams, P.

    1977-01-01

    Over the last few years many ion beam techniques have been reported for the profiling of hydrogen in materials. Nine of these were evaluated using similar samples of hydrogen ion-implanted into silicon. When possible the samples were analyzed using two or more techniques to confirm the ion-implanted accuracy. The results of this analysis which has produced a consensus profile of H in silicon which is useful as a calibration standard are reported. The analytical techniques used have capabilities ranging from very high depth resolution (approximately 50 A) and high sensitivity (less than 1 ppM) to deep probes for hydrogen which can sample throughout thin sheets

  1. A study on online learner profile for supporting personalized learning

    Directory of Open Access Journals (Sweden)

    Jie Yang

    2013-09-01

    Full Text Available Digital learning as a popular learning approach has received increasing attention in modern education. The learner profile in online learning plays a critical role in supporting personalized learning. This article uses an information flow-based approach to build the learner profile for supporting personalized learning. The learner profile includes the individual profile to capture the personal features and the community profile to capture the social features in online learning environment.

  2. High-resolution humidity profiles retrieved from wind profiler radar measurements

    Science.gov (United States)

    Saïd, Frédérique; Campistron, Bernard; Di Girolamo, Paolo

    2018-03-01

    The retrieval of humidity profiles from wind profiler radars has already been documented in the past 30 years and is known to be neither as straightforward and nor as robust as the retrieval of the wind velocity. The main constraint to retrieve the humidity profile is the necessity to combine measurements from the wind profiler and additional measurements (such as observations from radiosoundings at a coarser time resolution). Furthermore, the method relies on some assumptions and simplifications that restrict the scope of its application. The first objective of this paper is to identify the obstacles and limitations and solve them, or at least define the field of applicability. To improve the method, we propose using the radar capacity to detect transition levels, such as the top level of the boundary layer, marked by a maximum in the radar reflectivity. This forces the humidity profile from the free troposphere and from the boundary layer to coincide at this level, after an optimization of the calibration coefficients, and reduces the error. The resulting mean bias affecting the specific humidity profile never exceeds 0.25 g kg-1. The second objective is to explore the capability of the algorithm to retrieve the humidity vertical profiles for an operational purpose by comparing the results with observations from a Raman lidar.

  3. Molecular, Serological And Microbiological Profiling Evidence Of ...

    African Journals Online (AJOL)

    All items that the boy had contact with including a laboratory coat, bunch of keys and shoes were swabbed. Finally samples of all the boy's food and drinks were taken. Microbiological, Serological and Polymerase Chain Reaction (PCR) Profiling Assays. l the samples were cultured on Sorbitol - MacConkey (SMAC) agar, ...

  4. Somatic symptom profiles in the general population

    DEFF Research Database (Denmark)

    Eliasen, Marie; Jørgensen, Torben; Schröder, Andreas

    2017-01-01

    PURPOSE: The aim of this study was to identify and describe somatic symptom profiles in the general adult population in order to enable further epidemiological research within multiple somatic symptoms. METHODS: Information on 19 self-reported common somatic symptoms was achieved from a population...

  5. Atmospheric Profile Imprint in Firewall Ablation Coefficient

    Science.gov (United States)

    Ceplecha, Z.; Pecina, P.

    1984-01-01

    A general formula which expresses the distance along the meteoric fireball trajectory 1 as a function of t is discussed. Differential equations which include the motion and ablation of a single nonfragmenting meteor body are presented. The importance of the atmospheric density profile in the meteor formula is emphasized.

  6. Criminal Justice. Occupational Competency Analysis Profile.

    Science.gov (United States)

    Ohio State Univ., Columbus. Vocational Instructional Materials Lab.

    This Occupational Competency Analysis Profile (OCAP) contains a competency list verified by expert workers and developed through a modified DACUM (Developing a Curriculum) involving business, industry, labor, and community agency representatives from Ohio. This OCAP identifies the occupational, academic, and employability skills (competencies)…

  7. Flange Curling in Cold Formed Profiles

    DEFF Research Database (Denmark)

    Jönsson, Jeppe; Ramonas, Gediminas

    2012-01-01

    The non-linear flange curling phenomenon in cold formed profiles is the tendency of slender flanges to deform towards the neutral axis for increasing flexural curvature. Based on Braziers work, Winter proposed a simple engineering formula for determination of the local flange deformation towards...

  8. Estimation and display of beam density profiles

    Energy Technology Data Exchange (ETDEWEB)

    Dasgupta, S; Mukhopadhyay, T; Roy, A; Mallik, C

    1989-03-15

    A setup in which wire-scanner-type beam-profile monitor data are collected on-line in a nuclear data-acquisition system has been used and a simple algorithm for estimation and display of the current density distribution in a particle beam is described.

  9. Ceramide profile in hypohidrotic ectodermal dysplasia

    DEFF Research Database (Denmark)

    Jungersted, J. M.; Høgh, Julie Kaae; Hellgren, Lars

    2012-01-01

    Background. Hypohidrotic ectodermal dysplasia (HED) is a rare genetic disease. The clinical presentation includes lack of sweating ability, and an often widely spread dermatitis resembling atopic dermatitis (AD). In AD, the skin‐barrier defect is partly ascribed to the altered lipid profile...

  10. Recommending Research Profiles for Multidisciplinary Academic Collaboration

    Science.gov (United States)

    Gunawardena, Sidath Deepal

    2013-01-01

    This research investigates how data on multidisciplinary collaborative experiences can be used to solve a novel problem: recommending research profiles of potential collaborators to academic researchers seeking to engage in multidisciplinary research collaboration. As the current domain theories of multidisciplinary collaboration are insufficient…

  11. Complications, disease profile and histological yield from ...

    African Journals Online (AJOL)

    Objective. The objective of the study was to evaluate (i) the technique used at Universitas Hospital in comparison with other international centres also performing renal biopsies, (ii) the disease profile in patients undergoing renal biopsies, (iii) the complications experienced during and/or after the procedure, and (iv) the ...

  12. State Education Finance and Governance Profile: Tennessee

    Science.gov (United States)

    Krause, Mike

    2010-01-01

    This article presents the state education finance and governance profile of Tennessee. The 17th largest state, Tennessee is home to 2.01% of the nation's inhabitants. Funding of K-12 education in Tennessee is accomplished via a formula known as the Basic Educational Program (BEP). This plan primarily utilizes school district enrollment numbers to…

  13. Doing Business 2014 Economy Profile : Australia

    OpenAIRE

    World Bank; International Finance Corporation

    2013-01-01

    This economy profile presents the Doing Business indicators for Australia. In a series of annual reports, Doing Business assesses regulations affecting domestic firms in 189 economies and ranks the economies in 10 areas of business regulation, such as starting a business, resolving insolvency and trading across borders. This year's report data cover regulations measured from June 2012 thro...

  14. Doing Business Economy Profile 2017 : Australia

    OpenAIRE

    World Bank Group

    2016-01-01

    This economy profile presents the Doing Business indicators for Australia. To allow useful comparison, it also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2017 is the 14th in a series of annual reports investigating the regulations that enhance business activity and those that constrain it. Economies are ranked on their ease of doing...

  15. Network-based analysis of proteomic profiles

    KAUST Repository

    Wong, Limsoon

    2016-01-26

    Mass spectrometry (MS)-based proteomics is a widely used and powerful tool for profiling systems-wide protein expression changes. It can be applied for various purposes, e.g. biomarker discovery in diseases and study of drug responses. Although RNA-based high-throughput methods have been useful in providing glimpses into the underlying molecular processes, the evidences they provide are indirect. Furthermore, RNA and corresponding protein levels have been known to have poor correlation. On the other hand, MS-based proteomics tend to have consistency issues (poor reproducibility and inter-sample agreement) and coverage issues (inability to detect the entire proteome) that need to be urgently addressed. In this talk, I will discuss how these issues can be addressed by proteomic profile analysis techniques that use biological networks (especially protein complexes) as the biological context. In particular, I will describe several techniques that we have been developing for network-based analysis of proteomics profile. And I will present evidence that these techniques are useful in identifying proteomics-profile analysis results that are more consistent, more reproducible, and more biologically coherent, and that these techniques allow expansion of the detected proteome to uncover and/or discover novel proteins.

  16. The first decade of MALDI protein profiling

    DEFF Research Database (Denmark)

    Albrethsen, Jakob

    2011-01-01

    MALDI protein profiling has identified several important challenges in omics-based biomarker research. First, research into the analytical performance of a novel omics-platform of potential diagnostic impact must be carried out in a critical manner and according to common guidelines. Evaluation s...

  17. Electronics Technology. Tech Prep Competency Profile.

    Science.gov (United States)

    Lakeland Tech Prep Consortium, Kirtland, OH.

    This tech prep competency profile covers the occupation of electronics technician. Section 1 provides the occupation definition. Section 2 lists development committee members. Section 3 provides the leveling codes--abbreviations for grade level, (by the end of grade 12, by the end of associate degree), academic codes (communications, math, or…

  18. Poultry Producer. Ohio's Competency Analysis Profile.

    Science.gov (United States)

    Ohio State Univ., Columbus. Vocational Instructional Materials Lab.

    This Ohio Competency Analysis Profile (OCAP), derived from a modified Developing a Curriculum (DACUM) process, is a comprehensive and verified employer competency list for a poultry producer program. It contains units (with or without subunits), competencies, and competency builders that identify the occupational, academic, and employability…

  19. Country Nuclear Power Profiles - 2009 Edition

    International Nuclear Information System (INIS)

    2009-08-01

    The Country Nuclear Power Profiles compiles background information on the status and development of nuclear power programs in Member States. It consists of organizational and industrial aspects of nuclear power programs and provides information about the relevant legislative, regulatory, and international framework in each country. Its descriptive and statistical overview of the overall economic, energy, and electricity situation in each country, and its nuclear power framework is intended to serve as an integrated source of key background information about nuclear power programs in the world. The preparation of Country Nuclear Power Profiles (CNPP) was initiated in 1990s. It responded to a need for a database and a technical publication containing a description of the energy and economic situation, the energy and the electricity sector, and the primary organizations involved in nuclear power in IAEA Member States. This is the 2009 edition issued on CD-ROM and Web pages. It updates the country information for 44 countries. The CNPP is updated based on information voluntarily provided by participating IAEA Member States. Participants include the 30 countries that have operating nuclear power plants, as well as 14 countries having past or planned nuclear power programmes (Bangladesh, Egypt, Ghana, Indonesia, the Islamic Republic of Iran, Italy, Kazakhstan, Nigeria, Philippines, Poland, Thailand, Tunisia, Turkey and Vietnam). For the 2009 edition, 26 countries provided updated or new profiles. For the other countries, the IAEA updated the profile statistical tables on nuclear power, energy development, and economic indicators based on information from IAEA and World Bank databases

  20. The RIASEC Profile of Foreign Language Teachers

    Science.gov (United States)

    Swanson, Peter B.

    2008-01-01

    Vocational choice appears to crystallize during adolescence and one's career aspirations begin to take shape later. Over 40 years ago Holland studied incoming freshman to match vocational aspirations to vocational preference profiles. Individuals seeking to become foreign language teachers were assigned a Social, Artistic, Enterprising vocational…

  1. Doing Business 2014 Economy Profile : Croatia

    OpenAIRE

    World Bank; International Finance Corporation

    2013-01-01

    This economy profile presents the Doing Business indicators for Croatia. In a series of annual reports, Doing Business assesses regulations affecting domestic firms in 189 economies and ranks the economies in 10 areas of business regulation, such as starting a business, resolving insolvency and trading across borders. This year's report data cover regulations measured from June 2012 throug...

  2. E-Commerce Marketing State Competency Profile.

    Science.gov (United States)

    Ohio State Univ., Columbus. Tech Prep Curriculum Services.

    This profile provides the curricular framework for Ohio Tech Prep programs in e-commerce marketing beginning in high school and continuing through the end of the associate degree. It includes a comprehensive set of e-commerce marketing competencies that reflect job opportunities and skills required for e-commerce marketing professionals today and…

  3. Doing Business 2014 Economy Profile : Chile

    OpenAIRE

    World Bank; International Finance Corporation

    2013-01-01

    This economy profile presents the Doing Business indicators for Chile In a series of annual reports, Doing Business assesses regulations affecting domestic firms in 189 economies and ranks the economies in 10 areas of business regulation, such as starting a business, resolving insolvency and trading across borders. This year's report data cover regulations measured from June 2012 through M...

  4. Illustrating Enzyme Inhibition Using Gibbs Energy Profiles

    Science.gov (United States)

    Bearne, Stephen L.

    2012-01-01

    Gibbs energy profiles have great utility as teaching and learning tools because they present students with a visual representation of the energy changes that occur during enzyme catalysis. Unfortunately, most textbooks divorce discussions of traditional kinetic topics, such as enzyme inhibition, from discussions of these same topics in terms of…

  5. Pathological Demand Avoidance: Exploring the Behavioural Profile

    Science.gov (United States)

    O'Nions, Elizabeth; Viding, Essi; Greven, Corina U; Ronald, Angelica; Happé, Francesca

    2014-01-01

    "Pathological Demand Avoidance" is a term increasingly used by practitioners in the United Kingdom. It was coined to describe a profile of obsessive resistance to everyday demands and requests, with a tendency to resort to "socially manipulative" behaviour, including outrageous or embarrassing acts. Pathological demand…

  6. On the assessment of expertise profiles

    NARCIS (Netherlands)

    Berendsen, R.; Rijke, M. de; Balog, K.; Bogers, T.; Bosch, A.P.J. van den

    2013-01-01

    Expertise retrieval has attracted significant interest in the field of information retrieval. Expert finding has been studied extensively, with less attention going to the complementary task of expert profiling, that is, automatically identifying topics about which a person is knowledgeable. We

  7. Educational Data Base and School Profile Reports.

    Science.gov (United States)

    Chiang, Eleanor Yin

    This report describes the development in 1986 of a management information system by the Sacramento City (California) Unified School District for use in high schools. A nine-page attachment, which comprises two-thirds of the report, offers profiles of selected schools drawn from the databases. Data sets of 200 information items, collected from all…

  8. User Profiling in Online Marketplaces and Security

    Science.gov (United States)

    Koh, Byungwan

    2011-01-01

    The advent of information technology has enabled firms to collect significant amounts of data about individuals and mine the data for developing their strategies. Profiling of individuals is one common use of data collected about them. It refers to using known or inferred information to categorize the type of an individual and to tailor specific…

  9. Generic methodology for calibrating profiling nacelle lidars

    DEFF Research Database (Denmark)

    Borraccino, Antoine; Courtney, Michael; Wagner, Rozenn

    Improving power performance assessment by measuring at different heights has been demonstrated using ground-based profiling LIDARs. More recently, nacelle-mounted lidars studies have shown promising capabilities to assess power performance. Using nacelle lidars avoids the erection of expensive me...

  10. Epidemiological and antibiotic susceptibility profiles of infectious ...

    African Journals Online (AJOL)

    2011-09-28

    Sep 28, 2011 ... profiles of infectious bacterial diarrhoea in Juba, ... a Field Epidemiology and Laboratory Training Program (FELTP) resident, Jomo Kenyatta University of Agriculture and Technology, Nairobi, ... Teaching Hospital (JTH), Al Sabah children's hospital, .... Only 12 (4.2%) participants reached higher education.

  11. Beam profiles for fast neutrons; and reply

    International Nuclear Information System (INIS)

    Bewley, D.K.; Parnell, C.J.; Bloch, P.

    1976-01-01

    The authors express surprise that Bloch et al. (Bloch, P.H., Hendry, G.O., Hilton, J.L., Quam, W.M., Reinhard, D.K., and Wilson, C., 1976, Phys. Med. Biol., Vol. 21, 450) justified a target size of 5.5 x 5.5 cm in a neutron generator by comparison with the profile given by a 2.5 MV X-ray generator. The penumbral width of this new neutron generator is more than twice that of a modern megavoltage X-ray machine, and larger than those of beams from standard 60 Co units, or of the Hammersmith Hospital cyclotron beam. The large target size of the neutron generator may have to be accepted as a necessary evil, but should not be considered satisfactory. In reply, one of the authors of the original note presents the results of calculations of beam profiles for 14 MeV neutron beams in a tissue-equivalent phantom, and suggests that the broader profiles are principally caused by the larger probability of side scatter, not by source size. The most fruitful approach to sharpening the neutron beam profile would seem to be to design a field flattening filter to increase relative dose near the edge inside the geometrically defined field. Calculations indicating that Bewley and Parnell have underestimated the penumbral widths of 60 Co beams are also presented. (U.K.)

  12. Metabolic Profiling of Alpine and Ecuadorian Lichens

    Directory of Open Access Journals (Sweden)

    Verena K. Mittermeier

    2015-10-01

    Full Text Available Non-targeted 1H-NMR methods were used to determine metabolite profiles from crude extracts of Alpine and Ecuadorian lichens collected from their natural habitats. In control experiments, the robustness of metabolite detection and quantification was estimated using replicate measurements of Stereocaulon alpinum extracts. The deviations in the overall metabolite fingerprints were low when analyzing S. alpinum collections from different locations or during different annual and seasonal periods. In contrast, metabolite profiles observed from extracts of different Alpine and Ecuadorian lichens clearly revealed genus- and species-specific profiles. The discriminating functions determining cluster formation in principle component analysis (PCA were due to differences in the amounts of genus-specific compounds such as sticticin from the Sticta species, but also in the amounts of ubiquitous metabolites, such as sugar alcohols or trehalose. However, varying concentrations of these metabolites from the same lichen species e.g., due to different environmental conditions appeared of minor relevance for the overall cluster formation in PCA. The metabolic clusters matched phylogenetic analyses using nuclear ribosomal DNA (nrDNA internal transcribed spacer (ITS sequences of lichen mycobionts, as exemplified for the genus Sticta. It can be concluded that NMR-based non-targeted metabolic profiling is a useful tool in the chemo-taxonomy of lichens. The same approach could also facilitate the discovery of novel lichen metabolites on a rapid and systematical basis.

  13. Graphic Communications. Occupational Competency Analysis Profile.

    Science.gov (United States)

    Ohio State Univ., Columbus. Vocational Instructional Materials Lab.

    This Occupational Competency Analysis Profile (OCAP), which is one of a series of OCAPs developed to identify the skills that Ohio employers deem necessary to entering a given occupation/occupational area, lists the occupational, academic, and employability skills required of individuals entering graphic communications occupations. The…

  14. Educational Evaluation and the Hartman Value Profile.

    Science.gov (United States)

    Byrum, Stephen C.

    1979-01-01

    A tool consisting of 2 sets of 18 statements and requiring 20 minutes for administration, the Hartman Value Profile evaluates progress and maturity in areas not readily adaptable to more objective means of evaluation. Firsthand experiences with the HVP have indicated successful evaluations of postsecondary student thinking. (JC)

  15. Demand side management using profile steering

    NARCIS (Netherlands)

    Gerards, Marco Egbertus Theodorus; Toersche, Hermen; Hoogsteen, Gerwin; van der Klauw, Thijs; Hurink, Johann L.; Smit, Gerardus Johannes Maria

    2015-01-01

    Many Demand Side Management (DSM) approaches use energy prices as steering signals. This paper shows that such steering signals may result in power quality problems and high losses. As an alternative, this paper proposes to use desired (e.g., flat) power profiles as steering signals and presents an

  16. Extending Profiles with Stereotypes for Composite Concepts

    NARCIS (Netherlands)

    Quartel, Dick; Dijkman, R.M.; van Sinderen, Marten J.; Briand, L.; Williams, C.

    2005-01-01

    This paper proposes an extension of the UML 2.0 profiling mechanism. This extension facilitates a language designer to introduce composite concepts as separate conceptual and notational elements in a modelling language. Composite concepts are compositions of existing concepts. To facilitate the

  17. Lateral pressure profiles in lipid monolayers

    NARCIS (Netherlands)

    Baoukina, Svetlana; Marrink, Siewert J.; Tieleman, D. Peter

    2010-01-01

    We have used molecular dynamics simulations with coarse-grained and atomistic models to study the lateral pressure profiles in lipid monolayers. We first consider simple oil/air and oil/water interfaces, and then proceed to lipid monolayers at air/water and oil/water interfaces. The results are

  18. Determining a carbohydrate profile for Hansenula polymorpha

    Science.gov (United States)

    Petersen, G. R.

    1985-01-01

    The determination of the levels of carbohydrates in the yeast Hansenula polymorpha required the development of new analytical procedures. Existing fractionation and analytical methods were adapted to deal with the problems involved with the lysis of whole cells. Using these new procedures, the complete carbohydrate profiles of H. polymorpha and selected mutant strains were determined and shown to correlate favourably with previously published results.

  19. Real-time PCR gene expression profiling

    Czech Academy of Sciences Publication Activity Database

    Kubista, Mikael; Sjögreen, B.; Forootan, A.; Šindelka, Radek; Jonák, Jiří; Andrade, J.M.

    2007-01-01

    Roč. 1, - (2007), s. 56-60 ISSN 1360-8606 R&D Projects: GA AV ČR KJB500520601 Institutional research plan: CEZ:AV0Z50520514 Keywords : real - time PCR, * expression profiling * statistical analysis Subject RIV: EB - Genetics ; Molecular Biology

  20. Fluorine concentration profiles in archaeological bone

    International Nuclear Information System (INIS)

    Coote, G.E.; Sparks, R.J.

    1981-01-01

    The nuclear microprobe at the Institute of Nuclear Sciences was applied to the measurement of radial concentration profiles of fluorine, in transverse slices of archaeological bone from humans, moas, and other animals. A beam of 2.5 MeV protons was focused to a rectangular spot 250 microns by 50 microns, traversed along a radial line 3mm long, and gamma rays of 5-7 MeV from the reaction 19 F(p, α#betta#) 16 O were detected in a large sodium iodide crystal. Bombardment caused no detectable loss of fluorine from the bone. Measured profiles display a wide variety of shapes and maximum concentrations. In bones which had been exposed to ground water the fluorine concentration usually increases from the centre towards the surface, sometimes by as much as a factor of eight. The concentration at the surface is usually in the range 0.2 to 1%, though in moa bone from a limestone cave it is only 0.025%. Once a quantitative method of analysis has been developed, based on the shape of the profile rather than its magnitude, these profiles might be useful for dating bone. In the meantime, they could be used to distinguish bones of different ages from a common site

  1. Venous thromboembolism: Risk profile and management of ...

    African Journals Online (AJOL)

    Objectives. This study aims to describe the venous thromboembolism (VTE) risk profile of women undergoing elective gynaecological surgery in a tertiary hospital and to audit the VTE prophylaxis prescribed. Methods. One hundred and nine women who underwent elective gynaecological surgery at Kalafong Provincial ...

  2. Sports participation, anthropometric and physiological profiles of ...

    African Journals Online (AJOL)

    Sports participation has been adjudged to enhance healthy living. This study described anthropometric and physiological (A-P) profiles of university athletes based on types of sports (ToS) and duration (in years) of participation (DoP). One hundred and twenty-nine athletes (69 males, 60 females), aged l5-36, who had ...

  3. Olympic Training Film Profiles. Volume III.

    Science.gov (United States)

    1971

    Approximately 250 instructional films are described in Volume Three (1970-1971) of this review. After an introduction which considers film discussions from the instructor's point of view and offers some ideas for conducting a film showing and ordering the films, profiles of the films are presented grouped under such areas as management…

  4. Current deposition profiles in advanced geometries

    International Nuclear Information System (INIS)

    Wright, J.C.; Phillips, C.K.; Bonoli, P.T.

    1997-01-01

    In advanced toroidal devices, plasma shaping can have a significant effect on quantities of interest, including the radio frequency (RF) deposited power and current. Most 2D RF modeling codes use a parameterization of current drive efficiencies to calculate fast wave driven currents. This parameterization is derived from a ray-tracing model in a low-beta model equilibrium. There are difficulties in applying it to a spectrum of waves, and it cannot account for multiple resonances and coherency effects between the electrons and the waves. By evaluating a formulation of the quasilinear diffusion coefficient in an arbitrary inhomogenous geometry with the fields from a full wave code, we address the effects of wave spectra, plasma inhomogeneity, and plasma profile on the evaluation of current deposition profiles. Current profiles are calculated directly from the quasilinear diffusion using the adjoint formulation, with the magnetic equilibrium specified consistently in both the adjoint routine and the full wave code. Results are benchmarked by comparing a power deposition calculation from conductivity to one from the quasilinear expression. RF driven current profiles for various devices, including tokamaks with different aspect ratios, will be presented. copyright 1997 American Institute of Physics

  5. Epidemiology and clinical profile of common musculoskeletal ...

    African Journals Online (AJOL)

    Epidemiology and clinical profile of common musculoskeletal diseases in patients with diabetes mellitus at Tikur Anbessa Specialized Hospital in Addis Ababa, Ethiopia. ... or worsening of MSD. Keywords: musculoskeletal complications; diabetic foot; foot care; trigger finger; Dupuytren's contracture; stiff frozen shoulder ...

  6. Doing Business Economy Profile 2017 : Uruguay

    OpenAIRE

    World Bank Group

    2016-01-01

    This economy profile presents the Doing Business indicators for Uruguay. To allow useful comparison, it also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2017 is the 14th in a series of annual reports investigating the regulations that enhance business activity and those that constrain it. Economies are ranked on their ease of doing b...

  7. Matching Profiles from Social Network Sites

    NARCIS (Netherlands)

    Veldman, Irma

    2009-01-01

    In recent years social networking sites have become very popular. Many people are member of one or more of these profile sites and tend to put a lot of informa- tion about themselves online. This often publicly available data can be useful for many purposes. Retrieving all available data from one

  8. A new method for depth profiling

    International Nuclear Information System (INIS)

    Chittleborough, C.W.; Chaudhri, M.A.; Rouse, J.L.

    1978-01-01

    A simple method for obtaining depth profiles of concentrations has been developed for charged particle induced nuclear reactions which produce γ-rays or neutrons. This method is particularly suitable for non-resonant reactions but is also applicable to resonant reactions and can examine the concentration of the sought nuclide throughout the entire activation depth of the incoming particles in the matrix

  9. Older People of Tomorrow: A Psychosocial Profile.

    Science.gov (United States)

    Silverstone, Barbara

    1996-01-01

    Attempts to narrow the scope of present uncertainties about the older population by sketching a psychosocial profile of the older people of tomorrow based on what is known today. Focuses on the baby boom generation and the interplay between personal attributes they could bring to late life and the social and physical environment in which they…

  10. Doing Business 2014 Economy Profile : Taiwan, China

    OpenAIRE

    World Bank; International Finance Corporation

    2013-01-01

    This economy profile presents the Doing Business indicators for Taiwan. In a series of annual reports, Doing Business assesses regulations affecting domestic firms in 189 economies and ranks the economies in 10 areas of business regulation, such as starting a business, resolving insolvency and trading across borders. This year's report data cover regulations measured from June 2012 through...

  11. Doing Business 2014 Economy Profile : Marshall Islands

    OpenAIRE

    World Bank; International Finance Corporation

    2013-01-01

    This economy profile presents the Doing Business indicators for Marshall Islands. In a series of annual reports, Doing Business assesses regulations affecting domestic firms in 189 economies and ranks the economies in 10 areas of business regulation, such as starting a business, resolving insolvency and trading across borders. This year's report data cover regulations measured from June 20...

  12. Antimicrobial resistance and plasmid profiles of Aeromonas ...

    African Journals Online (AJOL)

    The purpose of this study was to investigate the presence of Aeromonas hydrophila at commonly used water collection points on the River Njoro and to determine the in-vitro antimicrobial susceptibility and plasmid profiles of isolates. In total, 126 samples were collected and 36.5% of them were positive for A. hydrophila.

  13. Concentration profiles near an activated enzyme.

    Science.gov (United States)

    Park, Soohyung; Agmon, Noam

    2008-09-25

    When a resting enzyme is activated, substrate concentration profile evolves in its vicinity, ultimately tending to steady state. We use modern theories for many-body effects on diffusion-influenced reactions to derive approximate analytical expressions for the steady-state profile and the Laplace transform of the transient concentration profiles. These show excellent agreement with accurate many-particle Brownian-dynamics simulations for the Michaelis-Menten kinetics. The steady-state profile has a hyperbolic dependence on the distance of the substrate from the enzyme, albeit with a prefactor containing the complexity of the many-body effects. These are most conspicuous for the substrate concentration at the surface of the enzyme. It shows an interesting transition as a function of the enzyme turnover rate. When it is high, the contact concentration decays monotonically to steady state. However, for slow turnover it is nonmonotonic, showing a minimum due to reversible substrate binding, then a maximum due to diffusion of new substrate toward the enzyme, and finally decay to steady state. Under certain conditions one can obtain a good estimate for the critical value of the turnover rate constant at the transition.

  14. Sensitivity profiles calculated with the UNISENS system

    International Nuclear Information System (INIS)

    Claro, L.H.; Menezes, A.

    1985-01-01

    Sensitivity profiles of the multiplication factor and several central reaction ratios for benchmarks ZPR 6/7, ZPR 3/11, FLATTOP-25, GODIVA and BIG-TEN, are presented in grafic form. A possible utilization is showed throught some modification to the ENDF/B-IV data file proposed for version ENDF/B-V. (Author) [pt

  15. Suspended Solids Profiler Shop Test Report

    International Nuclear Information System (INIS)

    STAEHR, T.W.

    2000-01-01

    The Suspended Solids Profiler (SSP) Instrument is planned to be installed in the AZ-101 tank to measure suspended solids concentrations during mixer pump testing. The SSP sensor uses a reflectance measurement principle to determine the suspended solids concentrations. The purpose of this test is to provide a documented means of verifying that the functional components of the SSP operate properly

  16. Demographic profile of patients diagnosed with intracranial ...

    African Journals Online (AJOL)

    Abstract. Background: Meningiomas are common brain tumours and display gender, racial and ethnic differences in their demographic profile. ... The mean age of patients was 45.7 ± 10.5 years with a female-to-male ratio of 3.8:1. The mean ...

  17. Anthropometrical Profile, Skinfold Tickness and Subcutaneous Fat ...

    African Journals Online (AJOL)

    Background: The threatening health problems resulting from excess subcutaneous fat depositions have been reported by the world Health Organization. Also noteworthy is that childhood obesity is a pointer to adult obesity. This necessitated a study on the anthropometrical profiles of adolescents of Southeast Nigeria using ...

  18. Personality Profiles of Cultures: Aggregate Personality Traits

    Czech Academy of Sciences Publication Activity Database

    McCrae, R.R.; Terracciano, A.; Leibovich, N.B.; Schmidt, V.; Shakespeare-Finch, J.; Neubauer, A.; De Fruyt, F.; Munyae, M.; Flores-Mendoza, C.; Dahourou, D.; Ayearst, L. E.; Trobst, K.K.; Alcalay, L.; Simonetti, F.; Bratko, D.; Marušic´, I.; Hřebíčková, Martina; Mortensen, L.K.; Jensen, H.H.; Allik, J.; Realo, A.; Sineshaw, T.; Rolland, J-P.; Petot, J.M.; Camart, N.; Angleitner, A.; Ostendorf, F.; Yik, M.; Jónsson, F. H.; Pramila, V.S.; Halim, M. S.; Jaya, A.; Shahriar Shahidi, S.; Barbaranelli, C.; Shimonaka, Y.; Gakuin, B.; Nakazato, K.; Abdel Khalek, A. M.; Alansari, B. M.; Khoury, B.; Mastor, K.A.; Falzon, R.; Lauri, M.A.; Borg Cunen, M.A.; Scicluna Calleja, S.; Diaz-Loving, R.; Ghayur, M. A.; Fischer, R.; Oluyinka Ojedokun, A.; Prentice, G.; McRorie, M.; Wang, L.; Reátegui, N.; Brunner-Sciarra, M.; del Pilar, G.E.H.; Sekowski, A.; Klinkosz, W.; Pedroso de Lima, M.; Porrata, J.; Martin, T.A.; Ficková, E.; Adamovová, L.; Rus, V.R.; Podobnik, N.; Zupancic, A.; Ahn, H.; Ahn, Ch.; Avia, M. D.; Sánchez-Bernardos, M.L.; Ruch, W.; Rossier, J.; Chittcharat, N.; Gülgöz, S.; Nansubuga, F.; Smith, P.B.; Matsumoto, D.; Diener, E.; Beer, A.; Humrichouse, J.; Budzinski, L.; Oishi, S.; Knežević, G.; Djuric Jocic, D.

    2005-01-01

    Roč. 89, č. 3 (2005), s. 407-425 ISSN 0022-3514 R&D Projects: GA ČR GA406/01/1507 Institutional research plan: CEZ:AV0Z70250504 Keywords : personality * five-factor model * cross - cultural * culture-level analyses * culture profiles Subject RIV: AN - Psychology Impact factor: 4.211, year: 2005

  19. Potential and profile experiments in MM-4

    International Nuclear Information System (INIS)

    Tian Zhongyu; Ming Linzhou; Feng Xiaozhen; Feng Chuntang; Yin Youjun; Liu Yuhua; Wang Jihai

    1988-01-01

    Experimental results in MM-4 are presented. These results show that there were double potential wells and double ion temperatures in the plasma. The mechanism giving rise to such potential profiles can be attributed to the Stormer region in the cusp system and the different operation regimes of the electron gun used. The measured plasma potential was about - 200 - 300V

  20. Antibiotic susceptibility profiles of oral pathogens

    NARCIS (Netherlands)

    Veloo, A. C. M.; Seme, K.; Raangs, Gerwin; Rurenga, P.; Singadji, Z.; Wekema - Mulder, G.; van Winkelhoff, A. J.

    2012-01-01

    Periodontitis is a bacterial disease that can be treated with systemic antibiotics. The aim of this study was to establish the antibiotic susceptibility profiles of five periodontal pathogens to six commonly used antibiotics in periodontics. A total of 247 periodontal bacterial isolates were tested

  1. Job profile research for the purchasing profession

    NARCIS (Netherlands)

    Mulder, M.; Wesselink, R.; Bruijstens, H.Chr.J.

    2005-01-01

    The study reported in this article is based on theories about job and competence analysis and a project in which job profiles were developed that were aimed at providing a framework of reference for evaluating in-service training programmes for purchasing professionals (professional buyers of goods

  2. Exact analytical density profiles and surface tension

    Indian Academy of Sciences (India)

    journal of. May 2005 physics pp. 785–801. Classical charged fluids at equilibrium near ... is provided by the excess surface tension for an air–water interface, which is determined ... the potential drop created by the electric layer which appears as soon as the fluid has ...... radii, by symmetry, the charge density profile is flat,.

  3. Overview of progesterone profiles in dairy cows

    DEFF Research Database (Denmark)

    Blavy, P.; Derks, M.; Martin, O.

    2016-01-01

    The aim of this study was to gain a better understanding of the variability in shape and features of all progesterone profiles during oestrus cycles in cows, and to create templates for cycle shapes and features as a base for further research. Milk progesterone data from 1418 oestrus cycles, coming...

  4. Short guide to SDI profiling at ORNL

    Energy Technology Data Exchange (ETDEWEB)

    Pomerance, H.S.

    1976-06-01

    ORNL has machine-searchable data bases that correspond to printed indexes and abstracts. This guide describes the peculiarities of those several data bases and the conventions of the ORNL search system so that users can write their own queries or search profiles and can interpret the part of the output that is encoded.

  5. Diagnose Test-Taker's Profile in Terms of Core Profile Patterns: Principal Component (PC) vs. Profile Analysis via MDS (PAMS) Approaches.

    Science.gov (United States)

    Kim, Se-Kang; Davison, Mark L.

    A study was conducted to examine how principal components analysis (PCA) and Profile Analysis via Multidimensional Scaling (PAMS) can be used to diagnose individuals observed score profiles in terms of core profile patterns identified by each method. The standardization sample from the Wechsler Intelligence Scale for Children, Third Edition…

  6. The Dynamics of Gastric Emptying and Self-Reported Feelings of Satiation Are Better Predictors Than Gastrointestinal Hormones of the Effects of Lipid Emulsion Structure on Fat Digestion in Healthy Adults-A Bayesian Inference Approach

    DEFF Research Database (Denmark)

    Steingoetter, Andreas; Buetikofer, Simon; Curcic, Jelena

    2017-01-01

    and acid stability were stronger modulators of fat emptying and hormone profiles than were emulsion droplet size or redispersibility. Cholecystokinin and PYY were most strongly affected by fat emulsion instability and droplet size. Although both hormones were relevant predictors of gastric emptying, only...

  7. Ti(r) profiles from the JET neutron profile monitor for ohmic discharges

    Energy Technology Data Exchange (ETDEWEB)

    Esposito, B. (ENEA, Frascati (Italy). Centro Ricerche Energia); Marcus, F.B.; Conroy, S.; Jarvis, O.N.; Loughlin, M.J.; Sadler, G.; Belle, P. van (Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking); Adams, J.M.; Watkins, N. (AEA Industrial Technology, Harwell (United Kingdom))

    1991-01-01

    A study has been made of the neutron emissivity, using the JET neutron profile monitor, obtained for ohmically heated deuterium discharges. Both one-dimensional (1-D) best-fit inversion procedures and 2-D tomography have been used to deduce the radial profile of the neutron emission from the line-integral data. The profiles of ion temperature and ion thermal conductivity are then derived. The scaling of the ion thermal conductivity with plasma current is found to be opposite to that of neoclassical theory. (author) 4 refs., 5 figs.

  8. Metabolite Profiling of Red Sea Corals

    KAUST Repository

    Ortega, Jovhana Alejandra

    2016-12-01

    Looking at the metabolite profile of an organism provides insights into the metabolomic state of a cell and hence also into pathways employed. Little is known about the metabolites produced by corals and their algal symbionts. In particular, corals from the central Red Sea are understudied, but interesting study objects, as they live in one of the warmest and most saline environments and can provide clues as to the adjustment of corals to environmental change. In this study, we applied gas chromatography – mass spectrometry (GC–MS) metabolite profiling to analyze the metabolic profile of four coral species and their associated symbionts: Fungia granulosa, Acropora hemprichii, Porites lutea, and Pocillopora verrucosa. We identified and quantified 102 compounds among primary and secondary metabolites across all samples. F. granulosa and its symbiont showed a total of 59 metabolites which were similar to the 51 displayed by P. verrucosa. P. lutea and A. hemprichii both harbored 40 compounds in conjunction with their respective isolated algae. Comparing across species, 28 metabolites were exclusively present in algae, while 38 were exclusive to corals. A principal component and cluster analyses revealed that metabolite profiles clustered between corals and algae, but each species harbored a distinct catalog of metabolites. The major classes of compounds were carbohydrates and amino acids. Taken together, this study provides a first description of metabolites of Red Sea corals and their associated symbionts. As expected, the metabolites of coral hosts differ from their algal symbionts, but each host and algal species harbor a unique set of metabolites. This corroborates that host-symbiont species pairs display a fine-tuned complementary metabolism that provide insights into the specific nature of the symbiosis. Our analysis also revealed aquatic pollutants, which suggests that metabolite profiling might be used for monitoring pollution levels and assessing

  9. Childhood Sports Participation and Adolescent Sport Profile.

    Science.gov (United States)

    Gallant, François; O'Loughlin, Jennifer L; Brunet, Jennifer; Sabiston, Catherine M; Bélanger, Mathieu

    2017-12-01

    We aimed to increase understanding of the link between sport specialization during childhood and adolescent physical activity (PA). The objectives were as follows: (1) describe the natural course of sport participation over 5 years among children who are early sport samplers or early sport specializers and (2) determine if a sport participation profile in childhood predicts the sport profile in adolescence. Participants ( n = 756, ages 10-11 years at study inception) reported their participation in organized and unorganized PA during in-class questionnaires administered every 4 months over 5 years. They were categorized as early sport samplers, early sport specializers, or nonparticipants in year 1 and as recreational sport participants, performance sport participants, or nonparticipants in years 2 to 5. The likelihood that a childhood sport profile would predict the adolescent profile was computed as relative risks. Polynomial logistic regression was used to identify predictors of an adolescent sport profile. Compared with early sport specialization and nonparticipation, early sport sampling in childhood was associated with a higher likelihood of recreational participation (relative risk, 95% confidence interval: 1.55, 1.18-2.03) and a lower likelihood of nonparticipation (0.69, 0.51-0.93) in adolescence. Early sport specialization was associated with a higher likelihood of performance participation (1.65, 1.19-2.28) but not of nonparticipation (1.01, 0.70-1.47) in adolescence. Nonparticipation in childhood was associated with nearly doubling the likelihood of nonparticipation in adolescence (1.88, 1.36-2.62). Sport sampling should be promoted in childhood because it may be linked to higher PA levels during adolescence. Copyright © 2017 by the American Academy of Pediatrics.

  10. Merged ozone profiles from four MIPAS processors

    Science.gov (United States)

    Laeng, Alexandra; von Clarmann, Thomas; Stiller, Gabriele; Dinelli, Bianca Maria; Dudhia, Anu; Raspollini, Piera; Glatthor, Norbert; Grabowski, Udo; Sofieva, Viktoria; Froidevaux, Lucien; Walker, Kaley A.; Zehner, Claus

    2017-04-01

    The Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) was an infrared (IR) limb emission spectrometer on the Envisat platform. Currently, there are four MIPAS ozone data products, including the operational Level-2 ozone product processed at ESA, with the scientific prototype processor being operated at IFAC Florence, and three independent research products developed by the Istituto di Fisica Applicata Nello Carrara (ISAC-CNR)/University of Bologna, Oxford University, and the Karlsruhe Institute of Technology-Institute of Meteorology and Climate Research/Instituto de Astrofísica de Andalucía (KIT-IMK/IAA). Here we present a dataset of ozone vertical profiles obtained by merging ozone retrievals from four independent Level-2 MIPAS processors. We also discuss the advantages and the shortcomings of this merged product. As the four processors retrieve ozone in different parts of the spectra (microwindows), the source measurements can be considered as nearly independent with respect to measurement noise. Hence, the information content of the merged product is greater and the precision is better than those of any parent (source) dataset. The merging is performed on a profile per profile basis. Parent ozone profiles are weighted based on the corresponding error covariance matrices; the error correlations between different profile levels are taken into account. The intercorrelations between the processors' errors are evaluated statistically and are used in the merging. The height range of the merged product is 20-55 km, and error covariance matrices are provided as diagnostics. Validation of the merged dataset is performed by comparison with ozone profiles from ACE-FTS (Atmospheric Chemistry Experiment-Fourier Transform Spectrometer) and MLS (Microwave Limb Sounder). Even though the merging is not supposed to remove the biases of the parent datasets, around the ozone volume mixing ratio peak the merged product is found to have a smaller (up to 0.1 ppmv

  11. Sensory profile of eleven peach cultivars

    Directory of Open Access Journals (Sweden)

    Francine Lorena Cuquel

    2012-03-01

    Full Text Available The goal of this study was to evaluate the sensory profile of eleven peach cultivars grown in an experimental orchard located in the city of Lapa (PR, Brazil in two seasons. The peach cultivars analyzed were Aurora I, Chimarrita, Chiripá, Coral, Eldorado, Granada, Leonense, Maciel, Marli, Premier, and Vanguarda. The sensory analysis was performed by previously trained panelists; 20 of them in the first season and 10 in the second season. The sensory evaluation was performed using Quantitative Descriptive Analysis, in which the following attributes were measured: appearance, aroma, flesh color, flesh firmness, flavor, and juiciness. The results showed preference for sweet, soft, and juicy fruits. Chimarrita, Chiripá, and Coral fruits showed better sensorial performance than the other peach cultivars. It was also verified that the analysis of the attributes aroma, flesh firmness, and flavor is enough for performing the sensory profile of peach fruits for in natura consumption.

  12. The JET neutron emission profile monitor

    International Nuclear Information System (INIS)

    Adams, J.M.; Syme, D.B.; Watkins, N.; Jarvis, O.N.; Sadler, G.J.

    1993-01-01

    This paper provides a technical description of the neutron emission profile monitor as used routinely at the Joint European Torus (JET), and includes representative examples of its operational capabilities. The primary function of this instrument is to measure the neutron emission as a function of both position and time in a poloidal (vertical along major radius) section through the torus. For the first time the spatially localised effects of sawteeth (magnetic relaxation phenomena) have been observed using a neutron diagnostic. The total (global) neutron emission can be obtained from the profile monitor data by performing a volume integral over the plasma; the absolute neutron emission rates agree with those obtained from the JET time-resolved neutron monitor to within ±15%. This was the first such instrument routinely in use on any tokamak. It provides unique data which are independent of all other diagnostic measurements. (orig.)

  13. Pharmacology profiling of chemicals and proteins

    DEFF Research Database (Denmark)

    Kringelum, Jens Vindahl

    between pharmaceuticals and proteins in vivo potential leads to unwanted adverse effects, toxicity and reduced half-life, but can also lead to novel therapeutic effects of already approved pharmaceuticals. Hence identification of in vivo targets is of importance in discovery, development and repurposing....... This limitation complicates adverse effect assessment in the early drug-development phase, thus contributing to drugattrition. Prediction models offer the possibility to close these gaps and provide more complete pharmacology profiles, however improvements in performances are required for these tools to serve...... to its nonself origin, which potentially alters the pharmacology profile of the substance. The neutralization of biopharmaceuticals by antidrug antibodies (ADAs) is an important element in the immune response cascade, however studies of ADA binding site on biopharmaceuticals, referred to as B...

  14. Saponin profile of green asparagus genotypes.

    Science.gov (United States)

    Vázquez-Castilla, Sara; Jaramillo-Carmona, Sara; Fuentes-Alventosa, Jose María; Jiménez-Araujo, Ana; Rodríguez-Arcos, Rocío; Cermeño-Sacristán, Pedro; Espejo-Calvo, Juan Antonio; Guillén-Bejarano, Rafael

    2013-11-20

    The main goal of this study was to determine the saponin profiles of different "triguero" asparagus genotypes and to compare them to green asparagus commercial hybrids. The samples consisted of 31 commercial hybrids and 58 genotypes from the Huétor-Tájar (HT) population variety ("triguero"). The saponin analysis by high-performance liquid chromatography-mass spectrometry allowed for the determination of 12 saponins derived from a furostan-type steroidal genin, 4 of which had never been described in the edible part of asparagus. The saponin profile of "triguero" asparagus was a combination of these new saponins and protodioscin. Although protodioscin was the major saponin found in commercial hybrids, some of these 12 saponins were detected as major components in some of the commercial hybrids. The total contents of saponins described in some of these HT genotypes reach values as high as 10-100 times higher than those found in commercial hybrids.

  15. A STUDY OF LIPID PROFILE IN PREDIABETES

    Directory of Open Access Journals (Sweden)

    Manoj

    2016-06-01

    Full Text Available BACKGROUND Lipid abnormalities are common in diabetes mellitus and play an important role in acceleration of atherosclerosis leading to increased cardiovascular diseases. Due to increasing burden of diabetes, it is becoming important to identify dyslipidaemia in high-risk state for diabetes especially prediabetes so that early intervention can reduce cardiovascular risk. AIM To study lipid profile in prediabetes individuals. METHODS This study was a cross-sectional case control study which included 107 prediabetes and 101 healthy controls. Lipid profile of prediabetes and controls were measured and statistically analysed. RESULT Total cholesterol, LDL, triglycerides, VLDL, TG/HDL ratio, and LDL/HDL ratio were significantly high whereas HDL was significantly low in prediabetes subjects as compared to controls. CONCLUSION This study showed significant lipid abnormalities in prediabetes subjects. Because of these they are at high risk of developing atherosclerotic cardiovascular diseases. Therefore, proper screening and appropriate therapy of these conditions becomes important.

  16. Role of DNA profiling in forensic odontology

    Directory of Open Access Journals (Sweden)

    S Leena Sakari

    2015-01-01

    Full Text Available The recent advances in DNA profiling have made DNA evidence to be more widely accepted in courts. This has revolutionized the aspect of forensic odontology. DNA profiling/DNA fingerprinting has come a long way from the conventional fingerprints. DNA that is responsible for all the cell′s activities, yields valuable information both in the healthy and diseased individuals. When other means of traditional identification become impossible following mass calamities or fire explosions, teeth provide a rich source of DNA as they have a high chemical as well as physical resistance. The recent evolution in the isolation of DNA and the ways of running a DNA fingerprint are highlighted in this literature review.

  17. DYNAMIC MEMORY ALLOCATION – CLR PROFILER

    Directory of Open Access Journals (Sweden)

    Adrian LUPASC

    2014-06-01

    Full Text Available At the present time, information systems are an important component in the development of many activities, due to their ability of managing a large amount of data and performing complex operations in a very short time. In this regard, very important is the correct management of all available resources, especially memory management. Haven’t happened to test an application, but it runs out of memory? This paper is trying to explain some of the situations causing those problems and also is trying to find some solutions for fixing them. Concluding, the purpose of this paper is to emphasize on one hand the importance of using a memory profiler in the development of your applications and on the other hand, the advantages brought by CLR Profiler on your .NET applications.

  18. Photodegradation of wood and depth profile analysis

    International Nuclear Information System (INIS)

    Kataoka, Y.

    2008-01-01

    Photochemical degradation is a key process of the weathering that occurs when wood is exposed outdoors. It is also a major cause of the discoloration of wood in indoor applications. The effects of sunlight on the chemical composition of wood are superficial in nature, but estimates of the depth at which photodegradation occurs in wood vary greatly from 80 microm to as much as 2540 mic rom. Better understanding of the photodegradation of wood through depth profile analysis is desirable because it would allow the development of more effective photo-protective treatments that target the surface layers of wood most susceptible to photodegradation. This paper briefly describes fundamental aspects of photodegradation of wood and reviews progress made in the field of depth profile study on the photodegradation of wood. (author)

  19. Shallow surface depth profiling with atomic resolution

    International Nuclear Information System (INIS)

    Xi, J.; Dastoor, P.C.; King, B.V.; O'Connor, D.J.

    1999-01-01

    It is possible to derive atomic layer-by-layer composition depth profiles from popular electron spectroscopic techniques, such as X-ray photoelectron spectroscopy (XPS) or Auger electron spectroscopy (AES). When ion sputtering assisted AES or XPS is used, the changes that occur during the establishment of the steady state in the sputtering process make these techniques increasingly inaccurate for depths less than 3nm. Therefore non-destructive techniques of angle-resolved XPS (ARXPS) or AES (ARAES) have to be used in this case. In this paper several data processing algorithms have been used to extract the atomic resolved depth profiles of a shallow surface (down to 1nm) from ARXPS and ARAES data

  20. Optimizing the ATLAS code with different profilers

    CERN Document Server

    Kama, S; The ATLAS collaboration

    2013-01-01

    After the current maintenance period, the LHC will provide higher energy collisions with increased luminosity. In order to keep up with these higher rates, ATLAS software needs to speed up substantially. However, ATLAS code is composed of approximately 4M lines, written by many different programmers with different backgrounds, which makes code optimisation a challenge. To help with this effort different profiling tools and techniques are being used. These include well known tools, such as the Valgrind suite and Intel Amplifier; less common tools like PIN, PAPI, and GOODA; as well as techniques such as library interposing. In this talk we will mainly focus on PIN tools and GOODA. PIN is a dynamic binary instrumentation tool which can obtain statistics such as call counts, instruction counts and interrogate functions' arguments. It has been used to obtain CLHEP Matrix profiles, operations and vector sizes for linear algebra calculations which has provided the insight necessary to achieve significant performance...