Erbium–ytterbium fibre laser emitting more than 13 W of power in ...

Indian Academy of Sciences (India)

2014-01-05

Jan 5, 2014 ... We report the work on erbium:ytterbium-doped double clad fibre laser (EYDFL), that is pumped at ... reduction in life-time. The active ... region. Figure 2 shows plot of output power vs. absorbed pump power (after accounting.

Flashlamp pumped Ti-sapphire laser for ytterbium glass chirped pulse amplification

Energy Technology Data Exchange (ETDEWEB)

Nishimura, Akihiko; Ohzu, Akira; Sugiyama, Akira [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; and others

1998-03-01

A flashlamp pumped Ti:sapphire laser is designed for ytterbium glass chirped pulse amplification. A high quality Ti:sapphire rod and a high energy long pulse discharging power supply are key components. The primary step is to produce the output power of 10 J per pulse at 920 nm. (author)

Modelling the competition between photo-darkening and photo-bleaching effects in high-power ytterbium-doped fibre amplifiers

Science.gov (United States)

Jolly, A.; Vinçont, C.; Pierre, Ch.; Boullet, J.

2017-08-01

We propose an innovative, fully space-time model to take into account the seed-dependent nature of ageing penalties in high-power ytterbium-doped fibre amplifiers. Ageing is shown to be based on the on-going competition between photo-darkening and photo-bleaching phenomena. Our approach is based on the natural interplay between the excited states of co-existing ytterbium pairs and colour centres in highly doped fibres, in the presence of thermal coupling between the closely spaced excited states. As initiated from IR photons, the excitation of colour centres up to the UV band is supposed to be governed by multi-photon absorption. The interactions of interest in the kinetics of photo-bleaching then take the form of highly efficient charge transfers, which imply the reduction of some fraction of the basically trivalent ions to their divalent state. Due to the activation of ytterbium pairs by means of energy transfer up-conversion, these interactions get more and more effective at elevated operating powers. Computational results using these principles actually help to fit our experimental data regarding seeding effects, as well as fully generic trends already evidenced in the literature. This gives a fine demonstration for the need to discriminate co-active pump and signal contributions. Our self-consistent, still simplified model then consists of a valuable tool to help for a deeper understanding of the ageing issues. Furthermore, considering higher-order ytterbium aggregates, this should open new routes towards more comprehensive models.

Synthesis of samarium, europium and ytterbium acetylenides

International Nuclear Information System (INIS)

Bochkarev, M.N.; Fedorova, E.A.; Glushkova, N.V.; Protchenko, A.V.; Druzhkov , O.N.; Khorshev, S.Ya.

1995-01-01

Ethynyl complexes of samarium, europium and ytterbium were prepared by interaction of naphthalinides of metals with acetylene in tetrahydrofuran. The compounds are isolated in the form of dark-coloured pyrophore powders. Data of magnetic measurements suggest that in the course of the reaction Sm(2) is oxidized completely to Sm(3), Yb(2) transforms into Yb(3) partially, whereas europium preserves its initial bivalent state. Hydrolysis of the compounds prepared provides acetylene, ethylene, ethane and hydrogen which indicates the presence of acethylenide Ln 2 C 2 and hydride LnH groupings (Ln = Sm, Eu, Yb). 9 refs., 2 tabs

Reverse spontaneous laser line sweeping in ytterbium fiber laser

Czech Academy of Sciences Publication Activity Database

Navrátil, Petr; Peterka, Pavel; Honzátko, Pavel; Kubeček, V.

2017-01-01

Roč. 14, č. 3 (2017), č. článku 035102. ISSN 1612-2011 R&D Projects: GA ČR(CZ) GA16-13306S Institutional support: RVO:67985882 ; RVO:68378271 Keywords : laser line sweeping * ytterbium * fiber lasers Subject RIV: BH - Optics, Masers, Lasers; BH - Optics, Masers, Lasers (FZU-D) OBOR OECD: Optics (including laser optics and quantum optics); Optics (including laser optics and quantum optics) (FZU-D) Impact factor: 2.537, year: 2016

5 CFR 179.303 - General.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false General. 179.303 Section 179.303 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.303 General. (a) The Director or his or her designee, after attempting to collect a...

5 CFR 179.302 - Definitions.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 179.302 Section 179.302 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.302 Definitions. Administrative offset, as defined in 31 U.S.C. 3701(a)(1), means...

Beyond-Born-Oppenheimer effects in sub-kHz-precision photoassociation spectroscopy of ytterbium atoms

Science.gov (United States)

Borkowski, Mateusz; Buchachenko, Alexei A.; Ciuryło, Roman; Julienne, Paul S.; Yamada, Hirotaka; Kikuchi, Yuu; Takahashi, Kakeru; Takasu, Yosuke; Takahashi, Yoshiro

2017-12-01

We present high-resolution two-color photoassociation spectroscopy of Bose-Einstein condensates of ytterbium atoms. The use of narrow Raman resonances and careful examination of systematic shifts enabled us to measure 13 bound-state energies for three isotopologues of the ground-state ytterbium molecule with standard uncertainties of the order of 500 Hz. The atomic interactions are modeled using an ab initio based mass-scaled Born-Oppenheimer potential whose long-range van der Waals parameters and total WKB phase are fitted to experimental data. We find that the quality of the fit of this model, of about 112.9 kHz (rms) can be significantly improved by adding the recently calculated beyond-Born-Oppenheimer (BBO) adiabatic corrections [J. J. Lutz and J. M. Hutson, J. Mol. Spectrosc. 330, 43 (2016), 10.1016/j.jms.2016.08.007] and by partially treating the nonadiabatic effects using distance-dependent reduced masses. Our BBO interaction model represents the experimental data to within about 30.2 kHz on average, which is 3.7 times better than the "reference" Born-Oppenheimer model. We calculate the s -wave scattering lengths for bosonic isotopic pairs of ytterbium atoms with error bars over two orders of magnitude smaller than previous determinations. For example, the s -wave scattering length for 174Yb is +5.55812 (50 ) nm.

Bis(pentamethylcyclopentadienyl) ytterbium: Electron-transfer reactions with organotransition metal complexes

Energy Technology Data Exchange (ETDEWEB)

Matsunaga, Phillip Thomas [Univ. of California, Berkeley, CA (United States)

1991-11-01

The divalent lanthanide complex, (Me₅C₅)₂Yb, reacts with methylcopper to produce the base-free, ytterbium-methyl complex, (Me₅C₅)₂YbMe. This product forms a asymmetric, methyl-bridged dimer in the solid state. The bulky alkyl complex, (Me₅C₅)₂YbCH(SiMe₃)₂, displays similar chemistry to (Me₅C₅)₂YbMe, but at a reduced reaction rate due to the limited accessibility of the metal in (Me₅C₅)₃YbCH(SiMe₅)₂. Copper and silver halide salts react with (Me₅C₅)₂V to produce the trivalent halide derivatives, (Me₅C₅)₂VX (X + F, Cl, Br, I). The chloride complex, (Me₅C₅)₂VCl, reacts with lithium reagents to form the phenyl and borohydride species. Nitrous oxide transfers an oxygen atom to (Me₅C₅)₂V producing the vanadium-oxo complex, (Me₅Ce₅)₂VO. The trivalent titanium species, (Me₅C₅)₂TiX (X = Cl, Br, Me, BH₄), form bimetallic coordination complexes with (Me₅C₅)₂Yb. The magnetic behavior of the products indicates that electron transfer has not occurred. The solid state structures of the chloride and bromide complexes show unusual bend angles for the halide bridges between ytterbium and titanium. A model based on frontier orbital theory has been proposed to account for the bending behavior in these species. The bimetallic methyl complex contains a linear methyl bridge between ytterbium and titanium.

Separation of thulium, ytterbium and lutetium from uranium

International Nuclear Information System (INIS)

Lopez, G.H.

1987-01-01

The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)

5 CFR 179.304 - Notification procedures.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Notification procedures. 179.304 Section 179.304 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.304 Notification procedures. Before collecting any debt...

Size-dependent abnormal thermo-enhanced luminescence of ytterbium-doped nanoparticles.

Science.gov (United States)

Cui, Xiangshui; Cheng, Yao; Lin, Hang; Huang, Feng; Wu, Qingping; Wang, Yuansheng

2017-09-21

Thermal quenching above 300 K is widely expected in photoluminescence. Luminescence quenching is usually ascribed to the non-radiative relaxation of excited electrons to the ground state of the activators, during which a high temperature always plays a role in pushing the excited electrons towards the quenching channels, leading to thermal quenching. For the lanthanide-doped nanoparticles, however, there is a special luminescence quenching channel that does not exist in their bulk counterparts, i.e., energy migration-induced surface quenching. Herein, a size-dependent abnormal thermal enhancement of luminescence in the temperature range of 300 K to 423 K in the ytterbium-doped fluoride nanoparticles is presented for the first time. Importantly, in this work, we originally demonstrate that the energy migration-induced surface quenching can be suppressed by increasing temperature, which results in the abnormal thermal enhancement of luminescence. According to the temperature-dependent X-ray diffraction and lifetime analyses, an underlying mechanism based on the effect of thermal lattice expansion on ytterbium-mediated energy migration is proposed. This new finding adds new insights to the size effect on the luminescent characteristics of nanoparticles, which could be utilized to construct some unique nanostructures, especially for many important temperature-related purposes, such as thermal sensing technology.

49 CFR 179.11 - Welding certification.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Welding certification. 179.11 Section 179.11 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Design Requirements § 179.11 Welding certification. (a) Welding procedures, welders and fabricators shall...

5 CFR 179.308 - Accelerated procedures.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Accelerated procedures. 179.308 Section 179.308 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.308 Accelerated procedures. OPM may make an administrative...

5 CFR 179.307 - Administrative offset.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Administrative offset. 179.307 Section 179.307 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.307 Administrative offset. (a) If the debtor does not...

49 CFR 179.401-1 - Individual specification requirements.

Science.gov (United States)

2010-10-01

...) § 179.400-5(d). Standard heat transfer rate. (Btu per day per lb. of water capacity, max.) (see § 179... FOR TANK CARS Specification for Cryogenic Liquid Tank Car Tanks and Seamless Steel Tanks (Classes DOT... restrictions § 179.400-20 179.400-20. Transfer line insulation § 179.400-17 Not required. [Amdt. 179-32, 48 FR...

The three-electron bond =Siytterbium-doped silica

DEFF Research Database (Denmark)

Mattsson, Kent Erik

2013-01-01

The formation and bleaching of color centers during annealing of pre-darkened ytterbium-doped silica fibers is modeled by three-electron bond (TEB) = Si... bonds is described in terms of a Markov statistical model with state change set by Bose-Einstein phonon statistics. The center hold one terminal and four active states with activation energies for transitions among these found to match bond energies of molecular oxygen in ionic character bonds of 1...... and 1½ bond order. Experimentally observed in- and decrease in absorption during ramp and isothermal annealing of pre-darkened ytterbium co-doped silica fibers are hereby matched by a set of = Si

49 CFR 179.10 - Tank mounting.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Tank mounting. 179.10 Section 179.10 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Design Requirements § 179.10 Tank mounting. (a) The manner in which tanks are attached to the car...

Hybrid Ytterbium-doped large-mode-area photonic crystal fiber amplifier for long wavelengths

DEFF Research Database (Denmark)

Petersen, Sidsel Rübner; Alkeskjold, Thomas T.; Poli, Federica

2012-01-01

A large-mode-area Ytterbium-doped photonic crystal fiber amplifier with build-in gain shaping is presented. The fiber cladding consists of a hexagonal lattice of air holes, where three rows are replaced with circular high-index inclusions. Seven missing air holes define the large-mode-area core. ...

5 CFR 179.305 - Agency review.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Agency review. 179.305 Section 179.305 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.305 Agency review. (a) A debtor may dispute the existence of the debt, the amount of...

49 CFR 179.400-11 - Welding.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.400-11 Section 179.400-11...-11 Welding. (a) Except for closure of openings and a maximum of two circumferential closing joints in... subchapter). (d) Each welding procedure, welder, and fabricator must be approved. [Amdt. 179-32, 48 FR 27708...

49 CFR 179.220-10 - Welding.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.220-10 Section 179.220-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.220-10 Welding. (a) All joints... of this subchapter). Welding procedures, welders, and fabricators shall be approved. (b) Radioscopy...

40 CFR 179.125 - Judicial review.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Judicial review. 179.125 Section 179... EVIDENTIARY PUBLIC HEARING Judicial Review § 179.125 Judicial review. (a) The Administrator's final decision... judicial review within the period ending on the 60th day after the date of the publication of the order...

Charge-transfer state excitation as the main mechanism of the photodarkening process in ytterbium-doped aluminosilicate fibres

Energy Technology Data Exchange (ETDEWEB)

Bobkov, K K; Rybaltovsky, A A; Vel' miskin, V V; Likhachev, M E; Bubnov, M M; Dianov, E M [Fiber Optics Research Center, Russian Academy of Sciences, Moscow (Russian Federation); Umnikov, A A; Gur' yanov, A N; Vechkanov, N N [G.G.Devyatykh Institute of Chemistry of High-Purity Substances, Russian Academy of Sciences, Nizhnii Novgorod (Russian Federation); Shestakova, I A [Open Joint-Stock Company M.F. Stel' makh Polyus Research Institute, Moscow (Russian Federation)

2014-12-31

We have studied photodarkening in ytterbium-doped fibre preforms with an aluminosilicate glass core. Analysis of their absorption and luminescence spectra indicates the formation of stable Yb{sup 2+} ions in the glass network under IR laser pumping at a wavelength λ = 915 nm and under UV irradiation with an excimer laser (λ = 193 nm). We have performed comparative studies of the luminescence spectra of the preforms and crystals under excitation at a wavelength of 193 nm. The mechanism behind the formation of Yb{sup 2+} ions and aluminium – oxygen hole centres (Al-OHCs), common to ytterbium-doped YAG crystals and aluminosilicate glass, has been identified: photoinduced Yb{sup 3+} charge-transfer state excitation. (optical fibres)

49 CFR 179.100-9 - Welding.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.100-9 Section 179.100-9... Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.100-9 Welding. (a) All..., appendix W (IBR, see § 171.7 of this subchapter). Welding procedures, welders and fabricators shall be...

49 CFR 179.200-10 - Welding.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.200-10 Section 179.200-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.200-10 Welding. (a) All joints... W (IBR, see § 171.7 of this subchapter). Welding procedures, welders and fabricators shall be...

49 CFR 179.300-9 - Welding.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.300-9 Section 179.300-9... Specifications for Multi-Unit Tank Car Tanks (Classes DOT-106A and 110AW) § 179.300-9 Welding. (a) Longitudinal... fusion welded on class DOT-110A tanks. Welding procedures, welders and fabricators must be approved in...

Towards diode-pumped mid-infrared praseodymium-ytterbium-doped fluoride fiber lasers

Science.gov (United States)

Woodward, R. I.; Hudson, D. D.; Jackson, S. D.

2018-02-01

We explore the potential of a new mid-infrared laser transition in praseodymium-doped fluoride fiber for emission around 3.4 μm, which can be conveniently pumped by 0.975 μm diodes via ytterbium sensitizer co-doping. Optimal cavity designs are determined through spectroscopic measurements and numerical modeling, suggesting that practical diode-pumped watt-level mid-infrared fiber sources beyond 3 μm could be achieved.

5 CFR 179.309 - Additional administrative procedures.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Additional administrative procedures. 179.309 Section 179.309 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.309 Additional administrative procedures. Nothing...

5 CFR 179.301 - Scope of regulations.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Scope of regulations. 179.301 Section 179.301 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.301 Scope of regulations. These regulations apply to the...

ThSi_2 type ytterbium disilicide and its analogues YbT_xSi_2_-_x (T = Cr, Fe, Co)

International Nuclear Information System (INIS)

Peter, Sebastian C.; Kanatzidis, Mercouri G.

2012-01-01

YbSi_2 and the derivatives YbT_xSi_2_-_x (T = Cr, Fe, Co) crystallizing in the α-ThSi_2 structure type were obtained as single crystals from reactions run in liquid indium. All silicides were investigated by single-crystal X-ray diffraction, I4_1/amd space group and the lattice constants are: a = 3.9868(6) Aa and c = 13.541(3) Aa for YbSi_2, a = 4.0123(6) Aa and c = 13.542(3) Aa for YbCr_0_._2_7Si_1_._7_3, a = 4.0142(6) Aa and c = 13.830(3) Aa for YbCr_0_._7_1Si_1_._2_9, a = 4.0080(6) Aa and c = 13.751(3) Aa for YbFe_0_._3_4Si_1_._6_6, and a = 4.0036(6) Aa, c = 13.707(3) Aa for YbCo_0_._2_1Si_1_._7_9. YbSi_2 and YbT_xSi_2_-_x compounds are polar intermetallics with three-dimensional Si and M (T+Si) polyanion sub-networks, respectively, filled with ytterbium atoms. The degree of substitution of transition metal at the silicon site is signficant and leads to changes in the average bond lengths and bond angles substantially. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Double nanosecond pulses generation in ytterbium fiber laser

Energy Technology Data Exchange (ETDEWEB)

Veiko, V. P.; Samokhvalov, A. A., E-mail: samokhvalov.itmo@gmail.com; Yakovlev, E. B.; Zhitenev, I. Yu.; Kliushin, A. N. [Saint-Petersburg State University of Information Technologies, Mechanics and Optics, Kronverksky Pr. 49, Saint Petersburg (Russian Federation); Lednev, V. N. [Prokhorov General Physics Institute of the Russian Academy of Sciences, Vavilov Str., 38, Moscow (Russian Federation); National University of Science and Technology MISiS, Leninskyave., 4, Moscow (Russian Federation); Pershin, S. M. [Prokhorov General Physics Institute of the Russian Academy of Sciences, Vavilov Str., 38, Moscow (Russian Federation)

2016-06-15

Double pulse generation mode for nanosecond ytterbium fiber laser was developed. Two sequential 60-200 ns laser pulses with variable delay between them were generated by acousto-optic modulator opening with continuous diode pumping. A custom radio frequency generator was developed to produce two sequential “opening” radio pulses with a delay of 0.2–1 μs. It was demonstrated that double pulse generation did not decrease the average laser power while providing the control over the laser pulse power profile. Surprisingly, a greater peak power in the double pulse mode was observed for the second laser pulse. Laser crater studies and plasma emission measurements revealed an improved efficiency of laser ablation in the double pulse mode.

21 CFR 17.9 - Answer.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Answer. 17.9 Section 17.9 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL CIVIL MONEY PENALTIES HEARINGS... Dockets Management (HFA-305), Food and Drug Administration, 5630 Fishers Lane, rm. 1061, Rockville, MD...

49 CFR 179.12 - Interior heater systems.

Science.gov (United States)

2010-10-01

... Design Requirements § 179.12 Interior heater systems. (a) Interior heater systems shall be of approved design and materials. If a tank is divided into compartments, a separate system shall be provided for... 49 Transportation 2 2010-10-01 2010-10-01 false Interior heater systems. 179.12 Section 179.12...

Cladding-pumped ytterbium-doped fiber laser with radially polarized output.

Science.gov (United States)

Lin, Di; Daniel, J M O; Gecevičius, M; Beresna, M; Kazansky, P G; Clarkson, W A

2014-09-15

A simple technique for directly generating a radially polarized output beam from a cladding-pumped ytterbium-doped fiber laser is reported. Our approach is based on the use of a nanograting spatially variant waveplate as an intracavity polarization-controlling element. The laser yielded ~32 W of output power (limited by available pump power) with a radially polarized TM (01)-mode output beam at 1040 nm with a corresponding slope efficiency of 66% and a polarization purity of 95%. The beam-propagation factor (M(2)) was measured to be ~1.9-2.1.

Alloying of Yb-Cu and Yb-Ag utilizing liquid ammonia metal solutions of ytterbium

International Nuclear Information System (INIS)

Imamura, H.; Yoshimura, T.; Sakata, Y.

2003-01-01

In the course of the studies on preparation of novel compounds using the dissolution of Eu or Yb metals in liquid ammonia, the formation of Yb-Cu and Yb-Ag intermetallic films has been found. When Cu or Ag metal powders were placed in a reactor containing a solution of Yb metal in liquid ammonia, the dissolved Yb readily react with the Cu or Ag metal particles to form surface alloy compounds. X-ray diffraction of Yb-Cu showed that upon thermal treatment above 673 K, the Yb metal deposited on the Cu particles reacted together to be transformed into the YbCu 6.5 intermetallic compound. A characteristic endothermic peak at 749 K, due to alloying of Yb-Cu, was observed by the differential scanning calorimeter measurements. By use of the high reactivity of liquid ammonia metal solutions of ytterbium, it was found that the ytterbium intermetallic films were readily formed under mild conditions. Yb-Cu and Yb-Ag exhibited enhanced catalytic activity for the hydrogenation of ethene as a result of alloying

The incorporation of selenium and ytterbium into the eyes of mice

International Nuclear Information System (INIS)

Samochocka, K.; Czauderna, M.; Konecki, J.; Wolna, M.

1984-01-01

The incorporation of Se and Yb into the eyes of mice has been studied. Selenodiglutathione, (GS) 2 Se, or ytterbium chloride, YbCl 3 , were injected intraperitoneally into mice: either alone, combined, or after various time intervals. Instrumental neutron activation analysis was applied as the analytical method for the determination of the levels of Se and Yb. The concentrations of both investigated elements were highest in the retinal tissue of the eye. YbCl 3 influenced the distribution of Se in the eye. (author)

Transverse mode instability in high-power ytterbium doped fiber ampliers

DEFF Research Database (Denmark)

Hansen, Kristian Rymann

The last couple of decades have brought an impressive growth in the output power of rare-earth doped fiber lasers and amplifiers, reaching the kW average power regime in both CW and pulsed systems. As a result, even though fiber lasers have excellent heat dissipation properties, thermal effects due...... is to provide a theoretical understanding of the thermo-optical effects in high-power ytterbium doped fiber amplifiers, with a particular emphasis on understanding the aforementioned mode instability issue. Two main approaches to the problem have been used. The first is the development of a numerical model...

5 CFR 179.306 - Written agreement for repayment.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Written agreement for repayment. 179.306 Section 179.306 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.306 Written agreement for repayment. A debtor who admits...

Single-mode ytterbium-doped large-mode-area photonic bandgap rod fiber amplifier

DEFF Research Database (Denmark)

Alkeskjold, Thomas Tanggaard; Scolari, Lara; Broeng, Jes

2011-01-01

bandgap structure. The structure allows resonant coupling of higher-order modes from the core and acts as a spatially Distributed Mode Filter (DMF). With this approach, we demonstrate passive SM performance in an only ~50cm long and straight ytterbium-doped rod fiber. The amplifier has a mode field...... diameter of ∼59Lim at 1064nm and exhibits a pump absorption of 27dB/m at 976nm. © 2011 Optical Society of America....

49 CFR 179.200-11 - Postweld heat treatment.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Postweld heat treatment. 179.200-11 Section 179.200-11 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS... Postweld heat treatment. When specified in § 179.201-1, after welding is complete, postweld heat treatment...

Cross sections for fast-neutron interaction with ytterbium isotopes

International Nuclear Information System (INIS)

Luo, Junhua; Liu, Rong; Jiang, Li; Ge, Suhong; Liu, Zhenlai; Sun, Guihua

2013-01-01

Highlights: ► The cross sections for the (n,x) reactions on ytterbium isotopes have been measured. ► Mono-energetic neutron beams using the D + T reaction; Energies: 13.5 and 14.8 MeV. ► Neutron cross-section measurements by means of the activation technique. ► Reference reactions 93 Nb(n,2n) 92m Nb and 27 (n,α) 24 Na. ► Data for 172 Yb(n,p) 172 Tm and 176 Yb(n,d * ) 175 Tm are reported for the first time. - Abstract: Measurements of (n,2n), (n,p), and (n,d * ) (The expression (n,d * ) cross section used in this work includes a sum of (n,d), (n,np) and (n,pn) cross sections.) reaction cross-sections on ytterbium isotopes have been carried out in the range of 13.5–14.8 MeV using the activation technique. The monoenergetic neutron beams were produced via the 3 H(d,n) 3 He reaction. The neutron energies of different directions were determined using the Nb/Zr method. Samples were activated along with along with Nb and Al monitor foils to determine the incident neutron flux. Data are reported for the following reactions: 168 Yb(n,2n) 167 Yb, 170 Yb(n,2n) 169m+g Yb, 176 Yb(n,2n) 175m+g Yb, 172 Yb(n,p) 172 Tm, 173 Yb(n,p) 173 Tm, 176 Yb(n,d * ) 175 Tm, 174 Yb(n,p) 174 Tm, and 176 Yb(n,p) 176 Tm. The experimentally deduced cross-sections are compared with the existing experimental data. Furthermore, theoretical statistical model, based on the Hauser–Feshbach formalism, have been carried out using the HFTT

49 CFR 179.400-12 - Postweld heat treatment.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Postweld heat treatment. 179.400-12 Section 179... and 107A) § 179.400-12 Postweld heat treatment. (a) Postweld heat treatment of the inner tank is not... be attached before postweld heat treatment. Welds securing the following need not be postweld heat...

Ytterbium-doped large-mode-area photonic crystal fiber amplifier with gain shaping for use at long wavelengths

DEFF Research Database (Denmark)

Petersen, Sidsel Rübner; Alkeskjold, Thomas T.; Poli, Federica

2012-01-01

A large-mode-area Ytterbium-doped photonic crystal fiber amplifier with efficient suppression of amplified spontaneous emission is presented. The fiber cladding consists of a hexagonal lattice of air holes, where three rows are replaced with circular high-index inclusions. Seven missing air holes...

32-core erbium/ytterbium-doped multicore fiber amplifier for next generation space-division multiplexed transmission system

DEFF Research Database (Denmark)

Jain, Saurabh; Castro, Carlos; Jung, Yongmin

2017-01-01

We present a high-core-count 32-core multicore erbium/ytterbium-doped fiber amplifier (32c-MC-EYDFA) in a cladding pumped configuration. A side pumping technique is employed for ease of pump coupling in this monolithic all-fiber amplifier. A minimum gain of >17 dB and an average noise figure (NF)...

The solvent extraction of ytterbium from a molten eutectic

International Nuclear Information System (INIS)

Lengyel, T.

1977-01-01

The paper summarizes the results which were obtained in measurements performed with different binary mixtures of solvents being capable of effectively extracting ytterbium from the molten eutectic lithium nitrate--ammonium nitrate. In the course of elaborating the possible ways of extractive separation of rare earths systematic investigations regarding the individual members of the group are required. The binary solvent mixtures consisted of thenoyl-trifluoracetone (TTA), β-isopropil-tropolone (IPT), tributyl phosphate (TBP), di-2-ethylhexyl phosphoric acid (HDEHP), 2,2'-bipyridyl (bipy), dibutyl phtalate (DBP) and Amberlite LA-2 (LA-2). The concentration of the central ion was kept at 5x10 -6 M by using Yb-169 of high specific activity as a tracer for the radiometric assay. (T.I.)

Two-photon Doppler cooling of alkaline-earth-metal and ytterbium atoms

International Nuclear Information System (INIS)

Magno, Wictor C.; Cavasso Filho, Reinaldo L.; Cruz, Flavio C.

2003-01-01

The possibility of laser cooling of alkaline-earth-metal atoms and ytterbium atoms using a two-photon transition is analyzed. We consider a 1 S 0 - 1 S 0 transition with excitation in near resonance with the 1 P 1 level. This greatly increases the two-photon transition rate, allowing an effective transfer of momentum. The experimental implementation of this technique is discussed and we show that for calcium, for example, two-photon cooling can be used to achieve a Doppler limit of 123 μK. The efficiency of this cooling scheme and the main loss mechanisms are analyzed

Experimental study of a Q-switched ytterbium-doped double-clad fiber laser

International Nuclear Information System (INIS)

Anzueto S, G.; Estudillo A, M.; Martinez R, A.; Torres G, I.; Selvas A, R.

2008-01-01

We report an experimental characterization of a Q-switched operation of an all-fiber laser using , 30 m of a double-clad ytterbium-doped fiber spliced to a piece of single-mode un-doped holey fiber. Loss modulation in the splicing point between the active and un-doped fiber due to a substantial coupling of light into lossy cladding modes stimulates pulsed operation of the fiber laser. Pulse energy of ∼2.5 μJ was estimated and the repetition rate was measured in the range of 4-16 KHz. (Author)

5 CFR 179.102 - Delegation of authority.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Delegation of authority. 179.102 Section... COLLECTION STANDARDS General Provisions and Administration § 179.102 Delegation of authority. (a) The Chief... Disability Fund, the Employees' Life Insurance Fund, the Retired Federal Employees Health Benefits Act (74...

Studies on Ytterbium-doped Fibre Laser Operating in Different Regimes

International Nuclear Information System (INIS)

Gan, Y; Xiang, W H; Zhang, G Z

2006-01-01

An ytterbium-doped fibre laser with a unidirectional ring cavity containing a polarizer placed between two in-line polarization controllers is presented. Depending on an equivalent saturable absorber, this laser operates in continuous, Q-switched mode-locked or CW mode-locked regimes. The passive method described here allowed us to choose the operating regime of the fibre laser by rotating the two polarization controllers and adjusting the pump power. Results of numerical simulations of pulse propagation in such a mode-locked fibre ring laser are presented, which reveals that the Q-switched mode-locked or CW modelocked regimes can be achieved by aligning the polarizer near the slow or the fast axes of the fibre

49 CFR 179.500-10 - Protective housing.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Protective housing. 179.500-10 Section 179.500-10...-10 Protective housing. (a) Safety devices, and loading and unloading valves on tanks shall be protected from accidental damage by approved metal housing, arranged so it may be readily opened to permit...

49 CFR 179.500-6 - Heat treatment.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Heat treatment. 179.500-6 Section 179.500-6...-6 Heat treatment. (a) Each necked-down tank shall be uniformly heat treated. Heat treatment shall... treatment of alternate steels shall be approved. All scale shall be removed from outside of tank to an...

49 CFR 179.500-7 - Physical tests.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Physical tests. 179.500-7 Section 179.500-7...-7 Physical tests. (a) Physical tests shall be made on two test specimens 0.505 inch in diameter... tank. These test specimen ring sections or prolongations shall be heat treated, with the necked-down...

Modulation Transfer Spectroscopy of Ytterbium Atoms in a Hollow Cathode Lamp

International Nuclear Information System (INIS)

Wang Wen-Li; Xu Xin-Ye

2011-01-01

We present the experimental study of modulation transfer spectroscopy of ytterbium atoms in a hollow cathode lamp. The dependences of its linewidth, slope and magnitude on the various experimental parameters are measured and fitted by the well-known theoretical expressions. The experimental results are in good agreement with the theoretical prediction. We have observed the Dicke narrowing effect by increasing the current of the hollow cathode lamp. It is also found that there are the optimal current and laser power to generate the better modulation transfer spectroscopy signal, which can be employed for locking the laser frequency to the atomic transition. (atomic and molecular physics)

Elaboration by epitaxy in liquid phase and monocrystalline layers of doped Yag. Realisation of wave guides lasers neodymium and ytterbium at low thresholds

International Nuclear Information System (INIS)

Pelenc, D.

1993-10-01

This thesis reports on the prototype development of a new laser waveguide fabrication technique, Liquid Phase Epitaxy, as part of the research on diode-pumped compact laser devices. This technique has been applied to the growth of single crystal thin layers of neodymium and ytterbium doped YAG on pure YAG substrates. In order to obtain good quality waveguides, we have defined the growth conditions, and demonstrated the advantage of the growth of an undoped YAG cladding layer. Two extra dopings have been studied: gallium, in order to control the refractive index of the layer, and lutetium, in order to control their lattice mismatch. The determination of the segregation coefficient of these four dopants has required the development of a model that takes into account the evolution of the melt with time. We have measured the refractive index increase for each dopant and proposed a mechanism that explains this increase. The spectroscopic characterisation of the layers has shown that the neodymium and ytterbium ions have the same properties as in the bulk material of the same composition. The laser characterisation has shown very low propagation losses (around 0.1 dB/cm), comparable to those of bulk. For the neodymium laser transition at 1064 nm, we have demonstrated the laser effect for an absorbed power threshold of 700μW and measured a slope efficiency of 40% for a threshold of 14 mW in diode pumping. For quasi 3 level transitions, a significant reduction in threshold with respect to unguided lasers has been obtained: at 946 nm in a neodymium doped waveguide, at 1029 nm in an ytterbium doped waveguide, with a 1W diode bar pump. A slope efficiency of 80% has also been measured in an ytterbium doped waveguided emitting at 1048nm

Polarizing Ytterbium-Doped all-Solid Photonic Bandgap Fiber with 1150 micrometers2 Effective Mode Area

Science.gov (United States)

2015-02-11

RESPONSIBLE PERSON 19b. TELEPHONE NUMBER Liang Dong Fanting Kong,, Guancheng Gu,, Thomas W. Hawkins ,, Joshua Parsons, Maxwell Jones,, Christopher...Dunn,, Monica T. Kalichevsky-Dong,, Benjamin Pulford,, Iyad Dajani,, Kunimasa Saitoh,, Stephen P. Palese,, Eric Cheung,, Liang Dong c. THIS PAGE The...ytterbium-doped all-solid photonic bandgap fiber with ~1150µm2 effective mode area Fanting Kong,1,* Guancheng Gu,1 Thomas W. Hawkins ,1 Joshua Parsons

Efficient compression of the femtosecond pulses of an ytterbium laser in a gas-filled capillary

International Nuclear Information System (INIS)

Konyashchenko, Aleksandr V; Losev, Leonid L; Tenyakov, S Yu

2011-01-01

A 290-fs radiation pulse of an ytterbium laser system with a central wavelength of 1028 nm and an energy of 145 μJ was compressed to a 27-fs pulse with an energy of 75 μJ. The compression was realised on the basis of the effect of pulse spectrum broadening in a xenon-filled glass capillary for a pulse repetition rate of 3kHz. (control of laser radiation parameters)

33 CFR 110.179 - Skidaway River, Isle of Hope, Ga.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Skidaway River, Isle of Hope, Ga. 110.179 Section 110.179 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.179 Skidaway River, Isle of Hope, Ga. (a) The...

26 CFR 1.179-1 - Election to expense certain depreciable assets.

Science.gov (United States)

2010-04-01

... limitation on the amount of depreciation for luxury automobiles and where certain property is used for... under section 179. (i) Leasing of section 179 property—(1) In general. A lessor of section 179 property...

49 CFR 179.300-10 - Postweld heat treatment.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Postweld heat treatment. 179.300-10 Section 179.300-10 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS... Postweld heat treatment. After welding is complete, steel tanks and all attachments welded thereto, must be...

25 CFR 179.3 - What law applies to life estates?

Science.gov (United States)

2010-04-01

... INTERESTS General § 179.3 What law applies to life estates? (a) AIPRA applies to life estates created by operation of law under AIPRA for an individual who died on or after June 20, 2006, owning trust or... 25 Indians 1 2010-04-01 2010-04-01 false What law applies to life estates? 179.3 Section 179.3...

49 CFR 179.220-11 - Postweld heat treatment.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Postweld heat treatment. 179.220-11 Section 179... Postweld heat treatment. (a) Postweld heat treatment of the inner container is not a specification requirement. (b) Postweld heat treatment of the cylindrical portions of the outer shell to which the anchorage...

5 CFR 179.212 - Procedures for salary offset.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Procedures for salary offset. 179.212... COLLECTION STANDARDS Salary Offset § 179.212 Procedures for salary offset. (a) The Director or his or her designee shall coordinate salary deductions under this subpart. (b) OPM payroll office shall determine the...

Probing SU(N)-symmetric orbital interactions with ytterbium Fermi gases in optical lattices

International Nuclear Information System (INIS)

Scazza, Francesco

2015-01-01

This thesis reports on the creation and investigation of interacting two-orbital quantum gases of ytterbium in optical lattices. Degenerate fermionic gases of ytterbium or other alkaline-earth-like atoms have been recently proposed as model systems for orbital phenomena in condensed matter, such as Kondo screening, heavy-Fermi behaviour and colossal magnetoresistance. Such gases are moreover expected to obey a high SU(N) symmetry, owing to their highly decoupled nuclear spin, for which the emergence of novel, exotic phases of matter has been predicted. With the two lowest (meta-) stable electronic states mimicking electrons in distinct orbitals of solid materials, the two-orbital SU(N) Hubbard model and its spin-exchange inter-orbital interactions are realised. The interactions in two-orbital degenerate mixtures of different nuclear spin states of 173 Yb are probed by addressing the transition to the metastable state in a state-independent optical lattice. The complete characterisation of the two-orbital scattering channels and the demonstration of the SU(N=6) symmetry within the experimental uncertainty are presented. Most importantly, a strong spin- exchange coupling between the two orbitals is identified and the associated exchange process is observed through the dynamic equilibration of spin imbalances between ensembles in different orbitals. These findings are enabled by the implementation of high precision spectroscopic techniques and of full coherent control of the metastable state population. The realisation of SU(N)-symmetric gases with spin-exchange interactions, the elementary building block of orbital quantum magnetism, represents an important step towards the simulation of paradigmatic many-body models, such as the Kondo lattice model.

49 CFR 179.100-10 - Postweld heat treatment.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Postweld heat treatment. 179.100-10 Section 179...-10 Postweld heat treatment. (a) After welding is complete, steel tanks and all attachments welded... treatment is prohibited. (c) Tank and welded attachments, fabricated from ASTM A 240/A 240M (IBR, see § 171...

5 CFR 179.211 - Notice of salary offset.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Notice of salary offset. 179.211 Section... COLLECTION STANDARDS Salary Offset § 179.211 Notice of salary offset. (a) Upon receipt of proper... certification as the debtor, a written notice of salary offset. Such notice shall, at a minimum: (1) State that...

49 CFR 179.102-4 - Vinyl fluoride, stabilized.

Science.gov (United States)

2010-10-01

... TANK CARS Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.102... capacity stencil, MINIMUM OPERATING TEMPERATURE _ °F. (i) The tank car and insulation must be designed to..., at an ambient temperature of 90 °F. [Amdt. 179-32, 48 FR 27707, June 16, 1983, as amended at 49 FR...

Optical properties of ytterbium-doped yttrium oxide ceramics

Energy Technology Data Exchange (ETDEWEB)

Solomonov, V.I.; Maksimov, R.N. [Institute of Electrophysics UrB RAS, Amundsena 106, 620016 Ekaterinburg (Russian Federation); Ural Federal University Named After the First President of Russia B.N. Yeltsin, Mira 19, 620002 Ekaterinburg (Russian Federation); Osipov, V.V.; Shitov, V.A.; Lipchak, A.I. [Institute of Electrophysics UrB RAS, Amundsena 106, 620016 Ekaterinburg (Russian Federation)

2017-05-15

Ytterbium-doped yttrium oxide (Yb:Y{sub 2}O{sub 3}) transparent ceramics with different sintering additives (Lu{sub 2}O{sub 3}, Sc{sub 2}O{sub 3}, CeO{sub 2}, ZrO{sub 2}, or HfO{sub 2}) were fabricated using nanopowders produced by laser ablation. Transmission and photoluminescence spectra of the obtained ceramics were investigated at room temperature. Highest in-line transmittance was over 80% at the wavelength of 1060 nm for 2 mm thick Yb:Y{sub 2}O{sub 3} ceramics with zirconium and hafnium. Divalent Yb ions with the ground state electron configuration 4f{sup 13}6s were revealed. The absorption and emission bands caused by s <-> s transitions of these ions were observed in the IR spectral range of Yb{sup 3+} ions. The superposition of both Yb{sup 3+} and Yb{sup 2+} emission bands leads to an effective broadening of the whole luminescence band. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

49 CFR 179.300-15 - Pressure relief devices.

Science.gov (United States)

2010-10-01

... TANK CARS Specifications for Multi-Unit Tank Car Tanks (Classes DOT-106A and 110AW) § 179.300-15... exceeding that specified in § 179.301. (d) Fusible plugs shall function at a temperature not exceeding 175 °F. and shall be vapor-tight at a temperature of not less than 130 °F. [29 FR 18995, Dec. 29, 1964...

Electronic and ionic conductivities and point defects in ytterbium sesquioxide at high temperature

International Nuclear Information System (INIS)

Carpentier, J.-L.; Lebrun, A.; Perdu, F.; Tellier, P.

1982-01-01

From the study of complex impedance diagrams applied to a symmetric cell Pt-Yb 2 O 3 -Pt, the authors have shown the mixed character of electrical conduction within the ytterbium sesquioxide. The measurements were performed at thermodynamic equilibrium in the temperature range from 1423 to 1623 K and the partial pressure of oxygen range from 10 -12 to 1 atm. The variations of ionic and electronic conductivity as a function of Psub(O 2 ) were interpreted in terms of four different point defects in the general case of a Frenkel disorder. The relative contributions and the activation energies of conduction of these different defects were determined. (author)

Erbium:ytterbium fiber-laser system delivering watt-level femtosecond pulses using divided pulse amplification

Science.gov (United States)

Herda, Robert; Zach, Armin

2015-03-01

We present an Erbium:Ytterbium codoped fiber-amplifer system based on Divided-Pulses-Amplification (DPA) for ultrashort pulses. The output from a saturable-absorber mode-locked polarization-maintaining (PM) fiber oscillator is amplified in a PM normal-dispersion Erbium-doped fiber. After this stage the pulses are positively chirped and have a duration of 2.0 ps at an average power of 93 mW. A stack of 5 birefringent Yttrium-Vanadate crystals divides these pulses 32 times. We amplify these pulses using a double-clad Erbium:Ytterbium codoped fiber pumped through a multimode fiber combiner. The pulses double pass the amplifier and recombine in the crystals using non-reciprocal polarization 90° rotation by a Faraday rotating mirror. Pulses with a duration of 144 fs are obtained after separation from the input beam using a polarizing beam splitter cube. These pulses have an average power of 1.85 W at a repetition rate of 80 MHz. The generation of femtosecond pulses directly from the amplifier was enabled by a positively chirped seed pulse, normally dispersive Yttrium-Vanadate crystals, and anomalously dispersive amplifier fibers. Efficient frequency doubling to 780 nm with an average power of 725 mW and a pulse duration of 156 fs is demonstrated. In summary we show a DPA setup that enables the generation of femtosecond pulses at watt-level at 1560 nm without the need for further external dechirping and demonstrate a good pulse quality by efficient frequency doubling. Due to the use of PM fiber components and a Faraday rotator the setup is environmentally stable.

21 CFR 179.25 - General provisions for food irradiation.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true General provisions for food irradiation. 179.25... (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) IRRADIATION IN THE PRODUCTION, PROCESSING AND HANDLING OF FOOD Radiation and Radiation Sources § 179.25 General provisions for food irradiation. For the purposes...

49 CFR 179.100 - General specifications applicable to pressure tank car tanks.

Science.gov (United States)

2010-10-01

... car tanks. 179.100 Section 179.100 Transportation Other Regulations Relating to Transportation... REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.100 General specifications applicable to pressure tank car tanks. ...

Intense upconversion luminescence in ytterbium-sensitized thulium-doped oxychloride germanate glass

International Nuclear Information System (INIS)

Sun Hongtao; Zhanga Liyan; Zhang Junjie; Wen Lei; Yu Chunlei; Duan Zhongchao; Dai Shixun; Hu Lili; Jiang Zhonghong

2005-01-01

Structural and upconversion fluorescence properties in ytterbium-sensitized thulium-doped oxychloride germanate glass have been studied. The structure of oxychloride germanate glass was investigated by peak-deconvolution of Raman spectrum, and the structural information was obtained from the peak wavenumbers. The Raman spectrum investigation indicates that PbCl 2 plays an important role in the formation of glass network, and has an important influence on the upconversion luminescence. Intense blue and weak red emissions centered at 477 and 650 nm, corresponding to the transitions 1 G 4 → 3 H 6 and 1 G 4 → 3 H 4 , respectively, were observed at room temperature. The possible upconversion mechanisms are discussed and estimated. Intense upconversion luminescence indicates that oxychloride germanate glass can be used as potential host material for upconversion lasers

Study of ytterbium doping effects on structural, mechanical and opto-thermal properties of sprayed ZnO thin films using the Boubaker Polynomials Expansion Scheme (BPES)

Energy Technology Data Exchange (ETDEWEB)

Amlouk, A. [Unite de physique des dispositifs a semi-conducteurs, Faculte des sciences de Tunis, Universite de Tunis El Manar, 2092 Tunis (Tunisia); Boubaker, K., E-mail: mmbb11112000@yahoo.f [Unite de physique des dispositifs a semi-conducteurs, Faculte des sciences de Tunis, Universite de Tunis El Manar, 2092 Tunis (Tunisia); Amlouk, M. [Unite de physique des dispositifs a semi-conducteurs, Faculte des sciences de Tunis, Universite de Tunis El Manar, 2092 Tunis (Tunisia); Bouhafs, M. [Unite de Recherche MA2I, Ecole Nationale d' Ingenieurs de Tunis, B.P. 37 Le Belvedere, 1002 Tunis (Tunisia)

2009-10-19

In this work, ZnO thin films have been grown on glass substrates by using a solution of propanol (C{sub 3}H{sub 8}O), water (H{sub 2}O) and zinc acetate (Z{sub n}(CH{sub 3}CO{sub 2}){sub 2}) in acidified medium (pH 5). The obtained films were n doped with ytterbium (Yb) at the rates of 100, 200 and 300 ppm. The structural features of the doped films were investigated using XRD, atomic force microscopy and scanning electronic microscopy techniques. XRD analysis shows a strong (0 0 2) X-ray diffraction line for increasing Yb-doping amounts. This c-axis preferential orientation of ZnO crystallites is naturally required to use this oxide as transparent conductor in optoelectronic applications. Atomic force microscopy (AFM) analysis shows an enhancement in the surface roughness of the doped ZnO:Yb thin films. Optical measurements were performed in 300-1800 nm domain via transmittance T(lambda) and reflectance R(lambda) spectra. Conjoint optical and thermal properties were deduced from the optical measurements in reference to the Amlouk-Boubaker opto-thermal expansivity psi{sub AB}. Optically relevant ytterbium doping effects have been discussed. Finally, mechanical measurements have been carried out using Vickers standard disposal. The results confirmed the structural and functional changes that several recent studies attributed to ytterbium doping.

Generation of high-field terahertz pulses in an HMQ-TMS organic crystal pumped by an ytterbium laser at 1030 nm.

Science.gov (United States)

Rovere, Andrea; Jeong, Young-Gyun; Piccoli, Riccardo; Lee, Seung-Heon; Lee, Seung-Chul; Kwon, O-Pil; Jazbinsek, Mojca; Morandotti, Roberto; Razzari, Luca

2018-02-05

We present the generation of high-peak-electric-field terahertz pulses via collinear optical rectification in a 2-(4-hydroxy-3-methoxystyryl)-1-methilquinolinium-2,4,6-trimethylbenzenesulfonate (HMQ-TMS) organic crystal. The crystal is pumped by an amplified ytterbium laser system, emitting 170-fs-long pulses centered at 1030 nm. A terahertz peak electric field greater than 200 kV/cm is obtained for 420 µJ of optical pump energy, with an energy conversion efficiency of 0.26% - about two orders of magnitude higher than in common inorganic crystals collinearly pumped by amplified femtosecond lasers. An open-aperture Z-scan measurement performed on an n-doped InGaAs thin film using such terahertz source shows a nonlinear increase in the terahertz transmission of about 2.2 times. Our findings demonstrate the potential of this terahertz generation scheme, based on ytterbium laser technology, as a simple and efficient alternative to the existing intense table-top terahertz sources. In particular, we show that it can be readily used to explore nonlinear effects at terahertz frequencies.

Fibre amplifier based on an ytterbium-doped active tapered fibre for the generation of megawatt peak power ultrashort optical pulses

Energy Technology Data Exchange (ETDEWEB)

Koptev, M Yu; Anashkina, E A; Lipatov, D S; Andrianov, A V; Muravyev, S V; Kim, A V [Lobachevsky State University of Nizhny Novgorod, Nizhny Novgorod (Russian Federation); Bobkov, K K; Likhachev, M E; Levchenko, A E; Aleshkina, S S; Semjonov, S L; Denisov, A N; Bubnov, M M [Fiber Optics Research Center, Russian Academy of Sciences, Moscow (Russian Federation); Laptev, A Yu; Gur' yanov, A N [G.G.Devyatykh Institute of Chemistry of High-Purity Substances, Russian Academy of Sciences, Nizhnii Novgorod (Russian Federation)

2015-05-31

We report a new ytterbium-doped active tapered fibre used in the output amplifier stage of a fibre laser system for the generation of megawatt peak power ultrashort pulses in the microjoule energy range. The tapered fibre is single-mode at its input end (core and cladding diameters of 10 and 80 μm) and multimode at its output end (diameters of 45 and 430 μm), but ultrashort pulses are amplified in a quasi-single-mode regime. Using a hybrid Er/Yb fibre system comprising an erbium master oscillator and amplifier at a wavelength near 1.5 μm, a nonlinear wavelength converter to the 1 μm range and a three-stage ytterbium-doped fibre amplifier, we obtained pulses of 1 μJ energy and 7 ps duration, which were then compressed by a grating-pair dispersion compressor with 60% efficiency to a 130 fs duration, approaching the transform-limited pulse duration. The present experimental data agree well with numerical simulation results for pulse amplification in the threestage amplifier. (extreme light fields and their applications)

5 CFR 179.209 - Voluntary repayment agreement as alternative to salary offset.

Science.gov (United States)

2010-01-01

... alternative to salary offset. 179.209 Section 179.209 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.209 Voluntary repayment agreement as alternative to salary offset. (a)(1) In response to a notice of intent, an employee may propose...

49 CFR 179.102 - Special commodity requirements for pressure tank car tanks.

Science.gov (United States)

2010-10-01

... car tanks. 179.102 Section 179.102 Transportation Other Regulations Relating to Transportation... REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.102 Special commodity requirements for pressure tank car tanks. (a) In addition to...

Overview of ultraviolet and infrared spectroscopic properties of Yb{sup 3+} doped borate and oxy-borates compounds; De l'ultraviolet a l'infrarouge: caracterisation spectroscopique de materiaux type borate et oxyborate dopes a l'ytterbium trivalent

Energy Technology Data Exchange (ETDEWEB)

Sablayrolles, J

2006-12-15

The trivalent ytterbium ion can give rise to two emissions with different spectroscopic properties: the first one, with a short lifetime, in the ultraviolet (charge transfer emission) is used in detectors such as scintillators, and the other one, with a long lifetime, in the infrared (4f-4f emission) for laser applications. The strong link between material structure and properties is illustrated through ytterbium luminescence study, in the ultraviolet and infrared, inserted in the borate Li{sub 6}Y(BO{sub 3}){sub 3} and two oxy-borates: LiY{sub 6}O{sub 5}(BO{sub 3}){sub 3} and Y{sub 17,33}B{sub 8}O{sub 38}. For the first time an ytterbium charge transfer emission in oxy-borates has been observed. The calculation of the single configurational coordinate diagram, as well as the thermal quenching, has been conducted under a fundamental approach on the ytterbium - oxygen bond. The study of the ytterbium infrared spectroscopy in these compounds has been realised and an energy level attribution is proposed in the particular case of the borate Li{sub 6}Y(BO{sub 3}){sub 3}: Yb{sup 3+}. An original approach is introduced with the study of the charge transfer states for the three compounds by looking at the infrared emission. The first laser performances in three operating modes (continuous wave, Q-switch and mode locking) of a Li{sub 6}Y(BO{sub 3}){sub 3}: Yb{sup 3+} crystal are reported. (author)

Trace electrochemical analysis of Europium, Ytterbium, and Cerium at their joint presence in solution

Directory of Open Access Journals (Sweden)

Rema Matakova

2012-03-01

Full Text Available In the course of several decades at the department of analytical chemistry and chemistry of rare elements there were studied the electrode processes with participation of rare-earth metals (REM in accordance with the long awaiting problem of the development of rare-metal and rare-earth branch of non-ferrous metallurgy of Kazakhstan. With the aim of express and highly sensitive analytical control of raw materials and final product of rare-earth industry there were developed the methods of inversion-voltamperometric determination of low concentrations of europium, ytterbium and cerium under the conditions of their individual and combined presence in the solution.

Efficient single-mode operation of a cladding-pumped ytterbium-doped helical-core fiber laser.

Science.gov (United States)

Wang, P; Cooper, L J; Sahu, J K; Clarkson, W A

2006-01-15

A novel approach to achieving robust single-spatial-mode operation of cladding-pumped fiber lasers with multimode cores is reported. The approach is based on the use of a fiber geometry in which the core has a helical trajectory within the inner cladding to suppress laser oscillation on higher-order modes. In a preliminary proof-of-principle study, efficient single-mode operation of a cladding-pumped ytterbium-doped helical-core fiber laser with a 30 microm diameter core and a numerical aperture of 0.087 has been demonstrated. The laser yielded 60.4 W of output at 1043 nm in a beam with M2 clad fiber lasers.

Observations of high spin states in {sup 179}Au

Energy Technology Data Exchange (ETDEWEB)

Carpenter, M.P.; Ahmad, I.; Blumenthal, D.J. [and others

1995-08-01

As part of a current study on the properties of the {pi} i{sub 13/2} intruder state in the A = 175-190 region, we conducted an experiment at ATLAS to observe high spin states in {sup 179}Au utilizing the reaction {sup 144}Sm({sup 40}Ar,p4n) at beam energies of 207 MeV and 215 MeV. To aid in the identification of {sup 179}Au, and to filter out the large amount of events from fission by-products, the Fragment Mass Analyzer was utilized in conjunction with ten Compton-suppression germanium detectors. In total, 11 x 10{sup 6} {gamma}-{gamma} and 4 x 10{sup 5} {gamma}-recoil events were collected. By comparing {gamma}-rays in coincidence with an A = 179 recoil mass gate and {gamma}-rays in coincidence with Au K{alpha} and K{beta} X-rays, ten {gamma}-rays were identified as belonging to {sup 179}Au. Based on {gamma}-ray coincidence relationships and on comparisons with neighboring odd-A Au nuclei, we constructed a tentative level scheme and assigned a rotational-like sequence to the {pi} i{sub 13/2} proton configuration.

40 CFR 179.50 - Conduct at oral hearings or conferences.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Conduct at oral hearings or conferences. 179.50 Section 179.50 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... dignity and observe the same standards of practice and ethics that would be required of parties in a...

49 CFR 179.500 - Specification DOT-107A * * * * seamless steel tank car tanks.

Science.gov (United States)

2010-10-01

... car tanks. 179.500 Section 179.500 Transportation Other Regulations Relating to Transportation... REGULATIONS SPECIFICATIONS FOR TANK CARS Specification for Cryogenic Liquid Tank Car Tanks and Seamless Steel Tanks (Classes DOT-113 and 107A) § 179.500 Specification DOT-107A * * * * seamless steel tank car tanks. ...

49 CFR 179.4 - Changes in specifications for tank cars.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Changes in specifications for tank cars. 179.4... TANK CARS Introduction, Approvals and Reports § 179.4 Changes in specifications for tank cars. (a...—Tank Car Safety, AAR, for consideration by its Tank Car Committee. An application for construction of...

49 CFR 179.301 - Individual specification requirements for multi-unit tank car tanks.

Science.gov (United States)

2010-10-01

...-unit tank car tanks. 179.301 Section 179.301 Transportation Other Regulations Relating to... MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Multi-Unit Tank Car Tanks (Classes DOT-106A and 110AW) § 179.301 Individual specification requirements for multi-unit tank car tanks. (a) In...

49 CFR 17.9 - How does the Secretary receive and respond to comments?

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false How does the Secretary receive and respond to comments? 17.9 Section 17.9 Transportation Office of the Secretary of Transportation INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF TRANSPORTATION PROGRAMS AND ACTIVITIES § 17.9 How does the Secretary receive and...

A mass spectrometric study of the neutral and ionic vapor components of ytterbium chlorides; formation enthalpies of YbCl2 and YbCl3 molecules, and YbCl3- and YbCl4- ions in the gas phase

International Nuclear Information System (INIS)

Kuznetsov, F.Yh.; Kudin, L.S.; Pogrebnoj, A.M.; Butman, M.F.; Burdukovskaya, G.G.

1997-01-01

Ionic and neutral components of saturated vapour over the ytterbium di-and trichloride is studied through the Knudsen effusive method with mass-spectromic registration of evaporated products within the temperature range of 1000-1300 K. It is found that ytterbium trichloride is subjected to thermal decomposition with formation of ytterbium dichloride and molecular chloride. Sublimation enthalpy and enthalpy of YbCl 2 and YbCl 3 molecules formation in a gaseous phase at 298 K, comprising 356±6, 293±8, -425±6 and -667±6 kJ/mole correspondingly, are determined with application of 2 and 3 thermodynamical laws. Enthalpies of YbCl 3 - and YbCl 4 - negative ions formation in a gaseous phase at 298 K equal to -895 and -1211±30 kJ/mole correspondingly are calculated by measured equilibrium constants ion-molecular reaction. 30 refs., 3 figs., 3 tabs

Investigation of the vapour-plasma plume in the welding of titanium by high-power ytterbium fibre laser radiation

Energy Technology Data Exchange (ETDEWEB)

Bykovskiy, D P; Petrovskii, V N; Uspenskiy, S A [National Research Nuclear University ' MEPhI' (Russian Federation)

2015-03-31

The vapour-plasma plume produced in the welding of 6-mm thick VT-23 titanium alloy plates by ytterbium fibre laser radiation of up to 10 kW power is studied in the protective Ar gas medium. High-speed video filming of the vapour-plasma plume is used to visualise the processes occurring during laser welding. The coefficient of inverse bremsstrahlung by the welding plasma plume is calculated from the data of the spectrometric study. (interaction of laser radiation with matter)

The gadolinium nitrate-carbamide-water and the ytterbium nitrate-carbamide-water systems at 30 deg C

International Nuclear Information System (INIS)

Khudajbergenova, N.; Sulajmankulov, K.

1980-01-01

Gadolinium nitrate-carbamide-water(1) and ytterbium nitrate-carbamide-water(2) systems are studied at 30 deg C by the solubility method. Two new compounds are formed in the system(1). One of them is incongruent Gd(NO 3 ) 3 x3CON 2 H 4 and Gd(NO 3 ) 3 x4CON 2 H 4 is congruently soluble. Incongruent compound of Yb(NO 3 ) 3 xCON 2 H 4 composition and congruently soluble Yb(NO 3 ) 3 x4CON 2 H 4 are also formed in the system(2). Presented are solubility isotherms of the systems [ru

40 CFR 179.91 - Burden of going forward; burden of persuasion.

Science.gov (United States)

2010-07-01

... persuasion. 179.91 Section 179.91 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...; burden of persuasion. (a) The party whose request for an evidentiary hearing was granted has the burden... FFDCA has the burden of persuasion in the hearing on that issue, whether the proceeding concerns the...

Combined up conversion, down conversion and down shifting photo-luminescence of low cost erbium-ytterbium co-doped porous silicon produced by stain etching

Energy Technology Data Exchange (ETDEWEB)

Diaz-Herrera, B. [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Linsun Power Technology (Quanzhou) Corp. Ltd. Co., Economic Development Zone, Jinjiang 362200, Fujian (China); Jimenez-Rodriguez, E. [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Gonzalez-Diaz, B. [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Instituto Tecnologico y de Energias Renovables, S.A. (ITER), Poligono Industrial de Granadilla, S/N, E38600, Granadilla de Abona (Spain); Montesdeoca-Santana, A. [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Velazquez, J.J. [Departamento de Fisica Fundamental y Experimental, Electronica y Sistemas, Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Guerrero-Lemus, R., E-mail: rglemus@ull.es [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Fundacion de Estudios de Economia Aplicada, Programa Focus-Abengoa de Energia y Cambio Climaticoi, Jorge Juan 46, 28001 Madrid (Spain)

2011-07-01

In this work, erbium and ytterbium have been incorporated into luminescent porous silicon (PS) layers by simple impregnation of the PS substrate with a saturated nitrate solution of erbium and ytterbium. The photoluminescence of the co-doped rare earth layers have been evaluated. The doping process has been designed for its potential in silicon-based solar cell production, with the aim to improve the Shockley-Queisser limit with a reasonable cost effective method for the industry, which implies a significant enhancement of the efficiency under non-concentrated sunlight irradiation. The temperature and annealing time of the doping process were selected according to industry standards in order to ease a trial adoption. The composition was analyzed by Fourier transform infrared spectroscopy and X-ray photoelectron spectroscopy in order to characterize the doping profile. Different up-conversion and down-conversion contributions from the rare earths in the visible and IR were detected, together with the down shifting effect of the stain etched PS. There is no evidence of energy transference between the PS matrix and the rare earths.

Combined up conversion, down conversion and down shifting photo-luminescence of low cost erbium-ytterbium co-doped porous silicon produced by stain etching

International Nuclear Information System (INIS)

Diaz-Herrera, B.; Jimenez-Rodriguez, E.; Gonzalez-Diaz, B.; Montesdeoca-Santana, A.; Velazquez, J.J.; Guerrero-Lemus, R.

2011-01-01

In this work, erbium and ytterbium have been incorporated into luminescent porous silicon (PS) layers by simple impregnation of the PS substrate with a saturated nitrate solution of erbium and ytterbium. The photoluminescence of the co-doped rare earth layers have been evaluated. The doping process has been designed for its potential in silicon-based solar cell production, with the aim to improve the Shockley-Queisser limit with a reasonable cost effective method for the industry, which implies a significant enhancement of the efficiency under non-concentrated sunlight irradiation. The temperature and annealing time of the doping process were selected according to industry standards in order to ease a trial adoption. The composition was analyzed by Fourier transform infrared spectroscopy and X-ray photoelectron spectroscopy in order to characterize the doping profile. Different up-conversion and down-conversion contributions from the rare earths in the visible and IR were detected, together with the down shifting effect of the stain etched PS. There is no evidence of energy transference between the PS matrix and the rare earths.

179Ta and 180Ta structure by transfer reactions

International Nuclear Information System (INIS)

Warde, Elias.

1979-01-01

Transfer reactions (α,t); ( 3 He,d); (p,t) and (p,d) have been used to study the nuclear spectroscopy of 179 Ta and 180 Ta. In 179 Ta, 5/2 - and 9/2 - states of the 1/2(541) configuration have been identified. The core-quasiproton interaction has to be taken into account in order to explain the two-nucleon transfer intensities in the 181 Ta(p,t) 179 Ta reaction. A level scheme has been proposed for 180 Ta for the first time. Especially the ground state is identified with the (1 + ,1) level of the [7/2 + (404)sub(p), 9/2 + (624)sub(n)] configuration and spin (9 - ,9) of the configuration [9/2 - (514)sub(p), 9/2 + (624)sub(n)] has been assigned to the long-lived isomer. From the observed configurations in 180 Ta, the matrix elements of the effective residual interaction vsub(np) have been deduced and compared to theoretical predictions [fr

49 CFR 179.500-5 - Material.

Science.gov (United States)

2010-10-01

... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specification for Cryogenic Liquid Tank Car Tanks and Seamless Steel Tanks (Classes DOT-113 and 107A) § 179.500-5 Material. (a) Tanks shall be made from open-hearth or electric steel of uniform quality. Material...

49 CFR 179.400 - General specification applicable to cryogenic liquid tank car tanks.

Science.gov (United States)

2010-10-01

... liquid tank car tanks. 179.400 Section 179.400 Transportation Other Regulations Relating to... MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specification for Cryogenic Liquid Tank Car Tanks and... liquid tank car tanks. ...

49 CFR 179.400-5 - Materials.

Science.gov (United States)

2010-10-01

... Specification for Cryogenic Liquid Tank Car Tanks and Seamless Steel Tanks (Classes DOT-113 and 107A) § 179.400... condition prior to fabrication, forming and fusion welding; (2) Suitable for use at the temperature of the...) Conducted at the tank design service temperature or colder; and (4) Performed on test plate welds and...

14 CFR 406.179 - Judicial review of a final decision and order.

Science.gov (United States)

2010-01-01

... order. 406.179 Section 406.179 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION... with a United States district court. (b) In accordance with § 406.9(e)(iv), if a person seeks judicial... civil penalty and does not file an appeal with the United States district court within 60 days after...

49 CFR 179.400-22 - Protective housings.

Science.gov (United States)

2010-10-01

... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specification for Cryogenic Liquid Tank Car Tanks and Seamless Steel Tanks (Classes DOT-113 and 107A) § 179.400.... The protective housing must be adequate to protect the enclosed components from direct solar radiation...

49 CFR 179.201 - Individual specification requirements applicable to non-pressure tank car tanks.

Science.gov (United States)

2010-10-01

... to non-pressure tank car tanks. 179.201 Section 179.201 Transportation Other Regulations Relating to... MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Non-Pressure Tank Car Tanks (Classes... car tanks. ...

49 CFR 179.101 - Individual specification requirements applicable to pressure tank car tanks.

Science.gov (United States)

2010-10-01

... to pressure tank car tanks. 179.101 Section 179.101 Transportation Other Regulations Relating to... MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Pressure Tank Car Tanks (Classes DOT... tank car tanks. Editorial Note: At 66 FR 45186, Aug. 28, 2001, an amendment published amending a table...

Ytterbium and erbium derivatives of 2-methoxyethanol and their use in the thin film deposition of Er-doped Yb.sub.3./sub.Al.sub.5./sub.O.sub.12./sub..

Czech Academy of Sciences Publication Activity Database

Rubešová, E.; Hlásek, T.; Jakeš, V.; Matějka, P.; Oswald, Jiří; Holzhauser, P.

2014-01-01

Roč. 70, č. 1 (2014), s. 142-148 ISSN 0928-0707 Institutional support: RVO:68378271 Keywords : ytterbium-aluminium garnets * sol-gel growth * thin films * IR spectroscopy * optical materials * luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.532, year: 2014

Dual-Mode Operation of an Optical Lattice Clock Using Strontium and Ytterbium Atoms.

Science.gov (United States)

Akamatsu, Daisuke; Kobayashi, Takumi; Hisai, Yusuke; Tanabe, Takehiko; Hosaka, Kazumoto; Yasuda, Masami; Hong, Feng-Lei

2018-06-01

We have developed an optical lattice clock that can operate in dual modes: a strontium (Sr) clock mode and an ytterbium (Yb) clock mode. Dual-mode operation of the Sr-Yb optical lattice clock is achieved by alternately cooling and trapping 87 Sr and 171 Yb atoms inside the vacuum chamber of the clock. Optical lattices for Sr and Yb atoms were arranged with horizontal and vertical configurations, respectively, resulting in a small distance of the order of between the trapped Sr and Yb atoms. The 1 S 0 - 3 P 0 clock transitions in the trapped atoms were interrogated in turn and the clock lasers were stabilized to the transitions. We demonstrated the frequency ratio measurement of the Sr and Yb clock transitions by using the dual-mode operation of the Sr-Yb optical lattice clock. The dual-mode operation can reduce the uncertainty of the blackbody radiation shift in the frequency ratio measurement, because both Sr and Yb atoms share the same blackbody radiation.

Stark effect investigations of excited cadmium, ytterbium, and thulium I-levels using the methods of double resonance and level crossing

International Nuclear Information System (INIS)

Rinkleff, R.H.

1977-01-01

Using the method of optical double resonance, the 5s5p 3 P 1 level tensor polarizability of Cadmium has been measured. For this state, various authors have published different results, using different experimental methods. The experimental result presented here is in excellent agreement with the value of Happer, based on level crossing investigations, and agrees well with the theoretical result of Robinson based on a modified Sternheimer approximation, and so gives a reliable value for the tensor polarizability. Furthermore the tensor polarizability of the 6s6p 3 P 1 - level of the even Ytterbium isotopes and the odd Ytterbium 171 nucleus have been measured with the optical double resonance method, and the Stark constant has been calculated based on a given theory and oscillator strengths. Using the methods of optical double resonance and level crossing, the tensor polarizability of 5 excited levels of the Thulium configurations 4f 13 6s6p + 4f 12 5d6s 2 have been measured. From the experimental Stark constants and the angular coefficients of the eigenfunctions calculated by Camus, the radial integrals I(5d, 5p) and I(6p, 5d) are calculated for electric dipole transitions between levels of the configurations 4f 12 5d6s 2 + 4f 13 6s6p and levels of the 4f 12 6p6s 2 + 4f 13 6s5d configurations. The tensor polarizability calculated with these radial integrals show very good agreement with the experimental values. (orig./LH) [de

49 CFR 179.100-8 - Tank heads.

Science.gov (United States)

2010-10-01

... Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.100-8 Tank heads. (a... hot formed at a temperature exceeding 1700 °F., must be normalized after forming by heating to a temperature between 1550° and 1700 °F., by holding at that temperature for at least 1 hour per inch of...

Specificity protein 1-zinc finger protein 179 pathway is involved in the attenuation of oxidative stress following brain injury

Directory of Open Access Journals (Sweden)

Jian-Ying Chuang

2017-04-01

Full Text Available After sudden traumatic brain injuries, secondary injuries may occur during the following days or weeks, which leads to the accumulation of reactive oxygen species (ROS. Since ROS exacerbate brain damage, it is important to protect neurons against their activity. Zinc finger protein 179 (Znf179 was shown to act as a neuroprotective factor, but the regulation of gene expression under oxidative stress remains unknown. In this study, we demonstrated an increase in Znf179 protein levels in both in vitro model of hydrogen peroxide (H2O2-induced ROS accumulation and animal models of traumatic brain injury. Additionally, we examined the sub-cellular localization of Znf179, and demonstrated that oxidative stress increases Znf179 nuclear shuttling and its interaction with specificity protein 1 (Sp1. Subsequently, the positive autoregulation of Znf179 expression, which is Sp1-dependent, was further demonstrated using luciferase reporter assay and green fluorescent protein (GFP-Znf179-expressing cells and transgenic mice. The upregulation of Sp1 transcriptional activity induced by the treatment with nerve growth factor (NGF led to an increase in Znf179 levels, which further protected cells against H2O2-induced damage. However, Sp1 inhibitor, mithramycin A, was shown to inhibit NGF effects, leading to a decrease in Znf179 expression and lower cellular protection. In conclusion, the results obtained in this study show that Znf179 autoregulation through Sp1-dependent mechanism plays an important role in neuroprotection, and NGF-induced Sp1 signaling may help attenuate more extensive (ROS-induced damage following brain injury.

A crystal chemistry approach for high-power ytterbium doped solid-state lasers: diffusion-bonded crystals and new crystalline hosts

International Nuclear Information System (INIS)

Gaume, R.

2002-11-01

This work deals with ytterbium based crystals for high-power laser applications. In particular, we focus our interest in reducing crystal heating and its consequences during laser operation following two different ways. First, we review the specific properties of ytterbium doped solid-state lasers in order to define a figure-of-merit which gives the evaluation of laser performances, thermo-mechanical and thermo-optical properties. Bearing in mind this analysis, we propose a set of theoretical tools, based on the crystallographic structure of the crystal and its chemical composition, to predict thermo-mechanical and optical potentials. This approach, used for the seek of new Yb 3+ -doped materials for high-power laser applications, shows that simple oxides containing rare-earths are favorable. Therefore, the spectroscopic properties of six new materials Yb 3+ :GdVO 4 , Yb 3+ :GdAlO 3 , Yb 3+ :Gd 2 O 3 , Yb 3+ :Sc 2 SiO 5 , Yb 3+ :CaSc 2 O 4 and Yb 3+ :SrSc 2 O 4 are described. The second aspect developed in this work deals with thermal properties enhancement of already well characterized laser materials. Two different ways are explored: a) elaboration by diffusion bonding of end-caps lasers with undoped crystals (composite crystals). Thus, different composites were obtained and a fairly lowering of thermal lensing effect was observed during laser operation. b) strengthening of crystalline structures by ionic substitution of one of its constituents. We demonstrate how crystal growth ability can be improved by a cationic substitution in the case of Yb 3+ :BOYS, a largely-tunable laser material which is of great interest for femtosecond pulses generation. (author)

Soliton rains in a graphene-oxide passively mode-locked ytterbium-doped fiber laser with all-normal dispersion

International Nuclear Information System (INIS)

Huang, S S; Yan, P G; Zhang, G L; Zhao, J Q; Li, H Q; Lin, R Y; Wang, Y G

2014-01-01

We experimentally investigated soliton rains in an ytterbium-doped fiber (YDF) laser with a net normal dispersion cavity using a graphene-oxide (GO) saturable absorber (SA). The 195 m-long-cavity, the fiber birefringence filter and the inserted 2.5 nm narrow bandwidth filter play important roles in the formation of the soliton rains. The soliton rain states can be changed by the effective gain bandwidth of the laser. The experimental results can be conducive to an understanding of dissipative soliton features and mode-locking dynamics in all-normal dispersion fiber lasers with GOSAs. To the best of our knowledge, this is the first demonstration of soliton rains in a GOSA passively mode-locked YDF laser with a net normal dispersion cavity. (letter)

Status of fiber lasers study of on ytterbium doped fiber laser and laser spectroscopy of doped fibers

International Nuclear Information System (INIS)

Magne, S.

1994-07-01

This work shows all the advantages and drawbacks of the rare-earth-doped fiber lasers and fiber optical amplifiers, pointing out their potential use for instrumentation and optical fiber sensor technology. The theory of light propagation in optical fibers is presented in order to understand the manufacturing methods. A comparative study of preform surface and concentration analysis is performed. The gain behaviour is also thoroughly examined. A synthesis of all technological parameters of the fiber laser is then established and all technologies of the constituting integrated components are reviewed and compared. The experimental techniques mainly involve: site selective excitation tunability, cooperative luminescence, oxidation state changes induced by gamma irradiation, ytterbium-doped mono-mode continuous wave tunable three-level fiber laser. (TEC). 622 refs., 176 figs

Kinetics of electrophilic substitution of neodymium(III) by ytterbium(III) in aqueous solutions of ethylenediamintetraacetate and cyclohexanediaminetetraacetate

International Nuclear Information System (INIS)

Nikitenko, S.I.; Martynenko, L.I.; Pechurova, N.I.; Spitsyn, V.I.

1982-01-01

The kinetics of electrophilic substitution in systems containing rare earth element ions (REE) and Komplexon [tetrasodium ethylenediaminetetraacetate] have been studied little. At the same time, information about the mechanism of exchange is not only of theoretical interest but is important for the optimization of processes for separating and purifying REE. Least studied of all has been the mutual exchange in Komplexonate ions of light and heavy REE, although it is precisely the kinetics of exchange of different kinds of REE ions that primarily determines the effectiveness of the separation of their mixtures. We have studied electrophilic substitution in the case of the replacement of neodymium(III) by ytterbium(III) in solutions containing NdL - and Yb 3 + , where L 4 - and D 4 -

Status of fiber lasers study of on ytterbium doped fiber laser and laser spectroscopy of doped fibers; Etat de l`art des lasers a fibre, etude d`un laser a fibre dopee ytterbium et spectroscopie laser de fibres dopees

Energy Technology Data Exchange (ETDEWEB)

Magne, S

1994-07-01

This work shows all the advantages and drawbacks of the rare-earth-doped fiber lasers and fiber optical amplifiers, pointing out their potential use for instrumentation and optical fiber sensor technology. The theory of light propagation in optical fibers is presented in order to understand the manufacturing methods. A comparative study of preform surface and concentration analysis is performed. The gain behaviour is also thoroughly examined. A synthesis of all technological parameters of the fiber laser is then established and all technologies of the constituting integrated components are reviewed and compared. The experimental techniques mainly involve: site selective excitation tunability, cooperative luminescence, oxidation state changes induced by gamma irradiation, ytterbium-doped mono-mode continuous wave tunable three-level fiber laser. (TEC). 622 refs., 176 figs.

Synthesis and photocatalytic activity of ytterbium-doped titania/diatomite composite photocatalysts

Science.gov (United States)

Tang, Wenjian; Qiu, Kehui; Zhang, Peicong; Yuan, Xiqiang

2016-01-01

Ytterbium-doped titanium dioxide (Yb-TiO2)/diatomite composite materials with different Yb concentrations were prepared by sol-gel method. The phase structure, morphology, and chemical composition of the as-prepared composites were well characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy, Raman spectroscopy, scanning electron microscopy (SEM), and ultraviolet-visible (UV-vis) diffuse reflection spectroscopy. The XRD and Raman spectroscopy analysis indicated that the TiO2 existed in the form of pure anatase in the composites. The SEM images exhibited the well deposition and dispersion of TiO2 nanoparticles with little agglomeration on the surfaces of diatoms. The UV-vis diffuse reflection spectra showed that the band gap of TiO2 could be narrowed by the introduction of Yb species, which was further affected by doping concentration of Yb. The photocatalytic activity of synthesized samples was investigated by the degradation of methylene blue (MB) under UV light irradiation. It was observed that the photocatalytic degradation followed a pseudo-first-order kinetics according to the Langmuir-Hinshelwood model. Compared to TiO2 and TiO2/diatomite, the Yb-TiO2/diatomite composites exhibited higher photocatalytic activity toward degradation of MB using UV light irradiation.

Two-dimensional ytterbium oxide nanodisks based biosensor for selective detection of urea.

Science.gov (United States)

Ibrahim, Ahmed A; Ahmad, Rafiq; Umar, Ahmad; Al-Assiri, M S; Al-Salami, A E; Kumar, Rajesh; Ansari, S G; Baskoutas, S

2017-12-15

Herein, we demonstrate synthesis and application of two-dimensional (2D) rectangular ytterbium oxide (Yb 2 O 3 ) nanodisks via a facile hydrothermal method. The structural, morphological, compositional, crystallinity, and phase properties of as-synthesized nanodisks were carried out using several analytical techniques that showed well defined 2D rectangular nanodisks/sheet like morphologies. The average thickness and edge length of the nanosheet structures were 20 ± 5nm and 600 ± 50nm, respectively. To develop urea biosensor, glassy carbon electrodes (GCE) were modified with Yb 2 O 3 nanodisks, followed by urease immobilization and Nafion membrane covering (GCE/Yb 2 O 3 /Urease/Nafion). The fabricated biosensor showed sensitivity of 124.84μAmM -1 cm -2 , wide linear range of 0.05-19mM, detection limit down to ~ 2μM, and fast response time of ~ 3s. The developed biosensor was also used for the urea detection in water samples through spike-recovery experiments, which illustrates satisfactory recoveries. In addition, the obtained desirable selectivity towards specific interfering species, long-term stability, reproducibility, and repeatability further confirm the potency of as-fabricated urea biosensor. Copyright © 2017 Elsevier B.V. All rights reserved.

RDM lifetimes measurements in 179Re

International Nuclear Information System (INIS)

Chamoli, S.; Joshi, P.; Kumar, A.; Govil, I.M.; Singh, R.P.; Chatturvedi, L.

2001-01-01

The study of Re nuclei in the mass region from 170-190 is of particular interest as they lie in a region where the Nilsson orbitals exhibit large driving effects on the nuclear shape, presenting the strong possibility of shape coexistence. To see the variation of the deformation driving property of different bands and the other related phenomena like delay in band crossing frequency for intruder configuration h 92 in these nuclei with increasing in neutron number the lifetime measurement in 179 Re nucleus is done

All-optical switching in Sagnac loop mirror containing an ytterbium-doped fiber and fiber Bragg grating.

Science.gov (United States)

Zang, Zhigang

2013-08-10

A configuration of all-optical switching based on a Signac loop mirror that incorporates an ytterbium-doped fiber and uniform fiber Bragg grating (FBG) is proposed in this paper. It is found that the transmission spectrum of this structure is the narrow splitting of the reflection spectrum of the FBG. The shift of this ultranarrow transmission spectrum is very sensitive to the intensity of the pump power. Thus, the threshold switching power can be greatly reduced by shifting such narrow transmission spectrum. Compared with the single FBG, the threshold switching power of this configuration is reduced by 4 orders of magnitude. In addition, the results indicate that this optical switching has a high extinction ratio of 20 dB and a ultrafast response time of 3 ns. The operation regime and switching performance under the cross-phase modulation cases are also investigated.

Thermal characteristics of an end-pumped high-power ytterbium-sensitized erbium-doped fiber laser under natural convection.

Science.gov (United States)

Jeong, Y; Baek, S; Dupriez, P; Maran, J-N; Sahu, J K; Nilsson, J; Lee, B

2008-11-24

We investigate the thermal characteristics of a polymer-clad fiber laser under natural convection when it is strongly pumped up to the damage point of the fiber. For this, we utilize a temperature sensing technique based on a fiber Bragg grating sensor array. We have measured the longitudinal temperature distribution of a 2.4-m length ytterbium-sensitized erbium-doped fiber laser that was end-pumped at approximately 975 nm. The measured temperature distribution decreases exponentially, approximately, decaying away from the pump-launch end. We attribute this to the heat dissipation of absorbed pump power. The maximum temperature difference between the fiber ends was approximately 190 K at the maximum pump power of 60.8 W. From this, we estimate that the core temperature reached approximately 236 degrees C.

40 CFR 159.179 - Metabolites, degradates, contaminants, and impurities.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Metabolites, degradates, contaminants.../Benefit Information § 159.179 Metabolites, degradates, contaminants, and impurities. (a) Metabolites and... degradation of less than 10 percent in a 30-day period. (b) Contaminants and impurities. The presence in any...

A crystal chemistry approach for high-power ytterbium doped solid-state lasers: diffusion-bonded crystals and new crystalline hosts; Relations structures-proprietes dans les lasers solides de puissance a l'ytterbium: elaboration et caracterisation de nouveaux materiaux et de cristaux composites soudes par diffusion

Energy Technology Data Exchange (ETDEWEB)

Gaume, R

2002-11-15

This work deals with ytterbium based crystals for high-power laser applications. In particular, we focus our interest in reducing crystal heating and its consequences during laser operation following two different ways. First, we review the specific properties of ytterbium doped solid-state lasers in order to define a figure-of-merit which gives the evaluation of laser performances, thermo-mechanical and thermo-optical properties. Bearing in mind this analysis, we propose a set of theoretical tools, based on the crystallographic structure of the crystal and its chemical composition, to predict thermo-mechanical and optical potentials. This approach, used for the seek of new Yb{sup 3+}-doped materials for high-power laser applications, shows that simple oxides containing rare-earths are favorable. Therefore, the spectroscopic properties of six new materials Yb{sup 3+}:GdVO{sub 4}, Yb{sup 3+}:GdAlO{sub 3}, Yb{sup 3+}:Gd{sub 2}O{sub 3}, Yb{sup 3+}:Sc{sub 2}SiO{sub 5}, Yb{sup 3+}:CaSc{sub 2}O{sub 4} and Yb{sup 3+}:SrSc{sub 2}O{sub 4} are described. The second aspect developed in this work deals with thermal properties enhancement of already well characterized laser materials. Two different ways are explored: a) elaboration by diffusion bonding of end-caps lasers with undoped crystals (composite crystals). Thus, different composites were obtained and a fairly lowering of thermal lensing effect was observed during laser operation. b) strengthening of crystalline structures by ionic substitution of one of its constituents. We demonstrate how crystal growth ability can be improved by a cationic substitution in the case of Yb{sup 3+}:BOYS, a largely-tunable laser material which is of great interest for femtosecond pulses generation. (author)

A crystal chemistry approach for high-power ytterbium doped solid-state lasers: diffusion-bonded crystals and new crystalline hosts; Relations structures-proprietes dans les lasers solides de puissance a l'ytterbium: elaboration et caracterisation de nouveaux materiaux et de cristaux composites soudes par diffusion

Energy Technology Data Exchange (ETDEWEB)

Gaume, R

2002-11-15

This work deals with ytterbium based crystals for high-power laser applications. In particular, we focus our interest in reducing crystal heating and its consequences during laser operation following two different ways. First, we review the specific properties of ytterbium doped solid-state lasers in order to define a figure-of-merit which gives the evaluation of laser performances, thermo-mechanical and thermo-optical properties. Bearing in mind this analysis, we propose a set of theoretical tools, based on the crystallographic structure of the crystal and its chemical composition, to predict thermo-mechanical and optical potentials. This approach, used for the seek of new Yb{sup 3+}-doped materials for high-power laser applications, shows that simple oxides containing rare-earths are favorable. Therefore, the spectroscopic properties of six new materials Yb{sup 3+}:GdVO{sub 4}, Yb{sup 3+}:GdAlO{sub 3}, Yb{sup 3+}:Gd{sub 2}O{sub 3}, Yb{sup 3+}:Sc{sub 2}SiO{sub 5}, Yb{sup 3+}:CaSc{sub 2}O{sub 4} and Yb{sup 3+}:SrSc{sub 2}O{sub 4} are described. The second aspect developed in this work deals with thermal properties enhancement of already well characterized laser materials. Two different ways are explored: a) elaboration by diffusion bonding of end-caps lasers with undoped crystals (composite crystals). Thus, different composites were obtained and a fairly lowering of thermal lensing effect was observed during laser operation. b) strengthening of crystalline structures by ionic substitution of one of its constituents. We demonstrate how crystal growth ability can be improved by a cationic substitution in the case of Yb{sup 3+}:BOYS, a largely-tunable laser material which is of great interest for femtosecond pulses generation. (author)

49 CFR Appendix B to Part 179 - Procedures for Simulated Pool and Torch-Fire Testing

Science.gov (United States)

2010-10-01

... the plate. (4) The bare plate holder must be constructed in such a manner that the only heat transfer...) The bare plate holder must be constructed in such a manner that the only heat transfer to the back... SPECIFICATIONS FOR TANK CARS Pt. 179, App. B Appendix B to Part 179—Procedures for Simulated Pool and Torch-Fire...

Kinetic study by FTIR and DSC on the cationic curing of a DGEBA/{gamma}-valerolactone mixture with ytterbium triflate as an initiator

Energy Technology Data Exchange (ETDEWEB)

Arasa, M. [Departament de Quimica Analitica i Quimica Organica, Universitat Rovira i Virgili. C/Marcel.li Domingo s/n, 43007 Tarragona (Spain); Ramis, X. [Laboratori de Termodinamica, ETSEIB. Universitat Politecnica de Catalunya, Av. Diagonal 647, 08028 Barcelona (Spain)], E-mail: ramis@mmt.upc.edu; Salla, J.M. [Laboratori de Termodinamica, ETSEIB. Universitat Politecnica de Catalunya, Av. Diagonal 647, 08028 Barcelona (Spain); Mantecon, A.; Serra, A. [Departament de Quimica Analitica i Quimica Organica, Universitat Rovira i Virgili. C/Marcel.li Domingo s/n, 43007 Tarragona (Spain)

2008-12-05

A mixture of diglycidylether of bisphenol A (DGEBA) and {gamma}-valerolactone ({gamma}-VL) was cured in the presence of ytterbium triflate as an initiator to obtain poly(esther-ether) thermosets. The kinetics of the various elemental reactions, which take place during the curing process, was studied by means of isothermal curing in the FTIR spectrometer. The kinetic parameters were calculated by means of the isoconversional procedure and the best-fit kinetic model was determined with the so-called compensation effect (isokinetic relationship). The isothermal kinetic analysis was compared with that obtained by dynamic curing in DSC.

Kinetic study by FTIR and DSC on the cationic curing of a DGEBA/γ-valerolactone mixture with ytterbium triflate as an initiator

International Nuclear Information System (INIS)

Arasa, M.; Ramis, X.; Salla, J.M.; Mantecon, A.; Serra, A.

2008-01-01

A mixture of diglycidylether of bisphenol A (DGEBA) and γ-valerolactone (γ-VL) was cured in the presence of ytterbium triflate as an initiator to obtain poly(esther-ether) thermosets. The kinetics of the various elemental reactions, which take place during the curing process, was studied by means of isothermal curing in the FTIR spectrometer. The kinetic parameters were calculated by means of the isoconversional procedure and the best-fit kinetic model was determined with the so-called compensation effect (isokinetic relationship). The isothermal kinetic analysis was compared with that obtained by dynamic curing in DSC

Ytterbium 169 citrate in the diagnosis of lung opacities of cancerous origin

International Nuclear Information System (INIS)

Peltier, Patrick.

1976-01-01

Lung scintigraphy for tumour exploration has been widely studied for some years, but unfortunately with the many radioisotopes used at present this examination is not entirely reliable. It seemed interesting therefore to investigate a new tracer, 169 Yb citrate, the properties of which were demonstrated recently by HISADA. To estimate the specificity of this tracer we chose 62 records of different bronchopulmonary diseases. After an introductory review of various diagnostic methods the physical and physiological characteristics of ytterbium citrate and its method of use are described, then the records examined are presented and our thoughts and conclusions discussed. 169 Yb citrate possesses excellent biophysical properties for tumour scintigraphy but this isotope, though causing no radioactive pollution, delivers an appreciable irradiation dose to the patient examined. It has a positive tropism for pathological lung images. The fixation index of the documents taken separately, apart from that of the 14th day, cannot distinguish between benign and malignant diseases. This is possible with the kinetic uptake curve and the index ratios for the 2nd and 14th days. With these diagnostic criteria the overall results are better than those obtained with other commonly used radioisotopes: true positives 70%, false negatives 11%, false positives 4.5% [fr

CsPbBr3 nanocrystal saturable absorber for mode-locking ytterbium fiber laser

Science.gov (United States)

Zhou, Yan; Hu, Zhiping; Li, Yue; Xu, Jianqiu; Tang, Xiaosheng; Tang, Yulong

2016-06-01

Cesium lead halide perovskite nanocrystals (CsPbX3, X = Cl, Br, I) have been reported as efficient light-harvesting and light-emitting semiconductor materials, but their nonlinear optical properties have been seldom touched upon. In this paper, we prepare layered CsPbBr3 nanocrystal films and characterize their physical properties. Broadband linear absorption from ˜0.8 to over 2.2 μm and nonlinear optical absorption at the 1-μm wavelength region are measured. The CsPbBr3 saturable absorber (SA), manufactured by drop-casting of colloidal CsPbBr3 liquid solution on a gold mirror, shows modulation depth and saturation intensity of 13.1% and 10.7 MW/cm2, respectively. With this SA, mode-locking operation of a polarization-maintained ytterbium fiber laser produces single pulses with duration of ˜216 ps, maximum average output power of 10.5 mW, and the laser spectrum is centered at ˜1076 nm. This work shows that CsPbBr3 films can be efficient SA candidates for fiber lasers and also have great potential to become broadband linear and nonlinear optical materials for photonics and optoelectronics.

26 CFR 1.179-3 - Carryover of disallowed deduction.

Science.gov (United States)

2010-04-01

... deduction are selected by the taxpayer in the year the properties are placed in service. This selection must... no selection is made, the total carryover of disallowed deduction is apportioned equally over the... restaurant business. During 1992, ABC purchases and places in service two items of section 179 property—a...

Phosphorylated human prolactin (S179D-hPRL) is a potent anti-angiogenic hormone in vitro and in vivo; Prolactina humana pseudofosforilada (S179D-hPRL) e um potente fator anti-angiogenico in vitro e in vivo

Energy Technology Data Exchange (ETDEWEB)

Ueda, Eric Kinnosuke Martins

2006-07-01

S179D-prolactin (hPRL) is an experimentally useful mimic of naturally phosphorylated human prolactin. S179D-hPRL, but not unmodified PRL, was found to be anti-angiogenic in both the chorioallantoic membrane and corneal assays. Further investigation using human endothelial in vitro models showed reduced cell number, reduced tubule formation in Matrigel, and reduced migration and invasion, as a function of treatment with S179D-hPRL. Analysis of growth factors in human endothelial cells in response to S179D-hPRL showed a decreased expression or release of endogenous PRL, heme-oxygenase-1, basic fibroblast growth factor (bFGF), angio genin, epidermal growth factor and vascular endothelial growth factor and an increased expression of inhibitors of matrix metallo proteases. S179D-hPRL also blocked signaling from bFGF in these cells. We conclude that this molecular mimic of a pituitary hormone is a potent anti-angiogenic protein, partly as a result of its ability to reduce utilization of several well-established endothelial autocrine growth loops, partly by its ability to block signaling from bFGF and partly because of its ability to decrease endothelial migration. We also examined the influence of S179D-hPRL on apoptosis in human endothelial cells, using procaspase-8 as a marker of the extrinsic pathway, and cytochrome C release as a marker of the intrinsic pathway. Both pathways converge at caspase-3, which cleaves DNA fragmentation factor (DFF45). A 3-day incubation with 50 ng/ml S179D-hPRL quadrupled the early apoptotic cells; this effect was doubled at 100 ng/ml and maximal at 500 ng/ml. DFF45 and pro-caspase 8 cleavage were detectable at 100 ng/ml. Cytochrome C, however, was unaffected until 500 ng/ml. p21 increased at 100 ng/ml, whereas a change in p53 activity required both triple the time and 500 ng/ml. p21 promoter activity was maximal at 50 ng/ml, whereas 500 ng/ml were required to see a significant change in the Bax promoter (a measure of p53 activity). As

24 CFR 17.9 - Referral to Department of Justice.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Referral to Department of Justice... Procedures § 17.9 Referral to Department of Justice. When Department of Justice approval or consultation is required under § 17.8, the referral or request shall be transmitted to the Department of Justice by the...

Effects of adding metals to MoS2 in a ytterbium doped Q-switched fiber laser

Science.gov (United States)

Khaleque, Abdul; Liu, Liming

2018-03-01

Molybdenum disulfide (MoS2) is widely used in lubricants, metallic alloys and in electronic and optical components. It is also used as saturable absorbers (SAs) in lasers (e.g. fiber lasers): a simple deposition of MoS2 on the fiber end can create a saturable absorber without the necessity of extensive alignment of the optical beam. In this article, we study the effects of adding different metals (Cr, Au, and Al) to MoS2 in a ytterbium (Yb)-doped Q-switched fiber laser. Experimental results show that the addition of a thin layer of gold and aluminium can reduce pulse durations to about 5.8 μs and 8.5 μs, respectively, compared with pure MoS2 with pulse duration of 12 μs. Experimental analysis of the combined metal and MoS2 based composite SAs can be useful in fiber laser applications where it may also find applications in medical, three dimensional (3D) active imaging and dental applications.

Erbium/ytterbium co-doped double clad fiber amplifier, its applications and effects in fiber optic communication systems

Science.gov (United States)

Dua, Puneit

Increased demand for larger bandwidth and longer inter-amplifiers distances translates to higher power budgets for fiber optic communication systems in order to overcome large splitting losses and achieve acceptable signal-to-noise ratios. Due to their unique design ytterbium sensitized erbium doped, double clad fiber amplifiers; offer significant increase in the output powers that can be obtained. In this thesis we investigate, a one-stage, high power erbium and ytterbium co-doped double clad fiber amplifier (DCFA) with output power of 1.4W, designed and built in our lab. Experimental demonstration and numerical simulation techniques have been used to systematically study the applications of such an amplifier and the effects of incorporating it in various fiber optic communication systems. Amplitude modulated subcarrier multiplexed (AM-SCM) CATV distribution experiment has been performed to verify the feasibility of using this amplifier in an analog/digital communication system. The applications of the amplifier as a Fabry-Perot and ring fiber laser with an all-fiber cavity, a broadband supercontinuum source and for generation of high power, short pulses at 5GHz have been experimentally demonstrated. A variety of observable nonlinear effects occur due to the high intensity of the optical powers confined in micron-sized cores of the fibers, this thesis explores in detail some of these effects caused by using the high power Er/Yb double clad fiber amplifier. A fiber optic based analog/digital CATV system experiences composite second order (CSO) distortion due to the interaction between the gain tilt---the variation of gain with wavelength, of the doped fiber amplifier and the wavelength chirp of the directly modulated semiconductor laser. Gain tilt of the Er/Yb co-doped fiber amplifier has been experimentally measured and its contribution to the CSO of the system calculated. Theoretical analysis of a wavelength division multiplexed system with closely spaced

5 CFR 179.213 - Coordinating salary offset with other agencies.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Coordinating salary offset with other... REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.213 Coordinating salary offset with other agencies... intent of this regulation. (2) The designated salary offset coordinator will be responsible for: (i...

Comparative effects of indium/ytterbium doping on, mechanical and gas-sensitivity-related morphological, properties of sprayed ZnO compounds

International Nuclear Information System (INIS)

Boukhachem, A.; Fridjine, S.; Amlouk, A.; Boubaker, K.; Bouhafs, M.; Amlouk, M.

2010-01-01

In this study, conducting and transparent indium-doped zinc oxide (ZnO) thin films have been deposited on glass substrates by the micro-spray technique. First, zinc oxide layers were obtained by spaying a solution of propanol and zinc acetate in acidified medium. Alternatively, some of the obtained films were doped with indium (In) at the molar rates of: 1%, 2% and 3%. In addition to the classical structural investigated using XRD, AFM and SEM techniques, microhardness Vickers (Hv) measurements have been carried out along with comparative morphological prospecting. The specific gases sensitivity-related surface morphology of the doped ZnO compounds was favorably different from that of the non-doped ones, and showed a thin overlay structure. Results were compared to those recorded for similar ytterbium-doped material.

Cell damage evaluation of mammalian cells in cell manipulation by amplified femtosecond ytterbium laser

Science.gov (United States)

Hong, Z.-Y.; Iino, T.; Hagihara, H.; Maeno, T.; Okano, K.; Yasukuni, R.; Hosokawa, Y.

2018-03-01

A micrometer-scale explosion with cavitation bubble generation is induced by focusing a femtosecond laser in an aqueous solution. We have proposed to apply the explosion as an impulsive force to manipulate mammalian cells especially in microfluidic chip. Herein, we employed an amplified femtosecond ytterbium laser as an excitation source for the explosion and evaluated cell damage in the manipulation process to clarify the application potential. The damage of C2C12 myoblast cell prepared as a representative mammalian cell was investigated as a function of distance between cell and laser focal point. Although the cell received strong damage on the direct laser irradiation condition, the damage sharply decreased with increasing distance. Since the threshold distance, above which the cell had no damage, was consistent with radius of the cavitation bubble, impact of the cavitation bubble would be a critical factor for the cell damage. The damage had strong nonlinearity in the pulse energy dependence. On the other hand, cell position shift by the impact of the cavitation bubble was almost proportional to the pulse energy. In balance between the cell viability and the cell position shift, we elucidated controllability of the cell manipulation in microfluidic chip.

Orphan receptor GPR179 forms macromolecular complexes with components of metabotropic signaling cascade in retina ON-bipolar neurons.

Science.gov (United States)

Orlandi, Cesare; Cao, Yan; Martemyanov, Kirill A

2013-10-29

In the mammalian retina, synaptic transmission between light-excited rod photoreceptors and downstream ON-bipolar neurons is indispensable for dim vision, and disruption of this process leads to congenital stationary night blindness in human patients. The ON-bipolar neurons use the metabotropic signaling cascade, initiated by the mGluR6 receptor, to generate depolarizing responses to light-induced changes in neurotransmitter glutamate release from the photoreceptor axonal terminals. Evidence for the identity of the components involved in transducing these signals is growing rapidly. Recently, the orphan receptor, GPR179, a member of the G protein-coupled receptor (GPCR) superfamily, has been shown to be indispensable for the synaptic responses of ON-bipolar cells. In our study, we investigated the interaction of GPR179 with principle components of the signal transduction cascade. We used immunoprecipitation and proximity ligation assays in transfected cells and native retinas to characterize the protein-protein interactions involving GPR179. The influence of cascade components on GPR179 localization was examined through immunohistochemical staining of the retinas from genetic mouse models. We demonstrated that, in mouse retinas, GPR179 forms physical complexes with the main components of the metabotropic cascade, recruiting mGluR6, TRPM1, and the RGS proteins. Elimination of mGluR6 or RGS proteins, but not TRPM1, detrimentally affects postsynaptic targeting or GPR179 expression. These observations suggest that the mGluR6 signaling cascade is scaffolded as a macromolecular complex in which the interactions between the components ensure the optimal spatiotemporal characteristics of signal transduction.

Regulatory Guide 1.79 safety injection recirculation test requirements, fact or fiction

International Nuclear Information System (INIS)

Roberts, J.K.

1976-01-01

The overwhelming concern of the general public in this day of state nuclear initiatives is the basic question, ''is nuclear power safe.'' Much of this concern has focused on the emergency core cooling systems. This public attention spotlights the testing organization's responsibility during startup of proving the operation and reliability of the emergency core cooling systems. The standard established by the Nuclear Regulatory Commission for testing emergency core cooling systems is Regulatory Guide 1.79 ''Preoperational Testing of Emergency Core Cooling Systems for Pressurized Water Reactors''. The nuclear industry must satisfy the testing requirements of Regulatory Guide 1.79 to meet their responsibility to the public; and to prevent future embarrassment when questioned on the adequacy of emergency core cooling systems

R179H mutation in ACTA2 expanding the phenotype to include prune-belly sequence and skin manifestations.

Science.gov (United States)

Richer, J; Milewicz, D M; Gow, R; de Nanassy, J; Maharajh, G; Miller, E; Oppenheimer, L; Weiler, G; O'Connor, M

2012-03-01

Mutations in ACTA2 (smooth muscle cell-specific isoform of α-actin) lead to a predisposition to thoracic aortic aneurysms and other vascular diseases. More recently, the ACTA2 R179H mutation has been described in individuals with global smooth muscle dysfunction. We report a patient heterozygous for the mutation in ACTA2 R179H who presented with megacystis at 13 weeks gestational age and, at birth, with prune-belly sequence. He also had deep skin dimples and creases on his palms and soles, a finding not previously described but possibly related to ACTA2. To our knowledge, this is the first report of the R179H mutation in ACTA2 in a child with prune-belly sequence. We think the R179H mutation in ACTA2 should be included in the differential diagnosis of individuals presenting with the sequence without an identified mechanical obstruction. Furthermore, as ACTA2 R179H has been reported in patients with severe vasculomyopathy and premature death, we recommend that molecular testing for this mutation be considered in fetuses presenting with fetal megacystis with a normal karyotype, particularly if the bladder diameter is 15 mm or more, to allow expectant parents to make an informed decision. Copyright © 2012 Wiley Periodicals, Inc.

High-spin rotational states in {sup 179}Os

Energy Technology Data Exchange (ETDEWEB)

Burde, J [Lawrence Berkeley Lab., CA (United States); [Hebrew Univ., Jerusalem (Israel). Racah Inst. of Physics; Deleplanque, M A; Diamond, R M; Macchiavelli, A O; Stephens, F S; Beausang, C W [Lawrence Berkeley Lab., CA (United States)

1992-08-01

The rotational bands of the osmium isotopes display very interesting properties that vary with the neutron number. On the one hand the yrast bands of {sup 182,184,186}Os display a sudden and rather strong gain in aligned angular momentum,, whereas the lighter osmium nuclei such as {sup 176,178,180}Os show a more gradual increase of alignment characteristic of strongly interacting bands. In addition, an unusual rotational band has been found in {sup 178}Os. It consists of seven regularly spaced transitions about 36 keV apart which correspond closely to the spacing of the superdeformed band in {sup 152}Dy after an A{sup 5/3} normalization. this band populates the yrast band directly, and the moment of inertia J{sup (1)} is found to be much smaller than J{sup (2)}. The most likely interpretation of this is a band with large deformation which is undergoing systematic changes in deformation, pairing and/or alignment. This latter finding in particular motivated us to carry out research on the higher spin states in {sup 179}Os. Dracoulis et al. have published their results on 5 rotational bands in {sup 179}Os. In the present work we found six new bands and extended appreciably the spin limits in the other five. (author). 5 refs., 3 figs.

New homo- and heteroleptic derivatives of trivalent ytterbium containing anion-radical 1,4-diazadiene ligands. Synthesis, properties and crystal structure of (C9H7)2Yb[2-MeC6H4NC(Me)C(Me)NC6H4Me-2] and [PhNC(Ph)C(Ph)NPh]3Yb complexes

International Nuclear Information System (INIS)

Gudilenkov, I.D.; Fukin, G.K.; Cherkasov, A.V.; Shavyrin, A.S.; Trifonov, A.A.; Larionova, Yu.E.

2008-01-01

Reaction of ytterbium bisindenyl complex (C 9 H 7 ) 2 Yb II (THF) 2 (1) with 1,4-diazabutadiene 2-MeC 6 H 4 N=C(Me)-C(Me)=NC 6 H 4 Me-2 ( Me DAD) is accompanied by the oxidation of metal atom until trivalent state and results in the formation of paramagnetic compound of metallocenes type (C 9 H 7 ) 2 Yb III ( Me DAD -. ) (3) containing 1,4-diazabutadiene anion-radical. Structure of complex 3 is ascertained by the X-ray structure analysis. Reactions of bisindenyl (1) and bisfluorenyl (C 13 H 9 ) 2 Yb II (THF) 2 (2) derivatives of bivalent ytterbium with 1,4-diazabutadiene PhN=C(Ph)-C(Ph)=NPh ( Ph DAD) (at 1:2 molar ratio of reagents) proceed with the complete break of Yb-C bonds, oxidation of ytterbium atom until trivalent state, and result in the formation of homoligand complex ( Ph DAD -. ) 3 Yb (6) containing three anion-radical 1,4-diazadiene ligands. Complex 6 was also prepared by the exchange reaction of YbCl 3 with Ph DAD -. K + (1:3) in THF. Complex 6 is characterized by the X-ray structure analysis [ru

Study of parameters affecting the extraction of Ytterbium from anomaly No.5 of Saghand ore Leach Solution

International Nuclear Information System (INIS)

Abdollahy, M.; Alamdar Milani, S.; Koleini, M. J.; Samadzadeh Yazdi, M. R.

2010-01-01

Extraction of ytterbium from anomaly No.5 of Saghand leach solution using D 2 EHPA as extractant, kerosene as a diluent, and optimization of the effective parameters were investigated. In addition to uranium and thorium, rare earths elements also exist in Saghand ore. The effect of p H on the extraction of Yb and other existing elements shows that their extractions increase by increasing p H. The extraction of Yb, U, La, Y, Ce and Fe in p H=2 were 99.9, 83, 13.5, 99.8, 8.5 and 27.4%, respectively. The increasing of the A/O ratio decreases the extraction of other elements more than Yb where it resulted in the increasing of the Yb separation. The theoretical number of extraction stages were determined in p H=2 and A/O=9 using McCabe-Thiele diagram. Stripping of the organic phase was also carried out by different concentrations of nitric acid.

Synthesis and photocatalytic activity of ytterbium-doped titania/diatomite composite photocatalysts

International Nuclear Information System (INIS)

Tang, Wenjian; Qiu, Kehui; Zhang, Peicong; Yuan, Xiqiang

2016-01-01

Graphical abstract: - Highlights: • Yb-doped TiO_2/diatomite composite photocatalysts were prepared by a sol-gel method. • Yb-doped TiO_2/diatomite photocatalysts show much higher photocatalytic activity. • The higher photodegradation rate is due to the effect of diatomite and Yb doping. - Abstract: Ytterbium-doped titanium dioxide (Yb-TiO_2)/diatomite composite materials with different Yb concentrations were prepared by sol–gel method. The phase structure, morphology, and chemical composition of the as-prepared composites were well characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy, Raman spectroscopy, scanning electron microscopy (SEM), and ultraviolet–visible (UV–vis) diffuse reflection spectroscopy. The XRD and Raman spectroscopy analysis indicated that the TiO_2 existed in the form of pure anatase in the composites. The SEM images exhibited the well deposition and dispersion of TiO_2 nanoparticles with little agglomeration on the surfaces of diatoms. The UV–vis diffuse reflection spectra showed that the band gap of TiO_2 could be narrowed by the introduction of Yb species, which was further affected by doping concentration of Yb. The photocatalytic activity of synthesized samples was investigated by the degradation of methylene blue (MB) under UV light irradiation. It was observed that the photocatalytic degradation followed a pseudo-first-order kinetics according to the Langmuir–Hinshelwood model. Compared to TiO_2 and TiO_2/diatomite, the Yb-TiO_2/diatomite composites exhibited higher photocatalytic activity toward degradation of MB using UV light irradiation.

Synthesis and photocatalytic activity of ytterbium-doped titania/diatomite composite photocatalysts

Energy Technology Data Exchange (ETDEWEB)

Tang, Wenjian; Qiu, Kehui; Zhang, Peicong; Yuan, Xiqiang

2016-01-30

Graphical abstract: - Highlights: • Yb-doped TiO{sub 2}/diatomite composite photocatalysts were prepared by a sol-gel method. • Yb-doped TiO{sub 2}/diatomite photocatalysts show much higher photocatalytic activity. • The higher photodegradation rate is due to the effect of diatomite and Yb doping. - Abstract: Ytterbium-doped titanium dioxide (Yb-TiO{sub 2})/diatomite composite materials with different Yb concentrations were prepared by sol–gel method. The phase structure, morphology, and chemical composition of the as-prepared composites were well characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy, Raman spectroscopy, scanning electron microscopy (SEM), and ultraviolet–visible (UV–vis) diffuse reflection spectroscopy. The XRD and Raman spectroscopy analysis indicated that the TiO{sub 2} existed in the form of pure anatase in the composites. The SEM images exhibited the well deposition and dispersion of TiO{sub 2} nanoparticles with little agglomeration on the surfaces of diatoms. The UV–vis diffuse reflection spectra showed that the band gap of TiO{sub 2} could be narrowed by the introduction of Yb species, which was further affected by doping concentration of Yb. The photocatalytic activity of synthesized samples was investigated by the degradation of methylene blue (MB) under UV light irradiation. It was observed that the photocatalytic degradation followed a pseudo-first-order kinetics according to the Langmuir–Hinshelwood model. Compared to TiO{sub 2} and TiO{sub 2}/diatomite, the Yb-TiO{sub 2}/diatomite composites exhibited higher photocatalytic activity toward degradation of MB using UV light irradiation.

Creep Behavior of Hafnia and Ytterbium Silicate Environmental Barrier Coating Systems on SiC/SiC Ceramic Matrix Composites

Science.gov (United States)

Zhu, Dongming; Fox, Dennis S.; Ghosn, Louis J.; Harder, Bryan

2011-01-01

Environmental barrier coatings will play a crucial role in future advanced gas turbine engines because of their ability to significantly extend the temperature capability and stability of SiC/SiC ceramic matrix composite (CMC) engine components, thus improving the engine performance. In order to develop high performance, robust coating systems for engine components, appropriate test approaches simulating operating temperature gradient and stress environments for evaluating the critical coating properties must be established. In this paper, thermal gradient mechanical testing approaches for evaluating creep and fatigue behavior of environmental barrier coated SiC/SiC CMC systems will be described. The creep and fatigue behavior of Hafnia and ytterbium silicate environmental barrier coatings on SiC/SiC CMC systems will be reported in simulated environmental exposure conditions. The coating failure mechanisms will also be discussed under the heat flux and stress conditions.

Phosphorylated human prolactin (S179D-hPRL) is a potent anti-angiogenic hormone in vitro and in vivo

International Nuclear Information System (INIS)

Ueda, Eric Kinnosuke Martins

2006-01-01

S179D-prolactin (hPRL) is an experimentally useful mimic of naturally phosphorylated human prolactin. S179D-hPRL, but not unmodified PRL, was found to be anti-angiogenic in both the chorioallantoic membrane and corneal assays. Further investigation using human endothelial in vitro models showed reduced cell number, reduced tubule formation in Matrigel, and reduced migration and invasion, as a function of treatment with S179D-hPRL. Analysis of growth factors in human endothelial cells in response to S179D-hPRL showed a decreased expression or release of endogenous PRL, heme-oxygenase-1, basic fibroblast growth factor (bFGF), angio genin, epidermal growth factor and vascular endothelial growth factor and an increased expression of inhibitors of matrix metallo proteases. S179D-hPRL also blocked signaling from bFGF in these cells. We conclude that this molecular mimic of a pituitary hormone is a potent anti-angiogenic protein, partly as a result of its ability to reduce utilization of several well-established endothelial autocrine growth loops, partly by its ability to block signaling from bFGF and partly because of its ability to decrease endothelial migration. We also examined the influence of S179D-hPRL on apoptosis in human endothelial cells, using procaspase-8 as a marker of the extrinsic pathway, and cytochrome C release as a marker of the intrinsic pathway. Both pathways converge at caspase-3, which cleaves DNA fragmentation factor (DFF45). A 3-day incubation with 50 ng/ml S179D-hPRL quadrupled the early apoptotic cells; this effect was doubled at 100 ng/ml and maximal at 500 ng/ml. DFF45 and pro-caspase 8 cleavage were detectable at 100 ng/ml. Cytochrome C, however, was unaffected until 500 ng/ml. p21 increased at 100 ng/ml, whereas a change in p53 activity required both triple the time and 500 ng/ml. p21 promoter activity was maximal at 50 ng/ml, whereas 500 ng/ml were required to see a significant change in the Bax promoter (a measure of p53 activity). As

TITAN - a 9 MW, 179 bar pressurised water rig

International Nuclear Information System (INIS)

Mogford, D.J.; Lee, D.H.

1987-02-01

The report describes the TITAN rig built at Winfrith for thermal hydraulic experiments with water at up to 179 bar pressure. A power supply of 9 MW is available. The report describes three typical experiments that show the versatility of the rig. The first is a 25 rod pressurized water reactor fuel bundle critical heat flux experiment, the second is a parallel channel evaporator test and the third is a model jet pump test. (author)

CsPbBr{sub 3} nanocrystal saturable absorber for mode-locking ytterbium fiber laser

Energy Technology Data Exchange (ETDEWEB)

Zhou, Yan; Li, Yue; Xu, Jianqiu; Tang, Yulong, E-mail: yulong@sjtu.edu.cn [Key Laboratory for Laser Plasmas (MOE), Department of Physics and Astronomy, Collaborative Innovation Center of IFSA, Shanghai Jiao Tong University, Shanghai 200240 (China); Hu, Zhiping; Tang, Xiaosheng [Key Laboratory of Optoelectronic Technology and Systems of the Education Ministry of China, College of Optoelectronic Engineering, Chongqing University, Chongqing 400044 (China)

2016-06-27

Cesium lead halide perovskite nanocrystals (CsPbX{sub 3}, X = Cl, Br, I) have been reported as efficient light-harvesting and light-emitting semiconductor materials, but their nonlinear optical properties have been seldom touched upon. In this paper, we prepare layered CsPbBr{sub 3} nanocrystal films and characterize their physical properties. Broadband linear absorption from ∼0.8 to over 2.2 μm and nonlinear optical absorption at the 1-μm wavelength region are measured. The CsPbBr{sub 3} saturable absorber (SA), manufactured by drop-casting of colloidal CsPbBr{sub 3} liquid solution on a gold mirror, shows modulation depth and saturation intensity of 13.1% and 10.7 MW/cm{sup 2}, respectively. With this SA, mode-locking operation of a polarization-maintained ytterbium fiber laser produces single pulses with duration of ∼216 ps, maximum average output power of 10.5 mW, and the laser spectrum is centered at ∼1076 nm. This work shows that CsPbBr{sub 3} films can be efficient SA candidates for fiber lasers and also have great potential to become broadband linear and nonlinear optical materials for photonics and optoelectronics.

High-efficiency ytterbium-free erbium-doped all-glass double cladding silicate glass fiber for resonantly-pumped fiber lasers.

Science.gov (United States)

Qiang, Zexuan; Geng, Jihong; Luo, Tao; Zhang, Jun; Jiang, Shibin

2014-02-01

A highly efficient ytterbium-free erbium-doped silicate glass fiber has been developed for high-power fiber laser applications at an eye-safe wavelength near 1.55 μm. Our preliminary experiments show that high laser efficiency can be obtained from a relatively short length of the gain fiber when resonantly pumped at 1535 nm in both core- and cladding-pumping configurations. With a core-pumping configuration as high as 75%, optical-to-optical efficiency and 4 W output power were obtained at 1560 nm from a 1 m long gain fiber. When using a cladding-pumping configuration, approximately 13 W output power with 67.7% slope efficiency was demonstrated from a piece of 2 m long fiber. The lengths of silicate-based gain fiber are much shorter than their silica-based counterparts used in other experiments, which is significantly important for high-power narrow-band and/or pulsed laser applications.

Effects of ethylenediaminetetraacetic acid (EDTA)and diethylenetriaminepentaacetic acid (DTPA) derivatives on penetration of ytterbium-169 and cerium-144 into the rat offspring

Energy Technology Data Exchange (ETDEWEB)

Baltrukiewicz, Z; Burakowski, T; Derecki, J [Wojskowy Inst. Higieny i Epidemiologii, Warsaw (Poland)

1976-01-01

Penetration of radioactive ytterbum-169 and cerium-144 into fetuses was determined at the end of pregnancy and penetration into the organism of suckling rats was studied during feeding with the milk of exposed mothers when EDTA or DTPA derivatives were being administered. Injection of ytterbum-169 as a complex with EDTA or DTPA or injection of Na/sub 2/Ca EDTA or Na/sub 3/Ca DTPA 1h after administration of cerium-144 to mothers reduced penetration of both radionuclides into offsprings in relation to the animals receiving no complex compounds. It was observed that the action of DTPA was stronger than that of EDTA. Passage of ytterbium with milk and across the placenta was greater than the passage of cerium.

26 CFR 1.179-5 - Time and manner of making election.

Science.gov (United States)

2010-04-01

... desktop computer costing $1,500. On Taxpayer's 2003 Federal tax return filed on April 15, 2004, Taxpayer elected to expense under section 179 the full cost of the laptop computer and the full cost of the desktop... provided by the Internal Revenue Code, the regulations under the Code, or other guidance published in the...

49 CFR 179.100-12 - Manway nozzle, cover and protective housing.

Science.gov (United States)

2010-10-01

... listed in § 179.101. Manway cover shall be attached to manway nozzle by through or stud bolts not... twenty 3/4-inch studs. The shearing value of the bolts attaching protective housing to manway cover must not exceed 70 percent of the shearing value of bolts attaching manway cover to manway nozzle. Housing...

26 CFR 1.179A-1 - Recapture of deduction for qualified clean-fuel vehicle property and qualified clean-fuel vehicle...

Science.gov (United States)

2010-04-01

... the benefit of the section 179A deduction allowable multiplied by the recapture percentage. The... property. The recapture amount is equal to the benefit of the section 179A deduction allowable multiplied... allowance for depreciation, this increase in basis is recoverable over its remaining recovery period...

Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates

International Nuclear Information System (INIS)

Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.

1975-01-01

Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out

Ytterbium-selective polymeric membrane electrode based on substituted urea and thiourea as a suitable carrier

International Nuclear Information System (INIS)

Singh, A.K.; Jain, A.K.; Mehtab, Sameena

2007-01-01

Plasticized membranes using 1-phenyl-3-(2-thiazolyl)-2-thiourea (PTT) and 1-phenyl-3-(2-thiazolyl)-2-urea (PTU) have been prepared and explored as ytterbium ion-selective sensors. Effect of various plasticizers, viz. chloronaphthalene (CN), o-nitrophenyloctyl ether (o-NPOE), dibutylphthalate (DBP), dioctylsebacate (DOS) and anion excluders, sodium tetraphenylborate (NaTPB) and oleic acid (OA) was studied and improved membrane performance was observed. Optimum performance was noted with membrane of PTT having composition of PTT (3.5):PVC (80):DOS (160):NaTPB (1.5) in mg. The sensor works satisfactorily in the concentration range 1.2 x 10 -7 to 1.0 x 10 -2 M (detection limit 5.5 x 10 -8 M) with a Nernstian slope of 19.7 mV decade -1 of activity. Wide pH range (3.0-8.0), fast response time (10 s), non-aqueous tolerance (up to 20%) and adequate shelf life (12 weeks) indicate the vital utility of the proposed sensor. The proposed electrode comparatively shows good selectivity for Yb 3+ ion with respect to alkali, alkaline earth, transition and rare earth metals ions and can be used for its determination in binary mixtures and sulfite determination in white and red wine samples

Ytterbium-selective polymeric membrane electrode based on substituted urea and thiourea as a suitable carrier.

Science.gov (United States)

Singh, A K; Jain, A K; Mehtab, Sameena

2007-08-06

Plasticized membranes using 1-phenyl-3-(2-thiazolyl)-2-thiourea (PTT) and 1-phenyl-3-(2-thiazolyl)-2-urea (PTU) have been prepared and explored as ytterbium ion-selective sensors. Effect of various plasticizers, viz. chloronaphthalene (CN), o-nitrophenyloctyl ether (o-NPOE), dibutylphthalate (DBP), dioctylsebacate (DOS) and anion excluders, sodium tetraphenylborate (NaTPB) and oleic acid (OA) was studied and improved membrane performance was observed. Optimum performance was noted with membrane of PTT having composition of PTT (3.5):PVC (80):DOS (160):NaTPB (1.5) in mg. The sensor works satisfactorily in the concentration range 1.2x10(-7) to 1.0x10(-2) M (detection limit 5.5x10(-8) M) with a Nernstian slope of 19.7 mV decade(-1) of activity. Wide pH range (3.0-8.0), fast response time (10 s), non-aqueous tolerance (up to 20%) and adequate shelf life (12 weeks) indicate the vital utility of the proposed sensor. The proposed electrode comparatively shows good selectivity for Yb3+ ion with respect to alkali, alkaline earth, transition and rare earth metals ions and can be used for its determination in binary mixtures and sulfite determination in white and red wine samples.

Ytterbium-selective polymeric membrane electrode based on substituted urea and thiourea as a suitable carrier

Energy Technology Data Exchange (ETDEWEB)

Singh, A.K. [Department of Chemistry, Indian Institute of Technology-Roorkee, Roorkee 247667 (India)], E-mail: akscyfcy@iitr.ernet.in; Jain, A.K.; Mehtab, Sameena [Department of Chemistry, Indian Institute of Technology-Roorkee, Roorkee 247667 (India)

2007-08-10

Plasticized membranes using 1-phenyl-3-(2-thiazolyl)-2-thiourea (PTT) and 1-phenyl-3-(2-thiazolyl)-2-urea (PTU) have been prepared and explored as ytterbium ion-selective sensors. Effect of various plasticizers, viz. chloronaphthalene (CN), o-nitrophenyloctyl ether (o-NPOE), dibutylphthalate (DBP), dioctylsebacate (DOS) and anion excluders, sodium tetraphenylborate (NaTPB) and oleic acid (OA) was studied and improved membrane performance was observed. Optimum performance was noted with membrane of PTT having composition of PTT (3.5):PVC (80):DOS (160):NaTPB (1.5) in mg. The sensor works satisfactorily in the concentration range 1.2 x 10{sup -7} to 1.0 x 10{sup -2} M (detection limit 5.5 x 10{sup -8} M) with a Nernstian slope of 19.7 mV decade{sup -1} of activity. Wide pH range (3.0-8.0), fast response time (10 s), non-aqueous tolerance (up to 20%) and adequate shelf life (12 weeks) indicate the vital utility of the proposed sensor. The proposed electrode comparatively shows good selectivity for Yb{sup 3+} ion with respect to alkali, alkaline earth, transition and rare earth metals ions and can be used for its determination in binary mixtures and sulfite determination in white and red wine samples.

Theoretical investigations of the optical and EPR spectra for trivalent cerium and ytterbium ions in orthorhombic YF{sub 3} crystal

Energy Technology Data Exchange (ETDEWEB)

Liu, Hong-Gang, E-mail: kezhouliu@163.com; Zheng, Wen-Chen

2016-09-01

The optical spectra and electron paramagnetic resonance (EPR) parameters (g factors and hyperfine structure constants A) for trivalent cerium and ytterbium ions in YF{sub 3} crystal with orthorhombic structure are investigated together by the complete diagonalization (of energy matrix) method (CDM). The obtained results are in reasonable agreement with the experimental ones. More importantly, two magnetically nonequivalent centers in YF{sub 3} crystal observed in EPR experiments are confirmed and ascribed to their specific positions in a unit cell by our calculations based on superposition model (SPM) analysis. Such identification of local sites with different magnetic properties would help us to understand not only the EPR spectra and magnetic susceptibility of other lanthanide ions doped in crystals with the same structure as YF{sub 3} but also the energy transfer scheme between two lanthanide ions occupying such two sites. All results are discussed carefully.

Formation of the high-spin Hf-179m2 isomer in reactor irradiations

Czech Academy of Sciences Publication Activity Database

Karamian, S. A.; Carroll, J. J.; Adam, Jindřich; Kulagin, EN.; Shabalin, EP.

2004-01-01

Roč. 14, č. 4 (2004), s. 438-441 ISSN 1054-660X R&D Projects: GA MŠk(CZ) ME 134 Keywords : reactor irradiation * high-spin Hf-179m2 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.836, year: 2004

Absolute El Transition Probabilities in the Deformed Nuclei 177Yb and Hf179

International Nuclear Information System (INIS)

Malmskog, Sven G.

1964-08-01

The absolute E1-transition probabilities have been measured for two 7/2 - (514) levels populated from the short-lived isomers 177m Yb (6.4 sec) and 179m Hf (18.6 sec), a delayed coincidence set up being used for the purpose. This gave a half life of T 1/2 = (4.48 ± 0.08)x10 -9 sec for the 104 keV level in 177 Yb and T 1/2 = (1.86 ± 0.05)x10 -9 sec for the 217 keV level in 179 Hf. The result has been compared with the calculations made by Nilsson. The effect of the pairing correlation has also been taken into account. An agreement with the experimental values to within a factor of three is obtained. An extrapolated estimate of the half life for the 408.9 keV 7/2 - (514) level in 181 W gives 3x10 -11 sec

Characterization of two novel gammapapillomaviruses, HPV179 and HPV184, isolated from common warts of a renal-transplant recipient.

Directory of Open Access Journals (Sweden)

Lea Hošnjak

Full Text Available Gammapapillomavirus (Gamma-PV is a diverse and rapidly expanding PV-genus, currently consisting of 76 fully characterized human papillomavirus (HPV types. In this study, DNA genomes of two novel HPV types, HPV179 and HPV184, obtained from two distinct facial verrucae vulgares specimens of a 64 year-old renal-transplant recipient, were fully cloned, sequenced and characterized. HPV179 and HPV184 genomes comprise 7,228-bp and 7,324-bp, respectively, and contain four early (E1, E2, E6 and E7 and two late genes (L1 and L2; the non-coding region is typically positioned between L1 and E6 genes. Phylogenetic analysis of the L1 nucleotide sequence placed both novel types within the Gamma-PV genus: HPV179 was classified as a novel member of species Gamma-15, additionally containing HPV135 and HPV146, while HPV184 was classified as a single member of a novel species Gamma-25. HPV179 and HPV184 type-specific quantitative real-time PCRs were further developed and used in combination with human beta-globin gene quantitative real-time PCR to determine the prevalence and viral load of the novel types in the patient's facial warts and several follow-up skin specimens, and in a representative collection, a total of 569 samples, of HPV-associated benign and malignant neoplasms, hair follicles and anal and oral mucosa specimens obtained from immunocompetent individuals. HPV179 and HPV184 viral loads in patients' facial warts were estimated to be 2,463 and 3,200 genome copies per single cell, respectively, suggesting their active role in the development of common warts in organ-transplant recipients. In addition, in this particular patient, both novel types had established a persistent infection of the skin for more than four years. Among immunocompetent individuals, HPV179 was further detected in low-copy numbers in a few skin specimens, indicating its cutaneous tissue tropism, while HPV184 was further detected in low-copy numbers in one mucosal and a few skin

Mode-locked ytterbium fiber lasers using a large modulation depth carbon nanotube saturable absorber without an additional spectral filter

International Nuclear Information System (INIS)

Pan, Y Z; Miao, J G; Liu, W J; Huang, X J; Wang, Y B

2014-01-01

We demonstrate an all-normal-dispersion ytterbium (Yb)-doped fiber laser mode-locked by a higher modulation depth carbon nanotube saturable absorber (CNT-SA) based on an evanescent field interaction scheme. The laser cavity consists of pure normal dispersion fibers without dispersion compensation and an additional spectral filter. It is exhibited that the higher modulation depth CNT-SA could contribute to stabilize the mode-locking operation within a limited range of pump power and generate the highly chirped pulses with a high-energy level in the cavity with large normal dispersion and strong nonlinearity. Stable mode-locked pulses with a maximal energy of 29 nJ with a 5.59 MHz repetition rate at the operating wavelength around 1085 nm have been obtained. The maximal time-bandwidth product is 262.4. The temporal and spectral characteristics of pulses versus pump power are demonstrated. The experimental results suggest that the CNT-SA provides a sufficient nonlinear loss to compensate high nonlinearity and catch up the gain at a different pump power and thus leads to the stable mode locking. (letter)

21 CFR 179.39 - Ultraviolet radiation for the processing and treatment of food.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ultraviolet radiation for the processing and..., PROCESSING AND HANDLING OF FOOD Radiation and Radiation Sources § 179.39 Ultraviolet radiation for the processing and treatment of food. Ultraviolet radiation for the processing and treatment of food may be...

Broadband generation by multiple four-wave mixing process due to ASE Q-switching in high-power double-clad ytterbium-doped fiber amplifier

Science.gov (United States)

Chowdhury, Sourav D.; Shekhar, Nishant; Saha, Maitreyee; Sen, Ranjan; Pal, Mrinmay

2014-11-01

Broadband output from 1060nm to 1700nm and cascaded four-wave mixing generated red light pulsing is observed in a fiber amplifier set up consisting of a 5.5m double clad, double D shaped Ytterbium doped fiber, a single clad passive fiber for excess pump absorption and a splitter, both with and without a CW seed. Self-pulsing occurs from ASE due to passive Q-switching by saturable absorption effect of the active fiber and also depends on splice loss. The pulses generate broadband output by multiple four-wave mixing process with maximum broadening efficiency near 1300nm which is the zero dispersion wavelength for silica fiber. Pulses traveling both in forward and backward direction have enough peak power and energy to damage splice points and fiber components. When seeded the self-pulsing and broadband generation is often suppressed but again generate at increased pump powers.

21 CFR 179.30 - Radiofrequency radiation for the heating of food, including microwave frequencies.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Radiofrequency radiation for the heating of food... PRODUCTION, PROCESSING AND HANDLING OF FOOD Radiation and Radiation Sources § 179.30 Radiofrequency radiation for the heating of food, including microwave frequencies. Radiofrequency radiation, including...

Ytterbium silicide (YbSi{sub 2}). A promising thermoelectric material with a high power factor at room temperature

Energy Technology Data Exchange (ETDEWEB)

Tanusilp, Sora-at; Ohishi, Yuji; Muta, Hiroaki [Graduate School of Engineering, Osaka University, Suita, Osaka (Japan); Yamanaka, Shinsuke [Graduate School of Engineering, Osaka University, Suita, Osaka (Japan); Research Institute of Nuclear Engineering, University of Fukui, Tsuruga (Japan); Nishide, Akinori [Graduate School of Engineering, Osaka University, Suita, Osaka (Japan); Center for Exploratory Research, Research and Development Group, Hitachi, Ltd., Kokubunji, Tokyo (Japan); Hayakawa, Jun [Center for Exploratory Research, Research and Development Group, Hitachi, Ltd., Kokubunji, Tokyo (Japan); Kurosaki, Ken [Graduate School of Engineering, Osaka University, Suita, Osaka (Japan); Research Institute of Nuclear Engineering, University of Fukui, Tsuruga (Japan); JST, PRESTO, Kawaguchi, Saitama (Japan)

2018-02-15

Metal silicide-based thermoelectric (TE) materials have attracted attention in the past two decades, because they are less toxic, with low production cost and high chemical stability. Here, we study the TE properties of ytterbium silicide YbSi{sub 2} with a specific layered structure and the mixed valence state of Yb{sup 2+} and Yb{sup 3+}. YbSi{sub 2} exhibits large Seebeck coefficient, S, accompanied by high electrical conductivity, σ, leading to high power factor, S{sup 2}σ, of 2.2 mW m{sup -1} K{sup -2} at room temperature, which is comparable to those of state-of-the-art TE materials such as Bi{sub 2}Te{sub 3} and PbTe. Moreover, YbSi{sub 2} exhibits high Grueneisen parameter of 1.57, which leads to relatively low lattice thermal conductivity, κ{sub lat}, of 3.0 W m{sup -1} K{sup -1} at room temperature. The present study reveals that YbSi{sub 2} can be a good candidate of TE materials working near room temperature. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

49 CFR 179.103 - Special requirements for class 114A * * * tank car tanks.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Special requirements for class 114A * * * tank car... SPECIFICATIONS FOR TANK CARS Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.103 Special requirements for class 114A * * * tank car tanks. (a) In addition to the applicable...

Role of ytterbium and ytterbium/cesium fluoride on the chemistry of poly(9,9-dioctylfluorene-co-benzothiadiazole) as investigated by photoemission spectroscopy

International Nuclear Information System (INIS)

Fung, M.K.; Tong, S.W.; Lai, S.L.; Bao, S.N.; Lee, C.S.; Wu, W.W.; Inbasekaran, M.; O'Brien, J.J.; Liu, S.Y.; Lee, S.T.

2003-01-01

Since ytterbium (Yb) possesses a low work function of 2.6 eV and Yb fluoride generally has a high negative free energy of formation, it is conceivable to use Yb, either directly or parasitically, with a metal fluoride, as a cathode in organic light-emitting diodes (OLEDs). In this work, the electronic structure and chemistry at the interface of Yb/poly(9,9-dioctylfluorene-co-benzothiadiazole) (F8BT) were investigated by ultraviolet and x-ray photoemission spectroscopy (UPS and XPS, respectively). We found that the deposition of Yb on top of F8BT foremost formed organometallic complexes with the sulfur but interacted partly with the nitrogen of F8BT, and eventually formed a Yb-C complex at higher Yb coverages. In the UPS spectra, Yb deposition increased the relative peak intensities corresponding to the σ-bonds originated from the aliphatic side chains, implying that some of the π-conjugated carbons in the polymer backbone may be destroyed. These results agree well with the disappearance of the π-to-π* transition as observed from the shake-up peaks of the carbon 1s core level in the XPS. The chemistry at the interfaces of Yb/CsF/Au and Yb/CsF/F8BT was also examined by XPS. In both cases, Cs was liberated from the CsF upon Yb deposition and the Yb reacted with the liberated F to form YbF 3 . In the Yb/CsF/F8BT system, the dissociated Cs did not exist in the metallic state, but reacted with the N atoms and carbon backbone in the F8BT. The low work function of Cs (2.2 eV) may further enhance the injection of electrons into the polymer layer. More importantly, the utilization of Yb/CsF as an electrode is polymer independent, and the CsF layer between the Yb and F8BT could retard Yb diffusion into the bulk polymer. The present results are supported by a calculation of the free energy needed to liberate the Cs in the metal/CsF system using a simple thermodynamic model. It is suggested that the use of Yb/CsF cathode in the polymer offers an advantage over most other

Kinetics of electrophilic substitution of neodymium(3) by ytterbium(3) in aqueous solution of ethylenediaminetetraacetate solution of ethylenediaminetetraacetate and cyclohexanediaminetetraacetate

Energy Technology Data Exchange (ETDEWEB)

Nikitenko, S.I.; Martynenko, L.I.; Pechurova, N.I.; Spitsyn, V.I. (Moskovskij Gosudarstvennyj Univ. (USSR))

1981-01-01

The process of electrophilic substitution is studied spectrophotometrically taking as an example neodymium (3) substitution for ytterbium (3) in solutions, containing NdL/sup -/ and Yb/sup 3 +/, where L/sup 4 -/ = A/sup 4 -/ and D/sup 4 -/ (ethylenediaminetetraacetate- and cyclohexanediaminetetraacetate). The study of the exchange kinetics is carried out in pH range of 4-6. For the system with L=A in pH range 4.0-4.8 the exchange is realized by the way of acidic dissociation, at pH 5.5-6.0 - by the way of the direct attack. In the system with L=D in pH range 3.5-4.0 the way of acid dissociation prevails, at the same time, the rate constant of acidic dissociation for NdD/sup -/ is two order lower the constant for NdA/sup -/. However, at pH 4.7 the machanism of spontaneous dissociation prevails in the system. Thus, the structure of the complex has considerable effect on the mechanism of electrophilic substitution in rare earth complexes.

Kinetics of electrophilic substitution of neodymium(3) by ytterbium(3) in aqueous solution of ethylenediaminetetraacetate solution of ethylenediaminetetraacetate and cyclohexanediaminetetraacetate

International Nuclear Information System (INIS)

Nikitenko, S.I.; Martynenko, L.I.; Pechurova, N.I.; Spitsyn, V.I.

1981-01-01

The process of electrophilic substitution is studied spectrophotometrically taking as an example neodymium (3) substitution for ytterbium (3) in solutions, containing NdL - and Yb 3+ , where L 4- = A 4- and D 4- (ethylenediaminetetraacetate- and cyclohexanediaminetetraacetate). The study of the exchange kinetics is carried out in pH range of 4-6. For the system with L=A in pH range 4.0-4.8 the exchange is realized by the way of acidic dissociation, at pH 5.5-6.0 - by the way of the direct attack. In the system with L=D in pH range 3.5-4.0 the way of acid dissociation prevails, at the same time, the rate constant of acidic dissociation for NdD - is two order lower the constant for NdA - . However, at pH 4.7 the machanism of spontaneous dissociation prevails in the system. Thus, the structure of the complex has considerable effect on the mechanism of electrophilic substitution in rare earth complexes [ru

FOLLOW-UP DATA ON 179 DANISH CHILDREN AFTER THEIR FIRST PYELONEPHRITIS

DEFF Research Database (Denmark)

Breinbjerg, Anders; Kamperis, Konstantinos; Frøkjær, Jørgen

Introduction: Controversy exists regarding follow-up investigations in children diagnosed with their first pyelonephritis. In our centre children with upper urinary tract infections are subjected to a DMSA or MAG3 scan to assess renal parenchymal damage app. 6 months following the UTI. We aimed...... to analyse follow-up data on 179 consecutive Danish children after their first pyelonephritis. Material and methods:We examined the records of children diagnosed with their first upper UTI confirmed by urine culture during the years 2011-2013.We collected data on the clinical course of the pyelonephritis...

Influence of Heavy Fermion Ytterbium Substitution on the Electronic and Crystal Properties of the Frustrated Magnet CuFeO2 Oxide

Science.gov (United States)

Ozkendir, Osman Murat

2017-11-01

The influence of heavy fermion Ytterbium substitution was investigated on the crystal, electronic, and magnetic properties of CuFeO2 with the general formula Yb x Cu1- x FeO2. The results of the crystal structure study revealed polycrystalline formations in the sample. The electronic and magnetic properties of the samples were studied using X-ray absorption spectroscopy (XAS) and X-ray magnetic circular dichroism (XMCD) techniques. Both XAS and XMCD revealed that the substituted Yb atoms govern the entire phenomena with their narrow 4 f levels by forming broader molecular bonds with the 3 d levels of the transition metals. Owing to the prominent changes caused by the activity of the 4 f electrons in the crystal structures, Yb atoms were determined to be the main "role player" in the phase transitions. XMCD measurements were performed at room temperature 300 K (27 °C) to determine the magnetic properties of the samples and, except for CuFeO2 ( x = 0.0), the samples were observed to be ordered magnetically (mainly ferrimagnetic) in the bulk.

Newly developed semi-empirical formulas for (p, α) at 17.9 MeV and ...

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics; Volume 74; Issue 6. Newly developed semi-empirical formulas for (, ) at 17.9 MeV and (, ) at 22.3 MeV reaction cross-sections. Eyyup Tel Abdullah Aydin E Gamze Aydin Abdullah Kaplan Ömer Yavaş İskender A Reyhancan. Research Articles Volume 74 Issue 6 June ...

Levels in /sup 179/W studied in the /sup 181/Ta(p, 3n) reaction by on-line electron and gamma ray spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Meijer, B J; Konijn, J [Instituut voor Kernphysisch Onderzoek, Amsterdam (Netherlands); Klank, B; Jett, J H; Ristinen, R A [Colorado Univ., Boulder (USA)

1975-01-01

Levels in /sup 179/W have been deduced from in-beam gamma and conversion electron studies of the /sup 181/Ta(p, 3n)/sup 179/W reaction. The gamma-ray spectrum was studied with Ge(Li) detectors and a crystal diffraction spectrometer; the conversion electrons were measured with solenoid Si(Li) spectrometer. The multipolarities of some 50 transitions could be determined. Coriolis mixing of the Nilsson orbits with N = 6 was calculated.

A structural insight into the inhibitory mechanism of an orally active PI3K/mTOR dual inhibitor, PKI-179 using computational approaches.

Science.gov (United States)

Mohd Rehan

2015-11-01

The PI3K/AKT/mTOR signaling pathway has been identified as an important target for cancer therapy. Attempts are increasingly made to design the inhibitors against the key proteins of this pathway for anti-cancer therapy. The PI3K/mTOR dual inhibitors have proved more effective than the inhibitors against only single protein targets. Recently discovered PKI-179, an orally effective compound, is one such dual inhibitor targeting both PI3K and mTOR. This anti-cancer compound is efficacious both in vitro and in vivo. However, the binding mechanisms and the molecular interactions of PKI-179 with PI3K and mTOR are not yet available. The current study investigated the exact binding mode and the molecular interactions of PKI-179 with PI3Kγ and mTOR using molecular docking and (un)binding simulation analyses. The study identified PKI-179 interacting residues of both the proteins and their importance in binding was ranked by the loss in accessible surface area, number of molecular interactions of the residue, and consistent appearance of the residue in (un)binding simulation analysis. The key residues involved in binding of PKI-179 were Ala-805 in PI3Kγ and Ile-2163 in mTOR as they have lost maximum accessible surface area due to binding. In addition, the residues which played a role in binding of the drug but were away from the catalytic site were also identified using (un)binding simulation analyses. Finally, comparison of the interacting residues in the respective catalytic sites was done for the difference in the binding of the drug to the two proteins. Thus, the pairs of the residues falling at the similar location with respect to the docked drug were identified. The striking similarity in the interacting residues of the catalytic site explains the concomitant inhibition of both proteins by a number of inhibitors. In conclusion, the docking and (un)binding simulation analyses of dual inhibitor PKI-179 with PI3K and mTOR will provide a suitable multi-target model for

Relationship between strains of tumor-bearing animals and the tumor affinity of /sup 169/Yb and /sup 67/Ga

Energy Technology Data Exchange (ETDEWEB)

Ando, A; Hiraki, T [Kanazawa Univ. (Japan). School of Paramedicine; Hisada, K; Ando, I; Ugiie, T

1975-02-01

It is well a well-known fact that ytterbium-169 is a strong bone seeking element. We have already reported that this element was concentrated in nonosseous tumor tissues and that its tumor affinity was stronger than that of gallium-67 in our previous experiment using Yoshida sarcoma-bearing rats. Ytterbium-169 citrate and gallium-67 citrate were compared in four strains of tumor-bearing rats and mice. The uptake rate of ytterbium-169 in tumor tissues was much larger than that of gallium-67 in Ehrlich cancer-bearing mice, but these values of ytterbium-169 were slightly smaller than those of gallium-67 in Yoshida sarcoma-bearing rats, Walker carcinosarcoma 256-bearing rats and sarcoma 180-bearing mice. Tumor to organ ratios of ytterbium-169, which were most important for tumor scanning agents, were much larger than those of gallium-67 in all four strains except for the tumor to bone ratio of ytterbium-169. From the above-described facts, it was shown that ytterbium-169 citrate had a stronger tumor affinity than did gallium-67 citrate and that the tumor affinity of ytterbium-169 citrate was similar in each of these four strains of tumor-bearing animals.

Complete Genome Sequence of Gallibacterium anatis Strain UMN179, Isolated from a Laying Hen with Peritonitis ▿

OpenAIRE

Johnson, Timothy J.; Fernandez-Alarcon, Claudia; Bojesen, Anders Miki; Nolan, Lisa K.; Trampel, Darrell W.; Seemann, Torsten

2011-01-01

Gallibacterium anatis is a member of the normal flora of avian hosts and an important causative agent of peritonitis and salpingitis in laying hens. Here we report the availability of the first completed G. anatis genome sequence of strain UMN179, isolated from an Iowa laying hen with peritonitis.

Complete Genome Sequence of Gallibacterium anatis Strain UMN179, Isolated from a Laying Hen with Peritonitis ▿

Science.gov (United States)

Johnson, Timothy J.; Fernandez-Alarcon, Claudia; Bojesen, Anders Miki; Nolan, Lisa K.; Trampel, Darrell W.; Seemann, Torsten

2011-01-01

Gallibacterium anatis is a member of the normal flora of avian hosts and an important causative agent of peritonitis and salpingitis in laying hens. Here we report the availability of the first completed G. anatis genome sequence of strain UMN179, isolated from an Iowa laying hen with peritonitis. PMID:21602325

Roles of Asp179 and Glu270 in ADP-Ribosylation of Actin by Clostridium perfringens Iota Toxin.

Directory of Open Access Journals (Sweden)

Alexander Belyy

Full Text Available Clostridium perfringens iota toxin is a binary toxin composed of the enzymatically active component Ia and receptor binding component Ib. Ia is an ADP-ribosyltransferase, which modifies Arg177 of actin. The previously determined crystal structure of the actin-Ia complex suggested involvement of Asp179 of actin in the ADP-ribosylation reaction. To gain more insights into the structural requirements of actin to serve as a substrate for toxin-catalyzed ADP-ribosylation, we engineered Saccharomyces cerevisiae strains, in which wild type actin was replaced by actin variants with substitutions in residues located on the Ia-actin interface. Expression of the actin mutant Arg177Lys resulted in complete resistance towards Ia. Actin mutation of Asp179 did not change Ia-induced ADP-ribosylation and growth inhibition of S. cerevisiae. By contrast, substitution of Glu270 of actin inhibited the toxic action of Ia and the ADP-ribosylation of actin. In vitro transcribed/translated human β-actin confirmed the crucial role of Glu270 in ADP-ribosylation of actin by Ia.

Comparison of 14 MeV isomer production of 178m2Hf and 179m2Hf using Feshbach-Kerman-Koonin and exciton preequilibrium models

International Nuclear Information System (INIS)

Chadwick, M.B.; Young, P.G.

1993-01-01

The 178m2 Hf(16+) isomeric state has a 31-yr half life and could pose serious radioactive problems in nuclear fusion reactors if its production in 14 MeV neutron-induced reactions is significant. We present statistical/preequilibrium model calculations for the production of this isomer in the 179 Hf(n, 2n) 178m2 Hf reaction, as well as the 25-days 12.5 - isomer in the 179 Hf(n,n') 179m2 Hf reaction, using two different preequilibrium models: the exciton model and the Feshbach-Kerman-Koonin (FKK) theory. Our calculations which use the exciton model agree well with measurements, but those with the FKK theory underestimate measurements. Our calculations axe the first to probe angular momentum transfer effects in the FKK theory and suggest that, as it is presently applied, high spin-transfer reactions are underestimated. We suggest modifications to the FKK statistical averaging procedure which may result in an improved agreement with experiment

Measurement of the isotope shift of the 63 P 1 ↔53 D 1 transition of ytterbium by using a diode oscillator fiber amplified laser

Science.gov (United States)

Lee, L.; Park, H.; Ko, K.-H.; Jeong, D.-Y.

2010-08-01

We demonstrated a Diode Oscillator Fiber Amplification (DOFA) system in order to study the 63 P 1 ↔53 D 1 (1539 nm) transition line of a neutral ytterbium atom that is accessed by the stepwise excitation of the ground state. The frequency of the DOFA system was doubled by a MgO:PPLN crystal for the resonant excitation of the 61 S 0 ↔63 P 1 transition. The frequency of the second harmonic beam was stabilized to the 61 S 0 ↔63 P 1 transition of each isotope with the stability of about 2 MHz. We performed absorption spectroscopy on the 63 P 1 ↔53 D 1 (1539 nm) transition after the velocity selective excitation by the frequency-doubled beam. The isotope shifts in the 63 P 1 ↔53 D 1 (1539 nm) transition were directly measured for the first time. The relative isotope shifts from 174Yb were measured as -105.8 MHz and 109.7 MHz for 176Yb and 172Yb, respectively.

Surface oxidation of porous ZrB2-SiC ceramic composites by continuous-wave ytterbium fibre laser

International Nuclear Information System (INIS)

Mahmod, Dayang Salyani Abang; Glandut, Nicolas; Khan, Amir Azam; Labbe, Jean-Claude

2015-01-01

Highlights: • Surface oxidation of ZrB 2 -SiC ceramic composites by Yb-fibre laser. • Round spiral laser pattern created for the surface oxidation. • Presence of laser-formed oxide scale and unaffected beneath regions. • Crazed but uncracked surface oxide. • A dense glassy SiO 2 -rich layer exhibited enhances oxidation resistance. - Abstract: Surface treatment of ceramic substrates by a laser beam can allow to incorporate interesting properties to these ceramics. In the present work, surface oxidation of ca. 30% porous ZrB 2 -SiC ceramic composites by using an ytterbium fibre laser was conducted. Oxidation of ceramic substrates through this process under ambient conditions has certain advantages compared to the classical oxidation method. A particular spiral laser pattern was created in order to produce an oxidized structure on ZrB 2 -SiC porous substrates. The laser parameters were as follows i.e., laser power of 50, 60 and 70 W, a beam diameter of 1.25 mm, velocity of 2 mm/s, acceleration and deceleration of 1 mm/s 2 . The microstructural and morphological changes in the laser-treated region was examined using scanning electron microscopy, energy dispersive X-ray spectroscopy, and X-ray diffraction. At laser power of 70 W, the sample exhibits uniform oxidation. It revealed that the very porous bulk beneath remained unaffected and unoxidized because this laser-formed oxide scale protects the substrate from oxidation. The presence of oxidized and unaffected regions indicated a high degree of heat localization. The dense glassy SiO 2 -rich layer prevents the inward oxygen diffusion into the inner bulk hence enhances the oxidation resistance.

26 CFR 1.179B-1T - Deduction for capital costs incurred in complying with Environmental Protection Agency sulfur...

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Deduction for capital costs incurred in... capital costs incurred in complying with Environmental Protection Agency sulfur regulations (temporary... the deduction allowable under section 179B(a) for qualified capital costs paid or incurred by a small...

Klebsiella pneumoniae Carbapenemase-2 (KPC-2, Substitutions at Ambler Position Asp179, and Resistance to Ceftazidime-Avibactam: Unique Antibiotic-Resistant Phenotypes Emerge from β-Lactamase Protein Engineering

Directory of Open Access Journals (Sweden)

Melissa D. Barnes

2017-10-01

Full Text Available The emergence of Klebsiella pneumoniae carbapenemases (KPCs, β-lactamases that inactivate “last-line” antibiotics such as imipenem, represents a major challenge to contemporary antibiotic therapies. The combination of ceftazidime (CAZ and avibactam (AVI, a potent β-lactamase inhibitor, represents an attempt to overcome this formidable threat and to restore the efficacy of the antibiotic against Gram-negative bacteria bearing KPCs. CAZ-AVI-resistant clinical strains expressing KPC variants with substitutions in the Ω-loop are emerging. We engineered 19 KPC-2 variants bearing targeted mutations at amino acid residue Ambler position 179 in Escherichia coli and identified a unique antibiotic resistance phenotype. We focus particularly on the CAZ-AVI resistance of the clinically relevant Asp179Asn variant. Although this variant demonstrated less hydrolytic activity, we demonstrated that there was a prolonged period during which an acyl-enzyme intermediate was present. Using mass spectrometry and transient kinetic analysis, we demonstrated that Asp179Asn “traps” β-lactams, preferentially binding β-lactams longer than AVI owing to a decreased rate of deacylation. Molecular dynamics simulations predict that (i the Asp179Asn variant confers more flexibility to the Ω-loop and expands the active site significantly; (ii the catalytic nucleophile, S70, is shifted more than 1.5 Å and rotated more than 90°, altering the hydrogen bond networks; and (iii E166 is displaced by 2 ÅÅ when complexed with ceftazidime. These analyses explain the increased hydrolytic profile of KPC-2 and suggest that the Asp179Asn substitution results in an alternative complex mechanism leading to CAZ-AVI resistance. The future design of novel β-lactams and β-lactamase inhibitors must consider the mechanistic basis of resistance of this and other threatening carbapenemases.

25 CFR 179.101 - How does the Secretary distribute principal and income to the holder of a life estate?

Science.gov (United States)

2010-04-01

... must do the following: (1) Distribute all rents and profits, as income, to the life tenant; (2... mineral contracts: (i) Invest the principal, with interest income to be paid to the life tenant during the... the principal immediately according to § 179.102; and (ii) Invest all proceeds attributable to any...

Atomic frequency reference at 1033 nm for ytterbium (Yb)-doped fiber lasers and applications exploiting a rubidium (Rb) 5S_1/2 to 4D_5/2 one-colour two-photon transition

Science.gov (United States)

Roy, Ritayan; Condylis, Paul C.; Johnathan, Yik Jinen; Hessmo, Björn

2017-04-01

We demonstrate a two-photon transition of rubidium (Rb) atoms from the ground state (5$S_{1/2}$) to the excited state (4$D_{5/2}$), using a home-built ytterbium (Yb)-doped fiber amplifier at 1033 nm. This is the first demonstration of an atomic frequency reference at 1033 nm as well as of a one-colour two-photon transition for the above energy levels. A simple optical setup is presented for the two-photon transition fluorescence spectroscopy, which is useful for frequency stabilization for a broad class of lasers. This spectroscopy has potential applications in the fiber laser industry as a frequency reference, particularly for the Yb-doped fiber lasers. This two-photon transition also has applications in atomic physics as a background- free high- resolution atom detection and for quantum communication, which is outlined in this article.

CONSIDERATIONS ON AMENDING AND SUPPLEMENTING LAW NO. 279/2005 ON APPRENTICESHIP AT WORK BY LAW NO. 179/2013

Directory of Open Access Journals (Sweden)

Brîndușa Oana Vartolomei

2013-11-01

Full Text Available Changes and additions made to the Law on apprenticeship contract and call into question the manner in which the Romanian legislator understands that give efficiency to this legal institutions. The scientific research aims to identify substantive changes made to the legal text by Law no. 179/2013 and to explore opportunities in the current context of national and European legislation.

Surface oxidation of porous ZrB{sub 2}-SiC ceramic composites by continuous-wave ytterbium fibre laser

Energy Technology Data Exchange (ETDEWEB)

Mahmod, Dayang Salyani Abang, E-mail: dygsalyani@gmail.com [Department of Mechanical and Manufacturing Engineering, Faculty of Engineering, Universiti Malaysia Sarawak, 94300 Kota Samarahan, Sarawak (Malaysia); Glandut, Nicolas [SPCTS, UMR 7315, CNRS, University of Limoges, European Ceramic Center, 12 Rue Atlantis, 87068 Limoges (France); Khan, Amir Azam [Department of Mechanical and Manufacturing Engineering, Faculty of Engineering, Universiti Malaysia Sarawak, 94300 Kota Samarahan, Sarawak (Malaysia); Labbe, Jean-Claude [SPCTS, UMR 7315, CNRS, University of Limoges, European Ceramic Center, 12 Rue Atlantis, 87068 Limoges (France)

2015-12-01

Highlights: • Surface oxidation of ZrB{sub 2}-SiC ceramic composites by Yb-fibre laser. • Round spiral laser pattern created for the surface oxidation. • Presence of laser-formed oxide scale and unaffected beneath regions. • Crazed but uncracked surface oxide. • A dense glassy SiO{sub 2}-rich layer exhibited enhances oxidation resistance. - Abstract: Surface treatment of ceramic substrates by a laser beam can allow to incorporate interesting properties to these ceramics. In the present work, surface oxidation of ca. 30% porous ZrB{sub 2}-SiC ceramic composites by using an ytterbium fibre laser was conducted. Oxidation of ceramic substrates through this process under ambient conditions has certain advantages compared to the classical oxidation method. A particular spiral laser pattern was created in order to produce an oxidized structure on ZrB{sub 2}-SiC porous substrates. The laser parameters were as follows i.e., laser power of 50, 60 and 70 W, a beam diameter of 1.25 mm, velocity of 2 mm/s, acceleration and deceleration of 1 mm/s{sup 2}. The microstructural and morphological changes in the laser-treated region was examined using scanning electron microscopy, energy dispersive X-ray spectroscopy, and X-ray diffraction. At laser power of 70 W, the sample exhibits uniform oxidation. It revealed that the very porous bulk beneath remained unaffected and unoxidized because this laser-formed oxide scale protects the substrate from oxidation. The presence of oxidized and unaffected regions indicated a high degree of heat localization. The dense glassy SiO{sub 2}-rich layer prevents the inward oxygen diffusion into the inner bulk hence enhances the oxidation resistance.

First observation of excited structures in neutron-deficient 179Hg : evidence for multiple shape coexistence

International Nuclear Information System (INIS)

Kondev, F.G.; Carpenter, M.P.; Janssens, R.V.F.; Lister, C.J.; Abu Saleem, K.; Ahmad, I.; Amro, H.; Caggiano, J.; Davids, C.N.; Heinz, A.; Herskind, B.; Khoo, T.L.; Lauristen, T.; Ma, W.C.; Ressler, J.J.; Reviol, W.; Riedinger, L.L.; Sarantites, D.G.; Seweryniak, D.; Siem, S.; Sonzongni, A.A.; Varmette, P.G.; Wiedenhoever, I.

2002-01-01

Excited structures in the neutron-deficient nucleus 179 Hg have been established for the first time using the Gammasphere spectrometer in conjunction with the fragment mass analyzer. Competing states originating from three different minima associated with nearly spherical, oblate, and prolate deformations were found. This result can be contrasted with the situation in heavier odd-mass Hg isotopes where only two minima (oblate and prolate) have been seen. The implications of these three shapes at low spin and excitation energy are discussed in the general context of shape coexistence in this mass region.

Multifunctional stannum oxide compact bilayer modified by europium and erbium respectively doped ytterbium fluoride for high-performance dye-sensitized solar cell

International Nuclear Information System (INIS)

Yue, Jingyi; Xiao, Yaoming; Li, Yanping; Han, Gaoyi

2017-01-01

Graphical abstract: Multifunctional SnO 2 compact bilayer respectively modified by YbF 3 :Eu 3+ (SYEu) and YbF 3 :Er 3+ (SYEr) demonstrates three functions: 1) reducing the recombination rate of electron-hole pairs, 2) improving the utilization of sunlight, and 3) enhancing the long-term stability of the photovoltaic device. Display Omitted -- Highlights: •Multifunctional SYEu/SYEr compact bilayer is designed and fabricated. •The compact bilayer exhibits a reduced electron recombination rate. •The compact bilayer shows enhanced UV and IR light response via light-conversions. •The double layer has no significant influence on arising quenching effect. -- Abstract: Multifunctional stannum oxide compact bilayer modified by europium and erbium respectively doped ytterbium fluoride (SYEu/SYEr) is designed and prepared by a convenient and low-cost spin-coating approach for dye-sensitized solar cell. The most important three functions of the compact bilayer are reducing the recombination rate of electrons as a barrier layer, enlarging the utilization of sunlight as a luminescence material both with down- and up- conversions, and enhancing the long-term stability of the device as a defender of the dye. Besides, the construction of double layer with down- and up- conversion functions has no significant influence on giving rise to quenching effect. Furthermore, these findings offer potential applications for photovoltaic device with a wide range response of sunlight via the variation in rare-earth species and cell structures.

Resolution of the 179W-isomer anomaly: Exposure of a Fermi-aligned s band

International Nuclear Information System (INIS)

Walker, P.M.; Dracoulis, G.D.; Byrne, A.P.; Fabricius, B.; Kibedi, T.; Stuchbery, A.E.; Department of Physics, University of Surrey, Guildford, GU2 5XH United Kingdom)

1991-01-01

The K π =35/2 - , five-quasiparticle isomer in 179 W is shown to decay into the region of a backbend in the 7/2 - [514] band, allowing for the first time the identification of a full set of aligned-band states. Destructive interference results from level mixing in the band-crossing region. The deduced γ-ray branching ratios are used to establish the mixing matrix elements and to show that the aligned band has a high value of the K quantum number. The properties of well-defined alignment and yet also high K provide the first clear example of a Fermi-aligned s band. The anomalous decay of the isomer itself is now explained

Cost-effectiveness of female human papillomavirus vaccination in 179 countries: a PRIME modelling study.

Science.gov (United States)

Jit, Mark; Brisson, Marc; Portnoy, Allison; Hutubessy, Raymond

2014-07-01

Introduction of human papillomavirus (HPV) vaccination in settings with the highest burden of HPV is not universal, partly because of the absence of quantitative estimates of country-specific effects on health and economic costs. We aimed to develop and validate a simple generic model of such effects that could be used and understood in a range of settings with little external support. We developed the Papillomavirus Rapid Interface for Modelling and Economics (PRIME) model to assess cost-effectiveness and health effects of vaccination of girls against HPV before sexual debut in terms of burden of cervical cancer and mortality. PRIME models incidence according to proposed vaccine efficacy against HPV 16/18, vaccine coverage, cervical cancer incidence and mortality, and HPV type distribution. It assumes lifelong vaccine protection and no changes to other screening programmes or vaccine uptake. We validated PRIME against existing reports of HPV vaccination cost-effectiveness, projected outcomes for 179 countries (assuming full vaccination of 12-year-old girls), and outcomes for 71 phase 2 GAVI-eligible countries (using vaccine uptake data from the GAVI Alliance). We assessed differences between countries in terms of cost-effectiveness and health effects. In validation, PRIME reproduced cost-effectiveness conclusions for 24 of 26 countries from 17 published studies, and for all 72 countries in a published study of GAVI-eligible countries. Vaccination of a cohort of 58 million 12-year-old girls in 179 countries prevented 690,000 cases of cervical cancer and 420,000 deaths during their lifetime (mostly in low-income or middle-income countries), at a net cost of US$4 billion. HPV vaccination was very cost effective (with every disability-adjusted life-year averted costing less than the gross domestic product per head) in 156 (87%) of 179 countries. Introduction of the vaccine in countries without national HPV vaccination at present would prevent substantially more cases

Resolution of the 179W isomer anomaly: exposure of a fermi aligned s-band

International Nuclear Information System (INIS)

Walker, P.M.; Surrey Univ., Guildford; Dracoulis, G.D.; Byrne, A.P.; Fabricius, B.; Kibedi, T.; Stuchbery, A.E.

1991-06-01

The K Π = 35/2 - , five quasiparticle isomer in 179 W is shown to decay into the region of a backbend in the 7/2 - [514] band, allowing for the first time the identification of a full set of aligned-band states. Destructive interference results from level-mixing in the band-crossing region. The deduced γ-ray branching ratios are used to establish the mixing matrix elements and to show that the aligned band has a high value of the K-quantum number. The properties of well-defined alignment and yet also high-K, provided the first clear example of a Fermi Aligned s-band. The anomalous decay of the isomer itself is now explained. 11 refs., 1 tab., 3 figs

LEMS: application of the method to study the static quadrupole moment of the K=35/2 isomer in 179W

International Nuclear Information System (INIS)

Neyens, G.; Vyvey, K.; Byrne, A.P.; Dracoulis, G.D.; Blaha, P.

1997-01-01

The method of the level mixing spectroscopy (LEMS) was applied for the first time for the study of the static quadrupole moments of high-K isomers in the A∼180 mass region. Results from a preliminary experiment for the static quadrupole moment of the 35/2 - (750 ns) isomer in 179 W give a limit for its upper value Q 2 <0.343. (orig.). With 1 fig

Klebsiella pneumoniae Carbapenemase-2 (KPC-2), Substitutions at Ambler Position Asp179, and Resistance to Ceftazidime-Avibactam: Unique Antibiotic-Resistant Phenotypes Emerge from β-Lactamase Protein Engineering.

Science.gov (United States)

Barnes, Melissa D; Winkler, Marisa L; Taracila, Magdalena A; Page, Malcolm G; Desarbre, Eric; Kreiswirth, Barry N; Shields, Ryan K; Nguyen, Minh-Hong; Clancy, Cornelius; Spellberg, Brad; Papp-Wallace, Krisztina M; Bonomo, Robert A

2017-10-31

The emergence of Klebsiella pneumoniae carbapenemases (KPCs), β-lactamases that inactivate "last-line" antibiotics such as imipenem, represents a major challenge to contemporary antibiotic therapies. The combination of ceftazidime (CAZ) and avibactam (AVI), a potent β-lactamase inhibitor, represents an attempt to overcome this formidable threat and to restore the efficacy of the antibiotic against Gram-negative bacteria bearing KPCs. CAZ-AVI-resistant clinical strains expressing KPC variants with substitutions in the Ω-loop are emerging. We engineered 19 KPC-2 variants bearing targeted mutations at amino acid residue Ambler position 179 in Escherichia coli and identified a unique antibiotic resistance phenotype. We focus particularly on the CAZ-AVI resistance of the clinically relevant Asp179Asn variant. Although this variant demonstrated less hydrolytic activity, we demonstrated that there was a prolonged period during which an acyl-enzyme intermediate was present. Using mass spectrometry and transient kinetic analysis, we demonstrated that Asp179Asn "traps" β-lactams, preferentially binding β-lactams longer than AVI owing to a decreased rate of deacylation. Molecular dynamics simulations predict that (i) the Asp179Asn variant confers more flexibility to the Ω-loop and expands the active site significantly; (ii) the catalytic nucleophile, S70, is shifted more than 1.5 Å and rotated more than 90°, altering the hydrogen bond networks; and (iii) E166 is displaced by 2 Å when complexed with ceftazidime. These analyses explain the increased hydrolytic profile of KPC-2 and suggest that the Asp179Asn substitution results in an alternative complex mechanism leading to CAZ-AVI resistance. The future design of novel β-lactams and β-lactamase inhibitors must consider the mechanistic basis of resistance of this and other threatening carbapenemases. IMPORTANCE Antibiotic resistance is emerging at unprecedented rates and threatens to reach crisis levels. One key

Efficient and selective singlet oxygen sensitized NIR luminescence of a neodymium(III) complex and its application in biological imaging

Energy Technology Data Exchange (ETDEWEB)

Lo, Wai-Sum [Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong Special Administrative Region (Hong Kong); Li, Hongguang [Department of Chemistry, Hong Kong Baptist University, Kowloon Tong, Hong Kong Special Administrative Region (Hong Kong); Law, Ga-Lai, E-mail: ga-lai.law@polyu.edu.hk [Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong Special Administrative Region (Hong Kong); Wong, Wing-Tak, E-mail: bcwtwong@polyu.edu.hk [Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong Special Administrative Region (Hong Kong); Wong, Ka-Leung, E-mail: klwong@hkbu.edu.hk [Department of Chemistry, Hong Kong Baptist University, Kowloon Tong, Hong Kong Special Administrative Region (Hong Kong)

2016-01-15

A responsive neodymium NIR emission ({sup 4}F{sub 3/2}→{sup 4}I{sub 11/2,} {sub 9/2}) was recorded upon binding with singlet oxygen (K{sub B}=1.79×10{sup 6} M{sup −1}) via the anthracene moiety. The motif ytterbium analog served as a negative control with no significant NIR enhancement/quenching with the addition of the same amount of singlet oxygen. Our complex was also found to react with {sup 1}O{sub 2} generated by a known photosensitizer TMPyP inside HeLa cells without inducing cell death and display no significant cytotoxicity. - Highlights: • A turn-on NIR-emissive {sup 1}O{sub 2} probe has been synthesized for potential biological applications. • It has a binding constant of 1.9×10{sup 6} M{sup −1} and the emission intensity has a 5-fold increase upon binding. • The probe was also found to quench singlet oxygen in vitro generated by known photosensitizer TMPyP.

Absorption Spectra Of Rbcl:Yb Rbbr:Yb And Rbi:Yb Crystals ...

African Journals Online (AJOL)

Single crystals of rubidium chloride, bromide and iodide were doped with substitutional divalent ytterbium, Yb ions, by heating them in ytterbium atmosphere. The absorption spectra of the Yb doped crystals were measured at room and liquid nitrogen temperatures. The spectra were found to consist of intense broad ...

Overview of ultraviolet and infrared spectroscopic properties of Yb3+ doped borate and oxy-borates compounds

International Nuclear Information System (INIS)

Sablayrolles, J.

2006-12-01

The trivalent ytterbium ion can give rise to two emissions with different spectroscopic properties: the first one, with a short lifetime, in the ultraviolet (charge transfer emission) is used in detectors such as scintillators, and the other one, with a long lifetime, in the infrared (4f-4f emission) for laser applications. The strong link between material structure and properties is illustrated through ytterbium luminescence study, in the ultraviolet and infrared, inserted in the borate Li 6 Y(BO 3 ) 3 and two oxy-borates: LiY 6 O 5 (BO 3 ) 3 and Y 17,33 B 8 O 38 . For the first time an ytterbium charge transfer emission in oxy-borates has been observed. The calculation of the single configurational coordinate diagram, as well as the thermal quenching, has been conducted under a fundamental approach on the ytterbium - oxygen bond. The study of the ytterbium infrared spectroscopy in these compounds has been realised and an energy level attribution is proposed in the particular case of the borate Li 6 Y(BO 3 ) 3 : Yb 3+ . An original approach is introduced with the study of the charge transfer states for the three compounds by looking at the infrared emission. The first laser performances in three operating modes (continuous wave, Q-switch and mode locking) of a Li 6 Y(BO 3 ) 3 : Yb 3+ crystal are reported. (author)

Comparative decay analysis of 179Re* and 189Au* formed in the reactions 20Ne+159Tb, 169Tm with Elab=8 MeV/A

International Nuclear Information System (INIS)

Manpreet Kaur; Singh, BirBikram

2016-01-01

The heavy ion induced reactions lead to the formation of composite systems, which subsequently decay because of high excitation energy and angular momentum. The study of decaying composite system facilitates to explore the number of nuclear characteristics and the reaction dynamics. The medium mass composite systems 164 Yb*, 176,182,188,196 Pt* and 200,202 Pb* have been studied successfully within the framework of dynamical cluster decay model (DCM). These studies show the emission of light particles, LP (or evaporation residues, ER), intermediate mass fragments, IMF, heavy mass fragments, HMF and symmetric fragments, SF along with signatures of quasi-fission, qf, process in their decay path. The decay of medium mass composite system 179 Re* has also been studied within DCM. In the present work, we investigate the comparative decay of two medium mass composite systems 179 Re* and 189 Au formed in the reactions with same projectile ( 20 Ne) having same E lab (or same E/A) on two different targets 159 Tb and 169 Tm, for which the experimental data is available

PKI-179: an orally efficacious dual phosphatidylinositol-3-kinase (PI3K)/mammalian target of rapamycin (mTOR) inhibitor.

Science.gov (United States)

Venkatesan, Aranapakam M; Chen, Zecheng; dos Santos, Osvaldo; Dehnhardt, Christoph; Santos, Efren Delos; Ayral-Kaloustian, Semiramis; Mallon, Robert; Hollander, Irwin; Feldberg, Larry; Lucas, Judy; Yu, Ker; Chaudhary, Inder; Mansour, Tarek S

2010-10-01

A series of mono-morpholino 1,3,5-triazine derivatives (8a-8q) bearing a 3-oxa-8-azabicyclo[3.2.1]octane were prepared and evaluated for PI3-kinase/mTOR activity. Replacement of one of the bis-morpholines in lead compound 1 (PKI-587) with 3-oxa-8-azabicyclo[3.2.1]octane and reduction of the molecular weight yielded 8m (PKI-179), an orally efficacious dual PI3-kinase/mTOR inhibitor. The in vitro activity, in vivo efficacy, and PK properties of 8m are discussed. Copyright © 2010. Published by Elsevier Ltd.

Etudes optiques de nouveaux materiaux laser: Des orthosilicates dopes a l'ytterbium: Le yttrium (lutetium,scandium) pentoxide de silicium

Science.gov (United States)

Denoyer, Aurelie

La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau

Barium iodide and strontium iodide crystals and scintillators implementing the same

Science.gov (United States)

Payne, Stephen A.; Cherepy, Nerine; Pedrini, Christian; Burger, Arnold

2016-09-13

In one embodiment, a crystal includes at least one metal halide; and an activator dopant comprising ytterbium. In another general embodiment, a scintillator optic includes: at least one metal halide doped with a plurality of activators, the plurality of activators comprising: a first activator comprising europium, and a second activator comprising ytterbium. In yet another general embodiment, a method for manufacturing a crystal suitable for use in a scintillator includes mixing one or more salts with a source of at least one dopant activator comprising ytterbium; heating the mixture above a melting point of the salt(s); and cooling the heated mixture to a temperature below the melting point of the salts. Additional materials, systems, and methods are presented.

Synthesis and Characterization of Yttria-Stabilized Zirconia Nanoparticles Doped with Ytterbium and Gadolinium: ZrO2 9.5Y2O3 5.6Yb2O3 5.2Gd2O3

Science.gov (United States)

Bahamirian, M.; Hadavi, S. M. M.; Rahimipour, M. R.; Farvizi, M.; Keyvani, A.

2018-06-01

Defect cluster thermal barrier coatings (TBCs) are attractive alternatives to Yttria-stabilized zirconia (YSZ) in advanced applications. In this study, YSZ nanoparticles doped with ytterbium and gadolinium (ZrO2 9.5Y2O3 5.6Yb2O3 5.2Gd2O3 (ZGYbY)) were synthesized through a chemical co-precipitation and calcination method, and characterized by in situ high-temperature X-ray diffraction analysis in the temperature range of 25 °C to 1000 °C (HTK-XRD), thermogravimetric analysis, differential thermal analysis, Fourier transform infrared spectroscopy, Raman spectroscopy, and field emission scanning electron microscopy (FE-SEM). Precise cell parameters of t-prime phase and the best zirconia phase for TBC applications were calculated by Cohen's and Rietveld refinement methods. Optimum crystallization temperature of the precursor powder was found to be 1000 °C. Furthermore, FE-SEM results for the calcined ZGYbY powders indicated orderly particles of uniform shape and size with a small tendency toward agglomeration. Average lattice thermal expansion coefficient in the temperature range of 25 °C to 1000 °C was determined to be 31.71 × 10-6 K-1.

Synthesis and Characterization of Yttria-Stabilized Zirconia Nanoparticles Doped with Ytterbium and Gadolinium: ZrO2 9.5Y2O3 5.6Yb2O3 5.2Gd2O3

Science.gov (United States)

Bahamirian, M.; Hadavi, S. M. M.; Rahimipour, M. R.; Farvizi, M.; Keyvani, A.

2018-03-01

Defect cluster thermal barrier coatings (TBCs) are attractive alternatives to Yttria-stabilized zirconia (YSZ) in advanced applications. In this study, YSZ nanoparticles doped with ytterbium and gadolinium (ZrO2 9.5Y2O3 5.6Yb2O3 5.2Gd2O3 (ZGYbY)) were synthesized through a chemical co-precipitation and calcination method, and characterized by in situ high-temperature X-ray diffraction analysis in the temperature range of 25 °C to 1000 °C (HTK-XRD), thermogravimetric analysis, differential thermal analysis, Fourier transform infrared spectroscopy, Raman spectroscopy, and field emission scanning electron microscopy (FE-SEM). Precise cell parameters of t-prime phase and the best zirconia phase for TBC applications were calculated by Cohen's and Rietveld refinement methods. Optimum crystallization temperature of the precursor powder was found to be 1000 °C. Furthermore, FE-SEM results for the calcined ZGYbY powders indicated orderly particles of uniform shape and size with a small tendency toward agglomeration. Average lattice thermal expansion coefficient in the temperature range of 25 °C to 1000 °C was determined to be 31.71 × 10-6 K-1.

Effects of ethylenediaminetetraacetic acid (EDTA) and diethylenetriaminepentaacetic acid (DTPA) derivatives on penetration of /sup 169/Yb and /sup 144/Ce into the rat offspring

Energy Technology Data Exchange (ETDEWEB)

Baltrukiewicz, Z; Burakowski, T; Derecki, J

1976-01-01

Penetration of radioactive ytterbium-169 and cerium-144 into fetuses was determined at the end of pregnancy and penetration into suckling rats was studied during feeding with the milk of exposed mothers when EDTA or DTPA derivatives were being administered. Injection of ytterbium-169 as a complex with EDTA or DTPA or injection of Na/sub 2/Ca EDTA or Na/sub 3/Ca DTPA 1h after administration of cerium-144 to mothers reduced penetration of both radionuclides into offsprings in relation to the animals receiving no complex compounds. It was observed that the action of DTPA was stronger than that of EDTA. Passage of ytterbium with milk and across the placenta was greater than the passage of cerium.

On observation of the downconversion mechanism in Er{sup 3+}/Yb{sup 3+} co-doped tellurite glass using thermal and optical parameters

Energy Technology Data Exchange (ETDEWEB)

Figueiredo, M.S.; Santos, F.A. [Universidade Federal da Grande Dourados, Faculdade de Ciências Exatas e Tecnologias, Dourados, MS (Brazil); Yukimitu, K.; Moraes, J.C.S. [Universidade Estadual Paulista, UNESP, Departamento de Física e Química, Av. Brasil, 56, 15385-000 Ilha Solteira, SP (Brazil); Nunes, L.A.O. [Instituto de Física de São Carlos, Universidade de São Paulo, CP 369, 13560-970 São Carlos, SP (Brazil); Andrade, L.H.C. [Grupo de Espectroscopia Óptica e Fototérmica, Universidade Estadual de Mato Grosso do Sul, Cidade Universitária de Dourados, CP 351, Dourados, MS (Brazil); Lima, S.M., E-mail: smlima@uems.br [Grupo de Espectroscopia Óptica e Fototérmica, Universidade Estadual de Mato Grosso do Sul, Cidade Universitária de Dourados, CP 351, Dourados, MS (Brazil)

2015-01-15

In this work we report the observed downconversion (DC) mechanism in Er{sup 3+}/Yb{sup 3+}-codoped tellurite glasses (in mol%, 80TeO{sub 2}–10Li{sub 2}O–10TiO{sub 2}). The samples were synthesized by the conventional melt-quenching method and then studied using optical spectroscopy and thermal lens spectroscopy (TLS). These characterizations enabled investigation of the radiative and nonradiative processes involved in energy transfer from erbium to ytterbium. The visible Er{sup 3+} fluorescence intensities decreased as a function of the Yb{sup 3+} concentration, and there was a corresponding increase in the ytterbium emission at around 980 nm. Simultaneously, there was a reduction in the heat-generated due nonradiative decays (∼21%) when ytterbium was added. This temperature change was measured by TLS measurements and the results corroborate with the indicated by spectroscopic interpretation. - Highlights: • Energy transfer from erbium to ytterbium in tellurite glass. • ∼56% of cross-relaxation efficiency from Er{sup 3+} to Yb{sup 3+}. • Downconversion effect in tellurite glasses. • Downconversion effect observation by thermal lens spectroscopy.

Structural properties of pure and Fe-doped Yb films prepared by vapor condensation

Energy Technology Data Exchange (ETDEWEB)

Rojas-Ayala, C., E-mail: chachi@cbpf.br [Centro Brasileiro de Pesquisas Físicas, Rio de Janeiro 22290-180, RJ (Brazil); Facultad de Ciencias Físicas, Universidad Nacional Mayor de San Marcos, Lima, P.O.B. 14-149, Lima 14 (Peru); Passamani, E.C. [Departamento de Física, Universidade Federal do Espírito Santo, Vitória 29075-910, ES (Brazil); Suguihiro, N.M. [Centro Brasileiro de Pesquisas Físicas, Rio de Janeiro 22290-180, RJ (Brazil); Litterst, F.J. [Centro Brasileiro de Pesquisas Físicas, Rio de Janeiro 22290-180, RJ (Brazil); Institut für Physik der Kondensierten Materie, Technische Universität Braunschweig, 38106 Braunschweig (Germany); Baggio Saitovitch, E. [Centro Brasileiro de Pesquisas Físicas, Rio de Janeiro 22290-180, RJ (Brazil)

2014-10-15

Ytterbium and iron-doped ytterbium films were prepared by vapor quenching on Kapton substrates at room temperature. Structural characterization was performed by X-ray diffraction and transmission electron microscopy. The aim was to study the microstructure of pure and iron-doped films and thereby to understand the effects induced by iron incorporation. A coexistence of face centered cubic and hexagonal close packed-like structures was observed, the cubic-type structure being the dominant contribution. There is an apparent thickness dependence of the cubic/hexagonal relative ratios in the case of pure ytterbium. Iron-clusters induce a crystalline texture effect, but do not influence the cubic/hexagonal volume fraction. A schematic model is proposed for the microstructure of un-doped and iron-doped films including the cubic- and hexagonal-like structures, as well as the iron distribution in the ytterbium matrix. - Highlights: • Pure and Fe-doped Yb films have been prepared by vapor condensation. • Coexistence of fcc- and hcp-type structures was observed. • No oxide phases have been detected. • Fe-clustering does not affect the fcc/hcp ratio, but favors a crystalline texture. • A schematic model is proposed to describe microscopically the microstructure.

Results of Time-of-Flight Neutron Capture Measurements of 176,177,178,179 Hf-enriched and nat Hf samples at 10 m, 30 m and 60 m stations of GELINA

International Nuclear Information System (INIS)

Ware, T.C.; Dean, C.J.; Borella, A.; Kopecky, S.; Moens, A.; Schillebeeckx, P.; Janeva, N.; Moxon, M.C.

2014-04-01

Neutron capture measurements have been performed at the time-offlight facility GELINA to determine neutron resonance parameters for 174,176,177,178,179,180 Hf. In total, 16 distinct experiments were conducted at the 12 m, 28 m and 58 m capture stations using C 6 D 6 detectors with a moderated neutron beam and the accelerator operating at 50 Hz or 800 Hz. Measurements were performed with nat Hf metallic samples and oxide samples enriched in 176 Hf, 177 Hf, 178 Hf and 179 Hf. This report describes the experimental details required to deliver the experimental capture yields to the EXFOR data library which is maintained by the Nuclear Energy Agency of the OECD and the Nuclear Data Section of the IAEA. The experimental conditions and data reduction procedures are described. In addition, the full covariance information based on the AGS concept is given, such that resonance parameters together with their covariances can be derived in a least squares adjustment to the data. (author)

Ln{sup 3+}:KLu(WO{sub 4}){sub 2}/KLu(WO{sub 4}){sub 2} epitaxial layers: Crystal growth and physical characterisation

Energy Technology Data Exchange (ETDEWEB)

Silvestre, O.; Pujol, M.C.; Sole, R.; Bolanos, W.; Carvajal, J.J.; Massons, J.; Aguilo, M. [Fisica i Cristal.lografia de Materials (FiCMA), Universitat Rovira i Virgili, Campus Sescelades c/Marcel.li Domingo, s/n E-43007 Tarragona (Spain); Diaz, F. [Fisica i Cristal.lografia de Materials (FiCMA), Universitat Rovira i Virgili, Campus Sescelades c/Marcel.li Domingo, s/n E-43007 Tarragona (Spain)], E-mail: f.diaz@urv.cat

2008-01-15

Monoclinic epitaxial layers of single doped KLu{sub 1-x}Ln{sub x}(WO{sub 4}){sub 2} (Ln{sup 3+} = Yb{sup 3+} and Tm{sup 3+}) have been grown on optically passive KLuW substrates by liquid phase epitaxy (LPE) technique using K{sub 2}W{sub 2}O{sub 7} as solvent. The ytterbium content in the layer is in the range of 0.05 < x < 0.75 atomic substitution and the studied thulium concentrations are 0.05 < x < 0.10. The grown epitaxies are free of macroscopic defects and only in highly ytterbium-doped epilayers do some cracks or inclusions appear. The refractive indices of the epilayers were determined. The absorption and emission cross sections of ytterbium and thulium in KLuW are characterised and laser generation results are presented and discussed.

Some mechanical properties of small specimens cut from 1.79-inch-thick southern pine dried for 6 hours at 300°F or for 5 days at 180°F- A Comparison

Science.gov (United States)

P. Koch; W.L. Wellford

1978-01-01

Small specimens cut from 1.79-inch-thick southern pine dried from green condition for 6 hours at a dry-bulb temperature of 300 F suffered no diminution in the mechanical properties determined, when compared to matched wood dried for 5 days at 180 F.

Stereoselective synthesis of an active metabolite of the potent PI3 kinase inhibitor PKI-179.

Science.gov (United States)

Chen, Zecheng; Venkatesan, Aranapakam M; Dos Santos, Osvaldo; Delos Santos, Efren; Dehnhardt, Christoph M; Ayral-Kaloustian, Semiramis; Ashcroft, Joseph; McDonald, Leonard A; Mansour, Tarek S

2010-03-05

The synthesis and stereochemical determination of 1-(4-(4-((1R,5R,6R)-6-hydroxy-3-oxa-8-azabicyclo[3.2.1]octan-8-yl)-6-morpholino-1,3,5-triazin-2-yl)phenyl)-3-(pyridin-4-yl)urea (2), an active metabolite of the potent PI3 kinase inhibitor PKI-179 (1), is described. Stereospecific hydroboration of the double bond of 2,5-dihydro-1H-pyrrole 8 gave the 2,3-trans alcohol 9 exclusively. The configuration of the 3-hydroxyl group in 9 was inverted by an oxidation and stereoselective reduction sequence to give the corresponding 2,3-cis isomer 23. Both exo (21) and endo (27) isomers of the metabolite 2 were prepared via a practical synthetic route from 9 and 23, respectively, and the stereochemistry of 2 was determined to be endo. The endo isomer (27) was separated into two enantiomers 28 and 29 by chiral HPLC. Compound 2 was found to be enantiomerically pure and identical to the enantiomer 28. The absolute stereochemistry of the enantiomer 28 was determined by Mosher's method, thus establishing the stereochemistry of the active metabolite 2.

High-Power Yb-Doped Solid-Core Photonic Bandgap Fiber Amplifier at 1150-1200nm

DEFF Research Database (Denmark)

Maruyama, H.; Shirakawa, A.; Ueda, K.

2008-01-01

Solid-core photonic-bandgap fiber amplification at the long-wavelength edge of ytterbium band is reported. A 32W output at 1156nm with a 66% slope efficiency and 9.1W output at 1178nm were succesfully obtained.......Solid-core photonic-bandgap fiber amplification at the long-wavelength edge of ytterbium band is reported. A 32W output at 1156nm with a 66% slope efficiency and 9.1W output at 1178nm were succesfully obtained....

Comparison of three inert markers in measuring apparent nutrient digestibility of juvenile abalone under different culture condition and temperature regimes

Science.gov (United States)

Nur, K. U.; Adams, L.; Stone, D.; Savva, N.; Adams, M.

2018-03-01

A comparative research using three inert markers, chromic oxide, yttrium and ytterbium to measure the apparent nutrient digestibility of experimental feed in juvenile Hybrid abalone (Haliotis rubra X H. laevigata) and Greenlip abalone (H.laevigata) revealed that apparent digestibility of crude protein (ADCP) measured using yttrium and ytterbium in hybrid abalone were significantly different across the treatments. Protein digestibility measured in experimental tanks was higher than those measured in indoor and outdoor commercial tanks, regardless of inert marker used. Chromic oxide led to overestimated ADCP compared to when measured using yttrium and ytterbium. There were no significant interactions between temperature and inert markers when measuring ADCP and apparent digestibility of gross energy (ADGE). However, there was a significant difference of ADCP amongst inert markers when measured in greenlip abalone cultured at two temperatures. While measurements of ADge calculated using three inert markers shared the same value.

Kaempferol Suppresses Transforming Growth Factor-β1-Induced Epithelial-to-Mesenchymal Transition and Migration of A549 Lung Cancer Cells by Inhibiting Akt1-Mediated Phosphorylation of Smad3 at Threonine-179.

Science.gov (United States)

Jo, Eunji; Park, Seong Ji; Choi, Yu Sun; Jeon, Woo-Kwang; Kim, Byung-Chul

2015-07-01

Kaempferol, a natural dietary flavonoid, is well known to possess chemopreventive and therapeutic anticancer efficacy; however, its antimetastatic effects have not been mechanistically studied so far in any cancer model. This study was aimed to investigate the inhibitory effect and accompanying mechanisms of kaempferol on epithelial-to-mesenchymal transition (EMT) and cell migration induced by transforming growth factor-β1 (TGF-β1). In human A549 non-small lung cancer cells, kaempferol strongly blocked the enhancement of cell migration by TGF-β1-induced EMT through recovering the loss of E-cadherin and suppressing the induction of mesenchymal markers as well as the upregulation of TGF-β1-mediated matrix metalloproteinase-2 activity. Interestingly, kaempferol reversed TGF-β1-mediated Snail induction and E-cadherin repression by weakening Smad3 binding to the Snail promoter without affecting its C-terminus phosphorylation, complex formation with Smad4, and nuclear translocation under TGF-β1 stimulation. Mechanism study revealed that the phosphorylation of Smad3 linker region induced by TGF-β1 was required for the induction of EMT and cell migration, and selective downregulation of the phosphorylation of Smad3 at Thr179 residue (not Ser204, Ser208, and Ser213) in the linker region was responsible for the inhibition by kaempferol of TGF-β1-induced EMT and cell migration. Furthermore, Akt1 was required for TGF-β1-mediated induction of EMT and cell migration and directly phosphorylated Smad3 at Thr179, and kaempferol completely abolished TGF-β1-induced Akt1 phosphorylation. In summary, kaempferol blocks TGF-β1-induced EMT and migration of lung cancer cells by inhibiting Akt1-mediated phosphorylation of Smad3 at Thr179 residue, providing the first evidence of a molecular mechanism for the anticancer effect of kaempferol. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Decadal changes in the CaCO3 saturation state along 179°E in the Pacific Ocean

Science.gov (United States)

Murata, Akihiko; Saito, Shu

2012-06-01

To assess degrees of ocean acidification, we mainly investigated decadal changes in the saturation state of seawater with respect to aragonite (Ωarg), which is a more vulnerable mineral form of CaCO3, along the 179°E meridian (WOCE P14N) in the Pacific Ocean. We found a maximum decrease of Ωarg of -0.48 (-0.034 a-1) at 200-300 dbar (isopycnal surfaces of 24.0-25.8 kg m-3) at 20°N. Between 1993 and 2007, the saturation horizon rose by 17 dbar (1.2 dbar a-1) at latitudes 10°N-50°N. Although ΔΩarg mostly reflected changes in normalized dissolved inorganic carbon (ΔnCT), it was larger than could be explained by anthropogenic CO2 storage alone. Decomposition of ΔnCT revealed that ΔΩarg was enhanced by approximately 50% by a non-anthropogenic CO2 contribution represented by changes in apparent oxygen utilization. Our results suggest that ocean acidification can be temporarily accelerated by temporal changes in oceanic conditions.

An Earth-Abundant Catalyst-Based Seawater Photoelectrolysis System with 17.9% Solar-to-Hydrogen Efficiency.

Science.gov (United States)

Hsu, Shao-Hui; Miao, Jianwei; Zhang, Liping; Gao, Jiajian; Wang, Hongming; Tao, Huabing; Hung, Sung-Fu; Vasileff, Anthony; Qiao, Shi Zhang; Liu, Bin

2018-05-01

The implementation of water splitting systems, powered by sustainable energy resources, appears to be an attractive strategy for producing high-purity H 2 in the absence of the release of carbon dioxide (CO 2 ). However, the high cost, impractical operating conditions, and unsatisfactory efficiency and stability of conventional methods restrain their large-scale development. Seawater covers 70% of the Earth's surface and is one of the most abundant natural resources on the planet. New research is looking into the possibility of using seawater to produce hydrogen through electrolysis and will provide remarkable insight into sustainable H 2 production, if successful. Here, guided by density functional theory (DFT) calculations to predict the selectivity of gas-evolving catalysts, a seawater-splitting device equipped with affordable state-of-the-art electrocatalysts composed of earth-abundant elements (Fe, Co, Ni, and Mo) is demonstrated. This device shows excellent durability and specific selectivity toward the oxygen evolution reaction in seawater with near 100% Faradaic efficiency for the production of H 2 and O 2 . Powered by a single commercial III-V triple-junction photovoltaic cell, the integrated system achieves spontaneous and efficient generation of high-purity H 2 and O 2 from seawater at neutral pH with a remarkable 17.9% solar-to-hydrogen efficiency. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Optical gain at 1.53 {mu}m in Er{sup 3+}-Yb{sup 3+} co-doped porous silicon waveguides

Energy Technology Data Exchange (ETDEWEB)

Najar, A. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, BP 80518, 22305 Lannion Cedex (France); Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 El Manar, Tunis (Tunisia)], E-mail: najar.adel@laposte.net; Charrier, J. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, BP 80518, 22305 Lannion Cedex (France); Ajlani, H. [Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 El Manar, Tunis (Tunisia); Lorrain, N.; Haesaert, S. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, BP 80518, 22305 Lannion Cedex (France); Oueslati, M. [Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 El Manar, Tunis (Tunisia); Haji, L. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, BP 80518, 22305 Lannion Cedex (France)

2008-01-15

Erbium-ytterbium (Er-Yb)-co-doped porous silicon planar waveguides were prepared from P{sup +}-type (1 0 0) oriented silicon wafer. Erbium and ytterbium ions were electrochemically introduced into the porous structure of the waveguide core. The doping profiles of erbium and ytterbium ions were determined by EDX analysis performed on sample cross-section. The mean concentration in the guiding layer is of about 1 x 10{sup 20} cm{sup -3}. The refractive indices were measured from co-doped porous silicon and undoped waveguides after the thermal treatments. The photoluminescence (PL) peak of optically activated erbium ions at 1.53 {mu}m was recorded. The PL enhancement is the result of the energy transfer from the excited state of Yb to the state of Er. Optical losses at 1.55 {mu}m were measured on these waveguides and were of about 2 dB/cm. An internal gain at 1.53 {mu}m of 5.8 dB/cm has been measured with a pump power of 65 mW at 980 nm.

Measurement of the yields of residual nuclei in interactions 17.9 GeV/c α-particles with sup(159)Tb, sup(181)Ta and sup(207,2)Pb nuclei

International Nuclear Information System (INIS)

Butsev, V.S.; Butseva, G.L.; Kostin, V.Ya.; Migalenya, V.Ya.

1984-01-01

The results of investigations of 17.9 GeV/c α-particle interactions with Tb, Ta and Ph nuclei are presented. Measurements have been carried out of the relative yields of residual nuclei for the (α+Tb), (α+Ta) and (α+Pb) reactions in the 24 93 Tc, 133 Ce and 198 Tl the isomeric ratios are determined, that are compared with the isomeric ratios measured in reactions induced by 500 MeV protons and by 25.2 GeV 12 C ions

Kinetic analysis by DSC of the cationic curing of mixtures of DGEBA and 6,6-dimethyl (4,8-dioxaspiro[2.5]octane-5,7-dione)

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, Lidia [Departament de Quimica Analitica i Quimica Organica, Universitat Rovira i Virgili, C/Marcelli Domingo s/n, 43007 Tarragona (Spain); Ramis, Xavier [Laboratori de Termodinamica, ETSEIB, Universitat Politecnica de Catalunya, Av. Diagonal 647, 08028 Barcelona (Spain); Salla, Josep Maria [Laboratori de Termodinamica, ETSEIB, Universitat Politecnica de Catalunya, Av. Diagonal 647, 08028 Barcelona (Spain)], E-mail: salla@mmt.upc.edu; Mantecon, Ana; Serra, Angels [Departament de Quimica Analitica i Quimica Organica, Universitat Rovira i Virgili, C/Marcelli Domingo s/n, 43007 Tarragona (Spain)

2007-11-25

The kinetics of the thermal cationic cure reaction of mixtures in different proportions of diglycidylether of bisphenol A (DGEBA) with 6,6-dimethyl (4,8-dioxaspiro[2.5]octane-5,7-dione) (MCP) initiated by ytterbium or lanthanum triflates or using a conventional initiator, BF{sub 3}.MEA was investigated. The non-isothermal differential scanning calorimetry (DSC) experiments at a controlled heating rate was used for obtaining the kinetic parameters of the reactive systems. BF{sub 3}.MEA and lanthanide triflates initiated curing systems follow a complete different kinetic model. Among lanthanide triflates, ytterbium is the most active initiator.

Kinetic analysis by DSC of the cationic curing of mixtures of DGEBA and 6,6-dimethyl (4,8-dioxaspiro[2.5]octane-5,7-dione)

International Nuclear Information System (INIS)

Gonzalez, Lidia; Ramis, Xavier; Salla, Josep Maria; Mantecon, Ana; Serra, Angels

2007-01-01

The kinetics of the thermal cationic cure reaction of mixtures in different proportions of diglycidylether of bisphenol A (DGEBA) with 6,6-dimethyl (4,8-dioxaspiro[2.5]octane-5,7-dione) (MCP) initiated by ytterbium or lanthanum triflates or using a conventional initiator, BF 3 .MEA was investigated. The non-isothermal differential scanning calorimetry (DSC) experiments at a controlled heating rate was used for obtaining the kinetic parameters of the reactive systems. BF 3 .MEA and lanthanide triflates initiated curing systems follow a complete different kinetic model. Among lanthanide triflates, ytterbium is the most active initiator

High-efficiency cavity-dumped micro-chip Yb:YAG laser

Science.gov (United States)

Nishio, M.; Maruko, A.; Inoue, M.; Takama, M.; Matsubara, S.; Okunishi, H.; Kato, K.; Kyomoto, K.; Yoshida, T.; Shimabayashi, K.; Morioka, M.; Inayoshi, S.; Yamagata, S.; Kawato, S.

2014-09-01

High-efficiency cavity-dumped ytterbium-doped yttrium aluminum garnet (Yb:YAG) laser was developed. Although the high quantum efficiency of ytterbium-doped laser materials is appropriate for high-efficiency laser oscillation, the efficiency is decreased by their quasi-three/four laser natures. High gain operation by high intensity pumping is suitable for high efficiency oscillation on the quasi-three/four lasers without extremely low temperature cooling. In our group, highest efficiency oscillations for continuous wave, nanosecond to picosecond pulse lasers were achieved at room temperature by the high gain operation in which pump intensities were beyond 100 kW/cm2.

Optical Magnetometry Using Multiphoton Transitions

Science.gov (United States)

Degenkolb, Skyler M.

Optical magnetometry plays a critical role in low-energy precision measurements and numerous other applications. In particular, permanent electric dipole moment (EDM) searches impose strict requirements on magnetic field sensitivity of the underlying atomic or molecular species. Other magnetometer properties - such as chemical reactivity, dielectric strength, and interaction cross-sections with other species - also impose limitations on experimental conditions. Here, we explore a novel approach to optical magnetometry, using multiphoton transitions of diamagnetic atoms to detect Larmor precession of polarized nuclei. Resonant probes are possible at moderate ultraviolet wavelengths, and hyperfine structure couples spin precession to fluorescence transitions with negligible backgrounds; paramagnetic rotation due to intensity-dependent dispersion may also be detectable. Nuclear spins and nonlinear optical excitation introduce new degrees of freedom, and evade limitations arising from rapid electronic decoherence. This dissertation reports progress towards two-photon optical magnetometry using ytterbium, rubidium, and xenon. We characterize the influence of probe polarization and magnetic fields on fluorescence spectra, for one- and two-photon continuous-wave (cw) excitation of ytterbium. Resolved hyperfine and isotope structure allow us to use spin-zero isotopes for diagnostics and normalization, and we develop analysis for overlapping two-photon resonances. We also report measurements of two-photon excitation in ytterbium and rubidium using picosecond laser pulses, and in xenon using a cw laser. Although hyperfine structure is unresolved, the rubidium measurements are sensitive to probe field polarization. Fluorescence spectra from two-photon excitation of ytterbium with femtosecond pulses show modulation when the repetition rate changes. Although techniques for polarizing noble gas nuclei are mature, existing cell designs are incompatible with two

Thulium oxide fuel characterization study: Part 3, Procedures

International Nuclear Information System (INIS)

Nelson, C.A.; Anderson, R.W.; Talbot, M.; Bierds, W.

1970-06-01

Procedures are presented for the following: Tm 2 O 3 -Yb 2 O 3 pseudo - binary phase diagram tests; compatibility tests; thulium-170 oxide dose rate measurements; preparation of Tm 2 O 3 wafers; SRL thulium and/or ytterbium oxide powder reprocessing for sintering; cold pressing and sintering thulium oxide wafers; preparation of thulium and/or ytterbium oxide powder via precipitation with oxalic acid, ammonium oxalate, urea and methyl oxalate; determination of the total surface area of rare earth oxide powders; determining oxygen in thulia - thulia/ytterbia for the purpose of determining metal-to-oxygen ratios; and determination of the impact resistance to fines generation of sintered rare earth oxide

Low-dose radiotherapy in 179 patients with Peyronie's disease: Treatment outcome and current sexual functioning

International Nuclear Information System (INIS)

Incrocci, Luca; Wijnmaalen, Arendjan; Slob, A. Koos; Hop, Wim C.J.; Levendag, Peter C.

2000-01-01

Purpose: To analyse retrospectively treatment outcome in patients irradiated for Peyronie's disease. Methods and Materials: The records of 179 patients, median age 52 years, that received radiotherapy (RT) between 1982 and 1997 were reviewed. 78% presented with painful erections and 89% with penile deformity. The symptoms were present for a median duration of 6 months (range, 1-72 months). The RT schedule consisted of 13.5 Gy (9 x 1.5 Gy, 3 fractions per week) using orthovoltage X-rays in 123 patients or 12 Gy (6 x 2 Gy, daily fractions) using electrons in 56 patients. A questionnaire regarding current sexual functioning was mailed to 130 patients whose addresses could be traced; 106 (82%) responded. Results: At mean follow-up period of 3 months, 83% reported that pain was diminished or had disappeared after RT. Twenty-three percent of patients reported a decrease in penile deformity. Following RT, surgical correction of penile curvature was performed in 29% of patients. No RT-related complications occurred except transient dysuria in 1 patient. Questionnaire data: 72% of patients were currently sexually active, 48% had erectile dysfunction, and 49% expressed dissatisfaction with their current sexual functioning. Conclusion: Low-dose external RT (12-13.5 Gy) results in relief of pain in the majority of patients with Peyronie's disease. Improvement in penile deformity was observed, avoiding surgery in a number of patients. No significant RT-associated morbidity was encountered. It is disappointing that almost 50% of patients complain of sexual functioning, but this is presumably not related to radiotherapy

Phase Transformations of an Fe-0.85 C-17.9 Mn-7.1 Al Austenitic Steel After Quenching and Annealing

Science.gov (United States)

Cheng, Wei-Chun

2014-09-01

Low-density Mn-Al steels could potentially be substitutes for commercial Ni-Cr stainless steels. However, the development of the Mn-Al stainless steels requires knowledge of the phase transformations that occur during the steel making processes. Phase transformations of an Fe-0.85 C-17.9 Mn-7.1 Al (wt.%) austenitic steel, which include spinodal decomposition, precipitation transformations, and cellular transformations, have been studied after quenching and annealing. The results show that spinodal decomposition occurs prior to the precipitation transformation in the steel after quenching and annealing at temperatures below 1023 K and that coherent fine particles of L12-type carbide precipitate homogeneously in the austenite. The cellular transformation occurs during the transformation of high-temperature austenite into lamellae of austenite, ferrite, and kappa carbide at temperatures below 1048 K. During annealing at temperatures below 923 K, the austenite decomposes into lamellar austenite, ferrite, κ-carbide, and M23C6 carbide grains for another cellular transformation. Last, when annealing at temperatures below 873 K, lamellae of ferrite and κ-carbide appear in the austenite.

Chemical ordering around open-volume regions in bulk metallic glass Zr52.5Ti5Al10Cu17.9Ni14.6

International Nuclear Information System (INIS)

Asoka-Kumar, P.; Hartley, J.; Howell, R.; Sterne, P. A.; Nieh, T. G.

2000-01-01

We provide direct experimental evidence for a nonrandom distribution of atomic constituents in Zr 52.5 Ti 5 Al 10 Cu 17.9 Ni 14.6 bulk metallic glass using positron annihilation spectroscopy. The Ti content around the open-volume regions is significantly enhanced at the expense of Ni and Cu. Our results indicate that Ni and Cu atoms closely occupy the volume bounded by their neighboring atoms while Al, Ti, and Zr are less closely packed, and more likely to be associated with the open-volume regions. The overall distribution of elements seen by the positron is not significantly altered by annealing or by crystallization. Theoretical calculations indicate that the observed elemental distribution is not consistent with the known crystalline phases Zr 2 Cu and NiZr 2 , while Al 3 Zr 4 shows some of the characteristics seen in the experiment. (c) 2000 American Institute of Physics

Effects of Stress on the Electrical Resistance of Ytterbium and Calibration of Ytterbium Stress Transducers

Science.gov (United States)

1973-08-01

loading and unloading calibration data are no more difficult to perform than experiments that produce only loading data, but the selection ol...carefully with a small glass fiber brush, and the grid photoetched on an epoxy- fiberglass or strippable mylar substrate using a mixture of

Highly Efficient Fiber Lasers for Wireless Power Transmission, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — We propose to develop ytterbium (Yb) fiber lasers with an electrical-to-optical efficiency of nominally 64% by directly coupling 80%-efficient diode lasers with Yb...

Water chemistry in 179 randomly selected Swedish headwater streams related to forest production, clear-felling and climate.

Science.gov (United States)

Löfgren, Stefan; Fröberg, Mats; Yu, Jun; Nisell, Jakob; Ranneby, Bo

2014-12-01

From a policy perspective, it is important to understand forestry effects on surface waters from a landscape perspective. The EU Water Framework Directive demands remedial actions if not achieving good ecological status. In Sweden, 44 % of the surface water bodies have moderate ecological status or worse. Many of these drain catchments with a mosaic of managed forests. It is important for the forestry sector and water authorities to be able to identify where, in the forested landscape, special precautions are necessary. The aim of this study was to quantify the relations between forestry parameters and headwater stream concentrations of nutrients, organic matter and acid-base chemistry. The results are put into the context of regional climate, sulphur and nitrogen deposition, as well as marine influences. Water chemistry was measured in 179 randomly selected headwater streams from two regions in southwest and central Sweden, corresponding to 10 % of the Swedish land area. Forest status was determined from satellite images and Swedish National Forest Inventory data using the probabilistic classifier method, which was used to model stream water chemistry with Bayesian model averaging. The results indicate that concentrations of e.g. nitrogen, phosphorus and organic matter are related to factors associated with forest production but that it is not forestry per se that causes the excess losses. Instead, factors simultaneously affecting forest production and stream water chemistry, such as climate, extensive soil pools and nitrogen deposition, are the most likely candidates The relationships with clear-felled and wetland areas are likely to be direct effects.

Page | 179

African Journals Online (AJOL)

Fr. Ikenga

guild of “Stationers” and the censorship law was in the form of a Charter granted to the ... Author's Domain and the Public Domain in Early British, French and US ... This argument paid off and saw the birth of the first recognisable modern ... works, cinematograph films and photographs lasted for only 25 years after the end of ...

Production and spectroscopy of ultracold YbRb* molecules

International Nuclear Information System (INIS)

Nemitz, Nils

2008-11-01

This thesis describes the formation of electronically excited but translationally cold molecules formed from rubidium atoms and two isotopes of ytterbium ( 176 Yb and 174 Yb) by means of photoassociation. The experiments were performed in a combined MOT with 10 9 rubidium atoms and 2.10 6 ytterbium atoms at temperatures of less than 1 mK. Photoassociation lines were found by trap loss spectroscopy throughout a wavelength range of 2 nm near the 795 nm D1 transition in rubidium. The majority of lines belong to two vibrational series in the excited YbRb * molecule, converging on a system of a ground state ytterbium atom and an excited rubidium atom. The strong variation of line strength between different vibrational lines is explained through the Franck-Condon principle. An improved version of the Leroy-Bernstein equation was used to extract the leading dispersion coefficient of the potential from the vibrational progression. Most of the observed lines show a resolved rotational structure as expected from a basic quantum mechanical model. The series terminates with the third or forth rotational component due to the ground state centrifugal barrier.The measured rotational constants agree very well with calculations based on the C 6 coefficient. The discovery of a splitting of the rotational components into subcomponents indicates an uncommon angular momentum coupling described by Hund's case. Variations in the depth of the subcomponents indicates a similar splitting in the ground state, with the energies of the substates based on the alignment of the rubidium atom's magnetic dipole moment relative to the angular momentum carried by an approaching ytterbium atom. This creates an additional ground state barrier, partially suppressing some of the subcomponents. Using a rate equation model developed for this purpose, a maximum formation rate of 2.5.10 6 molecules per second was calculated over the volume of the entire trap. The work presented here is an important step on

Endobronchial ultrasound-guided transbronchial needle aspiration for lung cancer diagnosis and staging in 179 patients

Directory of Open Access Journals (Sweden)

Antonio Bugalho

2013-09-01

Full Text Available Background: Linear endobronchial ultrasound-guided transbronchial needle aspiration (eBUStBNA is an important minimally invasive procedure for non-small cell lung cancer (NScLc staging. It is also a valid method for diagnosing extraluminal lesions adjacent to the tracheobronchial tree. Aim: to evaluate our eBUS-tBNA performance regarding diagnostic yield, safety and learning curve for lung cancer diagnosis and staging. Material and methods: All patients undergoing eBUS-tBNA for lung cancer diagnosis or staging were included. they were divided into three different groups: paratracheal and parabronchial masses sent for diagnosis (Group 1; peripheral lung lesions with abnormal mediastinal lymph nodes sent for diagnosis and staging (Group 2; NScLc patients sent for mediastinal staging (Group 3. the learning curve was assessed for yield, accuracy, procedure time, size and number of lesions punctured per patient Results: A total of 179 patients were included and 372 lesions were punctured. the overall yield and accuracy were 88% and 92.7%, respectively. In Group 1, eBUS-tBNA was performed in 48 patients and sensitivity was 86.1% and accuracy was 87.5%. For the 87 patients included in Group 2, yield was 86.7%, accuracy was 93.1% and cancer prevalence was 51.7%. the diagnostic yield and accuracy in Group 3 was 95% and 97.7% respectively. eBUS-tBNA practice led to an increase number of sites punctured per patient in a shorter time, without complications. Conclusion: eBUS-tBNA is an effective method for diagnosing and staging lung cancer patients. the procedure is clearly safe. Handling and performance improves with the number of procedures executed. Resumo: Introdução: A punção aspirativa transbrônquica guiada por ecoendoscopia brônquica linear (eBUS-tBNA é um importante procedimento minimamente invasivo para o estadiamento do cancro do pulmão de não pequenas células (cPNPc. É, também, um método válido para o diagnóstico de les

Nonlinear elastic properties of bulk metallic glasses Zr52.5Ti5Cu17.9Ni14.6Al10 and Pd40Cu30Ni10P20

International Nuclear Information System (INIS)

Kobelev, N.P.; Kolyvanov, E.L.; Khonik, V.A.

2005-01-01

The influence of uniaxial compression on the propagation of ultrasonic vibrations in Zr 52.5 Ti 5 Cu 17.9 Ni 14.6 Al 10 and Pd 40 Cu 30 Ni 10 P 20 bulk metallic glasses produced by melt quenching at a rate of 100 K/s is investigated. Elastic deformation was realized by compression of the samples along their long axis up to strains of about 1 GPa. Deriving of major ratios used during the calculation of the third-order elastic moduli of the glasses is described in brief, the results of the calculations being provided. A qualitative agreement between the calculated results and available data on the influence of the uniform pressure on the sound wave propagation rate was obtained [ru

Waveguide source of amplified spontaneous emission ASE 1550 nm

International Nuclear Information System (INIS)

Razik, M.; Budnicki, A.; Abramski, M.

2003-01-01

Light source of amplified spontaneous emission (ASE) type has been built on the base of double-clad waveguide doped with ytterbium and erbium. The characteristics and applications of the ASE source have been also presented

The outcome after aortic valve-sparing (David) operation in 179 patients: a single-centre experience.

Science.gov (United States)

Leontyev, Sergey; Trommer, Constanze; Subramanian, Sreekumar; Lehmann, Sven; Dmitrieva, Yaroslava; Misfeld, Martin; Mohr, Friedrich W; Borger, Michael A

2012-08-01

The David aortic valve-sparing reimplantation (AVr-D) operation is increasingly being used in patients with aortic root aneurysmal disease and pliable aortic cusps. The objective of this study was to assess our early and medium-term outcomes with the AVr-D operation. Between 2003 and 2011, a total of 179 patients underwent AVr-D procedures. The mean patient age was 49.7 ± 15.1 years, and 23.5% (n = 42) were females. Marfan syndrome was present in 17.3% of patients (n = 31), and acute Type A aortic dissection in 15.6% (n = 28). Clinical follow-up was 100% complete and was 1.8 ± 1.6 years (0 days to 7.5 years) long. Echocardiographic follow-up was performed 2.2 ± 1.5 years (0 days to 7.5 years) postoperatively and was 77% complete. Early mortality was 1.1% (n = 2), with both deaths occurring in patients with Type A dissection. Pre-discharge echocardiography revealed no patients with >2+ aortic insufficiency (AI), 19.6% of patients (n = 34) with 1+ or 2+ AI and 80.4% of patients (n = 145) with trace or no AI. Left ventricular end-diastolic diameters decreased significantly from 5.6 ± 0.9 to 5.1 ± 0.8 cm early postoperatively (P valve re-replacement during follow-up, two due to early endocarditis and two due to non-coronary leaflet prolapse in Marfan patients. Five-year freedom from aortic valve reoperation was 95.9 ± 2.0%. AVr-D is associated with a low mortality and morbidity rate, even in patients with Type A aortic dissection. Although a slightly higher rate of recurrent AI may be present in patients with Marfan syndrome, freedom from recurrent AI and reoperation remains excellent during medium-term follow-up. The David operation should be considered the gold standard for patients with proximal aortic root pathology (aneurysm or dissection) and pliable aortic cusps.

Electric quadrupole moments and strong interaction effects in pionic atoms of 165Ho, 175Lu, 176Lu, 179Hf and 181Ta

International Nuclear Information System (INIS)

Olaniyi, B.; Shor, A.; Cheng, S.C.; Dugan, G.; Wu, C.S.

1981-05-01

The effective quadrupole moments Q sub(eff) of the nuclei of 165 Ho, 175 Lu, 176 Lu, 179 Hf and 181 Ta were accurately measured by detecting the pionic atom 5g-4f x-rays of the elements. The spectroscopic quadrupole moments, Q sub(spec), were obtained by correcting Q sub(eff) for nuclear finite size effect, distortion of the pion wave function by the pion-nucleus strong interaction, and contribution to the energy level splittings by the strong interaction. The intrinsic quadrupole moments, Q 0 , were obtained by projecting Q sub(spec) into the frame of reference fixed on the nucleus. The shift, epsilon 0 , and broadening, GAMMA 0 , of the 4f energy level due to the strong interactions between the pion and the nucleons for all the elements were also measured. Theoretical values of epsilon 0 and GAMMA 0 were calculated and compared to the experimental values. The measured values of Q 0 were compared with the existing results in muonic and pionic atoms. The measured values of epsilon 0 and GAMMA 0 were also compared with existing values. (auth)

Production techniques and quality control of sealed radioactive sources of palladium-103, iodine-125, iridium-192 and ytterbium-169. Final report of a coordinated research project 2001-2005

International Nuclear Information System (INIS)

2006-06-01

of sealed sources based on Iodine-125, Palladium-103, Iridium-192 and Ytterbium-169. Experienced scientist groups from Belarus, China, Hungary, India, the Islamic Republic of Iran, Kazakhstan, the Republic of Korea, Peru, Poland and the Russian Federation participated in the CRP under research contracts and agreements. The technology and experimental procedures described in this report are the result of the common collaborative research of all the participants in the CRP. Many of these procedures are innovative and yet simple to follow by anyone wishing to prepare radioactive sealed sources based on 125 I, 103 Pd, 169 Yb and 192 Ir

Determination of the Isotope Ratio for Metal Samples Using a Laser Ablation/Ionization Time-of-flight Mass Spectrometry

International Nuclear Information System (INIS)

Song, Kyu Seok; Cha, Hyung Ki; Kim, Duk Hyeon; Min, Ki Hyun

2004-01-01

The laser ablation/ionization time-of-flight mass spectrometry is applied to the isotopic analysis of solid samples using a home-made instrument. The technique is convenient for solid sample analysis due to the onestep process of vaporization and ionization of the samples. The analyzed samples were lead, cadmium, molybdenum, and ytterbium. To optimize the analytical conditions of the technique, several parameters, such as laser energy, laser wavelength, size of the laser beam on the samples surface, and high voltages applied on the ion source electrodes were varied. Low energy of laser light was necessary to obtain the optimal mass resolution of spectra. The 532 nm light generated mass spectra with the higher signal-to-noise ratio compared with the 355 nm light. The best mass resolution obtained in the present study is ∼1,500 for the ytterbium

Sol–gel-derived planar waveguides of Er.sup.3+./sup.: Yb.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. prepared by a polyvinylpyrrolidone-based method.

Czech Academy of Sciences Publication Activity Database

Hlásek, T.; Polák, V.; Rubešová, K.; Jakeš, V.; Nekvindová, P.; Jankovský, O.; Mikolášová, D.; Oswald, Jiří

2016-01-01

Roč. 80, č. 2 (2016), s. 531-537 ISSN 0928-0707 Institutional support: RVO:68378271 Keywords : sol–gel * polyvinylpyrrolidone * planar waveguide * ytterbium- aluminum garnet * erbium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.575, year: 2016

Cladding-pumped Yb-doped fiber laser with vortex output beam

OpenAIRE

Lin, Di; Clarkson, William

2015-01-01

A simple technique for selectively generating a donut-shaped LP11 mode with vortex phase front in a cladding-pumped ytterbium-doped fiber laser is reported. The laser yielded 36W of output with a slope efficiency of 74%.

Optimization of Levan Production by Cold-Active Bacillus licheniformis ANT 179 and Fructooligosaccharide Synthesis by Its Levansucrase.

Science.gov (United States)

Xavier, Janifer Raj; Ramana, Karna Venkata

2017-03-01

Fructooligosaccharides (FOS) and levan attract much attention due to a wide range of applications in food technology and pharmaceutical and cosmetic industry. Bacillus licheniformis ANT 179, isolated from Antarctica soil, produced levansucrase and levan in a medium containing sucrose as carbon substrate. In this study, characterization of levansucrase and production of short-chain FOS and levan were investigated. Temperature and pH optimum of the enzyme were found to be 60 °C and pH 6.0, respectively. The optimization of fermentation conditions for levan production using sugarcane juice by response surface methodology (RSM) was carried out. Central composite rotatable design was used to study the main and the interactive effects of medium components: sugarcane juice and casein peptone concentration on levan production by the bacterium. The optimized medium with sugarcane juice at 20 % (v/v) and casein peptone at 2 % (w/v) was found to be optimal at an initial pH of 7.0 and incubation temperature of 35 °C for 48 h. Under these conditions, the maximum levan concentration was 50.25 g/L on wet weight basis and 16.35 g/L on dry weight basis. The produced inulin type FOS (kestose and neokestose) and levan were characterized by Fourier transform infrared spectroscopy (FT-IR) and nuclear magnetic resonance (NMR) analysis. The study revealed that the levansucrase could form FOS from sucrose. The locally available low-cost substrate such as sugarcane juice in the form of a renewable substrate is proposed to be suitable even for scale-up production of enzyme and FOS for industrial applications. The levan and FOS synthesized by the bacterium are suitable for food applications and biomedical uses as the bacterium has GRAS status and devoid of endotoxin as compared to other Gram-negative bacteria.

Linearly polarized intracavity passive Q-switched Yb-doped ...

Indian Academy of Sciences (India)

2014-02-14

Feb 14, 2014 ... ytterbium-doped photonic crystal fibre laser with a Cr4+:YAG crystal ... average output power of 9.4 W with pulse duration of 64 ns and ... applications of nonlinear frequency shifting like frequency doubling and optical paramet-.

Highly stable microwave carrier generation using a dual-frequency distributed feedback laser

NARCIS (Netherlands)

Khan, M.R.H.; Bernhardi, Edward; Marpaung, D.A.I.; Burla, M.; de Ridder, R.M.; Worhoff, Kerstin; Pollnau, Markus; Roeloffzen, C.G.H.

2012-01-01

Photonic generation of microwave carriers by using a dual-frequency distributed feedback waveguide laser in ytterbium-doped aluminum oxide is demonstrated. A highperformance optical frequency locked loop is implemented to stabilize the microwave carrier. This approach results in a microwave

Enhanced exciton emission from ZnO nano-phosphor induced by Yb3+ ions

CSIR Research Space (South Africa)

Kabongo, GL

2014-01-01

Full Text Available In this work, the sol–gel method was used to prepare Ytterbium (Yb(sup3+)) doped ZnO nano-phosphors with different concentrations of Yb(sup3+) ions. Their structural, morphological, photoluminescence, electronic states and the chemical composition...

Physical vapor deposition of Er.sup.3+./sup.: Yb.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. thin films from sol-gel derived targets

Czech Academy of Sciences Publication Activity Database

Hlásek, T.; Rubešová, K.; Jakeš, V.; Nováček, M.; Oswald, Jiří; Fitl, P.; Siegel, J.; Macháč, P.

2016-01-01

Roč. 60, č. 4 (2016), s. 285-290 ISSN 0862-5468 Institutional support: RVO:68378271 Keywords : PLD * electron beam deposition * thin film * ytterbium-aluminium garnet * erbium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.439, year: 2016

Prevalence of metabolic syndrome in patients with rheumatoid arthritis in Morocco: a cross-sectional study of 179 cases.

Science.gov (United States)

Abourazzak, Fatima Ezzahra; Mansouri, Samia; Najdi, Adil; Tahiri, Latifa; Nejjari, Chakib; Harzy, Taoufik

2014-11-01

Rheumatoid arthritis (RA) is associated with an increased risk for cardiovascular disease (CVD). The prevalence of metabolic syndrome (MetS)-a major contributor to CVD-in RA seems to be increased, suggesting that systemic inflammation and antirheumatic therapy may contribute to its presence. We aimed to determine the prevalence of MetS in RA, to identify the potential factors associated with its presence, and to evaluate the influence of antirheumatic drugs on the occurrence of MetS in a cohort of Moroccan patients with RA. The prevalence of MetS was assessed cross-sectionally in 179 patients with RA over a period of 17 months (July 2011-December 2012). Three definitions of MetS were used (National Cholesterol Education Program/Adult Treatment Panel III 2005, International Diabetes Federation 2005, and American Association of Clinical Endocrinologists 2003). All statistical analyses were done using the SPSS software version 18.0. Multivariate logistic regression model was constructed to identify independent predictors of MetS in patients with RA. The prevalence of MetS in RA varied from 24.6 to 30.7 % according to the definitions used. In a multivariate logistic regression model, the severity of RA and less methotrexate use were identified as significant independent predictors of the presence of MetS in RA patients. Our study suggests that MetS is common among Moroccan patients with severe RA. Methotrexate therapy was identified as an independent factor associated with a reduced risk of having MetS in these patients, suggesting a drug-specific mechanism and making methotrexate a first-line disease-modifying antirheumatic drug in RA patients who are at high risk of developing MetS.

PENGEMBANGAN PERANGKAT PEMBELAJARAN PADA MATERI GEOMETRI DAN PENGUKURAN DENGAN PENDEKATAN PENDIDIKAN MATEMATIKA REALISTIK INDONESIA DI SD NEGERI 179 PALEMBANG

Directory of Open Access Journals (Sweden)

N. Fahriza Fuadiah

2013-09-01

Full Text Available The aims of the research is to produce the set of oriented realistic mathematical education (RME approach material that is valid and practical for teaching in elementary school student of the fifth grade  and have a good potencial effect. PMRI is one of learning approach which dribbles students in understanding mathematics concept by selfcontruction through prior knowledge which is related to daily activity, finding the concept by themselves so that the learning becomes meaningful. The research is a development research and method used in two stages, that are preliminary study (analysis and model development stage and formative study (evaluation and revision stage. The samples were students of fifth grade at SD Negeri 179 Palembang. In technique collecting the data, the writer used interview with the experts, observation by using prototype. The data was analyzed by using descriptive method. The result of data analyses concludes that the development of geometry and measurement prototype for the fifth grade students is valid based on content, construction, and language. It can be conclude from the documentary data that the use of student’s book has been a practical use. The try out tested on students has given potential effect which is the students like to study using realistic mathematical education approach with student activity level of 6.47 in a very high criteria and the average of final mark of  87,17 in a very good criteria. Key words: development research, RME, the set of teaching and learning

Production and spectroscopy of ultracold YbRb{sup *} molecules

Energy Technology Data Exchange (ETDEWEB)

Nemitz, Nils

2008-11-15

This thesis describes the formation of electronically excited but translationally cold molecules formed from rubidium atoms and two isotopes of ytterbium ({sup 176}Yb and {sup 174}Yb) by means of photoassociation. The experiments were performed in a combined MOT with 10{sup 9} rubidium atoms and 2.10{sup 6} ytterbium atoms at temperatures of less than 1 mK. Photoassociation lines were found by trap loss spectroscopy throughout a wavelength range of 2 nm near the 795 nm D1 transition in rubidium. The majority of lines belong to two vibrational series in the excited YbRb{sup *} molecule, converging on a system of a ground state ytterbium atom and an excited rubidium atom. The strong variation of line strength between different vibrational lines is explained through the Franck-Condon principle. An improved version of the Leroy-Bernstein equation was used to extract the leading dispersion coefficient of the potential from the vibrational progression. Most of the observed lines show a resolved rotational structure as expected from a basic quantum mechanical model. The series terminates with the third or forth rotational component due to the ground state centrifugal barrier.The measured rotational constants agree very well with calculations based on the C{sub 6} coefficient. The discovery of a splitting of the rotational components into subcomponents indicates an uncommon angular momentum coupling described by Hund's case. Variations in the depth of the subcomponents indicates a similar splitting in the ground state, with the energies of the substates based on the alignment of the rubidium atom's magnetic dipole moment relative to the angular momentum carried by an approaching ytterbium atom. This creates an additional ground state barrier, partially suppressing some of the subcomponents. Using a rate equation model developed for this purpose, a maximum formation rate of 2.5.10{sup 6} molecules per second was calculated over the volume of the entire trap. The

Relationships between ytterbium precipitation assay, colorimetric ...

African Journals Online (AJOL)

digestion and metabolism of protein (Komolong et al., 2001). ... room temperature (25 °C) pending chemical analyses and in vitro ... assayed without sodium sulphite but with a heat-stable α-amylase due to the high ... of starch in the tree fruits.

Resonant filtered fiber amplifiers

DEFF Research Database (Denmark)

Alkeskjold, Thomas Tanggaard; Laurila, Marko; Olausson, Christina Bjarnal Thulin

2013-01-01

In this paper we present our recent result on utilizing resonant/bandgap fiber designs to achieve high performance ytterbium doped fiber amplifers for achieving diffraction limited beam quality in large mode area fibers, robust bending performance and gain shaping for long wavelength operation...

Direct conversion of glucose to 5-(hydroxymethyl)furfural in ionic liquids with lanthanide catalysts

DEFF Research Database (Denmark)

Ståhlberg, Tim; Sørensen, Mathilde Grau; Riisager, Anders

2010-01-01

The direct conversion of glucose to 5-(hydroxymethyl)furfural (HMF) in ionic liquids with lanthanide catalysts was examined in search of a possibly more environmentally feasible process not involving chromium. The highest HMF yield was obtained with ytterbium chloride or triflate together...

Intra-laser-cavity microparticle sensing with a dual-wavelength distributed-feedback laser

NARCIS (Netherlands)

Bernhardi, Edward H.; van der Werf, Kees O; Hollink, Anton J F; Wörhoff, Kerstin; de Ridder, René M; Subramaniam, Vinod; Pollnau, Markus

An integrated intra-laser-cavity microparticle sensor based on a dual-wavelength distributed-feedback channel waveguide laser in ytterbium-doped amorphous aluminum oxide on a silicon substrate is demonstrated. Real-time detection and accurate size measurement of single micro-particles with diameters

On-chip microparticle detection and sizing using a dual-wavelength waveguide laser

NARCIS (Netherlands)

Bernhardi, Edward; van der Werf, Kees; Hollink, Anton; Worhoff, Kerstin; de Ridder, R.M.; Subramaniam, Vinod; Pollnau, Markus

An integrated intra-laser-cavity microparticle sensor based on a dual-phase-shift, dual-wavelength distributed-feedback channel waveguide laser in ytterbium-doped aluminium oxide is presented. Single micro-particles with diameters ranging between 1 μm and 20 μm are detected.

Studies on high-pressure reaction of Er/sub 2/O/sub 3/ or Yb/sub 2/O/sub 3/ with VO/sub 2/

Energy Technology Data Exchange (ETDEWEB)

Shin-ike, T [Osaka Dental Coll., Hirakata (Japan); Adachi, G; Shiokawa, J; Shimada, M; Koizumi, M

1980-12-01

The reaction of erbium sesquioxide (Er/sub 2/O/sub 3/) or ytterbium sesquioxide (Yb/sub 2/O/sub 3/) with vanadium dioxide (VO/sub 2/) at 1400/sup 0/C and 50 kbar and 30 kbar pressures was studied. Quadrivalent vanadium ions were reduced to the trivalent state, erbium vanadate (ErVO/sub 3/) or ytterbium vanadate (YbVO/sub 3/) being obtained. The crystal structure of ErVO/sub 3/ obtained at 50 kbar pressure was vaterite-type isostructural with ErBO/sub 3/ belonging to a hexagonal system, and that obtained at 30 kbar calcite-type belonging to a rhombohedral (pseudo-hexagonal) system. In the reaction of Yb/sub 2/O/sub 3/ with VO/sub 2/ at high pressure, a perovskite-type crystal was obtained. The electrical and magnetic properties of the vaterite- and the calcite-type ErVO/sub 3/ were studied.

Sideband-cooling of trapped ytterbium-ions in the microwave regime; Seitenbandkuehlung von gespeicherten Ytterbium-Ionen im Mikrowellenregime

Energy Technology Data Exchange (ETDEWEB)

Scharfenberger, Benedikt J.

2012-12-14

Trapped ions in a Paul trap are at present one of the most promising candidates for Quantum Information Processing (QIP). The technique that is used for this purpose in this experiment was introduced in 2001 by F. Mintert and Ch. Wunderlich. The core of this method is the use of atomic transitions in the radio- or microwave region, while a magnetic field gradient along the trap axis (where the ion chain is situated) lifts the degeneracy of the transition frequencies, such that the ions can be distinguished in frequency space; it also serves for the coupling of internal and external degrees of freedom of the ion chain. This method is called MAGIC (MAgnetic Gradient Induced Coupling). The performance of the measurements required that the apparatus of the experiment, which consists of laser sources, lambdameter, vacuum- and microwave system as well as imaging- and detection-units, had to be assembled and tested, which was an important prerequisite for the successful performance of the here described experiments. For the experiments it is advantageous to prepare the ions in an energetic state close to the motional ground state, which contributes to a reduction of the dephasing of the system while manipulating it with microwaves. By using the sideband-cooling technique to the sub-Doppler regime it is taken advantage of the fact, that ions in a linear trap are in good approximation situated in a harmonic oscillator potential and can therefore only populate discrete vibrational energy levels, whose frequency difference is given by the axial trap frequency {omega}{sub z}. If the system is excited by a microwave, which frequency is detuned from resonance to lower energies by a vibrational quantum, the ion looses one such phonon within each cooling-cycle. When this cycle is driven several times, the average phonon number and thus the temperature of the ion can be reduced efficiently and the ion can be initialized in a state close to the motional ground state. As sideband-cooling-transition two hyperfine-levels of {sup 171}Yb{sup +} were used, addressed with a microwave at about 12.6 GHz. In principle microwave photons do not carry enough momentum to cool down the ions but due to the MAGIC-technique, this is even possible. In this work the parameters relevant for the sideband-cooling process were characterized, including the heat rate that counteracts the cooling. With this, the average phonon number was reduced from about 100 to left angle n right angle 4(4), which is compatible with the motional ground state. For the verification of the successful cooling process two different methods for analysis were used while the results agreed. The work is to the knowledge of the author the first detailed description of sideband-cooling of trapped ions in a static magnetic field gradient in the microwave regime.

Single-mode pumped high air-fill fraction photonic crystal fiber taper for high-power deep-blue supercontinuum sources

DEFF Research Database (Denmark)

Sørensen, Simon Toft; Larsen, Casper; Jakobsen, Christian

2014-01-01

Dispersion control with axially nonuniform photonic crystal fibers (PCFs) permits supercontinuum (SC) generation into the deep-blue from an ytterbium pump laser. In this Letter, we exploit the full degrees of freedom afforded by PCFs to fabricate a fiber with longitudinally increasing air-fill fr...

Self-induced laser line sweeping in double-clad Yb-doped fiber-ring lasers

Czech Academy of Sciences Publication Activity Database

Peterka, Pavel; Navrátil, P.; Maria, J.; Dussardier, B.; Slavík, Radan; Honzátko, Pavel; Kubeček, V.

2012-01-01

Roč. 9, č. 6 (2012), s. 445-450 ISSN 1612-2011 R&D Projects: GA MŠk(CZ) ME10119 Institutional support: RVO:67985882 Keywords : fiber laser * tunable laser * ytterbium Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 7.714, year: 2012

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Well-crystalline structured ZnO nanoparticles with cobalt (Co) and ytterbium (Yb) multiple ions doping were successfully synthesized by the chemical precipitation technique. The structures, optical and magnetic properties of the samples were analysed with X-ray diffraction (XRD), UV–visible spectroscopy and magnetic ...

Leg 179 summary

Digital Repository Service at National Institute of Oceanography (India)

Pettigrew, T.J.; Casey, J.F.; Miller, D.J.; Araki, E.; Boissonnas, R.; Busby, R.; Einaudi, F.; Gerdom, M.; Guo, Z.P.; Hopkins, H.; Myers, G.; Rao, D.G.; Shibata, T.; Thy, P.

and the bit was set aside. We then modified a third bit by welding the concentric arms closed. This bit was tripped to the seafloor and we initiated Hole 1104E. After ~1 hr, we had made ~1.5 m of penetration, but the bit stuck in the hole. We were able to free... the bit with left-hand rotation, indicating that the arms had broken free and were causing the bit to stick. Having exhausted all the bits we had on board for hammer test- ing, and with the promise of delivery of a different bit design in a few days from a...

179 ORIGINAL ARTICLE

African Journals Online (AJOL)

boaz

ABSTRACT. Humoral and cellular mechanisms play roles in immune response to foreign antigens. The present study was designed to determine the T lymphocyte subsets (CD4 + T cells, CD8 + T cells and CD4/CD8 ratio) in the prostate cancer subjects and control subjects. CD4 + T cells ( l/count) and CD8 + T cells ...

179 ORIGINAL ARTICLE

African Journals Online (AJOL)

boaz

été conçue pour déterminer les sous – ensembles de lymphocyte T (CD4 + cellules T, CD8 + cellules T et le rapport CD4/CD8) dans les sujets atteints de cancer de la prostate et sujets témoins. CD4 + cellules T ( l/count) et CD8 + cellules T ont été estimées en utilisant la méthode de cytométrique en flux par Partec tandis ...

Electrically tunable liquid crystal photonic bandgap fiber laser

DEFF Research Database (Denmark)

Olausson, Christina Bjarnal Thulin; Scolari, Lara; Wei, Lei

2010-01-01

We demonstrate electrical tunability of a fiber laser by using a liquid crystal photonic bandgap fiber. Tuning of the laser is achieved by combining the wavelength filtering effect of a liquid crystal photonic bandgap fiber device with an ytterbium-doped photonic crystal fiber. We fabricate an al...

Modeling of Yb3+-sensitized Er3+-doped silica waveguide amplifiers

DEFF Research Database (Denmark)

Lester, Christian; Bjarklev, Anders Overgaard; Rasmussen, Thomas

1995-01-01

A model for Yb3+-sensitized Er3+-doped silica waveguide amplifiers is described and numerically investigated in the small-signal regime. The amplified spontaneous emission in the ytterbium-band and the quenching process between excited erbium ions are included in the model. For pump wavelengths...

Chelating extractants of improved selectivity. Progress report for period November 1, 1977--July 31 1978

International Nuclear Information System (INIS)

Freiser, H.

1978-08-01

During the current contract period, the high susceptibility of lanthanide chelate stability to steric hindrance was confirmed. The increase in coordination number of lanthanides from lanthanum to ytterbium as evidenced from extraction equilibria serves to increase their separability. 8-Quinolinol immobilized on silica can separate lanthanide ions

Rapidly tunable continuous-wave optical parametric oscillator pumped by a fiber laser

NARCIS (Netherlands)

Klein, M.E.; Gross, P.; Boller, Klaus J.; Auerbach, M.; Wessels, P.; Fallnich, C.

2003-01-01

We report on rapid, all-electronically controlled wavelength tuning of a continuous-wave (cw) optical parametric oscillator (OPO) pumped by an ytterbium fiber laser. The OPO is singly resonant for the signal wave and consists of a 40-mm-long periodically poled lithium niobate crystal in a

Watt-level passively Q-switched double-cladding fiber laser based on graphene oxide saturable absorber.

Science.gov (United States)

Yu, Zhenhua; Song, Yanrong; Dong, Xinzheng; Li, Yanlin; Tian, Jinrong; Wang, Yonggang

2013-10-10

A watt-level passively Q-switched ytterbium-doped double-cladding fiber laser with a graphene oxide (GO) absorber was demonstrated. The structure of the GO saturable absorber mirror (GO-SAM) was of the sandwich type. A maximum output power of 1.8 W was obtained around a wavelength of 1044 nm. To the best of our knowledge, this is the highest output power in Q-switched fiber lasers based on a GO saturable absorber. The pure GO was protected from the oxygen in the air so that the damage threshold of the GO-SAM was effectively raised. The gain fiber was a D-shaped ytterbium-doped double-cladding fiber. The pulse repetition rates were tuned from 120 to 215 kHz with pump powers from 3.89 to 7.8 W. The maximum pulse energy was 8.37 μJ at a pulse width of 1.7 μs.

Crystal field effect in YbMnO.sub.3./sub..

Czech Academy of Sciences Publication Activity Database

Diviš, M.; Hölsä, J.; Lastusaari, M.; Litvinchuk, A. P.; Nekvasil, Vladimír

2008-01-01

Roč. 451, 1-2 (2008), s. 662-665 ISSN 0925-8388 R&D Projects: GA AV ČR IAA100100627 Institutional research plan: CEZ:AV0Z10100521 Keywords : ytterbium * manganites * IR spectroscopy * crystal field Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.510, year: 2008

Reflectivity of transient Bragg reflection gratings in fiber laser with laser-wavelength selfsweeping

Czech Academy of Sciences Publication Activity Database

Peterka, Pavel; Honzátko, Pavel; Koška, Pavel; Todorov, Filip; Aubrecht, Jan; Podrazký, Ondřej; Kašík, Ivan

2014-01-01

Roč. 22, č. 24 (2014), s. 30024-30031 ISSN 1094-4087 R&D Projects: GA ČR(CZ) GAP205/11/1840 Institutional support: RVO:67985882 Keywords : Ytterbium-doped fiber * Laser optics * Q switched lasers Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.488, year: 2014

Reflectivity of transient Bragg reflection gratings in fiber laser with laser-wavelength self-sweeping: erratum

Czech Academy of Sciences Publication Activity Database

Peterka, Pavel; Honzátko, Pavel; Koška, Pavel; Todorov, Filip; Aubrecht, Jan; Podrazký, Ondřej; Kašík, Ivan

2016-01-01

Roč. 24, č. 14 (2016), s. 16222-16223 ISSN 1094-4087 R&D Projects: GA ČR(CZ) GA16-13306S Institutional support: RVO:67985882 Keywords : Ytterbium-doped fiber * Laser optics * Q switched lasers Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.307, year: 2016

High average power supercontinuum sources

Indian Academy of Sciences (India)

The physical mechanisms and basic experimental techniques for the creation of high average spectral power supercontinuum sources is briefly reviewed. We focus on the use of high-power ytterbium-doped fibre lasers as pump sources, and the use of highly nonlinear photonic crystal fibres as the nonlinear medium.

Resonance journal of science education

Indian Academy of Sciences (India)

Photograph of laser-cooled cloud of ytterbium atoms taken with a CCD camera. The inven- tors of the CCD sensor shared the 2009 Nobel. Prize in Physics. See page 732. (Courtesy: Atomic and Optical Physics Lab, IISc). Ferdinand Freudenstein. (1926–2006). ( Illustration: Subhankar Biswas ). Front Cover. Back Cover. 681.

Tm-Yb Doped Optical Fiber Performance with Variation of Host-Glass Composition

Directory of Open Access Journals (Sweden)

Anirban Dhar

2014-01-01

Full Text Available The fabrication process of Thulium-Ytterbium doped optical fiber comprising different host glass through the Modified Chemical Vapor Deposition (MCVD coupled with solution doping technique is presented. The material and optical performance of different fibers are compared with special emphasis on their lasing efficiency for 2 µm application.

Luminescent converter of neodymium laser radiation

International Nuclear Information System (INIS)

Ryba-Romanowski, W.; Golab, S.

1992-01-01

The new luminescent converter of neodymium laser radiation has been worked out. Activated inorganic compounds of ytterbium and erbium ions has been used as luminescent agent. The multi-component inorganic glass containing tellurium oxide as well as boron, sodium, magnesium and zinc oxides has been applied as a converter matrix

High-power picosecond pulse delivery through hollow core photonic band gap fibers

DEFF Research Database (Denmark)

Michieletto, Mattia; Johansen, Mette Marie; Lyngsø, Jens Kristian

2016-01-01

We demonstrated robust and bend insensitive fiber delivery of high power laser with diffraction limited beam quality for two different kinds of hollow core band gap fibers. The light source for this experiment consists of ytterbium-doped double clad fiber aeroGAIN-ROD-PM85 in a high power amplifier...

1018 nm Yb-doped high-power fiber laser pumped by broadband pump sources around 915 nm with output power above 100 W

DEFF Research Database (Denmark)

Midilli, Yakup; Efunbajo, Oyewole Benjamin; Şimşek, Bartu

2017-01-01

laser were also addressed in this study. Finally, we have tested this system for high power experimentation and obtained 67% maximum optical-to-optical efficiency at an approximately 110 W output power level. To the best of our knowledge, this is the first 1018 nm ytterbium-doped all-fiber laser pumped...

Effect of long- and short-term exposure to laser light at 1070 nm on growth of Saccharomyces cerevisiae

DEFF Research Database (Denmark)

Aabo, Thomas; Perch-Nielsen, Ivan R.; Dam, Jeppe Seidelin

2010-01-01

The effect of a 1070-nm continuous and pulsed wave ytterbium fiber laser on the growth of Saccharomyces cerevisiae single cells is investigated over a time span of 4 to 5 h. The cells are subjected to optical traps consisting of two counterpropagating plane wave beams with a uniform flux along th...

Optical properties of ion beam modified waveguide materials doped with erbium and silver

NARCIS (Netherlands)

Strohhöfer, C. (Christof)

2001-01-01

In the first part of this thesis we investigate codoping of erbium-doped waveguide materials with different ions in order to increase the efficiency of erbium-doped optical amplifiers. Codoping with ytterbium can overcome the limitations due to the small absorption cross section of Er3+ in Al2O3 at

Millijoule Pulse Energy Second Harmonic Generation With Single-Stage Photonic Bandgap Rod Fiber Laser

DEFF Research Database (Denmark)

Laurila, Marko; Saby, Julien; Alkeskjold, Thomas Tanggaard

2011-01-01

In this paper, we demonstrate, for the first time, a single-stage Q-switched single-mode (SM) ytterbium-doped rod fiber laser delivering record breaking pulse energies at visible and UV light. We use a photonic bandgap rod fiber with a mode field diameter of 59μm based on a new distributed...

XAFS studies of ytterbium doped lead-telluride

International Nuclear Information System (INIS)

Radisavljevic, I.; Novakovic, N.; Romcevic, N.; Manasijevic, M.; Mahnke, H.-E.; Ivanovic, N.

2010-01-01

X-ray Absorption Fine Structure (XAFS) measurements were performed on uniformly doped PbTe:Yb (1.3 at.%) at all elemental absorption edges and the analysis of the results has provided precise information on the local structure around each atom. From the near edge part of the absorption spectra it was determined that Yb is in the mixed valent state, which is predominantly divalent with a small trivalent contribution. The analysis of the high energy region of the absorption spectra revealed that Yb incorporation causes deformation of the host PbTe lattice, manifested through extension of all the nearest-, and next-nearest neighbour distances.

Efficient diode pumped ytterbium-doped fibre laser

Czech Academy of Sciences Publication Activity Database

Harun, S.W.; Paul, M.C.; Moghaddam, M.R.A.; Das, S.; Sen, R.; Dhar, Anirban; Pal, M.; Bhadra, S.K.; Ahmad, H.

2010-01-01

Roč. 46, č. 1 (2010), s. 68-69 ISSN 0013-5194 Institutional research plan: CEZ:AV0Z20670512 Keywords : Fibre lasers * Oscillator * Diode-pumped Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.001, year: 2010

Radiation Effects on Ytterbium-doped Optical Fibers

Science.gov (United States)

2014-06-02

conducted on Er- doped fiber amplifiers (Lezius, et al., 2012; Ahrens, et al., 1999; Ahrens, Jaques , LuValle, DiGiovanni, & Windeler, 2001; Ott, 2004...Ahrens, R. G., Abate, J. A., Jaques , J. J., Presby, H. M., Fields, A. B., DiGiovanni, D. J., LuValle, M. J. (1999). Radiation reliability of rare... Jaques , J. J., LuValle, M. J., DiGiovanni, D. J., & Windeler, R. S. (2001). Radiation effects on optical fibers and amplifiers. Testing, Reliability

Cathodoluminescence study of ytterbium doped GaSb

International Nuclear Information System (INIS)

Hidalgo, P.; Mendez, B.; Ruiz, C.; Bermudez, V.; Piqueras, J.; Dieguez, E.

2005-01-01

Yb-doped GaSb ingots have been grown by the Bridgman method. The defect structure and compositional homogeneity of the crystals have been investigated by cathodoluminescence and X-ray microanalysis in the scanning electron microscope. The nature of the point defects has been found to depend on the position along the growth axis. Doping with Yb has been found to reduce the luminescence intensity of GaSb and no infrared emission related to intra-ionic transitions of the Yb 3+ ions has been detected

Ytterbium-Phosphate Glass for Microstructured Fiber Laser

Directory of Open Access Journals (Sweden)

Ryszard Stępień

2014-06-01

Full Text Available In the paper, we report on the development of a synthesis and melting method of phosphate glasses designed for active microstructured fiber manufacturing. Non-doped glass synthesized in a P2O5-Al2O3-BaO-ZnO-MgO-Na2O oxide system served as the matrix material; meanwhile, the glass was doped with 6 mol% (18 wt% of Yb2O3, as fiber core. The glasses were well-fitted in relation to optical (refractive index and thermal proprieties (thermal expansion coefficient, rheology. The fiber with the Yb3+-doped core, with a wide internal photonic microstructure for a laser pump, as well as with a high relative hole size in the photonic outer air-cladding, was produced. The laser built on the basis of this fiber enabled achieving 8.07 W of output power with 20.5% slope efficiency against the launched pump power, in single-mode operation M2 = 1.59, from a 53 cm-long cavity.

Pump radiation distribution in multi-element first cladding laser fibres

International Nuclear Information System (INIS)

Mel'kumov, Mikhail A; Bufetov, Igor' A; Bubnov, M M; Shubin, Aleksei V; Semenov, S L; Dianov, Evgenii M

2005-01-01

Pump radiation transfer is studied experimentally in multi-element first cladding laser fibres. A model of this process is proposed, which is in good agreement with experimental results. An all-fibre single-mode cw ytterbium laser based on a three-element first cladding fibre with an output power of 100W is fabricated. (lasers)

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics. B N Upadhyay. Articles written in Pramana – Journal of Physics. Volume 82 Issue 1 January 2014 pp 143-146 Contributed Papers. Erbium–ytterbium fibre laser emitting more than 13W of power in 1.55 m region · Srikanth Gurram Antony Kuruvilla Rajpal Singh Blacius Ekka ...

ACRT technique for the single crystal growth of the heavy fermion compound YbRh{sub 2}Si{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Witt, Sebastian; Kliemt, Kristin; Butzke, Constantin; Krellner, Cornelius [Goethe University Frankfurt, 60438 Frankfurt am Main (Germany)

2016-07-01

In the heavy fermion compound YbRh{sub 2}Si{sub 2} the antiferromagnetic ordering below 70 mK close to a quantum critical point is well-studied. Beneath the magnetic ordering a new phase transition was found recently at 2 mK. It is necessary to prepare large and high-quality single crystals for studying the nature of this new phase transition. Besides the optimization of the single crystal growth it is important to investigate single crystals with different isotopes at this phase transition. Here, we report the crystal growth of YbRh{sub 2}Si{sub 2} with the accelerated crucible rotation technique (ACRT). ACRT shows for other compounds, e.g. YAG (yttrium aluminum garnet, Y{sub 3}Al{sub 5}O{sub 12}), that this technique can reduce flux impurities and enhance the yield of larger crystals. We also report the attempt to receive metallic isotopes of ytterbium with metallothermic reduction. Crystals with different isotopes of silicon and ytterbium can be used for NMR measurements to investigate the underlying phenomena of quantum criticality in more detail.

Fingermark detection on non-porous and semi-porous surfaces using YVO4:Er,Yb luminescent upconverting particles.

Science.gov (United States)

Ma, Rongliang; Shimmon, Ronald; McDonagh, Andrew; Maynard, Philip; Lennard, Chris; Roux, Claude

2012-04-10

This article describes the use of an anti-Stokes luminescent material (upconverter), yttrium vanadate doped with ytterbium and erbium (YVO(4):Er,Yb), for the development of latent fingermarks on a range of non-porous surfaces. Anti-Stokes luminescent materials emit light at shorter wavelengths than the excitation wavelength. This property is unusual in both natural and artificial materials commonly found as exhibits in forensic science casework. As a result, fingermark detection techniques based on anti-Stokes luminescence are potentially extremely sensitive and selective. Latent fingermarks on non-luminescent and inherently luminescent substrates, including Australian polymer banknotes (a well-known 'difficult' surface), were developed with YVO(4):Er,Yb by dry powder and wet powder techniques. The effectiveness of YVO(4):Er,Yb for fingermark detection was compared with that of cyanoacrylate fuming and of sodium yttrium tetrafluoride doped with ytterbium and erbium (NaYF(4):Er,Yb). The results illustrate some benefit of luminescent up-converting phosphors over traditional luminescence techniques for the detection of latent fingermarks. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

Sythesis of rare earth metal - GIC graphite intercalation compound in molten chloride system

International Nuclear Information System (INIS)

Ito, Masafumi; Hagiwara, Rika; Ito, Yasuhiko

1994-01-01

Graphite intercalation compounds of ytterbium and neodymium have been prepared by interacting graphite and metals in molten chlorides. These rare earth metals can be suspended in molten chlorides in the presence of trichlorides via disproportionation reaction RE(0) + RE(III) = 2RE(II) at lower than 300 degC. Carbides-free compounds are obtained in these systems. (author)

26 CFR 1.179-2 - Limitations on amount subject to section 179 election.

Science.gov (United States)

2010-04-01

... trade or business and interest from working capital of the trade or business. Taxable income derived... aggregate amount of partnership items, deductions and losses are treated as negative income. Any limitation... aggregate amount of S corporation items, deductions and losses are treated as negative income. Any...

Preparation and thermopower of new mischmetal-based partially filled skutterudites Mm yFe4-x(Co/Ni) xSb12

International Nuclear Information System (INIS)

Bourgoin, B.; Berardan, D.; Alleno, E.; Godart, C.; Rouleau, O.; Leroy, E.

2005-01-01

We report on sample preparation and electron probe microanalysis (EPMA) in the series Mm y Fe 4-x (Co/Ni) x Sb 12 with Mm being mischmetal. We show the possibility of preparing mischmetal-based partially filled skutterudites without any segregation of the rare-earths. Room temperature thermopower is similar in mischmetal-based skutterudites to cerium- or ytterbium-based partially filled skutterudites

Test plan for air monitoring during the Cryogenic Retrieval Demonstration

International Nuclear Information System (INIS)

Yokuda, E.

1992-06-01

This report presents a test plan for air monitoring during the Cryogenic Retrieval Demonstration (CRD). Air monitors will be used to sample for the tracer elements neodymium, terbium, and ytterbium, and dysprosium. The results from this air monitoring will be used to determine if the CRD is successful in controlling dust and minimizing contamination. Procedures and equipment specifications for the test are included

High repetition rate, high energy, actively Q-switched all-in-fiber laser

Science.gov (United States)

Lecourt, J. B.; Bertrand, A.; Guillemet, S.; Hernandez, Y.; Giannone, D.

2010-05-01

We report an actively Q-switched Ytterbium-doped all-in-fibre laser delivering 10ns pulses with high repetition rate (from 100kHz to 1MHz). The laser operation has been validated at three different wavelengths (1040, 1050 and 1064nm). The laser can deliver up to 20Watts average power with an high beam quality (M2 = 1).

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

2014-02-14

Feb 14, 2014 ... In this paper we report linearly polarized high average power passive Q-switched ytterbium-doped photonic crystal fibre laser with a Cr4+:YAG crystal as a saturable absorber. An average output power of 9.4 W with pulse duration of 64 ns and pulse repetition rate of 57.4 kHz with a slope efficiency of 52% ...

Journal of Chemical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

The effect of ytterbium substitution at the lanthanum site on the superconducting properties of La1-YbO0.8F0.2FeAs ( = 0.10, 0.20 and 0.30) oxypnictides has been investigated. Powder X-ray diffraction studies show the presence of Yb2O3 and LaOF as secondary phases. The superconducting transition temperature ...

Lifetimes Measurements in 160Yb,162Yb,164Yb,166Yb,168Yb

International Nuclear Information System (INIS)

Araddad, S. Y.; El-barouni, A. M.; Rateb, G. M.; Mosbah, D. S.; Elahrash, M. S.; Sergiwa, S. M.

2004-01-01

From our measurements of the lifetimes of high spin states in 168 Yb along with the published lifetime data for the nearby even even ytterbium isotopes, 160-168 Yb using the Recoil Distance Method (RDM) and the Doppler Shift Attenuation Method (DSAM) present a great opportunity to probe systematically the relationship between the nuclear shape changes and the reduction in collectivity. (authors)

Heavy stable isotope separation by ion cyclotron resonance

International Nuclear Information System (INIS)

Louvet, P.; Compant La Fontaine, A.; Larousse, B.; Patris, M.

1994-01-01

The scientific feasibility of the ion cyclotron resonance process (ICR), as well as the technical one, has been investigated carefully for light metallic elements, whose masses lies between 40 and 100/1,2/. The present work deals mainly with the same demonstration for heavier elements such as ytterbium, gadolinium and barium. Recent results, as well as future prospects, are considered here. (authors)

76 FR 70811 - Notice of Applications for Modification of Special Permit

Science.gov (United States)

2011-11-15

... transportation (NASA) Washington, locations. DC. 14509-M Pacific Consolidated 49 CFR 173.302 To modify the... Alexandria, LA. (a)(2), 173.314, manufacture, marking, 179.100, 179.101, sale and use of three 179.102-3, 179...

DNA studies are necessary for accurate patient diagnosis in compound heterozygosity for Hb Adana (HBA2:c.179>A) with deletional or nondeletional α-thalassaemia.

Science.gov (United States)

Tan, Jin Ai Mary Anne; Kho, Siew Leng; Ngim, Chin Fang; Chua, Kek Heng; Goh, Ai Sim; Yeoh, Seoh Leng; George, Elizabeth

2016-06-08

Haemoglobin (Hb) Adana (HBA2:c.179>A) interacts with deletional and nondeletional α-thalassaemia mutations to produce HbH disorders with varying clinical manifestations from asymptomatic to severe anaemia with significant hepatosplenomegaly. Hb Adana carriers are generally asymptomatic and haemoglobin subtyping is unable to detect this highly unstable α-haemoglobin variant. This study identified 13 patients with compound heterozygosity for Hb Adana with either the 3.7 kb gene deletion (-α(3.7)), Hb Constant Spring (HbCS) (HBA2:c.427T>C) or Hb Paksé (HBA2:429A>T). Multiplex Amplification Refractory Mutation System was used for the detection of five deletional and six nondeletional α-thalassaemia mutations. Duplex-PCR was used to confirm Hb Paksé and HbCS. Results showed 84.6% of the Hb Adana patients were Malays. Using DNA studies, compound heterozygosity for Hb Adana and HbCS (α(codon 59)α/α(CS)α) was confirmed in 11 patients. A novel point in this investigation was that DNA studies confirmed Hb Paksé for the first time in a Malaysian patient (α(codon 59)α/α(Paksé)α) after nine years of being misdiagnosis with Hb Adana and HbCS (α(codon 59)α/α(CS)α). Thus, the reliance on haematology studies and Hb subtyping to detect Hb variants is inadequate in countries where thalassaemia is prevalent and caused by a wide spectrum of mutations.

Decamethylytterbocene Complexes of Bipyridines and Diazabutadienes: Multiconfigurational Ground States and Open-Shell Singlet Formation

Energy Technology Data Exchange (ETDEWEB)

Booth, Corwin H.; Walter, Marc D.; Kazhdan, Daniel; Hu, Yung-Jin; Lukens, Wayne W.; Bauer, Eric D.; Maron, Laurent; Eisenstein, Odile; Andersen, Richard A.

2009-04-22

Partial ytterbium f-orbital occupancy (i.e., intermediate valence) and open-shell singlet formation are established for a variety of bipyridine and diazabutadiene adducts with decamethylytterbocene, (C5Me5)2Yb, abbreviated as Cp*2Yb. Data used to support this claim include ytterbium valence measurements using Yb LIII-edge X-ray absorption near-edge structure spectroscopy, magnetic susceptibility, and complete active space self-consistent field (CASSCF) multiconfigurational calculations, as well as structural measurements compared to density functional theory calculations. The CASSCF calculations indicate that the intermediate valence is the result of a multiconfigurational ground-state wave function that has both an open-shell singlet f13(?*)1, where pi* is the lowest unoccupied molecular orbital of the bipyridine or dpiazabutadiene ligands, and a closed-shell singlet f14 component. A number of other competing theories for the unusual magnetism in these materials are ruled out by the lack of temperature dependence of the measured intermediate valence. These results have implications for understanding chemical bonding not only in organolanthanide complexes but also for f-element chemistry in general, as well as understanding magnetic interactions in nanoparticles and devices.

Decamethylytterbocene complexes of bipyridines and diazabutadines: multiconfigurational ground states and open-shell singlet formation

Energy Technology Data Exchange (ETDEWEB)

Bauer, Eric D [Los Alamos National Laboratory; Booth, C H [LBNL; Walter, M D [LBNL; Kazhdan, D [LBNL; Hu, Y - J [LBNL; Lukens, Wayne [LBNL; Maron, Laurent [INSA TOULOUSE; Eisentein, Odile [UNIV MONTPELLIER 2; Anderson, Richard [LBNL

2009-01-01

Partial ytterbium f-orbital occupancy (i.e. intermediate valence) and open-shell singlet Draft 12/formation are established for a variety of bipyridine and diazabutadiene adducts to decamethylytterbocene, (C{sub 5}Me{sub 5}){sub 2}Yb or Cp*{sub 2}Yb. Data used to support this claim includes ytterbium valence measurements using Yb Lm-edge x-ray absorption near-edge structure (XANES) spectroscopy, magnetic susceptibility and Complete Active Space Self-Consistent Field (CASSCF) multi configurational calculations, as well as structural measurements compared to density-functional theory (DFT) calculations. The CASSCF calculations indicate that the intermediate valence is the result of a multiconfigurational ground state wave function that has both an open-shell singlet f{sup 13} and a closed-shell singlet f{sup 14} component. A number of other competing theories for the unusual magnetism in these materials are ruled out by the presence of intermediate valence and its lack of any significant temperature dependence. These results have implications for understanding chemical bonding not only in organolanthanide complexes, but also for organometallic chemistry in general, as well as understanding magnetic interactions in nanopartic1es and devices.

An IFNG SNP with an estrogen-like response element selectively enhances promoter expression in peripheral but not lamina propria T cells.

Science.gov (United States)

Gonsky, R; Deem, R L; Bream, J H; Young, H A; Targan, S R

2006-07-01

This study examines mucosa-specific regulatory pathways involved in modulation of interferon-gamma (IFN-gamma) in lamina propria T cells. Previous studies identified mucosa-specific CD2 cis-elements within the -204 to -108 bp IFNG promoter. Within this region, a single-site nucleotide polymorphism, -179G/T, imparts tumor necrosis factor-alpha stimulation of IFNG in peripheral blood lymphocytes, and is linked with accelerated AIDS progression. We discovered a putative estrogen response element (ERE) introduced by the -179T, which displays selective activation in peripheral blood mononuclear cells (PBMC) vs lamina propria mononuclear cells (LPMC). Transfection of PBMC with constructs containing the -179G or -179T site revealed CD2-mediated enhancement of the -179T compared to -179G allele, although, in LPMC, a similar level of expression was detected. Electrophoretic mobility shift assay (EMSA) analysis demonstrated CD2-mediated nucleoprotein binding to the -179T but not the -179G in PBMC. In LPMC, binding is constitutive to both -179G and -179T regions. Sequence and EMSA analysis suggests that the -179T allele creates an ERE-like binding site capable of binding recombinant estrogen receptor. Estrogen response element transactivation is enhanced by CD2 signaling, but inhibited by estrogen in PBMC but not in LPMC, although expression of estrogen receptor was similar. This is the first report to describe a potential molecular mechanism responsible for selectively controlling IFN-gamma production in LPMC.

Synthesis and molecular structure of YbI(bipy)(DME)2 complex

International Nuclear Information System (INIS)

Petrovskaya, T.V.; Fedyushkin, I.L.; Nevodchikov, V.I.; Bochkarev, M.N.; Borodina, N.V.; Eremenko, I.L.; Nefedov, S.E.

1998-01-01

The reaction of the ytterbium naphthaline complex [Yb(DME) 2 ] 2 (μ-C 10 H 8 ) with 2,2 ' -bipyridine in DME is found to lead to the formation of the complex with the Yb 2+ atom, YbI(bipy)(DME) 2 (1) containing 2,2 ' -bipyridine radical anion. Complex 1 is characterized by IR and UV spectroscopy, magnetic methods and X-ray analysis [ru

Measurements of 14-MeV neutron cross-sections for the production of isomeric states in hafnium isotopes

International Nuclear Information System (INIS)

Patrick, B.H.; Sowerby, M.G.; Wilkins, C.G.; Russen, L.C.

1990-01-01

The cross sections for the production of isomeric states in the reactions 179 Hf(n,2n) 178m2 Hf, 180 Hf(n,2n) 179m2 Hf, 179 Hf(n,n') 179m2 Hf with 14 MeV neutrons have been measured and compared with the theoretical ones. 4 refs, 3 figs, 4 tabs

Cryogenic Yb: YAG Thin-Disk Laser

Science.gov (United States)

2016-09-09

as a 4- level laser. Its absorption and emission cross-sections increase, and its thermal conductivity improves. Yb:YAG thin disk laser performance...Air Force Base, NM USA 87117 4RINI Technologies, 582 South Econ Circle, Oviedo, FL USA 32765 Keywords: Laser materials; Lasers, ytterbium...temperatures, Yb:YAG behaves as a 4- level laser. Its absorption and emission cross-sections increase, and its thermal conductivity improves. Yb:YAG

Spin noise measurement with diamagnetic atoms

International Nuclear Information System (INIS)

Takeuchi, M.; Ichihara, S.; Takano, T.; Kumakura, M.; Takahashi, Y.

2007-01-01

We report the measurement of the atomic spin noise of the diamagnetic atom ytterbium (Yb). Yb has various merits for utilizing the quantum nature of the atomic spin ensemble compared with the paramagnetic atoms used in all previous experiments. From the magnitude of the noise level and dependence on the detuning, we concluded that we succeeded in the measurement of 171 Yb atomic spin noise in an atomic beam

Synthesis, magnetism and electronic structure of YbNi{sub 2-x}Fe{sub x}Al{sub 8} (x=0.91) isolated from Al flux

Energy Technology Data Exchange (ETDEWEB)

Xiuni, Wu [Department of Physical Sciences, Rhode Island College, Providence, RI 02908 (United States); Francisco, Melanie [Department of Chemistry, Northwestern University, Evanston, IL 60208 (United States); Rak, Zsolt [Department of Physics, Michigan State University, East Lansing, MI 48824 (United States); Bakas, T [Department of Physics, University of Ioannina, GR-45110 Ioannina (Greece); Mahanti, S D [Department of Physics, Michigan State University, East Lansing, MI 48824 (United States); Kanatzidis, Mercouri G. [Department of Chemistry, Northwestern University, Evanston, IL 60208 (United States)], E-mail: m-kanatzidis@northwestern.edu

2008-12-15

The combination of ytterbium, nickel, iron in liquid aluminum resulted in the formation of the new intermetallic compound YbNi{sub 2-x}Fe{sub x}Al{sub 8} (x=0.91) which adopts the CaCo{sub 2}Al{sub 8} structure type with a=14.458(3) A, b=12.455(3) A, c=3.9818(8) A and space group Pbam. Its resistivity drops with decreasing temperature, saturating to a constant value at lower temperatures. Above 50 K, the inverse magnetic susceptibility data follows Curie-Weiss Law, with a calculated {mu}{sub eff}=2.19 {mu}{sub B}. Although the observed reduced moment in magnetic susceptibility measurement suggests that the Yb ions in this compound are of mixed-valent nature, ab initio electronic structure calculations within density functional theory using LDA+U approximation give an f{sup 13} configuration in the ground state. - Graphical abstract: The reaction of ytterbium, nickel, iron in aluminum flux gives crystals of the intermetallic compound YbNi{sub 2-x}Fe{sub x}Al{sub 8} (x=0.96) which adopts the CaCo{sub 2}Al{sub 8} structure, ab initio electronic structure calculations within density functional theory using LDA+U approximation suggest an f{sup 13} configuration in the ground state.

27 CFR 24.179 - Sweetening.

Science.gov (United States)

2010-04-01

... than 14 percent by volume. Natural wine containing added wine spirits may be used in the production of specially sweetened natural wine; however, wine spirits may not be added to specially sweetened natural wine... blending wine (including juice or concentrated fruit juice to which wine spirits have been added), in the...

WOOD CELLULOSE ACETATE MEMBRANE 179

African Journals Online (AJOL)

DR. AMINU

2013-06-01

Jun 1, 2013 ... 1988), cosmetics and food additives or pharmaceutical applications (Wellisch .... displaced by sample. Determination of percent α-, β- and γ–cellulose ..... addition, the smaller pore diameter would lead to a greater exclusion of ...

5 CFR 179.202 - Scope.

Science.gov (United States)

2010-01-01

... Social Security Act (42 U.S.C. 301 et seq.); the tariff laws of the United States; or to any case where... submitting a subsequent claim to the General Accounting Office in accordance with procedures established by the General Accounting Office. ...

5 CFR 179.207 - Hearing.

Science.gov (United States)

2010-01-01

... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... explain why the matter cannot be resolved by review of the documentary evidence alone (4 CFR 102.3(c)). (b... official determines that the matter cannot be resolved by review of documentary evidence alone (e.g., when...

9 CFR 381.179 - Registration.

Science.gov (United States)

2010-01-01

... transporting in commerce, or importing, any dead, dying, disabled, or diseased poultry, or parts of the carcasses of any poultry that died otherwise than by slaughter, shall register with the Administrator... which, and all trade names under which he conducts such business. Such persons shall register under this...

5 CFR 179.203 - Definitions.

Science.gov (United States)

2010-01-01

... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... Office of Personnel Management. Paying agency means the agency of the Federal Government which employs... the creditor agency and the paying agency. Payroll office means the payroll office in the paying...

BDML Metadata: 179 [SSBD[Archive

Lifescience Database Archive (English)

Full Text Available NC-SA 0.180 3893011f-0c5c-4575-b7b0-4190000aef5c 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_R13F6.1_040817_01.zip http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_R13F6.1_040817_01.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_...P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/search/3893011f-0c5c-4575-b7b0-4190000aef5c/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-91 ...

32 CFR 179.4 - Policy.

Science.gov (United States)

2010-07-01

..., stakeholder interest) can affect the sequence in which munitions response actions at a specific MRS are funded... review committees, and local stakeholders are offered opportunities to participate in the application of...

32 CFR 179.3 - Definitions.

Science.gov (United States)

2010-07-01

... obscuration-producing items; flame and incendiary-producing items; or soil, water, debris, or other media... components of any item thereof. The term does not include wholly inert items, improvised explosive devices...

Investigations on Ce- and Yb-based intermetallic compounds

International Nuclear Information System (INIS)

Elenbaas, R.A.

1980-01-01

The author describes investigations on a number of cerium- and ytterbium-based intermetallic compounds and alloys, yielding a lot of experimental results which could not always be put in a quantitative picture. All experimental data are consistent with a single-ion behaviour, where the 4f state is more or less modified by the conduction electrons. In the investigated systems several different features of the magnetism of cerium atoms in metals were studied. (Auth.)

Initial crystallographic studies of a small heat-shock protein from Xylella fastidiosa

International Nuclear Information System (INIS)

Tada, Susely F. S.; Saraiva, Antonio Marcos; Lorite, Gabriela S.; Rosselli-Murai, Luciana K.; Pelloso, Alexandre César; Santos, Marcelo Leite dos; Trivella, Daniela B. B.; Cotta, Mônica A.; Souza, Anete Pereira de; Aparicio, Ricardo

2012-01-01

Initial crystallographic studies of the X. fastidiosa small heat-shock protein HSP17.9 are reported. The ORF XF2234 in the Xylella fastidiosa genome was identified as encoding a small heat-shock protein of 17.9 kDa (HSP17.9). HSP17.9 was found as one of the proteins that are induced during X. fastidiosa proliferation and infection in citrus culture. Recombinant HSP17.9 was crystallized and surface atomic force microscopy experiments were conducted with the aim of better characterizing the HSP17.9 crystals. X-ray diffraction data were collected at 2.7 Å resolution. The crystal belonged to space group P4 3 22, with unit-cell parameters a = 68.90, b = 68.90, c = 72.51 Å, and is the first small heat-shock protein to crystallize in this space group

Complete Sequence of p07-406, a 24,179-base-pair plasmid harboring the blaVIM-7 metallo-beta-lactamase gene in a Pseudomonas aeruginosa isolate from the United States.

Science.gov (United States)

Li, Hongyang; Toleman, Mark A; Bennett, Peter M; Jones, Ronald N; Walsh, Timothy R

2008-09-01

An outbreak involving a Pseudomonas aeruginosa strain that was resistant to all tested antimicrobials except polymyxin B occurred in a hospital in Houston, TX. Previous studies on this strain showed that it possesses a novel mobile metallo-beta-lactamase (MBL) gene, designated bla(VIM-7), located on a plasmid (p07-406). Here, we report the complete sequence, annotation, and functional characterization of this plasmid. p07-406 is 24,179 bp in length, and 29 open reading frames were identified related to known or putatively recognized proteins. Analysis of this plasmid showed it to be comprised of four distinct regions: (i) a region of 5,200 bp having a Tn501-like mercuric resistance (mer) transposon upstream of the replication region; (ii) a Tn3-like transposon carrying a truncated integron with a bla(VIM-7) gene and an insertion sequence inserted at the other end of this transposon; (iii) a region of four genes, upstream of the Tn3-like transposon, possessing very high similarity to plasmid pXcB from Xanthomonas campestris pv. citri commonly associated with plants; (iv) a backbone sequence similar to the backbone structure of the IncP group plasmid Rms149, pB10, and R751. This is the first plasmid to be sequenced carrying an MBL gene and highlights the amelioration of DNA segments from disparate origins, most noticeably from plant pathogens.

Single crystal growth of europium and ytterbium based intermetallic ...

Indian Academy of Sciences (India)

The difference between an intermetallic compound and a regular metal (e.g., ... intriguing properties, there have not been any reports of thorough investigations of .... scanning electron microscope (SEM) equipped with an energy dispersive ...

Towards improved measurements of parity violation in atomic ytterbium

Energy Technology Data Exchange (ETDEWEB)

Antypas, D., E-mail: dantypas@uni-mainz.de [Helmholtz-Institut Mainz (Germany); Fabricant, A.; Bougas, L. [Johannes Gutenberg-Universität Mainz, Institut für Physik (Germany); Tsigutkin, K. [ASML (Netherlands); Budker, D. [Helmholtz-Institut Mainz (Germany)

2017-11-15

We report on progress towards performing precision measurements of parity violation in Yb, in which the theoretical prediction for a strong weak-interaction-induced effect in the 6s{sup 2} {sup 1}S{sub 0}→ 5d6s{sup 3}D{sub 1} optical transition at 408 nm has already been confirmed, with a measurement of the effect at the ≈10 % level of accuracy. With a new atomic-beam apparatus offering enhanced sensitivity, we are aiming at precisely determining the parity violation observable in Yb, which will allow us to probe the distributions of neutrons in different isotopes, investigate physics beyond the Standard Model, as well as to study intra-nucleus weak interactions, through an observation of the anapole moment of Yb nuclei with nonzero spin. We present the experimental principle employed to probe atomic parity violation, describe our new apparatus, and discuss the attained experimental sensitivity as well as the methods for characterizing systematics in these measurements.

Theory of Valence Transitions in Ytterbium and Europium Intermetallics

International Nuclear Information System (INIS)

Zlatic, V.; Freericks, J.K.

2001-01-01

The exact solution of the multi-component Falicov-Kimball model in infinite-dimensions is presented and used to discuss a new fixed point of valence fluctuating intermetallics with Yb and Eu ions. In these compounds, temperature, external magnetic field, pressure, or chemical pressure induce a transition between a metallic state with the f-ions in a mixed-valent (non-magnetic) configuration and a semi-metallic state with the f-ions in an integral-valence (paramagnetic) configuration. The zero-field transition occurs at the temperature T V , while the zero-temperature transition sets in at the critical field H c . We present the thermodynamic and dynamic properties of the model for an arbitrary concentration of d- and f -electrons. For large U, we find a MI transition, triggered by the temperature or field- induced change in the f-occupancy. (author)

Aqueous-salt system containing ytterbium nitrate and pyridine nitrate

International Nuclear Information System (INIS)

Zhuravlev, E.F.; Khisaeva, D.A.; Izmajlova, L.V.

1983-01-01

Cross-section method has been used to study solubility in ternary aqueous-salt system Yb(NO 3 ) 3 -C 5 H 5 NxHNO 3 -H 2 0 at 25 and 50 deg C. It is established that the system is characterized by chemical interaction. Congruently soluble compound of Yb(NO 3 ) 3 x2[C 5 H 5 NxHNO 3 ] composition is discovered in the system. Composition of the compound is confirmed by chemical analysis; its infrared spectra are studied. Interplanar distances are determined; derivatogram of the compound is given. The results of the works are compared with analogous investigations of another rare earth nitrates

Contamination of YBCO bulk superconductors by samarium and ytterbium

Czech Academy of Sciences Publication Activity Database

Volochová, D.; Jurek, Karel; Radušovská, M.; Piovarči, S.; Antal, V.; Kováč, J.; Jirsa, Miloš; Diko, P.

2014-01-01

Roč. 496, JAN (2014), s. 14-17 ISSN 0921-4534 Institutional support: RVO:68378271 Keywords : YBCO bulk superconductors * critical temperature * critical current density * peak effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.942, year: 2014

Investigation of adducts of tris-(acetylacetonato)lanthanides with o-phenanthroline and α,α'-dipyridyl by mass spectroscopy

International Nuclear Information System (INIS)

Gavrishchuk, E.M.; Dzyubenko, N.G.; Martynenko, L.I.

1984-01-01

Mass spectra of adducts of tris-acetylacetonates of REE (REE, Ln, M) with O-phenanthroline (Phen) and α, α 1 -dipyridyl (Dipy) are obtained. A scheme of fragmentation is suggested. Peculiarities of dissociative ionization processes for samarium-, europium-thulium-, and ytterbium compounds are shown to be determined by a possibility of changing the oxidation state of a central ion. Energy characteristics of separation of the first and second ligands of compleXes in the entire REE series are compared

A chimeric protein of aluminum-activated malate transporter generated from wheat and Arabidopsis shows enhanced response to trivalent cations.

Science.gov (United States)

Sasaki, Takayuki; Tsuchiya, Yoshiyuki; Ariyoshi, Michiyo; Ryan, Peter R; Yamamoto, Yoko

2016-07-01

TaALMT1 from wheat (Triticum aestivum) and AtALMT1 from Arabidopsis thaliana encode aluminum (Al)-activated malate transporters, which confer acid-soil tolerance by releasing malate from roots. Chimeric proteins from TaALMT1 and AtALMT1 (Ta::At, At::Ta) were previously analyzed in Xenopus laevis oocytes. Those studies showed that Al could activate malate efflux from the Ta::At chimera but not from At::Ta. Here, functions of TaALMT1, AtALMT1 and the chimeric protein Ta::At were compared in cultured tobacco BY-2 cells. We focused on the sensitivity and specificity of their activation by trivalent cations. The activation of malate efflux by Al was at least two-fold greater in the chimera than the native proteins. All proteins were also activated by lanthanides (erbium, ytterbium, gadolinium, and lanthanum), but the chimera again released more malate than TaALMT1 or AtALMT1. In Xenopus oocytes, Al, ytterbium, and erbium activated inward currents from the native TaALMT1 and the chimeric protein, but gadolinium only activated currents from the chimera. Lanthanum inhibited currents from both proteins. These results demonstrated that function of the chimera protein was altered compared to the native proteins and was more responsive to a range of trivalent cations when expressed in plant cells. Copyright © 2016 Elsevier B.V. All rights reserved.

Combustion synthesis and photoluminescence properties of LaAlO{sub 3} nanophosphors doped with Yb{sup 3+} ions

Energy Technology Data Exchange (ETDEWEB)

Dhahri, A. [Laboratoire de Physico-chimie des Matériaux Minéraux et leurs Applications, Centre National des Recherches en Sciences des Matériaux, Technopole de Borj Cedria, B.P. 73, Soliman 8027 (Tunisia); Horchani-Naifer, K., E-mail: karima_horchani@yahoo.com [Laboratoire de Physico-chimie des Matériaux Minéraux et leurs Applications, Centre National des Recherches en Sciences des Matériaux, Technopole de Borj Cedria, B.P. 73, Soliman 8027 (Tunisia); Benedetti, A. [Dipartimento di Scienze Molecolari e Nanosistemi, Università Ca’ Foscari Venezia, Dorsoduro 2137, 30123 Venezia (Italy); Enrichi, F. [CIVEN – Coordinamento Interuniversitario Veneto per le Nanotecnologie, Via Delle Industrie 5, Marghera, Venice 30175 (Italy); Ferid, M. [Laboratoire de Physico-chimie des Matériaux Minéraux et leurs Applications, Centre National des Recherches en Sciences des Matériaux, Technopole de Borj Cedria, B.P. 73, Soliman 8027 (Tunisia)

2014-09-15

Ytterbium doped lanthanum aluminate (LaAlO{sub 3}) nanophosphors have been prepared by a combustion process with glycine as a fuel. The structures of the powders were determined by X-ray diffraction (XRD), the morphology of the annealed materials was observed using scanning electron microscopy (SEM), the average crystalline grain sizes have been determined by transmission electron microscopy (TEM) and photoluminescence properties using fluorescence spectroscopy. Pure LaAlO{sub 3} phase was obtained at 800 °C heated for 4 h, with an average crystal size, as determined by TEM, of 60 nm. Emission spectra and decay times of main luminescence transitions were measured at room temperature. A strong emission is reported at 986 nm from the ({sup 2}F{sub 5/2}→{sup 2}F{sub 7/2}) transition, whose intensity depends on Yb concentration. - Highlights: • Ytterbium doped lanthanum aluminate (LaAlO{sub 3}) nanophosphors have been prepared by a combustion process with glycine as a fuel. • Powders were characterized by DRX, FTIR, TEM and fluorescence spectroscopy. • Pure LaAlO{sub 3} phase was obtained at 800 °C heated for 4 h, with an average crystal size of 60 nm. • A strong emission is reported at 986 nm from the ({sup 2}F{sub 5/2}→{sup 2}F{sub 7/2}) transition, whose intensity depends on Yb concentration.

Improvement of the thermal and thermo-oxidative stability of high-density polyethylene by free radical trapping of rare earth compound

Energy Technology Data Exchange (ETDEWEB)

Ran, Shiya; Zhao, Li; Han, Ligang [Laboratory of Polymer Materials and Engineering, Ningbo Institute of Technology, ZhejiangUniversity, Ningbo, 315100 (China); MOE Key Laboratory of Macromolecular Synthesis and Functionalization, Institute of Polymer Composites, Zhejiang University, Hangzhou, 310027 (China); Guo, Zhenghong, E-mail: guozhenghong@nit.zju.edu.cn [Laboratory of Polymer Materials and Engineering, Ningbo Institute of Technology, ZhejiangUniversity, Ningbo, 315100 (China); Fang, Zhengping [Laboratory of Polymer Materials and Engineering, Ningbo Institute of Technology, ZhejiangUniversity, Ningbo, 315100 (China); MOE Key Laboratory of Macromolecular Synthesis and Functionalization, Institute of Polymer Composites, Zhejiang University, Hangzhou, 310027 (China)

2015-07-20

Highlights: • Polyethylene filled with ytterbium trifluoromethanesulfonate was prepared. • A low Yb loading improved thermal stability of PE obviously by radical trapping. • Yb(OTf){sub 3} is expected to be an efficient thermal stabilizer for the polymer. - Abstract: A kind of rare earth compound, ytterbium trifluoromethanesulfonate (Yb(OTf){sub 3}), was introduced into high-density polyethylene (HDPE) by melt compounding to investigate the effect of Yb(OTf){sub 3} on the thermal and thermo-oxidative stability of HDPE. The results of thermogravimetric (TG) and differential scanning calorimetry (DSC) showed that the addition of Yb(OTf){sub 3} made the thermal degradation temperatures dramatically increased, the oxidative induction time (OIT) extended, and the enthalpy (ΔH{sub d}) reduced. Very low Yb(OTf){sub 3} loading (0.5 wt%) in HDPE could increase the onset degradation temperature in air from 334 to 407 °C, delay the OIT from 11.0 to 24.3 min, and decrease the ΔH{sub d} from 61.0 to 13.0 J/g remarkably. Electron spin resonance spectra (ESR), thermogravimetric analysis coupled to Fourier transform infrared spectroscopy (TGA-FTIR), rheological investigation and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS) indicated that the free radicals-trapping ability of Yb(OTf){sub 3} was responsible for the improved thermal and thermo-oxidative stability.

Organoamido- and aryloxo-lanthanoids. Pt. IV

International Nuclear Information System (INIS)

Deacon, G.B.; Feng, T.; Nickel, S.; Ogden, M.I.

1992-01-01

This study illustrates the capacity of bulky aryl oxide ligands to stabilize low-coordination numbers in lanthanoid complexes, the isolation of the first low-coordinate hydroxo-bridged complex being of particular interest. (Tetrahydrofuran)tis(2,4,6-tri-t-butylphenolato)ytterbium(III) was isolated following oxidation of the aryloxoytterbium(II) complex Yb(Otbp)2(thf)3 with thallium (I) 2,4,6-tri-t-butylphenolate in tetrahydrofuran. A further synthesis was achieved by redox transmetallation between ytterbium metal and thallium(I) aryl oxide in tetrahydrofuran. The X-ray characterization of Yb(Otbp) 3 (thf)(thp=2,4,6-Bu t -3 C 6h2 ) is also presented. An interesting feature of the bond angles of (2).(thf) n is the marked difference between the O(4)-Yb-O(n) and the corresponding O(4')-Yb-O(n) (n=1-3) values. This illustrates the irregularity of the five coordination. Nevertheless, there is similarity between the sums of the O(4)-Yb-O(n) and O(4')-Yb-O(n) angles (333/336 deg). The Yb-O(H)-Yb and HO-Yb-OH angles of (2).(thf) n are larger and smaller, respectively, than those of the organolanthanoid hydroxides. This reflects the weaker bridging (longer bond lengths) of the present complex. 32 refs., 4 tabs., 2 figs

Efficient green and red up-conversion emissions in Er/Yb co-doped TiO{sub 2} nanopowders prepared by hydrothermal-assisted sol–gel process

Energy Technology Data Exchange (ETDEWEB)

Salhi, Rached, E-mail: salhi_rached@yahoo.fr [Laboratoire de chimie industrielle, Ecole Nationale d’ingénieurs de Sfax, Université de Sfax, 3018 Sfax (Tunisia); Deschanvres, Jean-Luc [Laboratoire des Matériaux et du Génie Physique, 3 Parvis Louis Néel, BP 257, 38016 Grenoble (France)

2016-08-15

In this work, erbium and ytterbium co-doped titanium dioxide (Er–Yb:TiO{sub 2}) nanopowders have been successfully prepared by hydrothermal-assisted sol–gel method using supercritical drying of ethyl alcohol and annealing at 500 °C for 1 h. Nanopowders were prepared with fixed 5 mol% Erbium concentration and various Ytterbium concentrations of 5 and 10 mol%. The powders were characterized by studying their structural, morphology and photo-luminescent properties. The annealing treatment at 500 °C was found to enhance the crystallinity of the TiO{sub 2} anatase structure and the upconversion (UC) emission of the nanopowders. UC emissions were investigated under 980 nm excitation, and the Er–Yb:TiO{sub 2} nanopowders exhibited the intense green (520–570 nm) and red (640–690 nm) upconverted emissions of Er ions originating from an efficient Yb–Er energy transfer process. The absolute upconversion quantum yield (UC-QY) of each nanopowders was measured for the UC emissions centered at 525, 550 and 655 nm at varying excitation power densities. UC-QY analysis has revealed that 5 mol% Er–5 mol% Yb:TiO{sub 2} nanopowders possess the highest total quantum yield of 2.8±0.1% with a power density of 16.7 W/cm{sup 2}. These results make these nanopowders promising materials for efficient upconversion in photonic applications.

Development of Ceramic Solid-State Laser Host Material

Science.gov (United States)

Prasad, Narasimha S.; Trivedi, Sudhir; Kutcher, Susan; Wang, Chen-Chia; Kim, Joo-Soo; Hommerich, Uwe; Shukla, Vijay; Sadangi, Rajendra

2009-01-01

Polycrystalline ceramic laser materials are gaining importance in the development of novel diode-pumped solid-state lasers. Compared to single-crystals, ceramic laser materials offer advantages in terms of ease of fabrication, shape, size, and control of dopant concentrations. Recently, we have developed Neodymium doped Yttria (Nd:Y2O3) as a solid-state ceramic laser material. A scalable production method was utilized to make spherical non agglomerated and monodisperse metastable ceramic powders of compositions that were used to fabricate polycrystalline ceramic material components. This processing technique allowed for higher doping concentrations without the segregation problems that are normally encountered in single crystalline growth. We have successfully fabricated undoped and Neodymium doped Yttria material up to 2" in diameter, Ytterbium doped Yttria, and erbium doped Yttria. We are also in the process of developing other sesquioxides such as scandium Oxide (Sc2O3) and Lutesium Oxide (Lu2O3) doped with Ytterbium, erbium and thulium dopants. In this paper, we present our initial results on the material, optical, and spectroscopic properties of the doped and undoped sesquioxide materials. Polycrystalline ceramic lasers have enormous potential applications including remote sensing, chem.-bio detection, and space exploration research. It is also potentially much less expensive to produce ceramic laser materials compared to their single crystalline counterparts because of the shorter fabrication time and the potential for mass production in large sizes.

Design and Development of New Radiopharmaceuticals

Energy Technology Data Exchange (ETDEWEB)

Wagner, Jr., H. N.; Stern, H. S.; Rhodes, B. A.; Reba, R. C.; Hosain, F.; Zolle, I. [Johns Hopkins Medical Institutions, Baltimore, MD (United States)

1969-05-15

The major factors in the design of a new radiopharmaceutical for radioisotope scintigraphy are the photon energy of the radionuclide, the ability to incorporate the radionuclide insuitable chemical and biological form, the radiation dose to the patient, and the cost of production of the radiopharmaceutical. In this laboratory, the radionuclides, indium-113m and ytterbium-169, and technetium-99m, have been incorporated into a variety of radiopharmaceuticals. These include particles suitable for lung and liver studies, chelates for brain and kidney studies, and ionic forms for blood pool imaging. Studies in experimental animals and man indicate that these agents offer certain advantages over previously available radiopharmaceuticals. By providing larger numbers of photons, they permit more precise temporal and spatial resolution. The longer half-life of the tin-113 parent radionuclide from which indium-113m can be eluted makes indium-113m readily available, even at sites distant from the source of production. The tin-indium generator system need be purchased only every five months rather than weekly as in the case of the widely used molybdenum-technetium system. The ytterbium-radionuclide in the chemical form of a chelate is particularly useful as an inexpensive agent that provides high photon yields for renal and brain imaging. The rapid and complete biological excretion results in low radiation dose while the longer physical half-life greatly extends the shelf-life. (author)

A prospective analysis of 179 type 2 superior labrum anterior and posterior repairs: outcomes and factors associated with success and failure.

Science.gov (United States)

Provencher, Matthew T; McCormick, Frank; Dewing, Christopher; McIntire, Sean; Solomon, Daniel

2013-04-01

There is a paucity of type 2 superior labrum anterior and posterior (SLAP) surgical outcomes with prospective data. To prospectively analyze the clinical outcomes of the arthroscopic treatment of type 2 SLAP tears in a young, active patient population, and to determine factors associated with treatment success and failure. Case-control study; Level of evidence, 3. Over a 4-year period, 225 patients with a type 2 SLAP tear were prospectively enrolled. Two sports/shoulder-fellowship-trained orthopaedic surgeons performed repairs with suture anchors and a vertical suture construct. Patients were excluded if they underwent any additional repairs, including rotator cuff repair, labrum repair outside of the SLAP region, biceps tenodesis or tenotomy, or distal clavicle excision. Dependent variables were preoperative and postoperative assessments with the American Shoulder and Elbow Surgeons (ASES), Single Assessment Numeric Evaluation (SANE), and Western Ontario Shoulder Instability (WOSI) scores and independent physical examinations. A failure analysis was conducted to determine factors associated with failure: age, mechanism of injury, preoperative outcome scores, and smoking. Failure was defined as revision surgery, mean ASES score below 70, or an inability to return to sports and work duties, which was assessed statistically with the Student t test and stepwise logarithmic regression. There were 179 of 225 patients who completed the follow-up for the study (80%) at a mean of 40.4 months (range, 26-62 months). The mean preoperative scores (WOSI, 54%; SANE, 50%; ASES, 65) improved postoperatively (WOSI, 82%; SANE, 85%; ASES, 88) (P failure criteria. Fifty patients elected revision surgery. Advanced age within the cohort (>36 years) was the only factor associated with a statistically significant increase in the incidence of failure. Those who were deemed failed had a mean age of 39.2 years (range, 29-45 years) versus those who were deemed healed with a mean age of 29

Construct validity and test–retest reliability of the International Fitness Scale (IFIS in Colombian children and adolescents aged 9–17.9 years: the FUPRECOL study

Directory of Open Access Journals (Sweden)

Robinson Ramírez-Vélez

2017-05-01

Full Text Available Background There is a lack of instruments and studies written in Spanish evaluating physical fitness, impeding the determination of the current status of this important health indicator in the Latin population, especially in Colombia. The aim of the study was two-fold: to examine the validity of the International Fitness Scale (IFIS with a population-based sample of schoolchildren from Bogota, Colombia and to examine the reliability of the IFIS with children and adolescents from Engativa, Colombia. Methods The sample comprised 1,873 Colombian youths (54.5% girls aged 9–17.9 years. We measured their adiposity markers (waist-to-height ratio, skinfold thickness, percentage of body fat and body mass index, blood pressure, lipids profile, fasting glucose, and physical fitness level (self-reported and measured. A validated cardiometabolic risk index score was also used. An age- and sex-matched subsample of 229 schoolchildren who were not originally included in the sample completed the IFIS twice for reliability purposes. Results Our data suggest that both measured and self-reported overall physical fitness levels were inversely associated with percentage of body fat indicators and the cardiometabolic risk index score. Overall, schoolchildren who self-reported “good” or “very good” fitness had better measured fitness levels than those who reported “very poor/poor” fitness (all p < 0.001. The test-retest reliability of the IFIS items was also good, with an average weighted kappa of 0.811. Discussion Our findings suggest that self-reported fitness, as assessed by the IFIS, is a valid, reliable, and health-related measure. Furthermore, it can be a good alternative for future use in large studies with Latin schoolchildren from Colombia.

Ultrafast laser writing of optical waveguides in ceramic Yb:YAG: a study of thermal and non-thermal regimes

Energy Technology Data Exchange (ETDEWEB)

Benayas, A.; Jaque, D. [Universidad Autonoma de Madrid, Departamento de Fisica de Materiales, Madrid (Spain); Silva, W.F.; Jacinto, C. [Universidade Federal de Alagoas, Grupo de Fotonica e Fluidos Complexos, Instituto de Fisica, Maceio, Alagoas (Brazil); Rodenas, A.; Thomsom, R.R.; Psaila, N.D.; Reid, D.T.; Kar, A.K. [Heriot-Watt University, School of Engineering and Physical Sciences, Edinburgh (United Kingdom); Vazquez de Aldana, J. [Universidad de Salamanca, Grupo de Optica, Departamento de Fisica Aplicada, Facultad de Ciencias Fisicas, Salamanca (Spain); Chen, F.; Tan, Y. [Shandong University, School of Physics, Jinan (China); Torchia, G.A. [CONICET-CIC, Centro de Investigaciones Opticas, La Plata (Argentina)

2011-07-15

We report the improvement of ultrafast laser written optical waveguides in Yb:YAG ceramics by tailoring the presence of heat accumulation effects. From a combination of ytterbium micro-luminescence and micro-Raman structural analysis, maps of lattice defects and stress fields have been obtained. We show how laser annealing can strongly reduce the concentration of defects and also reduce compressive stress, leading to an effective 50% reduction in the propagation losses and to more extended and symmetric propagation modes. (orig.)

Casualty Estimation for Nuclear and Radiological Weapons

Science.gov (United States)

2016-06-01

rate 2.69 d β Metal Polonium - 210 210Po Static eliminators 138 d α Metal foil Radium-226 226Ra Brachytherapy - low dose rate 1600 y α Salt...Promethium-147 153Gd Gadolinium-153 169Yb Ytterbium-169 170Tm Thulium-170 192Ir Iridium-192 210Po Polonium - 210 226Ra Radium-226 238Pu Plutonium-238...Brussels: NATO, in development). iv present in a large food irradiator facility, and constitutes about 34.5 kg of 137Cs. To illustrate alternative

Synthesis, properties, and crystal structure of complex Cp2Yb(DAD)

International Nuclear Information System (INIS)

Trifonov, A.A.; Kirillov, E.N.; Bochkarev, M.N.; Shumani, G.; Myule, S.

1999-01-01

Diazadiene complex of trivalent ytterbium Cp 2 Yb(DAD) (1) (DAD = Bu 1 -N CH-CH = N-Bu 1 ) was obtained by three routes: the oxidation of Cp 2 Yb(THF) 2 by diazadiene in tetrahydrofuran (THF), the reaction of Cp 2 YbCl with DAD 2- Na 2 + (2:1), and the reaction of Cp 2 YbCl(THF) with DAD - K + in the 1:1 ratio. Complex 1 was characterized by microanalysis, IR spectroscopy, magnetochemistry, and X-ray structural analysis [ru

Construction work

CERN Multimedia

2004-01-01

Construction work on building 179 will start on the 16th February 2004 and continue until November 2004. The road between buildings 179 and 158 will temporarily become a one way street from Route Democrite towards building 7. The parking places between buildings 179 and 7 will become obsolete. The ISOLDE collaboration would like to apologize for any inconveniences.

Corrected OVJ-179-12-14.indd

African Journals Online (AJOL)

tulyasys

larvae. Reference magnetic stirrer method for pooled sample digestion for detection of Trichinella larvae was used according to EC requirements (EC, Regulation. No. 2075/2005). It is based on digestion of muscle in artificial gastric juice and investigation of the digest for the presence of Trichinella. The artificial gastric juice.

35_173 - 179_BIO 015 Akhilendra

African Journals Online (AJOL)

userpc

population live in small and medium ci ... based development projects should focus ... nges of sustainability viz; lack of basic amenities and facilities, heal ... rds sustainable living environment of Damaturu town in Yobe Sta ... rojects should focus on major areas of water, electricity, housi .... Ministry of Lands and Housing.

Publications | Page 179 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Background: The hospital has quite an important role in reducing IMR and MMR because ... The present study specifically explored and compared the miRNA expression ... South Asian Network for Development and Environmental Economics ...

49 CFR 179.400-25 - Stenciling.

Science.gov (United States)

2010-10-01

... outer jacket, below the tank classification stencil, in letters at least 11/2 inches high, with the... making the replacement, on the outer jacket in letters and figures at least 11/2 inches high. (b) The... inside the tank, in letters and figures at least 11/2 inches high. (d) Both sides of the tank car, in...

14 CFR 17.9 - Protective orders.

Science.gov (United States)

2010-01-01

... a competitive advantage to one or more firms. (b) The terms of the Office of Dispute Resolution for... application shall establish that the applicant is not involved in competitive decisionmaking for any firm that could gain a competitive advantage from access to the protected information and that the applicant will...

General and Robust Strategies for Multifunctional Organic-Inorganic Nanocompositesvia Direct Growth of Monodisperse Nanocrystals Intimately and Permanently Connected with Polymers

Science.gov (United States)

2016-04-21

cells: from complex nanostructure to planar heterojunction ”, Journal of Materials Chemistry A, 2, 5994 (2014). (featured on Cover of Journal of...naphthalenide solution. Trifluoroacetic acid (TFA, 99%), Yttrium(III) oxide (Y2O3, 99.99%), Ytterbium(III) oxide (Yb2O3, 99.9%), Erbium(III) oxide ...Er2O3, ≥99.99%) and Thulium(III) oxide (Tm2O3, 99.9%) were purchased from Sigma-Aldrich and used as received. Gold(III) chloride trihydrate (HAuCl4·3H2O

Influence of Yb{sup 3+} on the structural, dielectric and magnetic properties of Mg{sub 0.7}Co{sub 0.3}Fe{sub 2}O{sub 4} nanocrystallites synthesized via co-precipitation route

Energy Technology Data Exchange (ETDEWEB)

Ejaz, Muhammad [Department of Physics, The Islamia University of Bahawalpur, Bahawalpur 63100 (Pakistan); Mahmood, Azhar [Department of Chemistry, The Islamia University of Bahawalpur, Bahawalpur 63100 (Pakistan); Khan, Muhammad Azhar, E-mail: azhar.khan@iub.edu.pk [Department of Physics, The Islamia University of Bahawalpur, Bahawalpur 63100 (Pakistan); Hussain, Altaf [Department of Physics, The Islamia University of Bahawalpur, Bahawalpur 63100 (Pakistan); Sultan, Amber [Quaid-e-Azam Medical College, Bahawalpur 63100 (Pakistan); Mahmood, Asif [College of Engineering, Department of Chemical Engineering, King Saud University, Riyadh (Saudi Arabia); Chughtai, Adeel Hussain; Ashiq, Muhammad Naeem [Institute of Chemical Sciences, Bahauddin Zakaryia University, Multan 60800 (Pakistan); Warsi, Muhammad Farooq, E-mail: farooq.warsi@iub.edu.pk [Department of Chemistry, The Islamia University of Bahawalpur, Bahawalpur 63100 (Pakistan); Shakir, Imran [Sustainable Energy Technologies (SET) center, College of Engineering, King Saud University, PO-BOX 800, Riyadh 11421 (Saudi Arabia)

2016-04-15

A series of nanostructured ferrites having chemical composition Mg{sub 0.7}Co{sub 0.3}Yb{sub x}Fe{sub 2−x}O{sub 4} (x=0.0–0.08) was prepared by the chemical co-precipitation route. The synthesized samples were characterized by X-ray diffraction (XRD), Thermo-gravimetric analysis (TGA), differential thermal analysis (DTA), vibrating sample magnetometer (VSM) and impedance analyzer. The analysis of XRD patterns confirmed the spinel structure and the crystallite size calculated by Scherer's formula was found in the range of 18–43 nm. The crystallite size was small enough to obtain considerable signal to noise ratio in the recording media. The lattice constant was increased from 8.362 Ǻ to 8.383 Ǻ as the Yb contents were increased in the magnesium-cobalt ferrites. The TGA and DTA were carried out for prepared sample to investigate the thermal decomposition process. Magnetization results obtained from VSM measurements elucidate that the substitution of rare earth ytterbium decreased the saturation magnetization and retentivity. The dielectric properties of the samples were studied at room temperature in the frequency range of 1 MHz to 3 GHz and the samples exhibited the dispersion in high frequency region. The dielectric constant (ε) and dielectric loss (tan δ) were decreased with the increased frequency and ytterbium doping. The dielectric parameters were explained on the basis of space charge distribution. The dielectric and magnetic parameters suggested that these nano-materials are potential candidates for switching and recording media applications. - Graphical abstract: Mg{sub 0.7}Co{sub 0.3}Yb{sub x}Fe{sub 2−x}O{sub 4} nanostructured spinel ferrites were prepared by chemical co-precipitation technique. The crystallite size was found in the range 18–43 nm. The substitutions of rare earth ytterbium decrease the saturation magnetization and retentivity. The dielectric parameters were explained on the basis of space charge distribution. The

Developments in the application of atomic spectroscopy to trace metal analysis

International Nuclear Information System (INIS)

Fuavao, V.A.

1983-01-01

A method is described for the determination of selenium in horse blood by generation, atomization and analysis of the selenium hydride. A pooled horse blood sample which contained 8.8 μg 1 -1 of selenium exhibited a precision of analysis of 4.32% for ten replicate analyses. A study of the sensitivity of nonresonance and resonance lines of ytterbium utilizing microboat and platform atomization was investigated. Increases of at least twofold for all nonresonance lines were observed. Microboat sensitivity fell between that of the wall and the platform. Alternative surfaces of electrothermal atomization atomic absorption spectrophotometry (ETAAS) and the thermodynamic process for atom formation in ETAAS were investigated. Sensitivities for carbide-formation elements such as ytterbium and molybdenum and other noncarbide formation elements were determined by precoating graphite tubes and inserting collars. An improvement in analytical sensitivity and reduction in memory effect compared to commercially available pyrolytic graphite tubes were observed for all except the molybdenum analyte where a depression in analytical sensitivity resulted. The useful lifetime (analysis cycles) of all surfaces (except metal collars) were recorded at 250 to 400 cycles with acceptable and comparable precisions. A method is described for proposing the thermodynamic process in IL655 ETAAS. Appearance temperatures of analytes and free energy were studied and two major pathways were found operative: 1) thermal dissociation of the analyte oxide; 2) carbon reduction of the oxide followed by atomization of the free metal

High-energy fibered amplification for large-scale laser facilities

International Nuclear Information System (INIS)

Lago, L.

2011-01-01

This work concerns the development of a double-clad ytterbium-doped single-mode micro-structured flexible fiber-based amplifier, in the nanosecond, multi-kilohertz and milli-Joule regime, for large-scale laser facilities seeding. We have used a multi-stage master oscillator power amplifier fibered architecture. A numerical model of ytterbium-doped double-clad fiber-based amplification, including amplified spontaneous emission, was developed in order to study the behaviour of such amplifier and to correctly design the experimental set-up. This model was completed by a feed-back algorithm to numerically predict the optimal temporal shape to compensate the gain saturation process. We demonstrated experimental results in good agreement with numerical simulations, with the following performances: 0.5 mJ pulse energy, at a frequency repetition from 1 kHz to 10 kHz, with a narrow bandwidth spectrum centred at 1053 nm wavelength, with 10 ns pulse duration on a perfect super-Gaussian temporal profile, an optical signal-to-noise ratio better than 50 dB and a polarization extinction ratio of 20 dB. We checked that the beam quality was diffraction limited, with an M 2 measurement of 1.1. Moreover, the system can deliver energies up to 1.5 mJ. Then, we took the advantage of such results to amplify chirped pulses. We demonstrated 0.7 mJ pulse energy, with 570 fs duration at 10 kHz repetition frequency. (author) [fr

Densities and apparent molar volumes of HClO4(aq) and Yb(ClO4)3(aq) at elevated temperatures and pressures

International Nuclear Information System (INIS)

Hakin, Andrew W.; Lukacs, Michael J.; Jin Lianliu

2004-01-01

Relative densities have been measured for acidified aqueous solutions of ytterbium perchlorate {Yb(ClO 4 ) 3 } at approximately T=(348.15, 373.15, 398.15, and 423.15) K and p=(10.0, 20.0, and 30.0) MPa over the concentration range 0.01624≤m 2 /(mol · kg -1 ) ≤ 0.2531 using an optically coupled vibrating tube densimeter (OCVTD). Experimental apparent molar volumes have been calculated from the density measurements, and apparent molar volumes for the aqueous perchlorate salt have been calculated using Young's rule. The application of Young's rule requires apparent molar volumes for aqueous perchloric acid (HClO 4 ) solutions over extended temperature and pressure ranges. These values were calculated from densities for aqueous HClO 4 solutions that were measured using the OCVTD at the same temperatures and pressures as those used to investigate the density surface of the acidified aqueous Yb(ClO 4 ) 3 solutions. The temperature, pressure, and composition surfaces of the apparent molar volumes for Yb(ClO 4 ) 3 (aq) and HClO 4 (aq) have been modelled using Pitzer ion-interaction equations. Apparent molar volumes at infinite dilution obtained from these models have been compared to those which can be calculated using the semi-empirical Helgeson, Kirkham, and Flowers equations of state. Values for the apparent molar volume at infinite dilution of the ytterbium trivalent cation have also been calculated using simple additivity principles

Sideband-cooling of trapped ytterbium-ions in the microwave regime

International Nuclear Information System (INIS)

Scharfenberger, Benedikt J.

2012-01-01

Trapped ions in a Paul trap are at present one of the most promising candidates for Quantum Information Processing (QIP). The technique that is used for this purpose in this experiment was introduced in 2001 by F. Mintert and Ch. Wunderlich. The core of this method is the use of atomic transitions in the radio- or microwave region, while a magnetic field gradient along the trap axis (where the ion chain is situated) lifts the degeneracy of the transition frequencies, such that the ions can be distinguished in frequency space; it also serves for the coupling of internal and external degrees of freedom of the ion chain. This method is called MAGIC (MAgnetic Gradient Induced Coupling). The performance of the measurements required that the apparatus of the experiment, which consists of laser sources, lambdameter, vacuum- and microwave system as well as imaging- and detection-units, had to be assembled and tested, which was an important prerequisite for the successful performance of the here described experiments. For the experiments it is advantageous to prepare the ions in an energetic state close to the motional ground state, which contributes to a reduction of the dephasing of the system while manipulating it with microwaves. By using the sideband-cooling technique to the sub-Doppler regime it is taken advantage of the fact, that ions in a linear trap are in good approximation situated in a harmonic oscillator potential and can therefore only populate discrete vibrational energy levels, whose frequency difference is given by the axial trap frequency ω z . If the system is excited by a microwave, which frequency is detuned from resonance to lower energies by a vibrational quantum, the ion looses one such phonon within each cooling-cycle. When this cycle is driven several times, the average phonon number and thus the temperature of the ion can be reduced efficiently and the ion can be initialized in a state close to the motional ground state. As sideband-cooling-transition two hyperfine-levels of 171 Yb + were used, addressed with a microwave at about 12.6 GHz. In principle microwave photons do not carry enough momentum to cool down the ions but due to the MAGIC-technique, this is even possible. In this work the parameters relevant for the sideband-cooling process were characterized, including the heat rate that counteracts the cooling. With this, the average phonon number was reduced from about 100 to left angle n right angle 4(4), which is compatible with the motional ground state. For the verification of the successful cooling process two different methods for analysis were used while the results agreed. The work is to the knowledge of the author the first detailed description of sideband-cooling of trapped ions in a static magnetic field gradient in the microwave regime.

Passively Q-switched ytterbium- and chromium-doped all-fiber laser

Czech Academy of Sciences Publication Activity Database

Dussardier, B.; Maria, J.; Peterka, Pavel

2011-01-01

Roč. 50, č. 25 (2011), E20-E23 ISSN 0003-6935 R&D Projects: GA MŠk(CZ) ME10119 Institutional research plan: CEZ:AV0Z20670512 Keywords : optical fiber * fiber lasers * fiber amplifiers Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.703, year: 2010

Thermo-optical effects in high-power Ytterbium-doped fiber amplifiers

DEFF Research Database (Denmark)

Hansen, Kristian Rymann; Alkeskjold, Thomas Tanggaard; Broeng, Jes

2011-01-01

We investigate the effect of temperature gradients in high-power Yb-doped fiber amplifiers by a numerical beam propagation model, which takes thermal effects into account in a self-consistent way. The thermally induced change in the refractive index of the fiber leads to a thermal lensing effect...

The development of novel Ytterbium fiber lasers and their applications

Science.gov (United States)

Nie, Bai

The aim of my Ph.D. research is to push the fundamental limits holding back the development of novel Yb fiber lasers with high pulse energy and short pulse duration. The purpose of developing these lasers is to use them for important applications such as multiphoton microscopy and laser-induced breakdown spectroscopy. My first project was to develop a short-pulse high-energy ultrafast fiber laser for multiphoton microscopy. To achieve high multiphoton efficiency and depth resolved tissue imaging, ultrashort pulse duration and high pulse energy are required. In order to achieve this, an all-normal dispersion cavity design was adopted. Output performances of the built lasers were investigated by varying several cavity parameters, such as pump laser power, fiber length and intra-cavity spectral filter bandwidth. It was found that the length of the fiber preceding the gain fiber is critical to the laser performance. Generally, the shorter the fiber is, the broader the output spectrum is. The more interesting parameter is the intra-cavity spectral filter bandwidth. Counter intuitively, laser cavities using narrower bandwidth spectral filters generated much broader spectra. It was also found that fiber lasers with very narrow spectral filters produced laser pulses with parabolic profile, which are referred to as self-similar pulses or similaritons. This type of pulse can avoid wave-breaking and is an optimal approach to generate pulses with high pulse energy and ultrashort pulse duration. With a 3nm intra-cavity spectral filter, output pulses with about 20 nJ pulse energy were produced and compressed to about 41 fs full-width-at-half-maximum (FWHM) pulse duration. Due to the loss in the compression device, the peak power of the compressed pulses is about 250 kW. It was the highest peak power generated from a fiber oscillator when this work was published. This laser was used for multiphoton microscopy on living tissues like Drosophila larva and fruit fly wings. Several imaging methods, such as two-photon-excited fluorescence, second harmonic generation, and third harmonic generation, were performed. Not only were single layers of thin tissue imaged, but also depth resolved imaging of thick samples was tested, and three-dimensional image reconstruction was demonstrated. The other project was to develop a simple fiber oscillator for laser-induced breakdown spectroscopy (LIBS). Laser pulses with high energy, high ablation efficiency and low ablation threshold are desirable for this application. We built a fiber laser using up to 200 m long fiber and scaled the output pulse energy up to 450 nJ. This laser was operated in an unusual mode-locking regime and produced noise-like pulses, which have a picosecond long pulse envelope containing multiple irregular femtosecond sub-pulses. This type of pulse was mostly ignored by many earlier researchers. Intra-cavity spectral filters did not affect the laser performance as much as in the similariton lasers and were removed from the laser cavity. Characteristics of our noise-like laser, such as MHz repetition rate, broad spectrum, and picosecond-long pulse envelope containing multiple femtosecond sub-pulses, were found to meet the requirement of an ideal laser source for LIBS. A simple LIBS setup using our laser was demonstrated and atomic emission spectra with very good signal-to-noise ratio were obtained. Composition detection, qualitative concentration determination, and trace detection were also tested. These tests show that our noise-like fiber laser is an ideal laser source for a low-cost and portable LIBS system.

Electrode kinetics of ytterbium (III) in acrylate and crotonate media

Energy Technology Data Exchange (ETDEWEB)

Rao, A L.J.; Singh, M

1982-07-01

The polarographic reduction of Yb(III) in acrylate and crotonate media gives well-defined, diffusion-controlled irreversible waves. The forward rate constant (sub(f,h)Ksup(0)) and transfer coefficient (..cap alpha..) have been calculated by Koutecky's theoretical treatment as extended by Meites and Israel. This has also been made the basis of a method for the determination of Yb(III) in the presence of diverse ions and rare earth ions. Under optimum conditions. Yb(III) in the range 4 x 10/sup -4/ M to 1.6 x 10/sup -3/ M could be successfully determined in various mixtures, using any of the two acids.

Methods radiation protection data sheets for the use radionuclides in unsealed sources

International Nuclear Information System (INIS)

Anon.

1999-01-01

These radiation protection data sheets are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to safety in this field. They contain the essential radiation protection data for the use of radionuclides in unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: bromine 82, cobalt 58, cobalt 60, manganese 54, mercury 197, mercury 203, promethium 147, xenon 133 and ytterbium 169. (O.M.)

The use of voltammetry for determining uranium and associated elements in compounds of nuclear interest

International Nuclear Information System (INIS)

Carvalho, F.M.S. de.

1988-01-01

The determination of uranium and some trace elements found as impurities in nuclear materials by the voltammetric technique using the hanging mercury drop electrode is presented. Emphasis is given to the determination of uranium, of major interest. Europium and ytterbium are simultaneously determined in fractions of individual lanthanides. A procedure for the simultaneous determination of copper, cadmium, nickel and zinc in water, industrial effluents and uranium compounds is discussed. The advantage of the procedure is its simplicity and easiness of execution, with excellent precision and accuracy. (author) [pt

Prototyping of Dental Structures Using Laser Milling

Science.gov (United States)

Andreev, A. O.; Kosenko, M. S.; Petrovskiy, V. N.; Mironov, V. D.

2016-02-01

The results of experimental studies of the effect of an ytterbium fiber laser radiation parameters on processing efficiency and quality of ZrO2 ceramics widely used in stomatology are presented. Laser operating conditions with optimum characteristics for obtaining high quality final surfaces and rapid material removal of dental structures are determined. The ability of forming thin-walled ceramic structures by laser milling technology (a minimum wall thickness of 50 μm) is demonstrated. The examples of three-dimensional dental structures created in computer 3D-models of human teeth using laser milling are shown.

Kondo effect and non-Fermi liquid behavior in metallic glasses containing Yb, Ce, and Sm

Science.gov (United States)

Huang, B.; Yang, Y. F.; Wang, W. H.

2013-04-01

The low temperature properties of metallic glasses containing different concentrations of ytterbium, cerium, and samarium are studied. It is found that the Kondo effect caused by exchange interactions between the conduction and 4f electrons and non-Fermi liquid behavior appear in the strongly disordered alloys. We study the origins for these unique features and demonstrate that the found Kondo effect is inherited from the crystalline counterparts. The results might have significance on investigating the strong electron-electron interaction systems with structural disorder and be helpful for designing new metallic glasses with functional properties.

Extraction of nitrates of lanthanoids (3) of the yttrium group and yttrium (3) by trialkylbenzylammonium nitrate in toluene

International Nuclear Information System (INIS)

Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.

1997-01-01

A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs

Pressure Measurements on a Deforming Surface in Response to an Underwater Explosion in a Water-Filled Aluminum Tube

Directory of Open Access Journals (Sweden)

G. Chambers

2001-01-01

Full Text Available Experiments have been conducted to benchmark DYSMAS computer code calculations for the dynamic interaction of water with cylindrical structures. Small explosive charges were suspended using hypodermic needle tubing inside Al tubes filled with distilled water. Pressures were measured during shock loading by tourmaline crystal, carbon resistor and ytterbium foil gages bonded to the tube using a variety of adhesives. Comparable calculated and measured pressures were obtained for the explosive charges used, with some gages surviving long enough to record results after cavitation with the tube wall.

Neutron activation analysis of the rare earth elements in Nasu hot springs

International Nuclear Information System (INIS)

Ikeda, Nagao; Takahashi, Naruto.

1978-01-01

Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)

Fibre Tip Sensors for Localised Temperature Sensing Based on Rare Earth-Doped Glass Coatings

Directory of Open Access Journals (Sweden)

Erik P. Schartner

2014-11-01

Full Text Available We report the development of a point temperature sensor, based on monitoring upconversion emission from erbium:ytterbium-doped tellurite coatings on the tips of optical fibres. The dip coating technique allows multiple sensors to be fabricated simultaneously, while confining the temperature-sensitive region to a localised region on the end-face of the fibre. The strong response of the rare earth ions to changing temperature allows a resolution of 0.1–0.3 °C to be recorded over the biologically relevant range of temperatures from 23–39 °C.

Collision-induced stimulated photon echoes in ‘strong’ magnetic field

Science.gov (United States)

Reshetov, V. A.

2018-05-01

Collision-induced stimulated photon echoes formed in a gaseous medium on the transition with the angular momentum change Ja=0 → Jb=1 under the action of ‘strong’ longitudinal magnetic field, when the echo pulse becomes unpolarized, are considered with an account of elastic depolarizing collisions. In the case of narrow spectral line the explicit expressions for the echo polarization density matrix and the degree of polarization are obtained. In the case of broad spectral line the results of the numeric calculations reproduce qualitatively the curve obtained in the experiments with ytterbium vapor.

Does increase in the depreciation expensing allowance spur economic growth? Evidence from USA

Directory of Open Access Journals (Sweden)

Xiaoli Yuan

2016-07-01

Full Text Available Despite substantial evidence that economic growth is influenced by taxation, the impact of Section 179 on GDP is unclear. Section 179 of the Internal Revenue Code enacted in 1958 has operated for several decades in the United States. In addition, in late 2010, two congressional acts affecting Section 179 have been passed, i.e. The Tax Relief Act of 2010 and The Small Business Jobs Act of 2010. The essence of these adoptions is to provide incentives for corporate as well as individual taxpayers. However, there are concerns as to the degree of economic growth these adoptions will provide. This research is therefore focused on showing the correlation between these Section 179 deductions, depreciation and economic growth as the Section 179 figures are debated and changed annually. The study suggests that annual increments of capital depreciation deductions will aid corporate growth as well as other variables that affect economic growth in the United States. However, the benefits for small business are lower than for corporations.

The Host Response to a Clinical MDR Mycobacterial Strain Cultured in a Detergent-Free Environment: A Global Transcriptomics Approach.

Science.gov (United States)

Leisching, Gina; Pietersen, Ray-Dean; Mpongoshe, Vuyiseka; van Heerden, Carel; van Helden, Paul; Wiid, Ian; Baker, Bienyameen

2016-01-01

During Mycobacterium tuberculosis (M.tb) infection, the initial interactions between the pathogen and the host cell determines internalization and innate immune response events. It is established that detergents such as Tween alter the mycobacterial cell wall and solubilize various lipids and proteins. The implication of this is significant since induced changes on the cell wall affect macrophage uptake and the immune response to M.tb. Importantly, during transmission between hosts, aerosolized M.tb enters the host in its native form, i.e. in a detergent-free environment, thus in vitro and in vivo studies should mimic this as closely as possible. To this end, we have optimized a procedure for growing and processing detergent-free M.tb and assessed the response of murine macrophages (BMDM) infected with multi drug-resistant M.tb (R179 Beijing 220 clinical isolate) using RNAseq. We compared the effects of the host response to M.tb cultured under standard laboratory conditions (Tween 80 containing medium -R179T), or in detergent-free medium (R179NT). RNAseq comparisons reveal 2651 differentially expressed genes in BMDMs infected with R179T M.tb vs. BMDMs infected with R179NT M.tb. A range of differentially expressed genes involved in BMDM receptor interaction with M.tb (Mrc1, Ifngr1, Tlr9, Fpr1 and Itgax) and pro-inflammatory cytokines/chemokines (Il6, Il1b, Tnf, Ccl5 and Cxcl14) were selected for analysis through qPCR. BMDMs infected with R179NT stimulate a robust inflammatory response. Interestingly, R179NT M.tb induce transcription of Fpr1, a receptor which detects bacterial formyl peptides and initiates a myriad of immune responses. Additionally we show that the host components Cxcl14, with an unknown role in M.tb infection, and Tlr9, an emerging role player, are only stimulated by infection with R179NT M.tb. Taken together, our results suggest that the host response differs significantly in response to Tween 80 cultured M.tb and should therefore not be used in

Browse Title Index

African Journals Online (AJOL)

Items 151 - 179 of 179 ... Journal of Community Medicine and Primary Health Care. ... Socio-demographic determinants of cigarette smoking among ... a community based health screening program in Lagos, Nigeria ... S.O Osasona, E Uwadiae.

CT Image Contrast of High-Z Elements: Phantom Imaging Studies and Clinical Implications.

Science.gov (United States)

FitzGerald, Paul F; Colborn, Robert E; Edic, Peter M; Lambert, Jack W; Torres, Andrew S; Bonitatibus, Peter J; Yeh, Benjamin M

2016-03-01

To quantify the computed tomographic (CT) image contrast produced by potentially useful contrast material elements in clinically relevant imaging conditions. Equal mass concentrations (grams of active element per milliliter of solution) of seven radiodense elements, including iodine, barium, gadolinium, tantalum, ytterbium, gold, and bismuth, were formulated as compounds in aqueous solutions. The compounds were chosen such that the active element dominated the x-ray attenuation of the solution. The solutions were imaged within a modified 32-cm CT dose index phantom at 80, 100, 120, and 140 kVp at CT. To simulate larger body sizes, 0.2-, 0.5-, and 1.0-mm-thick copper filters were applied. CT image contrast was measured and corrected for measured concentrations and presence of chlorine in some compounds. Each element tested provided higher image contrast than iodine at some tube potential levels. Over the range of tube potentials that are clinically practical for average-sized and larger adults-that is, 100 kVp and higher-barium, gadolinium, ytterbium, and tantalum provided consistently increased image contrast compared with iodine, respectively demonstrating 39%, 56%, 34%, and 24% increases at 100 kVp; 39%, 66%, 53%, and 46% increases at 120 kVp; and 40%, 72%, 65%, and 60% increases at 140 kVp, with no added x-ray filter. The consistently high image contrast produced with 100-140 kVp by tantalum compared with bismuth and iodine at equal mass concentration suggests that tantalum could potentially be favorable for use as a clinical CT contrast agent.

Investigating the evolution of local structure around Er and Yb in ZnO:Er and ZnO:Er, Yb on annealing using X-ray absorption spectroscopy

Science.gov (United States)

Anjana, R.; Jayaraj, M. K.; Yadav, A. K.; Jha, S. N.; Bhattacharyya, D.

2018-04-01

The local structure around Er and Yb centre in ZnO favouring upconversion luminescence was studied using EXAFS (Extended X-ray absorption fine structure spectroscopy). Due to the ionic radii difference between Zn and Er, Yb ions, the dopants cannot replace Zn in the ZnO lattice properly. Er2O3 and Yb2O3 impurity phases are formed at the grain boundaries of ZnO. It is found that the local structure around the Er centre in ZnO is modified on annealing in air. The symmetry around both erbium and ytterbium reduces with increase in annealing temperature. Symmetry reduction will favour the intra-4f transition and the energy transitions causing upconversion luminescence. By fitting the EXAFS data with theoretically simulated data, it is found that the Er centre forms a local structure similar to C4ν symmetry which is a distorted octahedron. On annealing the sample to 1200 °C, all the erbium centres are transformed to C4ν symmetry causing enhanced upconversion emission. Yb centre has also been modified on annealing. The decrease in co-ordination number with annealing temperature will decrease the symmetry and increase the near infrared absorption cross section. The decrease in symmetry around both the erbium and ytterbium centre and formation of C4ν symmetry around Er centre is the reason behind the activation of upconversion luminescence with high temperature annealing in both Er doped and Er, Yb co-doped ZnO samples. The study will be useful for the synthesis of high efficiency upconversion materials.

Densities and apparent molar volumes of HClO{sub 4}(aq) and Yb(ClO{sub 4}){sub 3}(aq) at elevated temperatures and pressures

Energy Technology Data Exchange (ETDEWEB)

Hakin, Andrew W. E-mail: hakin@uleth.ca; Lukacs, Michael J.; Jin Lianliu

2004-09-01

Relative densities have been measured for acidified aqueous solutions of ytterbium perchlorate {l_brace}Yb(ClO{sub 4}){sub 3}{r_brace} at approximately T=(348.15, 373.15, 398.15, and 423.15) K and p=(10.0, 20.0, and 30.0) MPa over the concentration range 0.01624{<=}m{sub 2}/(mol {center_dot} kg{sup -1}) {<=} 0.2531 using an optically coupled vibrating tube densimeter (OCVTD). Experimental apparent molar volumes have been calculated from the density measurements, and apparent molar volumes for the aqueous perchlorate salt have been calculated using Young's rule. The application of Young's rule requires apparent molar volumes for aqueous perchloric acid (HClO{sub 4}) solutions over extended temperature and pressure ranges. These values were calculated from densities for aqueous HClO{sub 4} solutions that were measured using the OCVTD at the same temperatures and pressures as those used to investigate the density surface of the acidified aqueous Yb(ClO{sub 4}){sub 3} solutions. The temperature, pressure, and composition surfaces of the apparent molar volumes for Yb(ClO{sub 4}){sub 3}(aq) and HClO{sub 4}(aq) have been modelled using Pitzer ion-interaction equations. Apparent molar volumes at infinite dilution obtained from these models have been compared to those which can be calculated using the semi-empirical Helgeson, Kirkham, and Flowers equations of state. Values for the apparent molar volume at infinite dilution of the ytterbium trivalent cation have also been calculated using simple additivity principles.

Striving towards improved Friedel-Crafts acylation catalysts

International Nuclear Information System (INIS)

Scott, N.M.; Deacon, G.B.

1998-01-01

Full text: Lanthanum, ytterbium and scandium salts of trifluoromethanesulfonic acid have been shown to act as promising Lewis acid catalysts for the Friedel-Craft acylation reactions. In our study catalytic acylation of anisole by acetic anhydride in nitroethane was investigated. Yields were determined after extraction of para-methoxyacetophenone from the reaction mixture by G.L.C using the external standardisation method. Anhydrous lanthanoid tris-triflate salts [Ln(O 3 SCF 3 ) 3 , Ln La, Y, Nd, Eu and Yb] were initially investigated as catalysts. Ytterbium tris-triflate was found to be the most effective giving ∼90% of the acylation product. The hydrated lanthanide tris-nitrate salts [Ln(NO 3 ) 3 .nH 2 O, Ln = La, Nd, Eu and Yb] were also investigated using in situ dehydration with acetic anhydride. These were found to have low solubility in the reaction mixture and gave poor yields of para-methoxyacetophenone. The formation of side products was suggested by the low total recovery of anisole and para-methoxyacetophenone. The blocking of coordination sites of these catalysts by tetraglyme resulted in a 50% reduction in acylation activity compared with the simple salt. Addition of Li(O 3 SCF 3 ) to Ln(O 3 SCF 3 ) 3 catalysts (ratio of 4:1)had only a slight accelerating effect on the Friedel-Crafts acylation reaction and the yield was only marginally greater than that in the absence of the added salt. In contrast Li(ClO 4 ) dramatically decreased reaction times and improved the yield of para-methoxyace-tophenone, as recently reported

Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP

International Nuclear Information System (INIS)

Silva, Giovana Pasqualini da

2008-01-01

The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

The high-spin {sup 178m2}Hf isomer: production, chemical and isotopic separations, gamma spectrometry and internal conversion electrons spectrometry; L`isomere de haut spin {sup 178m2}Hf: production, separations chimiques et isotopiques, spectrometrie gamma et spectrometrie d`electrons de conversion interne

Energy Technology Data Exchange (ETDEWEB)

Kim, J B

1993-10-13

The high-spin isometric state of the nucleus 178Hf is a challenge for new and exotic nuclear physics studies. With its long half-life of 31 years, the production of a reasonable micro-weight quantity, with an isometric to ground state ratio as high as 5 per cent, is now regularly performed by intensive irradiations of ytterbium targets with helium ions of 36 MeV. Using sur-enriched, at 99,998 per cent, ytterbium 176 that we have prepared at the PARIS mass separator, the isomer purity has been improved. Targets of such material but also of enriched stable isotopes of hafnium have been prepared by electro-spraying of methanolic and acetic solutions. By inelastic diffusion of protons and deuton on these targets, the energy of the first state of the rotation band built on the isomer has been measured. Isotopic separations of the isomer have been performed, with a yield greater than 20 per cent, by the use of isotopically pure hafnium 176 as carrier. The separated beam of the mass 178 allowed to record the complete hyperfine spectrum of the isomer and to measure, for the first time, the magnetic dipole moment and the electric quadrupole moment. Isomer targets, implanted in various materials like copper, iron and hafnium monocrystal, provide the opportunity to accurately measure gamma and internal conversion decay of this nuclei and so to precise the multipolarity mixing of all transitions from K=16{sup +} to K=8{sup -}. (author). 49 refs., 47 figs., 11 tabs.

Radially polarized and passively Q-switched Yb-doped fiber laser based on intracavity birefringent mode discrimination

Science.gov (United States)

Sun, Xuehuan; Wu, Yongxiao; Chen, Sanbin; Li, Jianlang

2018-05-01

In this paper, we demonstrated a passive Q-switched ytterbium-doped fiber laser with radially polarized beam emission by using a c-cut YVO4 birefringent crystal as the intracavity polarization discriminator, and a Cr4+:YAG crystal as the saturable absorber and output coupler. The maximum averaged laser power reached 3.89 W with a high slope efficiency of 66.5%. The laser pulse had a peak power of 161 W, 160 ns duration, and 151 kHz repetition rate at the absorbed pump power of 6.48 W. Such a radially polarized pulse would facilitate numerous applications.

Synthesis, characterization and reactivity of some lanthanide organometallics

International Nuclear Information System (INIS)

Marchal, N.

1991-12-01

Organo lanthanides with reactive metal-carbon bonds are obtained by direct synthesis of the metal (powder) and a hydrocarbon in ether medium, like with alkali metals. Two types of synthesis are envisaged: formation of covalent bonds by opening cycles, only biphenylene is reactive enough in regard to ytterbium and samarium, these organometallic compounds can also be prepared by the classical way, i.e. reaction of 2.2'-dilithio biphenyl on rare earth halogenides and coupling of 6.6-dimethylfulvene leading to dicyclopentadienyl compounds with Sm and Yb. The reactivity of these complexes is studied by catalysis of ethylene polymerization

Mutual solubility between hexane and three-n-butyl phosphate solvates of lanthanide(III) and thorium(IV) nitrates at various temperatures

International Nuclear Information System (INIS)

Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.

2007-01-01

Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru

Knudsen cell vaporization of rare earth nitrides: enthalpy of vaporization of HoN098

International Nuclear Information System (INIS)

Brown, R.C.; Clark, N.J.

1975-01-01

The enthalpy of vaporization of HoN 0 . 98 was measured by the weight-loss Knudsen cell technique using Motzfeldt-Whitman extrapolations to zero orifice area. A third-law enthalpy of vaporization of HoN 0 . 98 of 155.9 +- 5 kcal mole -1 was obtained compared to a second-law value of 162.0 +- 5 kcal mole -1 . Similar measurements on the nitrides of samarium, erbium, and ytterbium gave third-law enthalpies of vaporization of 126.8 +-- 5 kcal mole -1 ; 159.6 +- 5 kcal mole -1 , and 121.0 +- 5 kcal mole -1 , respectively. 7 tables

The role of rare earths in narrow energy gap semiconductors

International Nuclear Information System (INIS)

Partin, D.L.; Heremans, J.; Morelli, D.T.; Thrush, C.M.

1991-01-01

Narrow energy band gap semiconductors are potentially useful for various devices, including infrared detectors and diode lasers. Rare earth elements have been introduced into lead chalcogenide semiconductors using the molecular beam epitaxy growth process. Europium and ytterbium increase the energy band gap, and nearly lattice-matched heterojunctions have been grown. In some cases, valence changes in the rare earth element cause doping of the alloy. In this paper some initial investigations of the addition of europium to indium antimonide are reported, including the variation of lattice parameter and optical transmission with composition and a negative magnetoresistance effect

Spectroscopic characterization of Yb.sup.3+./sup. - doped laser materials at cryogenic temperatures

Czech Academy of Sciences Publication Activity Database

Körner, J.; Jambunathan, Venkatesan; Hein, J.; Seifert, R.; Loeser, M.; Siebold, M.; Schramm, U.; Sikocinski, Pawel; Lucianetti, Antonio; Mocek, Tomáš; Kaluza, M.C.

2014-01-01

Roč. 116, č. 1 (2014), s. 75-81 ISSN 0946-2171 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : ytterbium * YAG * LuAG * CaF2 * FP15-glass * absorption * emission * gain * cross-section * cryogenic temperature Subject RIV: BH - Optics , Masers, Lasers Impact factor: 1.856, year: 2014 http://dx.doi.org/10.1007/s00340-013-5650-8

Cooperative emission in ion implanted Yb:YAG waveguides

Energy Technology Data Exchange (ETDEWEB)

Vazquez, G V; Desirena, H; De la Rosa, E [Centro de Investigaciones en Optica, Loma del Bosque 115, Lomas del Campestre, 37150 Leon, Guanajuato (Mexico); Flores-Romero, E; Rickards, J; Trejo-Luna, R [Instituto de Fisica, UNAM, Apartado Postal 20364, 01000 Mexico, D. F. (Mexico); Marquez, H, E-mail: gvvazquez@cio.mx [Departamento de Optica, CICESE, Km 107 Carr. Tijuana-Ensenada, 22860 Ensenada, B. C. (Mexico)

2011-01-01

In this work, we report the analysis of spectroscopic properties of waveguides fabricated by ion implantation in YAG doped with Yb{sup 3+} ions. Three emission bands were detected in the blue, green and red regions under 970-nm excitation. The strong blue-green emission can be explained by a cooperative process between ytterbium ion pairs, leading to emission centered at 514 nm. The additional blue bands as well as green and red emission bands are attributed to the presence of Tm{sup 3+} and Er{sup 3+} traces. The results include absorption and emission curves as well as decay time rates.

Cooperative emission in ion implanted Yb:YAG waveguides

International Nuclear Information System (INIS)

Vazquez, G V; Desirena, H; De la Rosa, E; Flores-Romero, E; Rickards, J; Trejo-Luna, R; Marquez, H

2011-01-01

In this work, we report the analysis of spectroscopic properties of waveguides fabricated by ion implantation in YAG doped with Yb 3+ ions. Three emission bands were detected in the blue, green and red regions under 970-nm excitation. The strong blue-green emission can be explained by a cooperative process between ytterbium ion pairs, leading to emission centered at 514 nm. The additional blue bands as well as green and red emission bands are attributed to the presence of Tm 3+ and Er 3+ traces. The results include absorption and emission curves as well as decay time rates.

Yb3+ sensitized Tm3+ upconversion in tellurite lead oxide glass.

Science.gov (United States)

Mohanty, Deepak Kumar; Rai, Vineet Kumar; Dwivedi, Y

2012-04-01

Triply ionized thulium/thulium--ytterbium doped/codoped TeO2-Pb3O4 (TPO) glasses have been fabricated by classical quenching method. The upconversion emission spectra in the Tm3+/Tm3+-Yb3+ doped/codoped glasses upon excitation with a diode laser lasing at ∼980 nm has been studied. Effect of the addition of the Yb3+ on the upconversion emission intensity in the visible and near infrared regions of the Tm3+ doped in TPO glass has been studied and the processes involved explored. Copyright © 2011 Elsevier B.V. All rights reserved.

Fiber MOPA based tunable source for terahertz spectroscopy

International Nuclear Information System (INIS)

Malinowski, A; Lin, D; Alam, S U; Zhang, Z; Ibsen, M; Richardson, D J; Young, J; Wright, P; Ozanyan, K; Stringer, M; Miles, R E

2012-01-01

We have developed a terahertz spectrometer based on difference frequency generation of beams from an ytterbium fiber master oscillator power amplifier (MOPA) system. The spectrometer has a resolution of ∼ 2 GHz. It can be tuned rapidly over several hundred GHz, and a wider frequency range can be covered (0.7–2.5 THz demonstrated) by swapping in alternate seed lasers and adjusting the alignment of the beams into the difference frequency generation (DFG) crystal. The system was constructed entirely from commercially available fiber and fiber components. We present some demonstration data on water vapor absorption lines

Impact of buffer gas quenching on the 1S0 → 1P1 ground-state atomic transition in nobelium

International Nuclear Information System (INIS)

Chhetri, P.; Lautenschlaeger, F.; Ackermann, D.; Backe, H.; Lauth, W.; Block, M.; Duellmann, C.E.; Goetz, S.; Cheal, B.; Wraith, C.; Even, J.; Ferrer, R.; Giacoppo, F.; Hessberger, F.P.; Khuyagbaatar, J.; Kishor Mistry, A.; Raeder, S.; Yakushev, A.; Kaleja, O.; Kunz, P.; Laatiaoui, M.; Minaya Ramirez, E.; Walther, T.

2017-01-01

Using the sensitive Radiation Detected Resonance Ionization Spectroscopy (RADRIS) technique an optical transition in neutral nobelium (No, Z = 102) was identified. A remnant signal when delaying the ionizing laser indicated the influence of a strong buffer gas induced de-excitation of the optically populated level. A subsequent investigation of the chemical homologue, ytterbium (Yb, Z = 70), enabled a detailed study of the atomic levels involved in this process, leading to the development of a rate equation model. This paves the way for characterizing resonance ionization spectroscopy (RIS) schemes used in the study of nobelium and beyond, where atomic properties are currently unknown. (authors)

49 CFR 179.7 - Quality assurance program.

Science.gov (United States)

2010-10-01

... means to detect any nonconformity in the manufacturing, repair, inspection, testing, and qualification... nonconformities. (8) Provisions indicating that the requirements of the AAR Specifications for Tank Cars (IBR, see...

179--14 Dec 2009 [Final version].indd

African Journals Online (AJOL)

14 Des 2009 ... Wilber's development theory to show the evolution of consciousness .... van hierdie artikel is sy boek The integral intake: A guide to comprehensive idiographic assessment .... world view, a valuing system, a level of psychological existence, ..... characteristic of mysticism, although the ways that mystics have.

Search Results | Page 179 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... South Asia 440 Apply South Asia filter · Far East Asia 420 Apply Far East Asia filter .... Culture and the Exercise of Decision Making by Women in West Africa ... the issues of reconciliation and justice on the Indian subcontinent after the Partition riot of ... Conservation as a Core Asset for Livelihood Security in East Africa.

49 CFR 179.103-5 - Bottom outlets.

Science.gov (United States)

2010-10-01

.... (a) In addition to or in place of the venting, loading and unloading valves, measuring and sampling... or male and female flange attachment, but in no case shall the breakage groove or equivalent extend... attachment on a pad attached to the outside bottom of the tank. The mounting pad must have a maximum...

49 CFR 179.201-3 - Lined tanks.

Science.gov (United States)

2010-10-01

... having 45° beveled edges. An additional rubber reinforcing pad at least 41/2 feet square and at least 1/2... accomplished and recorded. (c) All rivet heads on inside of tank must be buttonhead, or similar shape, and of...

Gender | Page 179 | IDRC - International Development Research ...

International Development Research Centre (IDRC) Digital Library (Canada)

... et font connaître des solutions pratiques pour la culture des légumineuses à ... Language French ... Language French ... Language French ... Language French ... A project supported by the Canadian International Food Security Research ...

Search Results | Page 179 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Bridging gender gaps with dairy goats and root crops ... There is ample evidence that addressing gender inequalities and empowering women are ... to a reduction in poverty across the country, yet crime and violence have been on the rise.

The Host Response to a Clinical MDR Mycobacterial Strain Cultured in a Detergent-Free Environment: A Global Transcriptomics Approach.

Directory of Open Access Journals (Sweden)

Gina Leisching

Full Text Available During Mycobacterium tuberculosis (M.tb infection, the initial interactions between the pathogen and the host cell determines internalization and innate immune response events. It is established that detergents such as Tween alter the mycobacterial cell wall and solubilize various lipids and proteins. The implication of this is significant since induced changes on the cell wall affect macrophage uptake and the immune response to M.tb. Importantly, during transmission between hosts, aerosolized M.tb enters the host in its native form, i.e. in a detergent-free environment, thus in vitro and in vivo studies should mimic this as closely as possible. To this end, we have optimized a procedure for growing and processing detergent-free M.tb and assessed the response of murine macrophages (BMDM infected with multi drug-resistant M.tb (R179 Beijing 220 clinical isolate using RNAseq. We compared the effects of the host response to M.tb cultured under standard laboratory conditions (Tween 80 containing medium -R179T, or in detergent-free medium (R179NT. RNAseq comparisons reveal 2651 differentially expressed genes in BMDMs infected with R179T M.tb vs. BMDMs infected with R179NT M.tb. A range of differentially expressed genes involved in BMDM receptor interaction with M.tb (Mrc1, Ifngr1, Tlr9, Fpr1 and Itgax and pro-inflammatory cytokines/chemokines (Il6, Il1b, Tnf, Ccl5 and Cxcl14 were selected for analysis through qPCR. BMDMs infected with R179NT stimulate a robust inflammatory response. Interestingly, R179NT M.tb induce transcription of Fpr1, a receptor which detects bacterial formyl peptides and initiates a myriad of immune responses. Additionally we show that the host components Cxcl14, with an unknown role in M.tb infection, and Tlr9, an emerging role player, are only stimulated by infection with R179NT M.tb. Taken together, our results suggest that the host response differs significantly in response to Tween 80 cultured M.tb and should therefore not

Ultracold Mixtures of Rubidium and Ytterbium for Open Quantum System Engineering

Science.gov (United States)

2014-06-01

species can be vanishing. 2.4.1 Miscibility Even at ultracold temperatures , our trapped gasses are very dilute. On the high side of achievable densities...essentially ideal. Therefore, any combination of isotopes will mix at high enough temperatures . Close to degeneracy, miscibility depends on the strength of...bakeout temperature is 200 ◦C, while the braze alloy melts at 305 ◦C. Custom dielectric AR coatings were designed and applied by Spectrum Thin Films

Site-resolved imaging of a bosonic Mott insulator using ytterbium atoms

Science.gov (United States)

Miranda, Martin; Inoue, Ryotaro; Tambo, Naoki; Kozuma, Mikio

2017-10-01

We demonstrate site-resolved imaging of a strongly correlated quantum system without relying on laser cooling techniques during fluorescence imaging. We observe the formation of Mott shells in the insulating regime and realize thermometry in an atomic cloud. This work proves the feasibility of the noncooled approach and opens the door to extending the detection technology to new atomic species.

Diffraction evidence for an FCC in equilibrium HCP transformation in ytterbium

International Nuclear Information System (INIS)

Kayser, F.X.

1971-04-01

X-ray powder patterns obtained from polycrystalline wires of high-purity Yb in several heat treated conditions have demonstrated (i) the existence of a martensitic transformation, β-Yb (fcc) reversible α-Yb(hcp) and (ii) that the hexagonal close-packed structure is the thermodynamically stable form of Yb at temperatures below approximately 270 0 K. Precision lattice parameters determined for both polymorphs at room temperature indicate the fractional volume change on the transformation to be 0.0091, a magnitude that is consistent with the belief that α-Yb is divalent. This can be regarded as a stacking fault transformation, and one wherein the preponderance of the volume change is accommodated by displacements normal to the habit plane

Artificial neural networks and its application in coastal urban development

Digital Repository Service at National Institute of Oceanography (India)

Mandal, S.

stream_size 12 stream_content_type text/plain stream_name AICTE-ISTE_Trg_Prog_Lect_2004_179.pdf.txt stream_source_info AICTE-ISTE_Trg_Prog_Lect_2004_179.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP; Estudo da viabilidade de producao do lutecio - 177 no reator nuclear IEA-R1 do IPEN/CNEN-SP

Energy Technology Data Exchange (ETDEWEB)

Silva, Giovana Pasqualini da

2008-07-01

The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

A chemically selective laser ion source for the on-line isotope separation

International Nuclear Information System (INIS)

Scheerer, F.

1993-03-01

In this thesis a laser ion source is presented. In a hot chamber the atoms of the elements to be studied are resonantly by light of pulsed dye lasers, which are pumped by pulsed copper-vapor lasers with extremely high pulse repetition rate (ν rep ∼ 10 kHz), stepwise excited and ionized. By the storage of the atoms in a hot chamber and the high pulse repetition rate of the copper-vapor lasers beyond the required high efficiency (ε ∼ 10%) can be reached. First preparing measurements were performed at the off-line separator at CERN with the rare earth elements ytterbium and thulium. Starting from the results of these measurements further tests of the laser ion source were performed at the on-line separator with in a thick tantalum target produced neutron-deficient ytterbium isotopes. Under application of a time-of-flight mass spectrometer in Mainz an efficient excitation scheme on the resonance ionization of tin was found. This excitation scheme is condition for an experiment at the GSI for the production of the extremely neutron-deficient, short-lived nucleus 102 Sn. In the summer 1993 is as first application of the newly developed laser ion source at the PSB-ISOLDE at CERN an astrophysically relevant experiment for the nuclear spectroscopy of the neutron-rich silver isotopes 124-129 Ag is planned. This experiment can because of the lacking selectivity of conventional ion sources only be performed by means of the here presented laser ion source. The laser ion source shall at the PSB-ISOLDE 1993 also be applied for the selective ionization of manganese. (orig./HSI) [de

Enhanced-locality fiber-optic two-photon-fluorescence live-brain interrogation

Energy Technology Data Exchange (ETDEWEB)

Fedotov, I. V.; Doronina-Amitonova, L. V. [International Laser Center, Physics Department, M.V. Lomonosov Moscow State University, Moscow 119992 (Russian Federation); Russian Quantum Center, ul. Novaya 100, Skolkovo, Moscow Region 1430125 (Russian Federation); Kurchatov Institute National Research Center, Moscow (Russian Federation); Sidorov-Biryukov, D. A.; Fedotov, A. B. [International Laser Center, Physics Department, M.V. Lomonosov Moscow State University, Moscow 119992 (Russian Federation); Russian Quantum Center, ul. Novaya 100, Skolkovo, Moscow Region 1430125 (Russian Federation); Anokhin, K. V. [Kurchatov Institute National Research Center, Moscow (Russian Federation); P.K. Anokhin Institute of Normal Physiology, Russian Academy of Medical Sciences, Moscow (Russian Federation); Kilin, S. Ya. [B.I. Stepanov Institute of Physics, National Academy of Sciences of Belarus, Minsk (Belarus); Sakoda, K. [National Institute for Materials Science, 1-1 Namiki, Tsukuba 305-0044 (Japan); Zheltikov, A. M. [International Laser Center, Physics Department, M.V. Lomonosov Moscow State University, Moscow 119992 (Russian Federation); Russian Quantum Center, ul. Novaya 100, Skolkovo, Moscow Region 1430125 (Russian Federation); Department of Physics and Astronomy, Texas A and M University, College Station, Texas 77843 (United States); Center of Photochemistry, Russian Academy of Sciences, ul. Novatorov 7a, Moscow 117421 (Russian Federation)

2014-02-24

Two-photon excitation is shown to substantially enhance the locality of fiber-based optical interrogation of strongly scattering biotissues. In our experiments, a high-numerical-aperture, large-core-are fiber probe is used to deliver the 200-fs output of a 100-MHz mode-locked ytterbium fiber laser to samples of live mouse brain, induce two-photon fluorescence of nitrogen–vacancy centers in diamond markers in brain sample. Fiber probes with a high numerical aperture and a large core area are shown to enable locality enhancement in fiber-laser–fiber-probe two-photon brain excitation and interrogation without sacrificing the efficiency of fluorescence response collection.

Spectrophotometric determination of elements of yttrium subgroup in the presence of cerium subgroup with xylenol orange and cetyl pyridinium chloride

International Nuclear Information System (INIS)

Belousova, V.V.; Chernova, R.K.; Sukhova, L.K.

1978-01-01

An effect of 17 cation surfactants of various types on optical properties of complexes of rare earth elements with xylenol orange (XO) has been studied. The ratio between the components in different-ligand complexes of r.e.e. with XO and cetylpyridinium is 1:1:3. The procedure of determining holmium in the presence of cerium and of ytterbium in the presence of praseodymium has been developed. Sodium fluoride has been used as a masking agent. pH value has been maintained equal to 4 (acetate-ammonium buffer). Standard deviation is, on the average, 0.87 for the case of determining Ho and 0.65 for Yb

1-kilowatt CW all-fiber laser oscillator pumped with wavelength-beam-combined diode stacks.

Science.gov (United States)

Xiao, Y; Brunet, F; Kanskar, M; Faucher, M; Wetter, A; Holehouse, N

2012-01-30

We have demonstrated a monolithic cladding-pumped ytterbium-doped single all-fiber laser oscillator generating 1 kW of CW signal power at 1080 nm with 71% slope efficiency and near diffraction-limited beam quality. Fiber components were highly integrated on "spliceless" passive fibers to promote laser efficiency and alleviate non-linear effects. The laser was pumped through a 7:1 pump combiner with seven 200-W 91x nm fiber-pigtailed wavelength-beam-combined diode-stack modules. The signal power of such a single all-fiber laser oscillator showed no evidence of roll-over, and the highest output was limited only by available pump power.

A high power, continuous-wave, single-frequency fiber amplifier at 1091 nm and frequency doubling to 545.5 nm

International Nuclear Information System (INIS)

Stappel, M; Steinborn, R; Kolbe, D; Walz, J

2013-01-01

We present a high power single-frequency ytterbium fiber amplifier system with an output power of 30 W at 1091 nm. The amplifier system consists of two stages, a preamplifier stage in which amplified spontaneous emission is efficiently suppressed (>40 dB) and a high power amplifier with an efficiency of 52%. Two different approaches to frequency doubling are compared. We achieve 8.6 W at 545.5 nm by single-pass frequency doubling in a MgO-doped periodically poled stoichiometric LiTaO 3 crystal and up to 19.3 W at 545.5 nm by frequency doubling with a lithium-triborate crystal in an external enhancement cavity. (paper)

Q-switching and efficient harmonic generation from a single-mode LMA photonic bandgap rod fiber laser

DEFF Research Database (Denmark)

Laurila, Marko; Saby, Julien; Alkeskjold, Thomas T.

2011-01-01

We demonstrate a Single-Mode (SM) Large-Mode-Area (LMA) ytterbium-doped PCF rod fiber laser with stable and close to diffraction limited beam quality with 110W output power. Distributed-Mode-Filtering (DMF) elements integrated in the cladding of the rod fiber provide a robust spatial mode...... with a Mode-Field-Diameter (MFD) of 59 mu m. We further demonstrate high pulse energy Second-Harmonic-Generation (SHG) and Third Harmonic Generation (THG) using a simple Q-switched single-stage rod fiber laser cavity architecture reaching pulse energies up to 1mJ at 515nm and 0.5mJ at 343nm. (C) 2011 Optical...

Effect of thermal lens on beam quality and mode matching in LD pumped Er-Yb-codoped phosphate glass microchip laser

Energy Technology Data Exchange (ETDEWEB)

Liu Shujing; Song Feng; Cai Hong; Li Teng; Tian Bin; Wu Zhaohui; Tian Jianguo [Photonics Center, Nankai University, Tianjin 300071 (China); Key Laboratory of Advanced Technique and Fabrication for Weak-Light Nonlinear Photonics Materials (Ministry of Education), Nankai University, Tianjin 300457 (China)

2008-02-07

The theoretical values of the thermal focal length and laser beam waist are derived from the theoretical model and transformation theory, respectively. The values of thermal focal length, laser beam waist and the far field divergence angle were experimentally measured in a laser diode (LD) pumped erbium-ytterbium(Er-Yb)-codoped phosphate microchip glass laser. As an extension of thermal effect studies, we investigate the role of thermal lens on beam quality and the mode matching between the pump and the laser, which affects laser efficiency in TEM{sub 00} operation. The study shows that the experimental data are in good agreement with the theoretical predictions.

Environmentally stable picosecond Yb fiber laser with low repetition rate

Science.gov (United States)

Baumgartl, M.; Abreu-Afonso, J.; Díez, A.; Rothhardt, M.; Limpert, J.; Tünnermann, A.

2013-04-01

A SESAM-mode-locked, all-polarization-maintaining Ytterbium fiber laser producing picosecond pulses with narrow spectral bandwidth is presented. A simple linear all-fiber cavity without dispersion compensation is realized using a uniform fiber Bragg grating (FBG). Different cavity lengths are investigated and repetition rates down to 0.7 MHz are obtained. Bandwidth and pulse duration of the output pulses are mainly determined by the choice of FBG. Pulses between 30 and 200 ps are generated employing different FBGs with bandwidths between 17 and 96 pm. The experimental results are in good agreement with numerical simulations. The laser holds great potential for simple amplification setups without pulse picking.

Solvation and Ion Pair Association in Aqueous Metal Sulfates: Interpretation of NDIS raw data by isobaric-isothermal molecular dynamics simulation

International Nuclear Information System (INIS)

Chialvo, Ariel A.; Simonson, J. Michael

2010-01-01

We analyzed the solvation behavior of aqueous lithium, nickel, and ytterbium sulfates at ambient conditions in terms of the relevant radial distributions functions and the corresponding first-order difference of the sulfur-site neutron weighted distribution functions generated by isothermal-isobaric molecular dynamics simulation. We determined of the partial contributions to the neutron weighted distribution functions, to identify the main peaks, and the effect of the contact ion-pair configuration on the resulting H-S coordination number. Finally, we assessed the extent of the ion-pair formation according to Poirier-DeLap formalism and highlighted the significant increase of the ion-pair association exhibited by these salts with cation charge.

Palaeoenvironments and facies on a progressively flooded rocky island (Upper Cenomanian – Lower Turonian, Bohemian Cretaceous Basin)

Czech Academy of Sciences Publication Activity Database

Žítt, Jiří; Vodrážka, R.; Hradecká, L.; Svobodová, Marcela

2010-01-01

Roč. 179, - (2010), s. 223-234 ISSN 1802-6842 Institutional research plan: CEZ:AV0Z30130516 Keywords : Cretaceous island * weathering * geomorphology * sedimentary environments * biostratigraphy * Upper Cenomanian-Lower Turonian * Bohemian Cretaceous Basin Subject RIV: DB - Geology ; Mineralogy http://www.nm.cz/publikace/archiv-en.php?id=1&rok=179&f_=Show

Parametric Trajectory Program

Science.gov (United States)

1976-10-01

TULA 444 URITEI6.95) 179 180 49 NWC TP 5864 179 176 ISO + REAO(5.3IO> . NTAB.VKT.QE. \\TEMP.ZT.ZO ^ /CALL EXIT\\ READɝ.311> IX.RIY.UTO.VO...11472. 984. 11514. 966. 11555. 949. 11596. 931. D1ST DRAG 11187. .176 11228. .175 11270. .174 11311. .173 11352 . .172 11393. .171

High-molecular-weight HPMA-based polymer drug carriers for delivery to tumor

Czech Academy of Sciences Publication Activity Database

Kostka, Libor; Etrych, Tomáš

2016-01-01

Roč. 65, Suppl. 2 (2016), S179-S190 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : nanotherapeutics * pH responsive * HPMA copolymers Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S179.pdf

Adsorpce peptidů produkovaných fytoplanktonem na aktivním uhlí

Czech Academy of Sciences Publication Activity Database

Čermáková, Lenka; Pivokonská, Lenka; Kopecká, Ivana; Pivokonský, Martin; Janda, V.

2015-01-01

Roč. 109, č. 3 (2015), s. 176-179 ISSN 0009-2770 R&D Projects: GA ČR GAP105/11/0247 Institutional support: RVO:67985874 Keywords : activated carbon * adsorption * algal organic matter * peptides Subject RIV: DJ - Water Pollution ; Quality Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_03_176-179.pdf

Optical properties of PMMA doped with erbium(III) and ytterbium(III) complexes

Czech Academy of Sciences Publication Activity Database

Prajzler, V.; Huttel, I.; Lyutakov, O.; Oswald, Jiří; Machovič, V.; Jerabek, V.

2009-01-01

Roč. 49, č. 9 (2009), s. 1814-1817 ISSN 0032-3888 Institutional research plan: CEZ:AV0Z10100521 Keywords : polymers * erbium * photoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.248, year: 2009

Efficient high-power narrow-linewidth all-fibred linearly polarized ytterbium laser source

Science.gov (United States)

Bertrand, Anthony; Liégeois, Flavien; Hernandez, Yves; Giannone, Domenico

2012-06-01

We report on experimental results on a high power, all-fibred, linearly polarized, mode-locked laser at 1.03 μm. The laser generates pulses of 40 ps wide at a repetition rate of 52 MHz, exhibiting 12 kW peak power. Dispersion in optical fibres is controlled to obtain both high power and narrow spectral linewidth. The average output power reached is 25 W with a spectral linewidth of 380 pm and a near diffraction limit beam (M2 < 1.2). This laser is an ideal candidate for applications like IR spectroscopy, where high peak power and narrow linewidth are required for subsequent wavelength conversion.

X-ray fluorescence analysis of ytterbium oxide/oxalate for rare earth impurities

International Nuclear Information System (INIS)

Chandola, L.C.; Khanna, P.P.; Thomas, A.

1982-01-01

An XRF method for the determination of Ho, Er, Tm, Lu and Y oxides in Yb 2 O 3 is described. 450 mg sample in the oxalate form is mixed with 150 mg boric acid binding material and pressed into 1.25 inch diameter pellet over a supporting pellet of boric acid. The sample is irradiated by X-rays from a tungsten tube and the fluorescent X-rays are dispersed by a LiF(200) crystal in a Philips PW 1220 semiautomatic X-ray fluorescence spectrometer. The intensities of characteristic X-rays of the impurity elements are measured by a flow proportional counter or a scintillation counter. The lowest determination limit is 0.005% for Ho, Er, Tm and Y and 0.01% for Lu. Calculations for theoretical detection limit, standard deviation and uncertainty are done and presented. (author)

The influence of ytterbium doping on the optical properties of tellurite glasses

Energy Technology Data Exchange (ETDEWEB)

Jaglarz, Janusz; Burtan, Bozena [Institute of Physics, Cracow University of Technology, ul. Podchorazych 1, 30-084 Cracow (Poland); Reben, Manuela; Wasylak, Jan [Faculty of Materials Science and Ceramics, AGH - University of Science and Technology, al. Mickiewicza 30, 30-059 Cracow (Poland); Cisowski, Jan [Institute of Physics, Cracow University of Technology, ul. Podchorazych 1, 30-084 Cracow (Poland); Centre of Polymer and Carbon Materials, Polish Academy of Sciences, ul. M. Curie-Sklodowskiej 34, 41-819 Zabrze (Poland); Jarzabek, Bozena [Centre of Polymer and Carbon Materials, Polish Academy of Sciences, ul. M. Curie-Sklodowskiej 34, 41-819 Zabrze (Poland)

2011-09-15

The goal of this work was to investigate the influence of rare earth ion Yb{sup 3+} doping on the thermal and optical properties of tellurite glass (TG) of the TeO{sub 2}-ZnO-PbO-La{sub 2}O{sub 3} system. The reflectance, transmittance and ellipsometric measurements have been done. Decreasing of the refractive index of TG with the Yb{sup 3+} ion doping has been concluded. For determination of the refractive index variation in the bulk, the small angle light scatter (SALS) measurements have been carried out. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

What we do | Page 179 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Economic Reform, Firm Survival and Competitiveness (Middle East and North Africa). During the 1980s, it was thought that liberalizing trade and exposing industries to competition would result in the loss of some firms but a more productive and competitive industrial sector as a whole. Middle East, North Of Sahara, South Of ...

49 CFR 179.500-14 - Test of tanks.

Science.gov (United States)

2010-10-01

... maintained for 30 seconds, and sufficiently longer to insure complete expansion of tank. Pressure gauge shall permit reading to accuracy of one percent. Expansion gauge shall permit reading of total expansion to... volumetric expansion shall not exceed 10 percent of the total volumetric expansion at test pressure. ...

What we do | Page 179 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Mobile Nav Footer Links ... Mbeubeuss Landfill : a Study of the Impact of Diamalaye II (Malika) on Human Health using an Ecohealth Approach (Sénégal) ... The benefits and value-added of working collaboratively have been demonstrated in ... to identify sustainable opportunities for technology-based businesses in priority ...

What we do | Page 179 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Who we work with ... Central Asia, Far East Asia, South Asia, Cambodia, Sri Lanka, Indonesia, Laos, Pakistan, Philippines. PROJECT. Community Driven Universal Access Solutions in Cambodia : Pilots to Policy Research. In Cambodia new ...

20 CFR 220.179 - Exceptions to medical improvement.

Science.gov (United States)

2010-04-01

... techniques or evalutions will come to the Board's attention by several methods. In reviewing cases, the Board... been made (e.g., the evidence in file such as pulmonary function study values was misread or an... documented by EEG evidence and by a detailed description of a typical seizure pattern. As history of either...

49 CFR 179.400-17 - Inner tank piping.

Science.gov (United States)

2010-10-01

... connected to this line to operate at their design capacity without excessive pressure build-up in the tank... housing and must be directed upward and away from operating personnel. (b) Any pressure building system...-17 Inner tank piping. (a) Product lines. The piping system for vapor and liquid phase transfer and...

29 CFR 1910.179 - Overhead and gantry cranes.

Science.gov (United States)

2010-07-01

... is fed back into the power system. (33) Mechanical means a method of control by friction. (34... recommendation shall be followed. The rated load divided by the number of parts of rope shall not exceed 20... shall be in accordance with the clip manufacturer's recommendation. Clips shall be drop-forged steel in...

49 CFR 179.500-18 - Inspection and reports.

Science.gov (United States)

2010-10-01

... other defects exist. (5) Inspector shall fully verify compliance with specification, verify heat treatment of tank as proper; obtain samples for all tests and check chemical analyses; witness all tests... identified as indicated by the attached list showing the serial number of each tank, followed by the heat...

179 SAME-SEX MARRIAGE, CIVIL MARRIAGE AND COHABITATION

African Journals Online (AJOL)

Fr. Ikenga

However, very little attention is paid to ..... apply for parental responsibility for your Civil Partner's child of the family; inheritance of the tenancy ... insurance for state employees; the availability of family leave benefits; the ability to adopt; the.

21 CFR 133.179 - Pasteurized process cheese spread.

Science.gov (United States)

2010-04-01

..., malt sirup, and hydrolyzed lactose, in a quantity necessary for seasoning. (4) Water. (5) Salt. (6... propionate. (9) Pasteurized process cheese spread in consumer-sized packages may contain lecithin as an...

1935 15' Quad #179 Aerial Photo Mosaic Index

Data.gov (United States)

Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

49 CFR 179.300-16 - Tests of tanks.

Science.gov (United States)

2010-10-01

... air pressure test of at least 100 psig under conditions favorable to detection of any leakage. No... postweld heat treatment, tanks shall be subjected to hydrostatic expansion test in a water jacket, or by...

What we do | Page 179 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

As part of an experimental project, Indian farmers spray mango trees with a hexanal- ... II (Malika) on Human Health using an Ecohealth Approach (Sénégal) ... play in the implementation of development activities that fall to local communities.

40 CFR 763.179 - Confidential business information claims.

Science.gov (United States)

2010-07-01

... is it referred to in advertising or promotional materials for the product or the resulting end... for your product? Consider in your answer such constraints as capital and marketing cost, specialized... used in the manufacturing or processing of a product or information unrelated to the effects of...

Study on preparation of 17'7Lu, labeling with DOTATATE for using in diagnosis and treatment neuroendocrine tumors

International Nuclear Information System (INIS)

Duong Van Dong; Bui Van Cuong; Pham Ngoc Dien; Chu Van Khoa; Mai Phuoc Tho; Nguyen Thi Thu; Vo Thi Cam Hoa

2014-01-01

Due to its physical and chemical characteristics, 177 Lu is a very attractive radionuclide for use in nuclear medicine. Its main usage is in the treatment of neuroendocrine tumours but its applicability in the treatment of colon cancer, metastatic bone cancer, non-Hodgkin lymphoma, lung, ovarian, and prostate cancer, has also been studied. Two alternative production routes are generally applied to obtain 177 Lu, namely the direct route based on neutron irradiation of lutetium targets and the indirect route based on neutron irradiation of ytterbium targets followed by radiochemical separation of 177 Lu from ytterbium isotopes. The comparison of theoretically calculated and experimentally determined yield for 176 Lu(n,γ) 177 Lu reaction is presented. 177 Lu could be produced with a specific activity of 42 mCi/mg by neutron activation using enriched 176 Lu (2.59%) target when irradiation was carried out at Dalat Nuclear Research Reactor with thermal neutron flux of 2x10 13 n.cm -2 .s -1 for 100 hours. The indirect production route as an alternative production route, 177 Lu could be obtained as carrier-free from beta decay of 177 Yb produced by neutron activation of 176 Yb. In this way, enriched target material was used but it may be the neutron capture cross section is only 2.4 barn so resulting in low activity just enough to study the separation process of 177 Lu from 177 Yb. In the other hand the study on labeling 177 Lu with DOTATATE is also described the optimization of the reaction conditions to obtain the complex 177 Lu-DOTATATE with a radiochemical purity > 99%, even so the studies of stability in vitro to the dilution in saline solution during 72 hours. The bio-distribution studies of this product in mice and rabbit are also investigated. (author)

Gold nanorod saturable absorber for passive mode-locking at 1 μm wavelength

International Nuclear Information System (INIS)

Kang, Z; Li, Q; Gao, X J; Jia, Z X; Qin, G S; Qin, W P; Zhang, L; Feng, Y

2014-01-01

Gold nanorods (GNRs) were used as a saturable absorber (SA) for passive mode-locking at 1 μm wavelength. The GNR-SA film was fabricated by mixing GNRs with sodium carboxymethylcellulose. The longitudinal surface plasmon resonance absorption of GNRs was used to induce mode-locking. By using the GNR-SA film, stable passive mode-locking at 1039 nm was experimentally demonstrated in an ytterbium-doped fiber laser cavity pumped by a 980 nm laser diode. The laser produced ∼440 ps pulses with a repetition rate of 36.6 MHz and an average output power of ∼1.25 mW for a pump power of ∼82 mW. (letter)

A 98 W 1178 nm Yb-doped solid-core photonic bandgap fiber oscillator

International Nuclear Information System (INIS)

Fan, Xinyan; Chen, Mingchen; Shirakawa, Akira; Ueda, Ken-ichi; Olausson, Christina B; Broeng, Jes

2013-01-01

A high-power ytterbium-doped solid-core photonic bandgap fiber laser directly oscillating at 1178 nm is reported. The sharp-cut bandpass distributed filtering effect of photonic bandgap fiber can suppress amplified spontaneous emission (ASE) in the conventional high-gain spectral region. The oscillator is composed of a high reflection fiber Bragg grating spliced with a 39 m gain fiber and a Fresnel fiber end surface. A model based on rate equations is investigated numerically. A record output power of 98 W is achieved with a slope efficiency of 54%. The laser linewidth is 0.5 nm. The spectrum at 98 W indicates that ASE and parasitic lasing are suppressed effectively. (letter)

Backward pumping kilowatt Yb3+-doped double-clad fiber laser

Science.gov (United States)

Han, Z. H.; Lin, X. C.; Hou, W.; Yu, H. J.; Zhou, S. Z.; Li, J. M.

2011-09-01

A ytterbium-doped double-clad fiber laser generating up to 1026 W of continuous-wave output power at 1085 nm with a slope efficiency of 74% by single-ended backward pumping configuration is reported. The core diameter was 20 μm with a low numerical aperture of 0.06, and a good beam quality (BPP < 1.8 mm mrad) is achieved without special mode selection methods. No undesirable roll-over was observed in output power with increasing pump power, and the maximum output power was limited by the available pump power. The instability of maximum output power was better than ±0.6%. Different pumping configurations were also compared in experiment, which shows good agreements with theoretical analyses.

Determination of pulse energy dependence for skin denaturation from 585nm fibre laser

Science.gov (United States)

Mujica-Ascencio, S.; Velazquez-Gonzalez, J. S.; Mujica-Ascencio, C.; Alvarez-Chavez, J. A.

2014-05-01

In this paper, simulation and mathematical analysis for the determination of pulse energy from a Q-switched Yb3+-doped fibre laser is required in Port Wine Stain (PWS) treatment. The pulse energy depends on average power, gain, volume, repetition rate and pulse duration. In some treatments such as Selective Photothermolysis (SP), the peak power at the end of the optical fibre and pulse duration can be obtained and modified via a cavity design. For that purpose, a 585nm optical fibre laser full design which considers all of the above besides the average losses through the optical devices proposed for the design and the Ytterbium optical fibre overall gain will be presented.

Combination of photosensitive elements for use in radiography

International Nuclear Information System (INIS)

Bollen, R.H.; Vandenabeele, H.

1976-01-01

A new and improved combination of photosensitive elements is proposed that can be used in radiography. The combination according to the invention is composed of an X-ray fluorescence intensifying screen and a photographic halide of silver containing a color coupler. The color coupler causes a negative silver image and a color image to be formed in the material. The fluorescent layer of the fluorescence screen contains a mixture of lanthanum oxychloride or lanthanum oxybromide activated with terbium or terbium and ytterbium. Detailed information about variants in the composition of the fluorescent substance, the grain sizes of the silver halides, variations of the color couplers and about the coating of the single layers is given. (UWI) [de

Determination of heavy metals impurities in low and medium atomic weight matrices

International Nuclear Information System (INIS)

Paiano, Silvestre; Prado Souza, Rose M.G. do

1997-01-01

Heavy materials have a mass attenuation coefficient in the energy interval from 100 to 400 KeV substantially higher than those corresponding to light and medium atomic weight matrices. They also show, in the same energy range, a more pronounced energy variation of this parameter. In a few cases, this property can be used for the determination of the concentration of impurities constituted by heavy metals in a lighter matrix. An Ytterbium gamma-ray source, which has several energy peaks in the considered interval, is used to supply a number of energy pairs from which the density of impurities can be found without the use of reference materials. (author). 1 ref., 4 figs

Preparation and spectroscopic properties of Yb-doped and Yb-Al-codoped high silica glasses

International Nuclear Information System (INIS)

Qiao Yanbo; Wen Lei; Wu Botao; Ren Jinjun; Chen Danping; Qiu Jianrong

2008-01-01

Yb-doped and Yb-Al-codoped high silica glasses have been prepared by sintering nanoporous glasses. The absorption, fluorescent spectra and fluorescent lifetimes have been measured and the emission cross-section and minimum pump intensities were calculated. Codoping aluminum ions enhanced the fluorescence intensity of Yb-doped high silica glass obviously. The emission cross-sections of Yb-doped and Yb-Al-codoped high silica glasses were 0.65 and 0.82 pm 2 , respectively. The results show that Yb-Al-codoped high silica glass has better spectroscopic properties for a laser material. The study of high silica glass doped with ytterbium is helpful for its application in Yb laser systems, especially for high-power and high-repetition lasers

Trace determination of yttrium and some heavy rare-earths by adsorptive stripping voltammetry

International Nuclear Information System (INIS)

Wang, J.; Zadeii, J.M.

1986-01-01

The interfacial and redox behaviour of rare-earth chelates the Solochrome Violet RS are exploited for developing a sensitive adsorptive stripping procedure. Yttrium and heavy rare earths such as dysprosium, holmium and ytterbium can thus be measured at ng/ml levels and below, by controlled adsorptive accumulation of the metal chelate at the hanging mercury drop electrode, followed by voltammetric measurement of the surface species. With a 3-min preconcentration time, the detection limit ranges from 5 x 10 -10 to 1.4 x 10 -9 M. The relative standard deviation at the 7 ng/ml level ranges from 4 to 7%. A separation method is required to differentiate between the individual rare-earth metals. (author)

Early childhood linear growth faltering in low-income and middle-income countries as a whole-population condition: analysis of 179 Demographic and Health Surveys from 64 countries (1993-2015).

Science.gov (United States)

Roth, Daniel E; Krishna, Aditi; Leung, Michael; Shi, Joy; Bassani, Diego G; Barros, Aluisio J D

2017-12-01

The causes of early childhood linear growth faltering (known as stunting) in low-income and middle-income countries remain inadequately understood. We aimed to determine if the progressive postnatal decline in mean height-for-age Z score (HAZ) in low-income and middle-income countries is driven by relatively slow growth of certain high-risk children versus faltering of the entire population. Distributions of HAZ (based on WHO growth standards) were analysed in 3-month age intervals from 0 to 36 months of age in 179 Demographic and Health Surveys from 64 low-income and middle-income countries (1993-2015). Mean, standard deviation (SD), fifth percentiles, and 95th percentiles of the HAZ distribution were estimated for each age interval in each survey. Associations between mean HAZ and SD, fifth percentile, and 95th percentile were estimated using multilevel linear models. Stratified analyses were performed in consideration of potential modifiers (world region, national income, sample size, year, or mean HAZ in the 0-3 month age band). We also used Monte Carlo simulations to model the effects of subgroup versus whole-population faltering on the HAZ distribution. Declines in mean HAZ from birth to 3 years of age were accompanied by declines in both the fifth and 95th percentiles, leading to nearly symmetrical narrowing of the HAZ distributions. Thus, children with relatively low HAZ were not more likely to have faltered than taller same-age peers. Inferences were unchanged in surveys regardless of world region, national income, sample size, year, or mean HAZ in the 0-3 month age band. Simulations showed that the narrowing of the HAZ distribution as mean HAZ declined could not be explained by faltering limited to a growth-restricted subgroup of children. In low-income and middle-income countries, declines in mean HAZ with age are due to a downward shift in the entire HAZ distribution, revealing that children across the HAZ spectrum experience slower growth compared to

Integrated Assessment of Vegetation and Soil Conditions Following Herbicide Application

Science.gov (United States)

2017-07-25

exchange capacity; POM, particulate organic matter; TC, total carbon; TIC, total inorganic carbon; TOC , total organic carbon; KCl, potassium chloride...2-butoxyethyl ester TIC Total inorganic carbon TOC Total organic carbon ERDC/EL TR-17-9 xiii Unit Conversion Factors Multiply By To Obtain...pH, electrical conductivity (EC), total carbon (TC), total inorganic C (TIC), total organic C ( TOC ), water extractable metals, ERDC/EL TR-17-9 28

A Logistic Regression and Markov Chain Model for the Prediction of Nation-state Violent Conflicts and Transitions

Science.gov (United States)

2016-03-24

current USD) 179 179 164 1990 0 Improved Water Source (% population with access ) 178 175 175 1960 1 Life Expectancy (years) 182 182 1990 2 Military...Microsoft Office visual basic ( VBA ) based consolidated 42 database tool was developed to compile the 39 separate identifying-information and data...conflict remains in conflictP A brief discussion of the accessibility of states within a Markov model is warranted before we proceed further

LASER ABLATION OF MONOCRYSTALLINE SILICON UNDER PULSED-FREQUENCY FIBER LASER

Directory of Open Access Journals (Sweden)

V. P. Veiko

2015-05-01

Full Text Available Subject of research. The paper deals with research of the surface ablation for single-crystal silicon wafers and properties of materials obtained in response to silicon ablation while scanning beam radiation of pulse fiber ytterbium laser with a wavelenght λ = 1062 nm in view of variation of radiation power and scanning modes. Method. Wafers of commercial p-type conductivity silicon doped with boron (111, n-type conductivity silicon doped with phosphorus (100 have been under research with a layer of intrinsical silicon oxide having the thickness equal to several 10 s of nanometers and SiO2 layer thickness from 120 to 300 nm grown by thermal oxidation method. The learning system comprises pulse fiber ytterbium laser with a wavelenght λ = 1062 nm. The laser rated-power output is equal to 20 W, pulse length is 100 ns. Pulses frequency is in the range from 20 kHz to 100 kHz. Rated energy in the pulse is equal to 1.0 mJ. Scanning has been carried out by means of two axial scanning device driven by VM2500+ and controlled by personal computer with «SinMarkТМ» software package. Scanning velocity is in the range from 10 mm/s to 4000 mm/s, the covering varies from 100 lines per mm to 3000 lines per mm. Control of samples has been carried out by means of Axio Imager A1m optical microscope Carl Zeiss production with a high definition digital video camera. All experiments have been carried out in the mode of focused laser beam with a radiation spot diameter at the substrate equal to 50 μm. The change of temperature and its distribution along the surface have been evaluated by FLIR IR imager of SC7000 series. Main results. It is shown that ablation occurs without silicon melting and with plasma torch origination. The particles of ejected silicon take part in formation of silicon ions plasma and atmosphere gases supporting the plasmo-chemical growth of SiO2. The range of beam scanning modes is determined where the growth of SiO2 layer is observed

Comparison of the chromosome maps around a resistance hot spot on chromosome 5 of potato and tomato using BAC-FISH painting.

Science.gov (United States)

Achenbach, Ute C; Tang, Xiaomin; Ballvora, Agim; de Jong, Hans; Gebhardt, Christiane

2010-02-01

Potato chromosome 5 harbours numerous genes for important qualitative and quantitative traits, such as resistance to the root cyst nematode Globodera pallida and the late blight fungus, Phytophthora infestans. The genes make up part of a "hot spot" for resistances to various pathogens covering a genetic map length of 3 cM between markers GP21 and GP179. We established the physical size and position of this region on chromosome 5 in potato and tomato using fluorescence in situ hybridization (FISH) on pachytene chromosomes. Five potato bacterial artificial chromosome (BAC) clones with the genetically anchored markers GP21, R1-contig (proximal end), CosA, GP179, and StPto were selected, labeled with different fluorophores, and hybridized in a five-colour FISH experiment. Our results showed the location of the BAC clones in the middle of the long arm of chromosome 5 in both potato and tomato. Based on chromosome measurements, we estimate the physical size of the GP21-GP179 interval at 0.85 Mb and 1.2 Mb in potato and tomato, respectively. The GP21-GP179 interval is part of a genome segment known to have inverted map positions between potato and tomato.

Dicty_cDB: Contig-U15446-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 425_1( CR933425 |pid:none) Paramecium tetraurelia, Small GTPa... 175 2e-42 AB241245_1( AB241245 |pid:none) Symbiotic...um ... 179 2e-43 DQ446594_1( DQ446594 |pid:none) Arabidopsis thaliana clone pENTR22... 179 2e-43 AB241244_1( AB241244 |pid:none) Symb...iotic protist of Reticuliterme... 178 2e-43 BT035344_1( BT035344 |pid:none) Zea may

Record power, ultra-broadband supercontinuum source based on highly GeO2 doped silica fiber

DEFF Research Database (Denmark)

Jain, Deepak; Sidharthan, R.; Moselund, Peter M.

2016-01-01

the potential of germania based photonic crystal fiber or a step-index fiber supercontinuum source for high power ultra-broad band emission being by pumped a 1060 nm or a 1550 nm laser source. To the best of our knowledge, this is the record power, ultra-broadband, and all-fiberized supercontinuum light source...... based on silica and germania fiber ever demonstrated to the date. (C) 2016 Optical Society of America......We demonstrate highly germania doped fibers for mid-infrared supercontinuum generation. Experiments ensure a highest output power of 1.44 W for a broadest spectrum from 700 nm to 3200 nm and 6.4 W for 800 nm to 2700 nm from these fibers, while being pumped by a broadband Erbium-Ytterbium doped...

Propagation of intense laser radiation through a diffusion flame of burning oil

Science.gov (United States)

Gvozdev, S. V.; Glova, A. F.; Dubrovskii, V. Yu; Durmanov, S. T.; Krasyukov, A. G.; Lysikov, A. Yu; Smirnov, G. V.; Pleshkov, V. M.

2015-06-01

We report the results of measuring the absorption coefficient of radiation from a cw ytterbium fibre single-mode laser with the power up to 1.5 kW by a diffusion flame of oil, burning in the atmosphere air at normal pressure on a free surface. For the constant length (30 mm) and width (30 mm) of the flame and the distance 10 mm between the laser beam axis and the oil surface the dependence of the absorption coefficient, averaged over the flame length, on the mean radiation intensity (varied from 4.5 × 103 to 1.2 × 106 W cm-2) entering the flame is obtained. The qualitative explanation of nonmonotonic behaviour of the absorption coefficient versus the intensity is presented.

Adsorption of volatile metals on metal surfaces and the possibilities of its application in nuclear chemistry

International Nuclear Information System (INIS)

Eichler, B.; Huebener, S.; Rossbach, H.

1985-08-01

Using an empiric model partial molar enthalpies of adsorption of the rare earth metals at zero coverage have been calculated for the adsorbent metals Ti, Fe, Ni, Cu, Zr, Nb, Mo, Rh, Pd, Ag, Ta, W, Re, Ir, Pt, Au as well as Al, Si, Zn, Ge, Cd, and Pb. The electron densities at the boundary of the Wigner-Seitz cells in the rare earth metals, necessary for the calculations, have been derived from the crystal entropies. In some cases the magnetic entropy was considered too. The calculated enthalpies of adsorption are compared with experimental data taken from the literature. The valence state of adsorbed europium and ytterbium is discussed in relation to the nature of the adsorbent metal. (author)

Towards isotope shift and hyperfine structure measurements of the element nobelium

Energy Technology Data Exchange (ETDEWEB)

Chhetri, Premaditya; Lautenschlaeger, Felix; Walther, Thomas [Institut fuer Angewandte Physik, TU Darmstadt, D-64289 Darmstadt (Germany); Laatiaoui, Mustapha [Helmholtz Institut Mainz, D-55099 Mainz (Germany); Block, Michael; Hessberger, Fritz-Peter [Helmholtz Institut Mainz, D-55099 Mainz (Germany); GSI, D-64291 Darmstadt (Germany); Lauth, Werner; Backe, Hartmut [Institut fuer Kernphysik, JGU Mainz, D-55122 Mainz (Germany); Kunz, Peter [TRIUMF, D-V6T2A3 Vancouver (Canada)

2014-07-01

Laser spectroscopy on the heaviest elements is of great interest as it allows the study of the evolution of relativistic effects on their atomic structure. In our experiment we exploit the Radiation Detected Resonance Ionization Spectroscopy technique and use excimer-laser pumped dye lasers to search for the first time the {sup 1}P{sub 1} level in {sup 254}No. Etalons will be used in the forthcoming experiments at GSI, Darmstadt, to narrow down the bandwidth of the dye lasers to 0.04 cm{sup -1}, for the determination of the isotope shift and hyperfine splitting of {sup 253,} {sup 255}No. In this talk results from preparatory hyperfine structure studies in nat. ytterbium and the perspectives for future experiments of the heaviest elements are discussed.

Development of a force sensor using atom interferometry to constrain theories on dark matter and dark energy

Science.gov (United States)

Schlupf, Chandler; Niederriter, Robert; Bohr, Eliot; Khamis, Sami; Park, Youna; Szwed, Erik; Hamilton, Paul

2017-04-01

Atom interferometry has been used in many precision measurements such as Newton's gravitational constant, the fine structure constant, and tests of the equivalence principle. We will perform atom interferometry in an optical lattice to measure the force felt by an atom due to a test mass in search of new forces suggested by dark matter and dark energy theories. We will be developing a new apparatus using laser-cooled ytterbium to continuously measure this force by observing their Bloch oscillations. Interfering atoms in an optical lattice allows continuous measurements in a small volume over a long period of time, enabling our device to be sensitive to time-varying forces while minimizing vibrational noise. We present the details of this experiment and the progress on it thus far.

Luminescence of YbP3O9 upon excitation in the UV-VUV range

International Nuclear Information System (INIS)

Stryganyuk, G; Trots, D; Berezovskaya, I; Shalapska, T; Voloshinovskii, A; Dotsenko, V; Zimmerer, G

2007-01-01

X-ray powder diffraction and luminescence spectral-kinetic studies have been performed for ytterbium metaphosphate (YbP 3 O 9 ) in the 12-290 K temperature range. The diffraction investigation has shown YbP 3 O 9 to be of monoclinic P 2 1 /c structure at T = 12-290 K. Charge transfer luminescence originating from Yb 3+ ion has been revealed. The carrier confinement within the Yb 3+ charge transfer state is pronounced at T = 12 K. A tendency has been revealed for charge carriers in YbP 3 O 9 to be localized in a trapped exciton state at room temperature. The quenching mechanisms for Yb 3+ charge transfer luminescence and processes competing with the formation of the Yb 3+ charge transfer state are discussed

Study of the R-(Zr,W)-(O,N) (R = Y, Nd, Sm, Gd, Yb) oxynitride system

Energy Technology Data Exchange (ETDEWEB)

Tessier, Franck, E-mail: Franck.Tessier@univ-rennes1.fr [UMR CNRS 6226 ' Sciences Chimiques de Rennes' , equipe ' Verres et Ceramiques' , Universite de Rennes 1, 35042 Rennes cedex (France); Maillard, Pascal [UMR CNRS 6226 ' Sciences Chimiques de Rennes' , equipe ' Verres et Ceramiques' , Universite de Rennes 1, 35042 Rennes cedex (France); Orhan, Emmanuelle [Laboratoire Science des Procedes Ceramiques et Traitements de Surface, UMR CNRS 6638, Universite de Limoges, 123 Avenue Albert Thomas, 87060 Limoges cedex (France); Chevire, Francois [UMR CNRS 6226 ' Sciences Chimiques de Rennes' , equipe ' Verres et Ceramiques' , Universite de Rennes 1, 35042 Rennes cedex (France)

2010-02-15

The replacement of tantalum by the couple Zr/W within the RTa-O-N systems (R = Y, Nd, Sm, Gd, Yb), enables the preparation of novel oxide and oxynitride phases in the R-Zr-W-O-N system. R{sub 2}Zr{sub 2-x}W{sub x}O{sub 7+x} oxides exhibit the fluorite-type (x < 0.9) and scheelite (x {approx} 1) structures. Corresponding oxynitride compositions are of the fluorite-type and show different colors, for example in the case of ytterbium: pale yellow (x = 0.2 or 0.25), green (x = 0.5-0.8) and brown for the tungsten-rich samples (x = 0.9, 1). Photocatalytic activity measurements have been performed to investigate the overall water splitting behavior of these colored phases.

Cr and Yb markers determination in animal feces by energy dispersive X-ray fluorescence

International Nuclear Information System (INIS)

Almeida, Eduardo de; Senicato, Luis A; Nascimento Filho, Virgilio F.; Gomide, Catarina A.

2007-01-01

Chromium and Ytterbium elements are utilized in animal nutritional studies as markers. This paper describes an analytical method for Cr and Yb determination in solid buffalo feces sample using standard addition method and energy dispersive X-ray spectrometry (EDXRF) technique. One gram dried sample was pressed manually in an XRF sample cup with Mylar film (6.3 μm thickness) in the bottom. The experimental conditions were: Mo target X-ray tube with Zr filter, operated at 25 kV/10 mA, and 500 s of acquisition time. The limits of detection for Cr and Yb were 16.6 and 11.4 mg/kg, respectively. This methodology has showed appropriated for simultaneous Cr and Yb determination as marker in animal feces. (author)

Cr and Yb markers determination in animal feces by energy dispersive X-ray fluorescence

Energy Technology Data Exchange (ETDEWEB)

Almeida, Eduardo de; Senicato, Luis A; Nascimento Filho, Virgilio F. [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Instrumentacao Nuclear (LIN)]. E-mail: edualm@usp.br; Gomide, Catarina A. [Universidade de Sao Paulo (USP), Pirassununga, SP (Brazil). Faculdade de Zootecnia e Engenharia de Alimentos (FZEA). Dept. de Zootecnia]. E-mail: cbgomide@usp.br

2007-07-01

Chromium and Ytterbium elements are utilized in animal nutritional studies as markers. This paper describes an analytical method for Cr and Yb determination in solid buffalo feces sample using standard addition method and energy dispersive X-ray spectrometry (EDXRF) technique. One gram dried sample was pressed manually in an XRF sample cup with Mylar film (6.3 {mu}m thickness) in the bottom. The experimental conditions were: Mo target X-ray tube with Zr filter, operated at 25 kV/10 mA, and 500 s of acquisition time. The limits of detection for Cr and Yb were 16.6 and 11.4 mg/kg, respectively. This methodology has showed appropriated for simultaneous Cr and Yb determination as marker in animal feces. (author)

Transition probabilities up to I = 36+ in 160Yb

International Nuclear Information System (INIS)

Johnson, N.R.; McGowan, F.K.; Winchell, D.F.; Baktash, C.; Garrett, J.D.; Lee, I.Y.; Wells, J.C.; Chaturvedi, L.; Gao, W.B.; Ma, W.C.; Pilotte, S.; Yu, C.H.

1992-01-01

During the past dozen years or so, numerous groups have worked on the properties of the ytterbium nuclei and we at Oak Ridge have been actively involved in the study of many of these nuclei. We have concentrated on lifetime measurements of their high-spin states because it is from the lifetime of a state that one can determine Q t , the transition quadrupole moment. The importance of obtaining a Q t value is in that it reflects the intrinsic part of the wave function and, hence, provides an indicator of the collectivity. This paper presents the results from recent Doppler broadened line shape measurements in 16O Yb at very large rotational frequencies of bar Hω∼0.36 - 0.50 MeV (I = 22 + -36 + )

Harmonic Mode-Locked Fiber Laser based on Photonic Crystal Fiber Filled with Topological Insulator Solution

Directory of Open Access Journals (Sweden)

Yu-Shan Chen

2015-04-01

Full Text Available We reported that the photonic crystal fiber (PCF filled with TI:Bi2Te3 nanosheets solution could act as an effective saturable absorber (SA. Employing this TI-PCF SA device; we constructed an ytterbium-doped all-fiber laser oscillator and achieved the evanescent wave mode-locking operation. Due to the large cavity dispersion; the fundamental mode-locking pulse had the large full width at half maximum (FWHM of 2.33 ns with the repetition rate of ~1.11 MHz; and the radio frequency (RF spectrum with signal-to-noise ratio (SNR of 61 dB. In addition; the transition dynamics from a bunched state of pulses to harmonic mode-locking (HML was also observed; which was up to 26th order.

Handbook on the physics and chemistry of rare earths: Volume 19: Lanthanides/Actinides: Physics, 2

International Nuclear Information System (INIS)

Gschneidner, Karl A.; Eyring, LeRoy; Choppin, G.R.; Lander, G.H.

1994-01-01

This handbook comprises five chapters on the lanthanide and actinide materials. In the first chapter the inelastic neutron scattering behaviors of the lanthanides and actinides are compared. In the next chapter the focus is on neutron scattering by heavy fermion single crystal materials, including metallic materials with a paramagnetic ground state, superconductors, metallic and semiconducting antiferromagnets and nearly insulating paramagnets. In chapter three a comprehensive review of intermediate valence and heavy fermions in a wide variety of lanthanide and actinide compounds is given, ranging from metallic to insulating materials. In chapter four two issues on the high pressure behaviours of anomalous cerium, ytterbium and uranium compounds are dealt with. In the final chapter an extensive review is given the thermodynamic properties of lanthanide and actinide metallic systems

Generation of 46 W green-light by frequency doubling of 96 W picosecond unpolarized Yb-doped fiber amplifier

Science.gov (United States)

Qi, Yaoyao; Yu, Haijuan; Zhang, Jingyuan; Zhang, Ling; He, Chaojian; Lin, Xuechun

2018-05-01

We demonstrated a high efficiency and high average power picosecond green light source based on SHG (second harmonic generation) of an unpolarized ytterbium-doped fiber amplifier chain. Using single-pass frequency doubling in two temperature-tuned type-I phase-matching LBO crystals, we were able to generate 46 W, >70 ps pulses at 532 nm from a fundamental beam at 1064 nm, whose output is 96 W, 4.8 μJ, with a repetition frequency of 20 MHz and nearly diffraction limited. The optical conversion efficiency was ∼48% in a highly compact design. To the best of our knowledge, this is the first reported on ps green source through SHG of an unpolarized fiber laser with such a high output and high efficiency.

Diode-pumped 1028 nm Ytterbium-doped fiber laser with near 90% slope efficiency

Czech Academy of Sciences Publication Activity Database

Harun, S.W.; Paul, M.C.; Moghaddam, M.R.A.; Das, S.; Sen, R.; Dhar, Anirban; Pal, M.; Bhadra, S.K.; Ahmad, H.

2010-01-01

Roč. 20, č. 3 (2010), s. 656-660 ISSN 1054-660X Institutional research plan: CEZ:AV0Z20670512 Keywords : Core composition * Oscillator * Diode-pumped Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.319, year: 2010

Near-infrared electroluminescence from double-emission-layers devices based on Ytterbium (III) complexes

International Nuclear Information System (INIS)

Li Zhefeng; Zhang Hongjie; Yu Jiangbo

2012-01-01

We investigated near-infrared electroluminescence properties of two lanthanide complexes Yb(PMBP) 3 Bath [PMBP = tris(1-phenyl-3-methyl-4-(4-tert-butylbenzacyl)-5-pyrazolone); Bath = bathophenanthroline] and Yb(PMIP) 3 TP 2 [PMIP = tris(1-phenyl-3-methyl-4-isobutyryl-5-pyrazolone); TP = triphenyl phosphine oxide] by fabricated the double-emission-layers devices. From the device characteristics, it is known that holes are easier to transport in Yb(PMIP) 3 TP 2 layer and electrons are easier to transport in Yb(PMBP) 3 Bath layer, at the same time, both of the two complexes can be acted as emission layers in the device. The recombination region of carriers has been confined in the interface of Yb(PMIP) 3 TP 2 /Yb(PMBP) 3 Bath, and pure Yb 3+ ion characteristic emission centered at 980 nm has been obtained. The device shows the maximum near-infrared irradiance as 14.7 mW/m 2 at the applied voltage of 17.8 V. - Highlights: ► Near-infrared electroluminescent devices with Yb(III) complexes as emission layers. ► Double-emission layer device structure introduced to balance carriers. ► Improved performance of double-emission layer device.

Analysis of the radiobiology of ytterbium-169 and iodine-125 permanent brachytherapy implants

Energy Technology Data Exchange (ETDEWEB)

Lazarescu, G.R. [Windsor Regional Cancer Center, Ontario Cancer Treatment and Research Foundation, Windsor, Canada N8W 2X3 (Canada); Battista, J.J. [London Regional Cancer Center, Ontario Cancer Treatment and Research Foundation, Dept. of Oncology and Dept. of Medical Biophysics, University of Western Ontario, London, Canada N6A 4L6 (Canada)

1997-09-01

Recently, Yb-169 has been considered as a potential replacement for I-125 and Pd-103 in permanent implants. In spite of the uncertainties in the parameters necessary for an accurate radiobiological modelling, the linear quadratic model can be useful in the comparative evaluation of the radiotherapeutic merit of similar implants. In order to find out if a Yb-169 permanent implant can be made biologically 'equivalent' to an I-125 implant, we studied the dependence of local control on the tumour cell radiosensitivity and on the balance between the rate of tumour cell killing and tumour cell proliferation, for rapidly and slowly proliferating tumours. The extrapolated response dose (ERD) has been calculated for tumour and late reacting normal tissue for both types of implants and the possible biological restrictions due to the normal tissue tolerance have been discussed. Our theoretical analysis is consistent with the clinical results published for I-125 permanent implants in prostate tumours and meningiomas. It predicts that Yb-169, which has only recently been used in human tumours, can provide comparable tumour control for permanent implants in slowly proliferating tumours with an initial dose rate of 13 cGy h{sup -1}. Control might be extended to rapidly proliferating tumours by increasing the initial dose rate within a range consistent with an acceptable level of normal tissue late reaction. (author)

49 CFR 179.102-17 - Hydrogen chloride, refrigerated liquid.

Science.gov (United States)

2010-10-01

... FOR TANK CARS Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120... stenciled, adjacent to the water capacity stencil, MINIMUM OPERATING TEMPERATURE _ °F. (l) The tank car and... 30 days, at an ambient temperature of 90° F. (m) Except as provided in § 173.314(d), tank cars built...

Adventures in Rocket Science. EG-2007-12-179-MSFC

Science.gov (United States)

Huegele, Vince; Hill, Kristy; Terry, Brenda

2008-01-01

This guide was prepared as a tool useful for informal education venues (4-H, Boys and Girls Clubs, Boy Scouts, Girl Scouts, etc.), science clubs and related programs, and can be adopted for formal education settings. An exciting and productive study in rocket science can be implemented using the selected activities for the above-mentioned…

49 CFR 179.400-18 - Test of inner tank.

Science.gov (United States)

2010-10-01

... hazard involved. After a hydrostatic test the container and piping must be emptied of all water and purged of all water vapor. (b) Caulking of welded joints to stop leaks developed during the test is...

All projects related to | Page 179 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Program: Maternal and Child Health. Total Funding: CA$ 256,600.00. Africa Centre for Systematic Reviews and Knowledge Translation. Project. There is increasing global recognition of the need to link research evidence to policy decisions and practice. Topic: HEALTH POLICY, POLICY MAKING, INSTITUTION BUILDING, ...

Publications | Page 179 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Hisham Zerriffi n'a aucun mal à énumérer les bienfaits de l'électrification des zones rurales : une meilleure éducation, puisque les enfants ont de la lumière pour lire et étudier, de meilleurs établissements de santé, de meilleurs... La cartographie des incidences : Intégrer l'apprentissage et la réflexion dans les programmes ...

Publications | Page 179 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Le rôle de l'énergie dans le développement rural. Hisham Zerriffi n'a aucun mal à énumérer les bienfaits de l'électrification des zones rurales : une meilleure éducation, puisque les enfants ont de la lumière pour lire et étudier, de meilleurs établissements de santé, de meilleurs.

179 The Impact of Photography in a Developing Economy

African Journals Online (AJOL)

Nekky Umera

An International Multi-Disciplinary Journal, Ethiopia. Vol. 3 (4) .... (TFT) view screen. The LCD is .... Photography came into being through the artistic aspirations of two .... colour, and modify selected areas of images using dodging and burning.

179 Nigerian Pidgin: A Means of Human Development Charles ...

African Journals Online (AJOL)

were generated from a library research. The study is based on .... understand that no language is inferior nor bad as some people have that notion .... in terms of content. It is obvious that .... In summary, it detribalizes the user and serve as a.

Cosmic-ray exposure ages of six chondritic Almahata Sitta fragments

Science.gov (United States)

Riebe, M. E. I.; Welten, K. C.; Meier, M. M. M.; Wieler, R.; Barth, M. I. F.; Ward, D.; Laubenstein, M.; Bischoff, A.; Caffee, M. W.; Nishiizumi, K.; Busemann, H.

2017-11-01

The Almahata Sitta strewn field is dominated by ureilites, but contains a large fraction of chondritic fragments of various types. We analyzed stable isotopes of He, Ne, Ar, Kr, and Xe, and the cosmogenic radionuclides 10Be, 26Al, and 36Cl in six chondritic Almahata Sitta fragments (EL6 breccia, EL6, EL3-5, CB, LL4/5, R-like). The cosmic-ray exposure (CRE) ages of five of the six samples have an average of 19.2 ± 3.3 Ma, close to the average of 19.5 ± 2.5 Ma for four ureilites. The cosmogenic radionuclide concentrations in the chondrites indicate a preatmospheric size consistent with Almahata Sitta. This corroborates that Almahata Sitta chondrite samples were part of the same asteroid as the ureilites. However, MS-179 has a lower CRE age of 11.0 ± 1.4 Ma. Further analysis of short-lived radionuclides in fragment MS-179 showed that it fell around the same time, and from an object of similar size as Almahata Sitta, making it almost certain that MS-179 is an Almahata Sitta fragment. Instead, its low CRE age could be due to gas loss, chemical heterogeneity that may have led to an erroneous 21Ne production-rate, or, perhaps most likely, MS-179 could represent the true 4π exposure age of Almahata Sitta (or an upper limit thereof), while all other samples analyzed so far experienced exposure on the parent body of similar lengths. Finally, MS-179 had an extraordinarily high activity of neutron-capture 36Cl, 600 dpm kg-1, the highest activity observed in any meteorite to date, related to a high abundance of the Cl-bearing mineral lawrencite.

Population carrier rates of pathogenic ARSA gene mutations: is metachromatic leukodystrophy underdiagnosed?

Directory of Open Access Journals (Sweden)

Agnieszka Ługowska

Full Text Available BACKGROUND: Metachromatic leukodystrophy (MLD is a severe neurometabolic disease caused mainly by deficiency of arylsulfatase A encoded by the ARSA gene. Based on epidemiological surveys the incidence of MLD per 100,000 live births varied from 0.6 to 2.5. Our purpose was to estimate the birth prevalence of MLD in Poland by determining population frequency of the common pathogenic ARSA gene mutations and to compare this estimate with epidemiological data. METHODOLOGY: We studied two independently ascertained cohorts from the Polish background population (N∼3000 each and determined carrier rates of common ARSA gene mutations: c.459+1G>A, p.P426L, p.I179S (cohort 1 and c.459+1G>A, p.I179S (cohort 2. PRINCIPAL FINDINGS: Taking into account ARSA gene mutation distribution among 60 Polish patients, the expected MLD birth prevalence in the general population (assuming no selection against homozygous fetuses was estimated as 4.0/100,000 and 4.1/100,000, respectively for the 1(st and the 2(nd cohort with a pooled estimate of 4.1/100,000 (CI: 1.8-9.4 which was higher than the estimate of 0.38 per 100,000 live births based on diagnosed cases. The p.I179S mutation was relatively more prevalent among controls than patients (OR = 3.6, P = 0.0082, for a comparison of p.I179S frequency relative to c.459+1G>A between controls vs. patients. CONCLUSIONS/SIGNIFICANCE: The observed discrepancy between the measured incidence of metachromatic leukodystrophy and the predicted carriage rates suggests that MLD is substantially underdiagnosed in the Polish population. The underdiagnosis rate may be particularly high among patients with p.I179S mutation whose disease is characterized mainly by psychotic symptoms.

UVB-induced nuclear translocation of TC-PTP by AKT/14-3-3σ axis inhibits keratinocyte survival and proliferation.

Science.gov (United States)

Kim, Mihwa; Morales, Liza D; Baek, Minwoo; Slaga, Thomas J; DiGiovanni, John; Kim, Dae Joon

2017-10-31

Understanding protein subcellular localization is important to determining the functional role of specific proteins. T-cell protein tyrosine phosphatase (TC-PTP) contains bipartite nuclear localization signals (NLSI and NLSII) in its C-terminus. We previously have demonstrated that the nuclear form of TC-PTP (TC45) is mainly localized to the cytoplasm in keratinocytes and it is translocated to the nucleus following UVB irradiation. Here, we report that TC45 is translocated by an AKT/14-3-3σ-mediated mechanism in response to UVB exposure, resulting in increased apoptosis and decreased keratinocyte proliferation. We demonstrate that UVB irradiation increased phosphorylation of AKT and induced nuclear translocation of 14-3-3σ and TC45. However, inhibition of AKT blocked nuclear translocation of TC45 and 14-3-3σ. Site-directed mutagenesis of 14-3-3σ binding sites within TC45 showed that a substitution at Threonine 179 (TC45/T179A) effectively blocked UVB-induced nuclear translocation of ectopic TC45 due to the disruption of the direct binding between TC45 and 14-3-3σ. Overexpression of TC45/T179A in keratinocytes resulted in a decrease of UVB-induced apoptosis which corresponded to an increase in nuclear phosphorylated STAT3, and cell proliferation was higher in TC45/T179A-overexpressing keratinocytes compared to control keratinocytes following UVB irradiation. Furthermore, deletion of TC45 NLSII blocked its UVB-induced nuclear translocation, indicating that both T179 and NLSII are required. Taken together, our findings suggest that AKT and 14-3-3σ cooperatively regulate TC45 nuclear translocation in a critical step of an early protective mechanism against UVB exposure that signals the deactivation of STAT3 in order to promote keratinocyte cell death and inhibit keratinocyte proliferation.

Imidazolopiperazines (IPZ) kill both rings and dormant rings in wild type and K13 artemisinin resistant Plasmodium falciparum in vitro.

Science.gov (United States)

Dembele, Laurent; Gupta, Devendra Kumar; Lim, Michelle Yi-Xiu; Ang, Xiaoman; Selva, Jeremy J; Chotivanich, Kesinee; Nguon, Chea; Dondorp, Arjen M; Bonamy, Ghislain M C; Diagana, Thierry T; Bifani, Pablo

2018-03-12

Artemisinin (ART) resistance has spread through Southeast Asia, posing serious threat to the control and elimination of malaria. ART resistance has been associated with mutations in the Plasmodium falciparum kelch-13 ( Pfk13 ) propeller domain. Phenotypically, ART resistance is defined as delayed parasite clearance in patients' due to the reduced susceptibility of early ring-stage parasites to the active metabolite of ART dihydroartemisinin (DHA). Early rings can enter a state of quiescence upon DHA exposure and resume growth in its absence. These quiescent rings are referred to as dormant rings or DHA-pretreated rings (called here dormant rings). The imidazolopiperazine (IPZ) is a novel class of antimalarial drugs, which has demonstrated efficacy in early clinical trials. Here, we characterized the stage of action of IPZ GNF179 and evaluated its activity against rings and dormant rings in wild type and ART resistant parasites. Unlike DHA, GNF179 does not induce dormancy. We show that GNF179 is more rapidly cidal against schizonts than ring and trophozoite stages. However, with 12 hours exposure, the compound effectively kills rings and dormant rings of both susceptible and ART resistant parasites within 72 hours. We further demonstrate that in combination with ART, GNF179 effectively prevent recrudescence of dormant rings including those bearing pfk13 propeller mutations. Copyright © 2018 Dembele et al.

The cost of brain diseases

DEFF Research Database (Denmark)

DiLuca, Monica; Olesen, Jes

2014-01-01

Brain diseases represent a considerable social and economic burden in Europe. With yearly costs of about 800 billion euros and an estimated 179 million people afflicted in 2010, brain diseases are an unquestionable emergency and a grand challenge for neuroscientists.......Brain diseases represent a considerable social and economic burden in Europe. With yearly costs of about 800 billion euros and an estimated 179 million people afflicted in 2010, brain diseases are an unquestionable emergency and a grand challenge for neuroscientists....

Innovation, Management and Sustainability - change processes in the food service sector

DEFF Research Database (Denmark)

Kristensen, Niels Heine; Dahl, Astrid; Mikkelsen, Bent Egberg

2005-01-01

Kristensen NH, Thorsen AV, Dahl A, Engelund EH, Mikkelsen BE (2005): Innovation, Management and Sustainability - change processes in the food service sector. Chapter in "Culinary Arts and Sciences V - Global and National Perspectives". Bournemouth University. ISBN 1-85899-179-X......Kristensen NH, Thorsen AV, Dahl A, Engelund EH, Mikkelsen BE (2005): Innovation, Management and Sustainability - change processes in the food service sector. Chapter in "Culinary Arts and Sciences V - Global and National Perspectives". Bournemouth University. ISBN 1-85899-179-X...

Determining gold content

International Nuclear Information System (INIS)

Clayton, C.G.; Wormald, M.R.

1981-01-01

A method for determining the gold content of a material, comprises irradiating a body of the material with neutrons and determining the intensity of γ-rays having an energy of 279 keV arising from the reaction 179 Au(nn') 179 Au → 279 keV. The apparatus has means for conveying the materials past an assembly, which has a neutron source, which does not produce neutrons having sufficient energy to excite fast neutron reactions in non-auriferous constituents. (author)

ORF Alignment: NC_004557 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Query: 179 WHADETVVFINGERYYLWLAIDSETRFILAFHLTKSRESDSAFSLINNASTYDAPENFIT 238 ... WHADETVVFINGERYYLWLAIDS...ETRFILAFHLTKSRESDSAFSLINNASTYDAPENFIT Sbjct: 1 ... WHADETVVFINGERYYLWLAIDSETRF

Investigation of diode-laser pumped thulium-doped fluoride lasers

International Nuclear Information System (INIS)

Matos, Paulo Sergio Fabris de

2006-01-01

Tunable lasers emitting around 2.3 mum region are important in many areas, like gas detection, remote sensing and medical applications. Thulium has a large emission spectra around 2.3 mum with demonstrated tuning range of 2.2-2.45 mum using the YLF host. For efficient pump absorption, a high concentration sensitizer like ytterbium can be used. We demonstrate quasi-cw operation of the Yb:Tm:YLF laser, pumped at 960 nm with a 20 W diode bar achieving the highest output power reported so far of 620 mW. Simultaneous pumping of the 2.3 mm Yb:Tm:YLF laser at 685 nm and 960 nm is demonstrated, showing higher slope efficiency than 960 nm alone. Numerical simulations and analytical models show the best ratio of pump power between both wavelengths. (author)

Propagation of intense laser radiation through a diffusion flame of burning oil

International Nuclear Information System (INIS)

Gvozdev, S V; Glova, A F; Dubrovskii, V Yu; Durmanov, S T; Krasyukov, A G; Lysikov, A Yu; Smirnov, G V; Pleshkov, V M

2015-01-01

We report the results of measuring the absorption coefficient of radiation from a cw ytterbium fibre single-mode laser with the power up to 1.5 kW by a diffusion flame of oil, burning in the atmosphere air at normal pressure on a free surface. For the constant length (30 mm) and width (30 mm) of the flame and the distance 10 mm between the laser beam axis and the oil surface the dependence of the absorption coefficient, averaged over the flame length, on the mean radiation intensity (varied from 4.5 × 10 3 to 1.2 × 10 6 W cm -2 ) entering the flame is obtained. The qualitative explanation of nonmonotonic behaviour of the absorption coefficient versus the intensity is presented. (laser applications and other topics in quantum electronics)

Investigation of diode-laser pumped thulium-doped fluoride lasers; Investigacao de lasers de floureto dopados com tulio e bombeados por diodo-laser

Energy Technology Data Exchange (ETDEWEB)

Matos, Paulo Sergio Fabris de

2006-07-01

Tunable lasers emitting around 2.3 mum region are important in many areas, like gas detection, remote sensing and medical applications. Thulium has a large emission spectra around 2.3 mum with demonstrated tuning range of 2.2-2.45 mum using the YLF host. For efficient pump absorption, a high concentration sensitizer like ytterbium can be used. We demonstrate quasi-cw operation of the Yb:Tm:YLF laser, pumped at 960 nm with a 20 W diode bar achieving the highest output power reported so far of 620 mW. Simultaneous pumping of the 2.3 mm Yb:Tm:YLF laser at 685 nm and 960 nm is demonstrated, showing higher slope efficiency than 960 nm alone. Numerical simulations and analytical models show the best ratio of pump power between both wavelengths. (author)

Estimation of stability of polynuclear rare earth complexes with EDTA in the presence of stable monocomplexonates

International Nuclear Information System (INIS)

Le Ba Tkhun; Kupriyanova, G.N.; Smirnova, N.S.; Martynenko, L.I.; Evseeva, A.M.

1987-01-01

Complexing in rare-earth-EDTA system at the mole ratio making up (M 3+ ):(H 2 A 2- )=1:1, 2:1, 5:1, (M=Nd, Yb), C H 2 A 2- =0.010, 0.015 mol/l, μ=0.5 (KCl) is studied in pH 1.6-3.0 interval by pH-metric titration technique using mathematical modelling method. A model containing MA - , MHA, M 2 A 2+ complexes for which stability constants, equalling respectively (lgK) to 15.66, 2.11, 1.06 (for neodymium complexes) and 18.70, 1.78, 0.45 (for ytterbium complexes) are determined by non-linear LSF, appears to be adequate. It is shown that binuclear complex concentration in solution with M 3+ excess is comparable to stable monocomplexonate concentration

Synthesis and Downconversion Emission Property of Yb2O3:Eu3+ Nanosheets and Nanotubes

Directory of Open Access Journals (Sweden)

Chao Qian

2013-01-01

Full Text Available Ytterbium oxide (Yb2O3 nanocrystals with different Eu3+ (1%, 2%, 5%, and 10% doped concentrations were synthesized by a facile hydrothermal method, subsequently by calcination at 700°C. The crystal phase, size, and morphology of prepared samples were characterized by X-ray diffraction (XRD and transmission electron microscopy (TEM. The results show that the as-prepared Yb2O3 nanocrystals with sheet- and tube-like shape have cubic phase structure. The Eu3+ doped Yb2O3 nanocrystals were revealed to have good down conversion (DC property and intensity of the DC luminescence can be modified by Eu3+ contents. In our experiment the 1% Eu3+ doped Yb2O3 nanocrystals showed the strongest DC luminescence among the obtained Yb2O3 nanocrystals.

Fingermark detection on non-porous and semi-porous surfaces using NaYF4:Er,Yb up-converter particles.

Science.gov (United States)

Ma, Rongliang; Bullock, Elicia; Maynard, Philip; Reedy, Brian; Shimmon, Ronald; Lennard, Chris; Roux, Claude; McDonagh, Andrew

2011-04-15

This article describes the first use of an anti-Stokes material, or up-converter, for the development of latent fingermarks on a range of non-porous surfaces. Anti-Stokes materials can absorb long-wavelength light and emit light at a shorter wavelength. This property is unusual in both natural and artificial materials and so fingermark detection techniques based on anti-Stokes luminescence are potentially sensitive and selective. Latent fingermarks on luminescent and non-luminescent substrates, including Australian polymer banknotes (a well-known 'difficult' surface), were developed with sodium yttrium tetrafluoride doped with erbium and ytterbium (NaYF(4):Er,Yb) by dry powder, wet powder, and cyanoacrylate staining techniques. This study illustrates the potential of up-converter phosphors for the detection of latent fingermarks. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

Femtosecond Fiber Lasers

Science.gov (United States)

Bock, Katherine J.

This thesis focuses on research I have done on ytterbium-doped femtosecond fiber lasers. These lasers operate in the near infrared region, lasing at 1030 nm. This wavelength is particularly important in biomedical applications, which includes but is not limited to confocal microscopy and ablation for surgical incisions. Furthermore, fiber lasers are advantageous compared to solid state lasers in terms of their cost, form factor, and ease of use. Solid state lasers still dominate the market due to their comparatively high energy pulses. High energy pulse generation in fiber lasers is hindered by either optical wave breaking or by multipulsing. One of the main challenges for fiber lasers is to overcome these limitations to achieve high energy pulses. The motivation for the work done in this thesis is increasing the output pulse peak power and energy. The main idea of the work is that decreasing the nonlinearity that acts on the pulse inside the cavity will prevent optical wave breaking, and thus will generate higher energy pulses. By increasing the output energy, ytterbium-doped femtosecond fiber lasers can be competitive with solid state lasers which are used commonly in research. Although fiber lasers tend to lack the wavelength tuning ability of solid state lasers, many biomedical applications take advantage of the 1030 microm central wavelength of ytterbium-doped fiber lasers, so the major limiting factor of fiber lasers in this field is simply the output power. By increasing the output energy without resorting to external amplification, the cavity is optimized and cost can remain low and economical. During verification of the main idea, the cavity was examined for possible back-reflections and for components with narrow spectral bandwidths which may have contributed to the presence of multipulsing. Distinct cases of multipulsing, bound pulse and harmonic mode-locking, were observed and recorded as they may be of more interest in the future. The third

ORF Alignment: NC_002935 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available LKAVKEDGVTG 60 ... Query: 179 GKGAFIAFGEKTLRARGAYKSNANSVDGFDSNADNELTRPAALAYKPLEHQRVDIIAAYP 238 ... GKGAFIA...FGEKTLRARGAYKSNANSVDGFDSNADNELTRPAALAYKPLEHQRVDIIAAYP Sbjct: 121 GKGAFIAFGEKTLR

Geochemical implications of gabbro from the slow-spreading Northern Central Indian Ocean Ridge, Indian Ocean

Digital Repository Service at National Institute of Oceanography (India)

Ray, Dwijesh; Misra, S.; Banerjee, R.; Weis, D.

., 1989) and the dynamics of crystallization of plutonic rocks (Bloomer et al., 1989; Meyer et al., 1989). The recovery of gabbroic rocks is mostly restricted to major transform faults or fracture zones transecting mid-ocean ridges, e.g., Mid... gabbro of Indian Ocean Ridge System (Fig 1) is ODP leg 118 from SWIR (Dick et al., 2002; Coogan et al, 2001). Gabbro from Leg 179 (ODP Hole 735B from Atlantis II fracture zone, Dick et al., 2000) and Leg 179 (Hole 1105A) near Leg 118 have also been...

The significance of Good Chair as part of children’s school and home environment in the preventive treatment of body statistics distortions

OpenAIRE

Mirosław Mrozkowiak; Hanna Żukowska

2015-01-01

Mrozkowiak Mirosław, Żukowska Hanna. Znaczenie Dobrego Krzesła, jako elementu szkolnego i domowego środowiska ucznia, w profilaktyce zaburzeń statyki postawy ciała = The significance of Good Chair as part of children’s school and home environment in the preventive treatment of body statistics distortions. Journal of Education, Health and Sport. 2015;5(7):179-215. ISSN 2391-8306. DOI 10.5281/zenodo.19832 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%287%29%3A179-215 https:...

The positive effect of oxygenated solvents for the synthetic use of electroregenerated ytterbium(II)

International Nuclear Information System (INIS)

Frontana-Uribe, Bernardo A.; Little, R. Daniel

2005-01-01

The addition of an oxygen based solvent, THF for example, to classical electrochemical media (DMF or ACN) improved the electrochemical behavior of the Yb(III)/Yb(II) couple. Two highlights of using 2:1 THF-DMF include the diminishing of the passivation at the carbon vitreous electrode when successive cycles are recorded and the almost totally reversible response of the system. The complexing effect of THF positively affects the electron-transfer kinetics of the redox couple, being faster in DMF-THF than in ACN-THF. A similar complexation effect was confirmed using tetraglyme as a cosolvent. The use of 2:1 THF-DMF allowed us to successfully substitute reticulated vitreous carbon in place of mercury as the working electrode for the Yb(II) electrogeneration experiments. Due to the stability of the alcoholate-Yb(III) complex, the recycling of Yb(III) to Yb(II) could not be achieved in the pinacolization reactions that were attempted