15C-15F Charge Symmetry and the 14C(n,γ)15C Reaction Puzzle
International Nuclear Information System (INIS)
Timofeyuk, N.K.; Thompson, I.J.; Baye, D.; Descouvemont, P.; Kamouni, R.
2006-01-01
The low-energy reaction 14 C(n,γ) 15 C provides a rare opportunity to test indirect methods for the determination of neutron capture cross sections by radioactive isotopes versus direct measurements. It is also important for various astrophysical scenarios. Currently, puzzling disagreements exist between the 14 C(n,γ) 15 C cross sections measured directly, determined indirectly, and calculated theoretically. To solve this puzzle, we offer a strong test based on a novel idea that the amplitudes for the virtual 15 C→ 14 C+n and the real 15 F→ 14 O+p decays are related. Our study of this relation, performed in a microscopic model, shows that existing direct and some indirect measurements strongly contradict charge symmetry in the 15 C and 15 F mirror pair. This brings into question the experimental determinations of the astrophysically important (n,γ) cross sections for short-lived radioactive targets
Distribution of spin dipole transition strength in the 15N(n,p)15C reaction
International Nuclear Information System (INIS)
Cellar, A.; Alford, W.P.; Helmer, R.; Abegg, R.; Frekers, D.; Haeusser, O.; Henderson, R.S.; Jackson, K.P.; Vetterli, M.; Yen, S.; Jeppesen, R.; Larson, B.; Mildenberger, J.; Pointon, B.W.; Trudel, A.
1990-08-01
The reaction 15 N(n,p) 15 C was studied at a neutron energy of 288 MeV using the TRIUMF (n,p) charge exchange facility and a high pressure gas target. The angular distributions for spin dipole (ΔL=1) transitions to the states in 15 C at energies 0 MeV and 0.740 MeV, as well as for higher excitation energies, were measured and the results were compared with DWIA calculations. The measured distribution of the spin dipole strength agrees well with shell model predictions, indicating that a rather simple model provides a satisfactory description of the 15 N ground state, and of positive parity states in 15 C up to about 18 MeV excitation. The magnitude of the peak cross sections (at ≅ 7 degrees) is described well by the calculations when the theoretical cross section is renormalized by a factor 0.7. The calculated cross sections near zero degrees are generally smaller than experimental data. It this is a general feature of ΔL=1 transitions, it suggests that estimates of GT strength based on a multipole decomposition of measured cross sections may be too high. (Author) (41 refs., 3 tabs., 14 figs.)
Preparation of 15N-13C-fulminic acid
International Nuclear Information System (INIS)
Wilmes, R.; Winnewisser, M.
1993-01-01
The precursor for the title compound was prepared in a three-step synthesis. The 13 C-label was incorporated in the first step employing 2- 13 C-ethyl acetate and the 15 N-label in the last step, using 15 N-sodium nitrite. Upon pyrolysis the precursor forms three fragments, one of them being the title compound. (Author)
Resonances in the nuclear reactions 15N + 12C and 15N + 16O
International Nuclear Information System (INIS)
Monnehan, G.A.
1987-06-01
The reaction 12 C + 15 N have been studied at 15 N beam energies between 30 and 70 MeV. For each reaction, about twelve residual nuclei have been identified through the γ-ray detection method. Excitation functions were obtained for the fusion and peripheral channels. Resonances are seen in the channels containing at least one α particle at energies below 50 MeV. At higher energies, strong structures are observed in the direct reaction channels. The evolution of the fusion cross section is well reproduced by a model based on the statistical desexcitation of the compound nucleus if the discrete states of the residual nuclei are taken into account. The favourable observation of resonant phenomena in 15 N induced reactions can be understood in terms of a small number of channels open to the grazing wave. In the range 50 to 60 MeV, there is a strong coupling between the fusion and the direct reaction channels. The occurrence of resonances above E lab = 50 MeV in the peripheral channels is explained with the band crossing and effective barrier models. In the 15 N induced reactions, the absorption of the surface waves is weak [fr
Martin, Gary E; Hilton, Bruce D; Irish, Patrick A; Blinov, Kirill A; Williams, Antony J
2007-10-01
Utilization of long-range (1)H--(15)N heteronuclear chemical shift correlation has continually grown in importance since the first applications were reported in 1995. More recently, indirect covariance NMR methods have been introduced followed by the development of unsymmetrical indirect covariance processing methods. The latter technique has been shown to allow the calculation of hyphenated 2D NMR data matrices from more readily acquired nonhyphenated 2D NMR spectra. We recently reported the use of unsymmetrical indirect covariance processing to combine (1)H--(13)C GHSQC and (1)H--(15)N GHMBC long-range spectra to yield a (13)C--(15)N HSQC-HMBC chemical shift correlation spectrum that could not be acquired in a reasonable period of time without resorting to (15)N-labeled molecules. We now report the unsymmetrical indirect covariance processing of (1)H--(13)C GHMBC and (1)H--(15)N IMPEACH spectra to afford a (13)C--(15)N HMBC-IMPEACH spectrum that has the potential to span as many as six to eight bonds. Correlations for carbon resonances long-range coupled to a protonated carbon in the (1)H--(13)C HMBC spectrum are transferred via the long-range (1)H--(15)N coupling pathway in the (1)H--(15)N IMPEACH spectrum to afford a much broader range of correlation possibilities in the (13)C--(15)N HMBC-IMPEACH correlation spectrum. The indole alkaloid vincamine is used as a model compound to illustrate the application of the method. (c) 2007 John Wiley & Sons, Ltd.
Synthesis of (+-)-[1,1'-15N2, 2'-13C]-trans-3'-methylnicotine
International Nuclear Information System (INIS)
Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr.
1992-01-01
The synthesis of (±)- [1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine is reported. 15 N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/[carbonyl- 13 C]-methyl formate. The resulting 15 n-Pyridine-3-[ 13 C-carbonyl]-carboxaldehyde was reacted with 15 N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give (±)- [1,1'- 15 N 2 , 5'- 13 C]-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave (±)-[1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine. (Author)
Fate of [15N]glycine in peat as determined by 13C and 15N CP-MAS NMR spectroscopy
International Nuclear Information System (INIS)
Benzing-Purdie, L.M.; Cheshire, M.V.; Williams, B.L.; Sparling, G.P.; Ratcliffe, C.I.; Ripmeester, J.A.
1986-01-01
Peat samples, nonsterile, sterilized by γ irradiation or autoclaving, were incubated with [ 15 N]glycine for a period of 6 months. The 13 C NMR data showed the established trend of increased humification with decreasing particle size and that autoclaving had significantly disturbed the humification-particle size distribution. The 15 N CP-MAS NMR spectra showed the presence of [ 15 N]glycine in all fractions after incubation. 15 NH 4 + , a result of either biological or chemical deamination, was one of the main products in the nonsterile peat series. The 15 N spectra also showed resonances corresponding to amine, secondary amide, and pyrrole-type nitrogen and the presence of glycine derivatives and melanoidins. The results presented give the first spectroscopic evidence of the possible involvement of the Maillard reaction in the humification process
Synthesis and NMR characterization of ( sup 15 N)taurine (2-( sup 15 N)aminoethanesulfonic acid)
Energy Technology Data Exchange (ETDEWEB)
Philippossian, G.; Welti, D.H.; Fumeaux, R.; Richli, U.; Anantharaman, K. (Nestle Research Centre, Nestec Ltd., Lausanne (Switzerland))
1989-11-01
The title compound was prepared in three steps with 55% overall yield starting from potassium ({sup 15}N)phthalimide. The synthetic route involved reaction with 1,2-dibromoethane, hydrolysis of the resulting N-(2-bromoethyl) ({sup 15}N)phthalimide with HBr and treatment of the 2-bromoethyl({sup 15}N)amine thus formed with sodium sulphite. The product was characterized by {sup 13}C, {sup 1}H and {sup 15}N NMR spectroscopy. The absolute coupling constants of {sup 15}N with the {sup 13}C nuclei and the non-exchanging protons were determined and an unambiguous assignment of the proton signals obtained. (author).
Progress in 15N and 13C separation by isotopic exchange
International Nuclear Information System (INIS)
Axente, D.
2004-01-01
An experimental study of 15 N separation by isotopic exchange in NO, NO 2 - HNO 3 system under pressure is presented. The pressure increase in 15 N separation plant improved the isotopic transport between the two phases circulated in counter-current in the packed column according to a better kinetics of isotopic exchange at higher pressures. The operation of 15 N separation plant at a pressure of 1.8 atm (absolute) will permit doubling of 10 M nitric acid flow rate and of 15 N production of a given column. The improved performance at a higher pressure is significant for large scale 15 N production, which would be utilized for uranium nitride fuels for FBRs. Enrichment of 13 C by chemical exchange between CO 2 and amine carbamate in nonaqueous solvent has been modelled. For process optimization the steady state separation and the height equivalent to a theoretical plate (HETP) have been determined for different experimental conditions and simulated for higher pressures than atmospheric one. At lower temperature (5 deg C) as the pressure increases the quantity of CO 2 dissolved in amine solution increases. For process analysis at higher pressures and lower temperatures, the two steps model has been considered. At 0.9 MPa pressure and 5 deg C the reaction rate is higher than at 25 deg C and atmospheric pressure, the value of HETP being lower with more than 100% than at 25 deg C. (author)
Cormie, A. B.; Schwarcz, H. P.
1996-11-01
We have examined the relationship of bone collagen δ15N and δ13C to climatic variables, humidity, temperature, and amount of precipitation using fifty-nine specimens of North American white-tailed deer ( Odocoileus virginianus) from forty-six different locations. In previous studies of African mammals there was a significant correlation between bone collagen δ15N and local amount of precipitation. Results presented here similarly show an increase in δ15N with decreasing amount of precipitation but only for 25% of the animals, namely those consuming more than 10% C 4 plants. These animals also exhibited a significant correlation between δ13C and temperature which mirrors previous observations for grasses suggesting that these deer consume grasses during times of population and nutrient stress. In contrast, even in dry areas containing high proportions of C 4 grasses, the majority of the deer had consumed low amounts of C 4 plants and these deer did not have δ15N which correlate with amount of precipitation. Only when deer deviated from their normal feeding pattern by consuming C 4 plants or grasses did their δ15N correlate with amount of rainfall. For these animals, consumption of C 4 plants or grasses may signal conditions of water and nutrient stress. An increase in δ15N of bone collagen may result from combined effects from excretion of concentrated urine (to conserve water) and increased internal recycling of nitrogen (to conserve nitrogen).
International Nuclear Information System (INIS)
Shiro, Yoshitsugu; Iizuka, Tetsutaro; Makino, Ryu; Ishimura, Yuzuru; Morishima, Isao
1989-01-01
The cyanide (C 15 N - ) complex of Pseudomonas putida cytochrome P-450 (P-450 cam ) exhibited well-resolved and hyperfine-shifted 15 N NMR resonances arising from the iron-bound C 15 N - at 423 and 500 ppm in the absence and presence of the substrate, d-camphor, respectively. The values were smaller than those for cyanide complexes of myoglobin and hemoglobin (∼ 1000 ppm) but fell into the same range as those for the cyanide complexes of peroxidases (∼ 500 ppm). The 15 N shift values of P-450 cam were not incompatible with the existence of anionic ligand, such as cysteinyl thiolate anion, at the fifth coordination site of heme iron. The difference in the 15 N chemical shift values between camphor-free and bound enzymes was inferred by the increase in the steric constraint to the Fe-C-N bond upon substrate binding
Fate of 15N and 14C from labelled plant material
DEFF Research Database (Denmark)
Rasmussen, Jim; Gjettermann, Birgitte; Eriksen, Jørgen
2008-01-01
strength of labelled plant residues in dissolved inorganic N (DIN) and dissolved organic N (DON) in pore water from the plough layer, and (ii) the plant uptake of organically bound N. Litterbags containing 14C- and 15N-labelled ryegrass or clover roots or leaves were inserted into the sward of a ryegrass......–clover mixture in early spring. The fate of the released 14C and 15N was monitored in harvested biomass, roots, soil, and pore water percolating from the plough layer. No evidence of plant uptake of dual-labelled organic compounds from the dual-labelled residues could be observed. N in pore water from the plough...
Synthesis of 15N-enriched fertilizers. Pt. II. Synthesis of 15N-enriched urea
International Nuclear Information System (INIS)
Bondassolli, J.A.; Trivelin, P.C.O.; Mortatti, J.; Victoria, R.L.
1988-01-01
The results of studies on the production of 15 N-urea through the reaction between 15 N-enriched anhidrous ammonia, carbon monoxide and sulfur, using hydrogen sulfite as a auto catalizers and methyl alcohol as a liquid reaction medium is presented. The influence of the quantities of reagents on final yield of synthesised urea were studied. Analysis of the cost of 5 Atoms % 15 N-enriched urea were made. (M.A.C.) [pt
Complete fusion of the 12C+12O, 14N+12C and 15N+12C systems
International Nuclear Information System (INIS)
Conjeaud, M.; Gary, S.; Harar, S.; Wieleczko, J.P.
1978-01-01
Cross sections for evaporation residues following the complete fusion of the 12 C+ 12 C, 14 N+ 12 C and 15 N+ 12 C systems have been measured with a E-ΔE counter telescope in a wide range of incident energies. They are fairly well reproduced by evaporation calculations based on the statistical theory. The total fusion excitation function of the 12 C+ 12 C system shows strong structure, which is compared to the predictions of the reaction cross sections derived from coupled channel calculations and to the integrated inelastic cross sections. Critical angular momenta have been obtained from the fusion cross-section data and these values are discussed in the framework of compound nucleus and entrance channel effects. A striking difference is observed between the fusion cross sections of the 14 N+ 12 C and 15 N+ 12 C systems and shows the importance of the valence nucleons of colliding ions in the fusion process. A possible interpretation might be the influence of the yrast line of the compound nuclei. (Auth.)
Production of 15N-enriched nitric acid (H15NO3
Directory of Open Access Journals (Sweden)
C. R. Sant Ana Filho
2008-12-01
Full Text Available Techniques that employ 15N have proved to be an important tool in many areas of the agronomic and biomedical sciences. Nevertheless, their use is limited by methodological difficulties and by the price of compounds in the international market. Nitric compounds (15NO3- have attracted the interest of researchers. However, these compounds are not currently produced in Brazil. Thus, in the present work H15NO3 was obtained from the oxidation of anhydrous 15NH3. The method we used differs from the industrial process in that the absorption tower is replaced with a polytetrafluoroethylene-lined, stainless-steel hydration reactor. The process output was evaluated based on the following parameters: reaction temperature; ratio of reagents; pressure and flow of 15NH3(g through the catalyst (Pt/Rh. The results showed that, at the best conditions (500 ºC; 50 % excess O2; 0.4 MPa; and 3.39 g.min-1 of 15NH3, a conversion percentage (N-15NH3 to N-15NO3- of 62.2 %, an overall nitrogen balance (N-15NH3 + N-15NO3- of 86.8 %, and purity higher than 99 % could be obtained.
The CN/C15N isotopic ratio towards dark clouds
Hily-Blant, P.; Pineau des Forêts, G.; Faure, A.; Le Gal, R.; Padovani, M.
2013-09-01
Understanding the origin of the composition of solar system cosmomaterials is a central question, not only in the cosmochemistry and astrochemistry fields, and requires various approaches to be combined. Measurements of isotopic ratios in cometary materials provide strong constraints on the content of the protosolar nebula. Their relation with the composition of the parental dark clouds is, however, still very elusive. In this paper, we bring new constraints based on the isotopic composition of nitrogen in dark clouds, with the aim of understanding the chemical processes that are responsible for the observed isotopic ratios. We have observed and detected the fundamental rotational transition of C15N towards two starless dark clouds, L1544 and L1498. We were able to derive the column density ratio of C15N over 13CN towards the same clouds and obtain the CN/C15N isotopic ratios, which were found to be 500 ± 75 for both L1544 and L1498. These values are therefore marginally consistent with the protosolar value of 441. Moreover, this ratio is larger than the isotopic ratio of nitrogen measured in HCN. In addition, we present model calculations of the chemical fractionation of nitrogen in dark clouds, which make it possible to understand how CN can be deprived of 15N and HCN can simultaneously be enriched in heavy nitrogen. The non-fractionation of N2H+, however, remains an open issue, and we propose some chemical way of alleviating the discrepancy between model predictions and the observed ratios. Appendices are available in electronic form at http://www.aanda.orgThe reduced spectra (in FITS format) are available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/557/A65
International Nuclear Information System (INIS)
Popelis, Yu.Yu.; Liepin'sh, E.E.; Lukevits, E.Ya.
1986-01-01
The 1 H, 13 C, and 15 N NMR spectra of 15 N-enriched 5-substituted furfural oximes were investigated. It was shown that the chemical shifts of the ring atoms and the oxime group correlate satisfactorily with the F and R substituent constants, whereas their sensitivity to the effect of the substituents is lower than in monosubstituted furan derivatives. The constants of spin-spin coupling between the ring protons and the oxime group were determined. An analysis of the 1 H- 1 H spin-spin coupling constants (SSCC) on the basis of their stereospecificity indicates that the E isomers have primarily an s-trans conformation in polar dimethyl sulfoxide, whereas the Z isomers, on the other hand, have an s-cis conformation. The signs of the direct and geminal 13 C- 15 N SSCC were determined for 5-trimethylsilylfurfural oxime
(13)C-(15)N correlation via unsymmetrical indirect covariance NMR: application to vinblastine.
Martin, Gary E; Hilton, Bruce D; Blinov, Kirill A; Williams, Antony J
2007-12-01
Unsymmetrical indirect covariance processing methods allow the derivation of hyphenated 2D NMR data from the component 2D spectra, potentially circumventing the acquisition of the much lower sensitivity hyphenated 2D NMR experimental data. Calculation of HSQC-COSY and HSQC-NOESY spectra from GHSQC, COSY, and NOESY spectra, respectively, has been reported. The use of unsymmetrical indirect covariance processing has also been applied to the combination of (1)H- (13)C GHSQC and (1)H- (15)N long-range correlation data (GHMBC, IMPEACH, or CIGAR-HMBC). The application of unsymmetrical indirect covariance processing to spectra of vinblastine is now reported, specifically the algorithmic extraction of (13)C- (15)N correlations via the unsymmetrical indirect covariance processing of the combination of (1)H- (13)C GHSQC and long-range (1)H- (15)N GHMBC to produce the equivalent of a (13)C- (15)N HSQC-HMBC correlation spectrum. The elimination of artifact responses with aromatic solvent-induced shifts (ASIS) is shown in addition to a method of forecasting potential artifact responses through the indirect covariance processing of the GHSQC spectrum used in the unsymmetrical indirect covariance processing.
1H, 15N and 13C NMR Assignments of Mouse Methionine Sulfoxide Reductase B2
Breivik, Åshild S.; Aachmann, Finn L.; Sal, Lena S.; Kim, Hwa-Young; Del Conte, Rebecca; Gladyshev, Vadim N.; Dikiy, Alexander
2011-01-01
A recombinant mouse methionine-r-sulfoxide reductase 2 (MsrB2ΔS) isotopically labeled with 15N and 15N/13C was generated. We report here the 1H, 15N and 13C NMR assignments of the reduced form of this protein. PMID:19636904
International Nuclear Information System (INIS)
Bendassolli, J.A.; Mortatti, J.; Trivelin, P.C.O.; Victoria, R.L.
1988-01-01
The results of 15 N-anhydrous ammonia production through reaction between 15 N-enriched ammonium sulphate and sodium hidroxide are reported. Influence of the reaction temperature, carrier gas flow, reaction time and mass of ammonium sulphate on the production of anhydrous ammonia were studied. Analyses for the cost of production of 5% atoms in 15 N-enriched anhydrous ammonia were made. (M.A.C.) [pt
Patrick J. Mulholland; Jennifer L. Tank; Diane M. Sanzone; Wilfrid M. Wollheim; Bruce J. Peterson; Jackson R. Webster; Judy L. Meyer
2000-01-01
Trophic relationships were examined using natural-abundance 13C and 15N analyses and a 15N-tracer addition experiment in Walker Branch, a 1st-order forested stream in eastern Tennessee. In the 15N-tracer addition experiment, we added 15NH4...
International Nuclear Information System (INIS)
Elliger, C.A.
1988-01-01
A method for preparative isolation of 15 N-tomatine from foliage of tomato plants grown hydroponically with 15 N-containing nutrient salts is described. Extractive workup of plant material gave a crude product which was chromatographed on Sephadex LH-20 to yield pure tomatine. Assay of 15 N content by mass spectrometry showed that isotopic purity was ca. 95%. (author)
Large old trees influence patterns of delta13C and delta15N in forests.
Weber, Pascale; Bol, Roland; Dixon, Liz; Bardgett, Richard D
2008-06-01
Large old trees are the dominant primary producers of native pine forest, but their influence on spatial patterns of soil properties and potential feedback to tree regeneration in their neighbourhood is poorly understood. We measured stable isotopes of carbon (delta(13)C) and nitrogen (delta(15)N) in soil and litter taken from three zones of influence (inner, middle and outer zone) around the trunk of freestanding old Scots pine (Pinus sylvestris L.) trees, to determine the trees' influence on below-ground properties. We also measured delta(15)N and delta(13)C in wood cores extracted from the old trees and from regenerating trees growing within their three zones of influence. We found a significant and positive gradient in soil delta(15)N from the inner zone, nearest to the tree centre, to the outer zone beyond the tree crown. This was probably caused by the higher input of (15)N-depleted litter below the tree crown. In contrast, the soil delta(13)C did not change along the gradient of tree influence. Distance-related trends, although weak, were visible in the wood delta(15)N and delta(13)C of regenerating trees. Moreover, the wood delta(15)N of small trees showed a weak negative relationship with soil N content in the relevant zone of influence. Our results indicate that large old trees control below-ground conditions in their immediate surroundings, and that stable isotopes might act as markers for the spatial and temporal extent of these below-ground effects. John Wiley & Sons, Ltd
Indirect Measurement of 15N(p,α)12C and 18O(p,α)15N. Applications to the AGB Star Nucleosynthesis
International Nuclear Information System (INIS)
La Cognata, M.; Spitaleri, C.; Cherubini, S.; Crucilla, V.; Gulino, M.; Lamia, L.; Pizzone, R. G.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S.; Sergi, M. L.; Tumino, A.; Tribble, R.; Al-Abdullah, T.; Banu, A.; Fu, C.; Goldberg, V.; Mukhamedzhanov, A.; Tabacaru, G.; Trache, L.
2008-01-01
The Trojan Horse Method has been recently applied to the study of reactions involved in fluorine nucleosynthesis inside AGB stars. Fluorine abundance is important since it allows to constrain mixing models from the comparison of the observed fluorine abundances with the ones predicted by models. Anyway direct measurements of the cross section do not extend down to the Gamow peak, which is the astrophysically relevant energy region. In particular the study focuses on the 15 N(p,α) 12 C and the 18 O(p,α) 15 N reactions which can influence fluorine yield as they are part of 19 F production/destruction network
Synthesis of (+-)-(1,1'- sup 15 N sub 2 , 2'- sup 13 C)-trans-3'-methylnicotine
Energy Technology Data Exchange (ETDEWEB)
Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr. (Department of Health and Human Services, Atlanta, GA (United States))
1992-03-01
The synthesis of ({+-})- (1,1'-{sup 15}N{sub 2}, 2'-{sup 13}C)-trans-3'-methylnicotine is reported. {sup 15}N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/(carbonyl-{sup 13}C)-methyl formate. The resulting {sup 15}n-Pyridine-3-({sup 13}C-carbonyl)-carboxaldehyde was reacted with {sup 15}N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give ({+-})- (1,1'-{sup 15}N{sub 2}, 5'-{sup 13}C)-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave ({+-})-(1,1'-{sup 15}N{sub 2}, 2'-{sup 13}C)-trans-3'-methylnicotine. (Author).
Comparison of 15N- and 13C-determined parameters of mobility in melittin
International Nuclear Information System (INIS)
Zhu Lingyang; Prendergast, Franklyn G.; Kemple, Marvin D.
1998-01-01
Backbone and tryptophan side-chain mobilities in the 26-residue, cytolytic peptide melittin (MLT) were investigated by 15 N and 13 C NMR. Specifically, inverse-detected 15 N T 1 and steady-state NOE measurements were made at 30 and 51 MHz on MLT at 22 deg. C enriched with 15 N at six amide positions and in the Trp 19 side chain. Both the disordered MLT monomer (1.2 mM peptide at pH 3.6 in neat water) and α-helical MLT tetramer (4.0 mM peptide at pH 5.2 in 150 mM phosphate buffer) were examined. The relaxation data were analyzed in terms of the Lipari and Szabo model-free formalism with three parameters: τ m , the correlation time for the overall rotation; S 2 , a site-specific order parameter which is a measure of the amplitude of the internal motion; and τ e , a local, effective correlation time of the internal motion. A comparison was made of motional parameters from the 15 N measurements and from 13 C measurements on MLT, the latter having been made here and previously [Kemple et al. (1997) Biochemistry, 36, 1678-1688]. τ m and τ e values were consistent from data on the two nuclei. In the MLT monomer, S 2 values for the backbone N-H and Cα-H vectors in the same residue were similar in value but in the tetramer the N-H order parameters were about 0.2 units larger than the Cα-H order parameters. The Trp side-chain N-H and C-H order parameters, and τ e values were generally similar in both the monomer and tetramer. Implications of these results regarding the dynamics of MLT are examined
International Nuclear Information System (INIS)
Straus, Suzana K.; Bremi, Tobias; Ernst, Richard R.
1998-01-01
High-resolution heteronuclear NMR correlation experiments and strategies are proposed for the assignment of fully 13 C/ 15 N-labelled polypeptides in the solid state. By the combination of intra-residue and inter-residue 13 C- 15 N correlation experiments with 13 C- 13 C spin-diffusion studies, it becomes feasible to partially assign backbone and side-chain resonances in solid proteins. The performance of sequences using 15 N instead of 13 C detection is evaluated regarding sensitivity and resolution for a labelled dipeptide (L-Val-L-Phe). The techniques are used for a partial assignment of the 15 N and 13 C resonances in human ubiquitin
Application of 15N labeling to topics in molecular hematology
International Nuclear Information System (INIS)
Lapidot, A.; Irving, C.S.
1975-01-01
The amount of information which can be obtained from many types of spectrometric analysis of compounds of hematological interest can be greatly enhanced when measurements are made on a series of isotopically labeled compounds. A murine Friend virus-induced erythroleukemic cell (FLC) culture was found to be a superior biosynthetic system for the preparation of highly and selectively 15 N and 13 C enriched hemoglobins. A mutant of Rhodopseudomonas spheroides was found suitable for the preparation of larger quantities of >90 percent enriched protoporphyrin-IX- 15 N and coproporphyrin-III-- 15 N. A comparison of the 15 N and 13 C NMR spectra of FLC carbomonoxy-[Gly- 15 N]-hemoglobin, carbomonoxy-[Gly- 13 C/sub alpha/]-hemoglobin, α and β globin-[Gly- 15 N] and globin-[Gly- 13 C/sub alpha/] demonstrated 1) 15 N peptide chemical shifts are sensitive to polypeptide sequence, whereas 13 C α-carbon chemical shifts are not, (2) variations in the solvation of the peptide N-H group can be detected in the 15 N spectra but not the 13 C spectra, (3) 15 N heme resonances could not be detected, whereas 13 C resonances could. These studies indicated that in hemoglobin the glycyl N-H resonances are either solvated by H 2 O or hydrogen bonded to peptide C=0 groups. In denatured globin, the majority of the glycyl residues are rapidly exchanging between these two states
Directory of Open Access Journals (Sweden)
P. von Hessberg
2004-01-01
Full Text Available The isotopically substituted nitrous oxide species 14N14NO, 15N14NO, 14N15NO and 15N15NO were investigated by ultra-violet (UV absorption spectroscopy. High precision cross sections were obtained for the wavelength range 181 to 218nm at temperatures of 233 and 283K. These data are used to calculate photolytic isotopic fractionation constants as a function of wavelength. The fractionation constants were used in a three-dimensional chemical transport model in order to simulate the actual fractionation of N2O in the stratosphere, and the results were found to be in good agreement with field studies.
Synthesis of hydroxylamine-15 N.HCl
International Nuclear Information System (INIS)
Baldea, Aurel
2001-01-01
15 N labelled hydroxylamine is one of the starting substance for synthesis of labelled oximes. Industrial procedure was chosen to prepare hydroxylamine- 15 N. Sodium nitrite reduced by sodium bisulfite and sulfur dioxide, at temperature of 0-2 deg. C, produces sodium hydroxylamine disulfonate. The reaction mixture is treated with acetone and the resulting acetoxime is distilled. In order to obtain crystalline hydroxylamine hydrochloride, hydrochloric acid is added to the distillate and the solution is evaporated to dryness. The crude product was purified by recristallization, yielding 62-65% of theoretical amount. Labelled ammonium chloride formed as byproduct can be recovered improving 15 N balance. IR spectra is used for chemical analysis and mass spectrometry for isotopic analysis. For this purpose hydroxylamine- 15 N is converted into molecular nitrogen. (author)
[Studies with 15N-labeled lysine in colostomized hens. 2. 15N excretion in feces].
Gruhn, K; Wiefel, P
1983-05-01
Over a period of four days colostomised hens were given 15N-lysine, and the development of 15N-excretion both in the TCA-soluble and the TCA-precipitable fraction of the faeces was measured over eight days. In both fractions the total, lysine, histidine and arginine N and 15N-excess (15N') was determined. The average apparent digestibility of 14N was 81.2% +/- 1.1% and of 15N' 93.2% +/- 0.7%. Labelled N is already excreted in faeces 3 hours after its application. The TCA-precipitable N is less strongly labelled than the TCA-soluble N. During the application of 15N' the labelling in faecal lysine is nearly one power of ten higher than in total N. The atom-% 15N' of the lysine could also be distinctly detected in arginine and histidine. The quotas of the total 15N' in faeces were 3.5% for arginine-15N' and 0.8% for histidine 15N'; 15N' can mainly be detected in the soluble fraction.
International Nuclear Information System (INIS)
Liu, Nan; Nittler, Larry R.; Alexander, Conel M. O’D.; Wang, Jianhua; Pignatari, Marco
2017-01-01
We report C, N, and Si isotopic data for 59 highly 13 C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 15 N-rich ( 14 N/ 15 N ≤ solar) AB grains, and their Mg–Al, S, and Ca–Ti isotope data when available. These 37 grains are enriched in 13 C, 15 N, and 26 Al with the PNGs showing more extreme enhancements. The 15 N-rich AB grains show systematically higher 26 Al and 30 Si excesses than the 14 N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 ( 14 N/ 15 N < solar) and 2 ( 14 N/ 15 N ≥ solar). For the first time, we have obtained both S and Ti isotopic data for five AB1 grains and one PNG and found 32 S and/or 50 Ti enhancements. Interestingly, one AB1 grain had the largest 32 S and 50 Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the 32 S excess and thus the initial presence of radiogenic 32 Si ( t 1/2 = 153 years). More importantly, we found that the 15 N and 26 Al excesses of AB1 grains form a trend that extends to the region in the N–Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.
Liu, Nan; Nittler, Larry R.; Pignatari, Marco; O'D. Alexander, Conel M.; Wang, Jianhua
2017-06-01
We report C, N, and Si isotopic data for 59 highly 13C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 15N-rich (14N/15N ≤ solar) AB grains, and their Mg-Al, S, and Ca-Ti isotope data when available. These 37 grains are enriched in 13C, 15N, and 26Al with the PNGs showing more extreme enhancements. The 15N-rich AB grains show systematically higher 26Al and 30Si excesses than the 14N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 (14N/15N PNG and found 32S and/or 50Ti enhancements. Interestingly, one AB1 grain had the largest 32S and 50Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the 32S excess and thus the initial presence of radiogenic 32Si (t 1/2 = 153 years). More importantly, we found that the 15N and 26Al excesses of AB1 grains form a trend that extends to the region in the N-Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.
Synthesis of 15N-enriched urea (CO(15NH22 from 15NH3, CO, and S in a discontinuous process
Directory of Open Access Journals (Sweden)
C. R. Sant Ana Filho
2012-12-01
Full Text Available CO(15NH22 enriched with the stable isotope 15N was synthesized based on a reaction involving CO, 15NH3, and S in the presence of CH3OH. The method differs from the industrial method; a stainless steel reactor internally lined with polytetrafluoroethylene (PTFE was used in a discontinuous process under low pressure and temperature. The yield of the synthesis was evaluated as a function of the parameters: the amount of reagents, reaction time, addition of H2S, liquid solution and reaction temperature. The results showed that under optimum conditions (1.36, 4.01, and 4.48 g of 15NH3, CO, and S, respectively, 40 ml CH3OH, 40 mg H2S, 100 ºC and 120 min of reaction 1.82 g (yield 76.5% of the compound was obtained per batch. The synthesized CO(15NH22 contained 46.2% N, 0.55% biuret, melting point of 132.55 ºC and did not exhibit isotopic fractionation. The production cost of CO(15NH22 with 90.0 at. % 15N was US$ 238.60 per gram.
15N fractionation in infrared-dark cloud cores
Zeng, S.; Jiménez-Serra, I.; Cosentino, G.; Viti, S.; Barnes, A. T.; Henshaw, J. D.; Caselli, P.; Fontani, F.; Hily-Blant, P.
2017-07-01
Context. Nitrogen is one of the most abundant elements in the Universe and its 14N/15N isotopic ratio has the potential to provide information about the initial environment in which our Sun formed. Recent findings suggest that the solar system may have formed in a massive cluster since the presence of short-lived radioisotopes in meteorites can only be explained by the influence of a supernova. Aims: We seek to determine the 14N/15N ratio towards a sample of cold and dense cores at the initial stages in their evolution. Methods: We observed the J = 1 → 0 transitions of HCN, H13CN, HC15N, HN13C, and H15NC towards a sample of 22 cores in four infrared-dark clouds (IRDCs) which are believed to be the precursors of high-mass stars and star clusters. Assuming LTE and a temperature of 15 K, the column densities of HCN, H13CN, HC15N, HN13C, and H15NC are calculated and their 14N/15N ratio is determined for each core. Results: The 14N/15N ratios measured in our sample of IRDC cores range between 70 and ≥763 in HCN and between 161 and 541 in HNC. These ratios are consistent with the terrestrial atmosphere (TA) and protosolar nebula (PSN) values, and with the ratios measured in low-mass prestellar cores. However, the 14N/15N ratios measured in cores C1, C3, F1, F2, and G2 do not agree with the results from similar studies towards the same cores using nitrogen bearing molecules with nitrile functional group (-CN) and nitrogen hydrides (-NH) although the ratio spread covers a similar range. Conclusions: Relatively low 14N/15N ratios amongst the four-IRDCs were measured in IRDC G which are comparable to those measured in small cosmomaterials and protoplanetary disks. The low average gas density of this cloud suggests that the gas density, rather than the gas temperature, may be the dominant parameter influencing the initial nitrogen isotopic composition in young PSN. The reduced spectra (FITS files) are only available at the CDS via anonymous ftp to http
Redox-controlled backbone dynamics of human cytochrome c revealed by 15N NMR relaxation measurements
International Nuclear Information System (INIS)
Sakamoto, Koichi; Kamiya, Masakatsu; Uchida, Takeshi; Kawano, Keiichi; Ishimori, Koichiro
2010-01-01
Research highlights: → The dynamic parameters for the backbone dynamics in Cyt c were determined. → The backbone mobility of Cyt c is highly restricted due to the covalently bound heme. → The backbone mobility of Cyt c is more restricted upon the oxidation of the heme. → The redox-dependent dynamics are shown in the backbone of Cyt c. → The backbone dynamics of Cyt c would regulate the electron transfer from Cyt c. -- Abstract: Redox-controlled backbone dynamics in cytochrome c (Cyt c) were revealed by 2D 15 N NMR relaxation experiments. 15 N T 1 and T 2 values and 1 H- 15 N NOEs of uniformly 15 N-labeled reduced and oxidized Cyt c were measured, and the generalized order parameters (S 2 ), the effective correlation time for internal motion (τ e ), the 15 N exchange broadening contributions (R ex ) for each residue, and the overall correlation time (τ m ) were estimated by model-free dynamics formalism. These dynamic parameters clearly showed that the backbone dynamics of Cyt c are highly restricted due to the covalently bound heme that functions as the stable hydrophobic core. Upon oxidation of the heme iron in Cyt c, the average S 2 value was increased from 0.88 ± 0.01 to 0.92 ± 0.01, demonstrating that the mobility of the backbone is further restricted in the oxidized form. Such increases in the S 2 values were more prominent in the loop regions, including amino acid residues near the thioether bonds to the heme moiety and positively charged region around Lys87. Both of the regions are supposed to form the interaction site for cytochrome c oxidase (CcO) and the electron pathway from Cyt c to CcO. The redox-dependent mobility of the backbone in the interaction site for the electron transfer to CcO suggests an electron transfer mechanism regulated by the backbone dynamics in the Cyt c-CcO system.
International Nuclear Information System (INIS)
Wada, E.
1987-01-01
Distributions of δ 15 N and δ 13 C for biogenic substances in the Antarctic Ocean and in the Otsuchi River estuary in Japan were investigated to construct isotope biogeochemical framework for assessing marine ecosystems. The isotopic compositions of phytoplankton were particularly low in the Antarctic Ocean. High nitrate and CO 2 concentrations in the surface sea waters, and the low light intensity seem to enhance the kinetic isotope fractionations that preferred the depletion of 15 N and 13 C in the algal body. A clear-cut linear relationship between animal δ 15 N and its trophic level was obtained in the Antarctic system. In the estuary, the variation of isotope ratios were principally governed by the mixing of land-derived organic matter, marine phytoplankton, and seagrasses. A food-chain effect of 15 N enrichment was also confirmed. An isotopically ordered structure was presented for a marine estuarine ecosystem. The isotopic abundances in a food network vary mainly because of the variation in 15 N and 13 C contents of primary producers grown under different environmental conditions and because of the enrichment of 15 N along food chains. (author)
Indirect measurement of the 15N(p,α)12C reaction cross section through the THM
International Nuclear Information System (INIS)
Romano, S.; La Cognata, M.; Spitaleri, C.; Cherubini, S.; Gulino, M.; Lamia, L.; Musumarra, A.; Tribble, R.; Trache, C.L.; Fu, C.
2005-01-01
Among the reactions of the stellar CNO cycle, the 15 N(p,α) 12 C plays a crucial role. In particular its reaction rate is important for understanding the CNOI escape towards CNOII. Thus it is important to study its bare nucleus cross section at the energies typical of such astrophysical environments, i.e. few tens of keV. At these energies such a measurement is hard to perform in a direct way because of the electron screening effect as pointed out for several cases. A possibility is then given by indirect methods and in particular the Trojan Horse Method (THM) has been applied in this case. The preliminary validity test for the study of 15 N(p,α) 12 C via the 15 N(d,α 12 C)n three body reaction is reported in this work. A 15 N beam was provided by the cyclotron at Texas A and M University with energy 60 MeV/c and delivered onto a CD 2 target. A ΔE/E telescope (PSD + ionization chamber) and a pair of PSD's were mounted in a coplanar geometry. Coincidences between the detectors were considered and the 15 N-p quasi-free contribution to the overall three-body cross-section was selected. Data analysis and preliminary results will be discussed and compared with direct data. (author)
Species specific and environment induced variation of δ13C and δ15N in alpine plants
Directory of Open Access Journals (Sweden)
Yang eYang
2015-06-01
Full Text Available Stable carbon and nitrogen isotope signals in plant tissues integrate plant-environment interactions over long periods. In this study, we hypothesized that humid alpine life conditions are narrowing the scope for significant deviations from common carbon, water and nitrogen relations as captured by stable isotope signals. We explored the variation in δ13C and δ15N in 32 plant species from tissue type to ecosystem scale across a suite of locations at c. 2500 m elevation in the Swiss Alps. Foliar δ13C and δ15N varied among species by about 3-4 ‰ and 7-8 ‰ respectively. However, there was no overall difference in means of δ13C and δ15N for species sampled in different plant communities or when bulk plant dry matter harvests of different plant communities were compared. δ13C was found to be highly species specific, so that the ranking among species was mostly maintained across 11 habitats. However, δ15N varied significantly from place to place in all species (a range of 2.7 ‰ except in Fabaceae (Trifolium alpinum and Juncaceae (Luzula lutea. There was also a substantial variation among individuals of the same species collected next to each other. No difference was found in foliar δ15N of non-legumes, which were either collected next to or away from the most common legume, T. alpinum. δ15N data place Cyperaceae and Juncaceae, just like Fabaceae, in a low discrimination category, well separated from other families. Soil δ15N was higher than in plants and increased with soil depth. The results indicate a high functional diversity in alpine plants that is similar to that reported for low elevation plants. We conclude that the surprisingly high variation in δ13C and δ15N signals in the studied high elevation plants is largely species specific (genetic and insensitive to obvious environmental cues.
Energy Technology Data Exchange (ETDEWEB)
McCleskey, M; Mukhamedzhanov, A M; Trache, L; Tribble, R E; Banu, A; Eremenko, V; Goldberg, V Z; Lui, Y W; McCleskey, E; Roeder, B T; Spiridon, A; Carstoiu, F; Burjan, V; Hons, Z; Thompson, I J
2014-04-17
The 14C + n <--> 15C system has been used as a test case in the evaluation of a new method to determine spectroscopic factors that uses the asymptotic normalization coefficient (ANC). The method proved to be unsuccessful for this case. As part of this experimental program, the ANCs for the 15C ground state and first excited state were determined using a heavy-ion neutron transfer reaction as well as the inverse kinematics (d,p) reaction, measured at the Texas A&M Cyclotron Institute. The ANCs were used to evaluate the astrophysical direct neutron capture rate on 14C, which was then compared with the most recent direct measurement and found to be in good agreement. A study of the 15C SF via its mirror nucleus 15F and a new insight into deuteron stripping theory are also presented.
International Nuclear Information System (INIS)
Rana, J.; Robins, D.J.
1985-01-01
The labelling patterns in (+)-lupanine, (+)-13-hydroxylupanine, and (+)-angustifoline derived biosynthetically from [1-amino- 15 N,1- 13 C]-1,5-diaminopentane (cadaverine) have been established by 13 C n.m.r. spectroscopy. Three cadaverine units are incorporated to about the same extent into each of these three alkaloids. The presence of two doublets due to 13 C- 15 N coupling in the 13 C brace 1 H brace n.m.r. spectra associated with C-2 and C-15 of lupanine and 13-hydroxylupanine, and one 13 C- 15 N doublet at C-2 of angustifoline, indicate that two of the cadaverine units are converted into the outer rings of the tetracyclic quinolizidine alkaloids in a specific fashion. (author)
Applications of stable isotopes of 2H, 13C and 15N to clinical problems
International Nuclear Information System (INIS)
Klein, P.D.; Szczepanik, P.A.; Hachey, D.L.
1974-01-01
The function of the Argonne Program is to provide synthetic, analytical instrumental capability in a core facility for the clinical investigator who needs to use 2 H, 13 C, or 15 N labelled compounds for metabolic or clinical research on pregnant women, newborn infants, young children, or for mass screening. To carry out such application development, there were six stages which were recurrent steps in every application. Five fundamental strategies should be adopted to establish the use of stable isotopes in clinical work. The instrument required for measurements was a combined gas chromatograph-mass spectrometer, and its use was schematically illustrated. Some of the successful experiences with compounds labelled by stable isotopes, such as deuterium labelled chenodeoxycholic acid, and respective 13 C and 15 N-labelled glycine were described. Deutrium labelled bile acid enabled easy and safe determination of the size of the bile acid pool and the replacement rate, providing clearer diagnoses for cholestatic liver disease and gallstones. 13 C and 15 N labelled compounds were used in clinical studies, of children with genetic disorders of amino acid metabolism, i.e., non ketotic hyperflycinemia, B 12 -responsive methyl malonic acidemia, and Lesch-Nyhan syndrome. 15 N-labelled glycine was also studied in a child with Lesch-Nyhan syndrome. (Mukohata, S.)
Energy Technology Data Exchange (ETDEWEB)
Liu, Nan; Nittler, Larry R.; Alexander, Conel M. O’D.; Wang, Jianhua [Department of Terrestrial Magnetism, Carnegie Institution for Science, Washington, DC 20015 (United States); Pignatari, Marco [E. A. Milne Centre for Astrophysics, Department of Physics and Mathematics, University of Hull, Hull HU6 7RX (United Kingdom)
2017-06-10
We report C, N, and Si isotopic data for 59 highly {sup 13}C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 {sup 15}N-rich ({sup 14}N/{sup 15}N ≤ solar) AB grains, and their Mg–Al, S, and Ca–Ti isotope data when available. These 37 grains are enriched in {sup 13}C, {sup 15}N, and {sup 26}Al with the PNGs showing more extreme enhancements. The {sup 15}N-rich AB grains show systematically higher {sup 26}Al and {sup 30}Si excesses than the {sup 14}N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 ({sup 14}N/{sup 15}N < solar) and 2 ({sup 14}N/{sup 15}N ≥ solar). For the first time, we have obtained both S and Ti isotopic data for five AB1 grains and one PNG and found {sup 32}S and/or {sup 50}Ti enhancements. Interestingly, one AB1 grain had the largest {sup 32}S and {sup 50}Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the {sup 32}S excess and thus the initial presence of radiogenic {sup 32}Si ( t {sub 1/2} = 153 years). More importantly, we found that the {sup 15}N and {sup 26}Al excesses of AB1 grains form a trend that extends to the region in the N–Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.
International Nuclear Information System (INIS)
Aumen, N.G.; Bottomley, P.J.; Gregory, S.V.
1985-01-01
Surface wood samples obtained from a Douglas fir log incubated in vitro with [ 14 C]lignocellulose in a defined mineral salts medium supplemented with 10 mg of N liter -1 of 15 N-labeled NO 3 - (50 atom % 15 N). Evolution of 14 CO 2 , distribution and isotopic dilution of 15 N, filtrate N concentrations, and the rates of denitrification, N 2 fixation, and respiration were measured at 6, 12, and 18 days of incubation. The organic N content of the lignocellulose-wood sample mixture had increased from 132 μg of N to a maximum of 231 μg of N per treatment after 6 days of incubation. Rates of [ 14 C]lignocellulose decomposition were greatest during the first 6 days and then began to decline over the remaining 12 days. Total CO 2 evolution was also highest at day 6 and declined steadily over the remaining duration of the incubation. Filtrate NH 4 + -N increased from background levels to a final value of 57 μg of N per treatment. Filtrate NO 3 - N completely disappeared by day 6, and organic N showed a slight decline between days 12 and 18. The majority of the 15 N that could be recovered appeared in the particulate organic fraction by day 6 (41 μg of N), and the filtrate NH 4 + N fraction contained 11 μg of 15 N by day 18. The 15 N enrichment values of the filtrate NH 4 + and the inorganic N associated with the particulate fraction had increased to approximately 20 atom % 15 N by 18 days of incubation, whereas the particulate organic fraction reached its highest enrichment by day 6. Measurements of N 2 fixation and denitrification indicated an insignificant gain or loss of N from the experimental system by these processes. The data show that woody debris in stream ecosystems might function as a rapid and efficient sink for exogenous N, resulting in stimulation of wood decomposition and subsequent activation of other N cycling processes
International Nuclear Information System (INIS)
Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J.
1994-01-01
Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study utilizes nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy (more than 10,000 mw) in this arena requires stable isotope enrichment. Herein, the authors present strategies for the site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of [U- 13 C, 15 N] DNA from methylotrophic bacteria. With commercially available 6-chloropurine, an effective 2-step route leads to [6- 15 N]-2'-deoxadenosine (dA). The resulting [6- 15 N]-dA is used in a series of reactions to synthesize [2- 13 C, 1,2'- 15 N 2 ]-2'-deoxyguanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4g of methanol to yield 1 gram of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. The authors are currently developing large scale isolation protocols. General synthetic pathways to oligomeric DNA are presented
International Nuclear Information System (INIS)
Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J.
1994-01-01
Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study uses nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy for DNA molecules with mw > 10,000 requires stable isotope enrichment. We present strategies for site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of (U- 13 C, 15 N) DNA from methylotropic bacteria. With commercially available 6-chloropurine, an effective two-step route leads to 2'-deoxy-(amino- 15 N)adenosine (dA). The resulting d(amino- 15 N)A is used in a series of reactions to synthesize 2'-deoxy-(2- 13 C,1,amino- 15 N 2 )guanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4 g of methanol to yield 1 g of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. We are currently developing large-scale isolation protocols. General synthetic pathways to oligomeric DNA will be presented
Effect of body size and body mass on δ 13 C and δ 15 N in coastal fishes and cephalopods
Vinagre, C.; Máguas, C.; Cabral, H. N.; Costa, M. J.
2011-11-01
Carbon and nitrogen isotopes have been widely used in the investigation of trophic relations, energy pathways, trophic levels and migrations, under the assumption that δ 13C is independent of body size and that variation in δ 15N occurs exclusively due to ontogenetic changes in diet and not body size increase per se. However, several studies have shown that these assumptions are uncertain. Data from food-webs containing an important number of species lack theoretical support on these assumptions because very few species have been tested for δ 13C and δ 15N variation in captivity. However, if sampling comprises a wide range of body sizes from various species, the variation of δ 13C and δ 15N with body size can be investigated. While correlation between body size and δ 13C and δ 15N can be due to ontogenetic diet shifts, stability in such values throughout the size spectrum can be considered an indication that δ 13C and δ 15N in muscle tissues of such species is independent of body size within that size range, and thus the basic assumptions can be applied in the interpretation of such food webs. The present study investigated the variation in muscle δ 13C and δ 15N with body size and body mass of coastal fishes and cephalopods. It was concluded that muscle δ 13C and δ 15N did not vary with body size or mass for all bony fishes with only one exception, the dragonet Callionymus lyra. Muscle δ 13C and δ 15N also did not vary with body size or mass in cartilaginous fishes and cephalopods, meaning that body size/mass per se have no effect on δ 13C or δ 15N, for most species analysed and within the size ranges sampled. The assumption that δ 13C is independent of body size and that variation in δ 15N is not affected by body size increase per se was upheld for most organisms and can be applied to the coastal food web studied taking into account that C. lyra is an exception.
International Nuclear Information System (INIS)
Billault, Isabelle; Courant, Frederique; Pasquereau, Leo; Derrien, Solene; Robins, Richard J.; Naulet, Norbert
2007-01-01
The active ingredient of ecstasy, N-methyl-3,4-methyldioxyphenylisopropylamine (MDMA) can be manufactured by a number of easy routes from simple precursors. We have synthesised 45 samples of MDMA following the five most common routes using N-precursors from 12 different origins and three different precursors for the aromatic moiety. The 13 C and 15 N contents of both the precursors and the MDMA samples derived therefrom were measured by isotope ratio mass spectrometry coupled to an elemental analyser (EA-IRMS). We show that within-pathway correlation between the 15 N content of the precursor and that of the derived MDMA can be strong but that no general pattern of correlation can be defined. Rather, it is evident that the δ 15 N values of MDMA are strongly influenced by a combination of the δ 15 N values of the source of nitrogen used, the route by which the MDMA is synthesised, and the experimental conditions employed. Multivariate analysis (PCA) based on the δ 15 N values of the synthetic MDMA and of the δ 15 N and δ 13 C values of the N-precursors leads to good discrimination between the majority of the reaction conditions tested
N-Mesityl-C-acylketenimines: 1,5-Sigmatropic Shifts and Electrocyclization to Quinolines.
Rao, V. V. Ramana; Fulloon, Belinda E.; Bernhardt, Paul V.; Koch, Rainer; Wentrup, Curt
1998-08-21
Flash vacuum thermolysis (FVT) of triazoles 6a-c generates alpha-oxoketenimines 10, the ester 10a being isolable. FVT of pyrroledione 8 generates the isomeric imidoylketene 9a. Ketenes 9 and ketenimines 10 undergo thermal interconversion by 1,3-shifts of methoxy and dimethylamino groups under mild FVT conditions (ca. 350-400 degrees C). Both 9 and 10 are directly observable by IR spectroscopy at either 77 K or on Ar matrix isolation at 12 K. On FVT at temperatures above ca. 400 degrees C, the ketenimines 10 undergo a 1,5-H shift to o-quinoid imines 12/13, followed by electrocyclization to dihydroquinolines 14 (unobserved) and 15 (observed by NMR). The latter are easily oxidized to alkylquinoline-3-carboxylates or quinoline-3-carboxamides 16 by atmospheric oxygen. Ab initio calculations on model compounds 18-23 predict an energy barrier of ca. 38 kcal mol(-)(1) (161 kJ mol(-)(1)) for the 1,5-H shift in N-(o-methylphenyl)ketenimines via the transition state TS19 followed by an electrocyclization barrier to dihydroquinoline 23a via TS22a of ca. 16 kcal mol(-)(1).
International Nuclear Information System (INIS)
Saito, S.M.T.
1974-01-01
The effect of the forms 15 N H 4 and 15 N O 3 in presence or absence of organic matter and of the nitrification inhibitor AM (2-amino-4-chloro-6-methyl-pyrimidine) in dry matter weight and nitrogen content of the plant derived from soil and form fertilizer is studied. The experiment was carried out in greenhouse and the test plant was the hybrid Maize Centralmex . The fertilizers ( 15 N H 4 ) 2 S O 4 and Na 15 N O 3 , were added in two levels: 40 and 120 Kg N/ha, with 1,02% of N and 1,4% of 15 N in excess, respectively. Three soils of different physical and chemical characteristics were used; Regosol intergrade, Latosol Roxo and Podzolized de Lins e Marilia var. Marilia. (M.A.C.)
Nitrogen-15-labeled deoxynucleosides. 3. Synthesis of [3-15N]-2'-deoxyadenosine
International Nuclear Information System (INIS)
Rhee, Young-Sook; Jones, R.A.
1990-01-01
The synthesis of [3- 15 N]-labeled adenine has been reported by several groups. Each of these syntheses followed essentially the same route, in which the 15 N is introduced by nitration of 4-bromoimidazole under forcing conditions using [ 15 N]-HNO 3 . The authors have devised an alternate route which uses an azo coupling reaction for introduction of the 15 N and proceeds through the intermediacy of [5- 15 N]-labeled 5-aminoimidazole-4-carboxamide (AICA). An unrelated route to the [5- 15 N]-labeled 5-amino-imidazole ribonucleoside (AIRs) was recently reported. AICA is a versatile precursor, which is most commonly used for entry into the guanine or isoguanine families, although it is usually used as the AICA-riboside rather than the heterocycle itself. The authors have found that AICA also can be used for the adenine family by cyclization to hypoxanthine using diethoxymethyl acetate in DMF at reflux. Although these conditions are more vigorous than those required for cyclization of 4,5-diaminopyrimidines using this reagent, the reaction works well. In addition, they report high-yield enzymatic conversion of [3- 15 N]-adenine to [3- 15 N]-2'-deoxyadenosine
Energy Technology Data Exchange (ETDEWEB)
Wu, Junjun; Zhang, Qian; Yang, Fan; Lei, Yao; Zhang, Quanfa; Cheng, Xiaoli, E-mail: xlcheng@fudan.edu.cn
2016-10-15
We investigated soil microbial biomass and its natural abundance of δ{sup 13}C and δ{sup 15}N in aggregates (> 2000 μm, 250–2000 μm, 53–250 μm and < 53 μm) of afforested (implementing woodland and shrubland plantations) soils, adjacent croplands and open area (i.e., control) in the Danjiangkou Reservoir area of central China. The afforested soils averaged higher microbial biomass carbon (MBC) and nitrogen (MBN) levels in all aggregates than in open area and cropland, with higher microbial biomass in micro-aggregates (< 250 μm) than in macro-aggregates (> 2000 μm). The δ{sup 13}C of soil microbial biomass was more enriched in woodland soils than in other land use types, while δ{sup 15}N of soil microbial biomass was more enriched compared with that of organic soil in all land use types. The δ{sup 13}C and δ{sup 15}N of microbial biomass were positively correlated with the δ{sup 13}C and δ{sup 15}N of organic soil across aggregates and land use types, whereas the {sup 13}C and {sup 15}N enrichment of microbial biomass exhibited linear decreases with the corresponding C:N ratio of organic soil. Our results suggest that shifts in the natural {sup 13}C and {sup 15}N abundance of microbial biomass reflect changes in the stabilization and turnover of soil organic matter (SOM) and thereby imply that afforestation can greatly impact SOM accumulation over the long-term. - Highlights: • Afforested soils averaged higher microbial biomass in all aggregates than cropland. • Microbial biomass was higher in micro-aggregates than in macro-aggregates. • δ{sup 13}C and δ{sup 15}N of microbe positively correlated with δ{sup 13}C and δ{sup 15}N of organic soil. • {sup 13}C and {sup 15}N enrichment of microbe was negatively related to with soil C:N ratio.
Stable isotope analysis (δ (13)C and δ (15)N) of soil nematodes from four feeding groups.
Melody, Carol; Griffiths, Bryan; Dyckmans, Jens; Schmidt, Olaf
2016-01-01
Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis ((13)C/(12)C and (15)N/(14)N, expressed as δ (13)C and δ (15)N) has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000) to achieve required minimum sample weights (typically >100 µg C and N). Here, micro-sample near-conventional elemental analysis-isotopic ratio mass spectrometry (μEA-IRMS) of C and N using microgram samples (typically 20 µg dry weight), was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus), bacterial feeders (Plectus and Rhabditis), omnivores (Aporcelaimidae and Qudsianematidae) and plant feeder (Rotylenchus). Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ (15)N (p = 0.290) or δ (13)C (p = 0.706) between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ (15)N = 1.08 to 3.22 mUr‰, δ (13)C = -29.58 to -27.87 mUr) and all other groups. There was an average difference of 9.62 mUr in δ (15)N between the plant feeder and the predator group (δ (15)N = 9.89 to 12.79 mUr, δ (13)C = -27.04 to -25.51 mUr). Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr(2)) and the predators (1.73 mUr(2)), but largest for
Stable isotope analysis (δ13C and δ15N of soil nematodes from four feeding groups
Directory of Open Access Journals (Sweden)
Carol Melody
2016-09-01
Full Text Available Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis (13C/12C and 15N/14N, expressed as δ13C and δ15N has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000 to achieve required minimum sample weights (typically >100 µg C and N. Here, micro-sample near-conventional elemental analysis–isotopic ratio mass spectrometry (μEA–IRMS of C and N using microgram samples (typically 20 µg dry weight, was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus, bacterial feeders (Plectus and Rhabditis, omnivores (Aporcelaimidae and Qudsianematidae and plant feeder (Rotylenchus. Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ15N (p = 0.290 or δ13C (p = 0.706 between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ15N = 1.08 to 3.22 mUr‰, δ13C = –29.58 to –27.87 mUr and all other groups. There was an average difference of 9.62 mUr in δ15N between the plant feeder and the predator group (δ15N = 9.89 to 12.79 mUr, δ13C = –27.04 to –25.51 mUr. Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr2 and the predators (1.73 mUr2, but largest for omnivores (3.83 mUr2
Energy Technology Data Exchange (ETDEWEB)
Bergner, H; Bergner, U; Adam, K [Humboldt-Universitaet, Berlin (German Democratic Republic). Sektion Tierproduktion und Veterinaermedizin
1984-07-01
4 male castrated pigs (55-65 kg) either received a wheat-fish meal diet (1 and 2) or a wheat-horse bean diet (3 and 4) without straw meal supplement (1 and 3) or with a supplement of 20% dry matter (2 and 4). In order to investigate whether a /sup 15/N labelling of the pigs is also possible with a protein excess in the ration, the animals received 24.8 g (1 and 2) and 11.6 g crude protein/kg/sup 0.75/ live weight (3 and 4). During a 10-day /sup 15/N-labelling 385 mg /sup 15/N excess (/sup 15/N') per kg/sup 0.75/ were applied with /sup 15/N labelling the following quotas of the applied /sup 15/N amount were incorporated: 1 = 10.2%, 2 = 7.2%, 3 = 18.7%, 4 = 14.4%. /sup 15/N excretion in both TCA fractions of feces showed a highly significant positive correlation to the increasing content of crude fibre in the 4 diets. The immediate /sup 15/N incorporation into the TCA-precipitable fraction of feces proves that /sup 15/N enters the large intestine endogenously and serves bacterial protein synthesis. 3 days after the last /sup 15/N application the pigs were killed. The values of atom-% /sup 15/N' were determined in the TCA-precipitable blood plasma and in the TCA-precipitable fraction of the liver. The other examined organs and tissues showed smaller differences between the test animals. The results show that the /sup 15/N labelling of tissues and organs of pigs is also possible at a high level of protein supply by means of an oral application of (/sup 15/N) ammonia salts.
International Nuclear Information System (INIS)
Hawke, D.J.; Clark, J.M.
2010-01-01
Seabird burrows provide a soil environment for processing discards such as feathers and guano, hence constituting a primary interface between the sea and the land. This study involved collection and culturing of soil invertebrates from three blue penguin (Eudyptula minor) burrows, and examined their 13 C/ 12 C and 15 N/ 14 N isotopic composition in relation to potential burrow resources (terrestrial plant litter, burrow soil, guano, blue penguin feathers). Two taxa (cerylonid beetles and small tineid moth larvae) had a depleted 13 C/ 12 C indicative of a level of dependence on C from terrestrial soil. Tineid moth larvae (Monopis crocicapitella and (or) M. ethelella) substantially increased their 13 C/ 12 C enrichment during development, implying increasing dependence on marine C. Remaining taxa, both decomposers and predators, had 13 C/ 12 C intermediate between guano and feathers. Larval and emergent fleas had the most enriched 13 C/ 12 C , indicative of a greater dependence on feather C and the likelihood of co-processing with guano. Pseudoscorpions and histerid beetles had overlapping isotopic enrichments implying competition for prey, but were spatially separated in burrow soil. With their highly enriched 15 N/ 14 N and marine 13 C/ 12 C, larvae and protonymphs of the histiostomatid mite Myianoetus antipodus stood alone. Blue penguin burrows therefore support a diverse invertebrate fauna that incorporates terrestrial soil as well as varying proportions of the various blue penguin discards. (author). 45 refs., 1 fig., 1 tab.
Energy Technology Data Exchange (ETDEWEB)
Wiedemann, Christoph; Goradia, Nishit; Häfner, Sabine [Leibniz Institute for Age Research, Fritz Lipmann Institute, Research Group Biomolecular NMR Spectroscopy (Germany); Herbst, Christian [Ubon Ratchathani University, Department of Physics, Faculty of Science (Thailand); Görlach, Matthias; Ohlenschläger, Oliver; Ramachandran, Ramadurai, E-mail: raman@fli-leibniz.de [Leibniz Institute for Age Research, Fritz Lipmann Institute, Research Group Biomolecular NMR Spectroscopy (Germany)
2015-10-15
A simple triple resonance NMR experiment that leads to the correlation of the backbone amide resonances of each amino acid residue ‘i’ with that of residues ‘i−1’ and ‘i+1’ in ({sup 13}C, {sup 15}N) labelled intrinsically disordered proteins (IDPs) is presented. The experimental scheme, {HN-NCA heteronuclear TOCSY-NH}, exploits the favourable relaxation properties of IDPs and the presence of {sup 1}J{sub CαN} and {sup 2}J{sub CαN} couplings to transfer the {sup 15}N{sub x} magnetisation from amino acid residue ‘i’ to adjacent residues via the application of a band-selective {sup 15}N–{sup 13}C{sup α} heteronuclear cross-polarisation sequence of ∼100 ms duration. Employing non-uniform sampling in the indirect dimensions, the efficacy of the approach has been demonstrated by the acquisition of 3D HNN chemical shift correlation spectra of α-synuclein. The experimental performance of the RF pulse sequence has been compared with that of the conventional INEPT-based HN(CA)NH pulse scheme. As the availability of data from both the HCCNH and HNN experiments will make it possible to use the information extracted from one experiment to simplify the analysis of the data of the other and lead to a robust approach for unambiguous backbone and side-chain resonance assignments, a time-saving strategy for the simultaneous collection of HCCNH and HNN data is also described.
International Nuclear Information System (INIS)
Bastidas, O.G.; Alvarez, A.; Victoria, R.L.; Urquiaga C, S.; Muraoka, T.
1984-01-01
The fate of nitrogen fertilizers in rice cultivars (Cica-8) is studied. Urea (1.973% at of 15 N) and ammonium sulfate (1.826% at of 15 N) are used. The fertilizers are applied in four levels (0,100,200 and 300 Kg N/ha) in shadow coditions and after 30 days of germination. (M.A.C.) [pt
Variation in hair δ13C and δ15N values in long-tailed macaques (Macaca fascicularis) from Singapore
Schillaci, Michael A.; Castellini, J. Margaret; Stricker, Craig A.; Jones-Engel, Lisa; Lee, Benjamin P.Y.-H.
2014-01-01
Much of the primatology literature on stable isotope ratios of carbon (δ13C) and nitrogen (δ15N) has focused on African and New World species, with comparatively little research published on Asian primates. Here we present hair δ13C and δ15N isotope values for a sample of 33 long-tailed macaques from Singapore. We evaluate the suggestion by a previous researcher that forest degradation and biodiversity loss in Singapore have led to a decline in macaque trophic level. The results of our analysis indicated significant spatial variability in δ13C but not δ15N. The range of variation in δ13C was consistent with a diet based on C3 resources, with one group exhibiting low values consistent with a closed canopy environment. Relative to other macaque species from Europe and Asia, the macaques from Singapore exhibited a low mean δ13C value but mid-range mean δ15N value. Previous research suggesting a decline in macaque trophic level is not supported by the results of our study.
Directory of Open Access Journals (Sweden)
Lijie Yang
Full Text Available This study investigated the influence of nitrogen (N fertilizer and straw on intact amino acid N uptake by soil microorganisms and the relationship between amino acid turnover and soil properties during the wheat growing season. A wheat pot experiment was carried out with three treatments: control (CK, N fertilizer (NF and N fertilizer plus rice straw (NS. We used stable isotope compound-specific analysis to determine the uptake of 13C,15N-glycine by soil microorganisms. In the NF treatment, microbial 13C,15N-glycine uptake was lower compared with CK, suggesting that inorganic N was the preferred N source for soil microorganisms. However, The application of straw with N fertilizer (in NS treatment increased microbial 13C,15N-glycine uptake even with the same amount of N fertilizer application. In this treatment, enzyme activities, soil microbial biomass C and microbial biomass N increased simultaneously because more C was available. Soil mineral N and plant N contents all decreased substantially. The increased uptake of intact 13C,15N-glycine in the NS treatment can be attributed to direct assimilation by soil microorganisms to satisfy the demand for N when inorganic N was consumed.
Affordable uniform isotope labeling with 2H, 13C and 15N in insect cells
International Nuclear Information System (INIS)
Sitarska, Agnieszka; Skora, Lukasz; Klopp, Julia; Roest, Susan; Fernández, César; Shrestha, Binesh; Gossert, Alvar D.
2015-01-01
For a wide range of proteins of high interest, the major obstacle for NMR studies is the lack of an affordable eukaryotic expression system for isotope labeling. Here, a simple and affordable protocol is presented to produce uniform labeled proteins in the most prevalent eukaryotic expression system for structural biology, namely Spodoptera frugiperda insect cells. Incorporation levels of 80 % can be achieved for 15 N and 13 C with yields comparable to expression in full media. For 2 H, 15 N and 2 H, 13 C, 15 N labeling, incorporation is only slightly lower with 75 and 73 %, respectively, and yields are typically twofold reduced. The media were optimized for isotope incorporation, reproducibility, simplicity and cost. High isotope incorporation levels for all labeling patterns are achieved by using labeled algal amino acid extracts and exploiting well-known biochemical pathways. The final formulation consists of just five commercially available components, at costs 12-fold lower than labeling media from vendors. The approach was applied to several cytosolic and secreted target proteins
International Nuclear Information System (INIS)
Trivelin, P.C.O.
1988-05-01
The dynamic of N fertilizers, urea and aqua ammonia, in the soil of sugar cane crops are studied with an emphasis on the horizontal and vertical moving. The nitrogen routing from urea and aqua ammonia sources, by isotopic technique with 15 N in relation to the leaching, volatilization and extraction by the cultivation and residue of N immobilized manure in the soil with sugar cane plantation is also analysed. (C.G.C.)
15N Hyperpolarization of Imidazole-15N2 for Magnetic Resonance pH Sensing via SABRE-SHEATH.
Shchepin, Roman V; Barskiy, Danila A; Coffey, Aaron M; Theis, Thomas; Shi, Fan; Warren, Warren S; Goodson, Boyd M; Chekmenev, Eduard Y
2016-06-24
15 N nuclear spins of imidazole- 15 N 2 were hyperpolarized using NMR signal amplification by reversible exchange in shield enables alignment transfer to heteronuclei (SABRE-SHEATH). A 15 N NMR signal enhancement of ∼2000-fold at 9.4 T is reported using parahydrogen gas (∼50% para-) and ∼0.1 M imidazole- 15 N 2 in methanol:aqueous buffer (∼1:1). Proton binding to a 15 N site of imidazole occurs at physiological pH (p K a ∼ 7.0), and the binding event changes the 15 N isotropic chemical shift by ∼30 ppm. These properties are ideal for in vivo pH sensing. Additionally, imidazoles have low toxicity and are readily incorporated into a wide range of biomolecules. 15 N-Imidazole SABRE-SHEATH hyperpolarization potentially enables pH sensing on scales ranging from peptide and protein molecules to living organisms.
Steinitz, Ronnie; Lemm, Jeffrey M; Pasachnik, Stesha A; Kurle, Carolyn M
2016-01-15
Stable isotope analysis is a powerful tool for reconstructing trophic interactions to better understand drivers of community ecology. Taxon-specific stable isotope discrimination factors contribute to the best use of this tool. We determined the first Δ(13)C and Δ(15)N values for Rock Iguanas (Cyclura spp.) to better understand isotopic fractionation and estimate wild reptile foraging ecology. The Δ(13)C and Δ(15)N values between diet and skin, blood, and scat were determined from juvenile and adult iguanas held for 1 year on a known diet. We measured relationships between iguana discrimination factors and size/age and quantified effects of lipid extraction and acid treatment on stable isotope values from iguana tissues. Isotopic and elemental compositions were determined by Dumas combustion using an elemental analyzer coupled to an isotope ratio mass spectrometer using standards of known composition. The Δ(13)C and Δ(15)N values ranged from -2.5 to +6.5‰ and +2.2 to +7.5‰, respectively, with some differences among tissues and between juveniles and adults. The Δ(13)C values from blood and skin differed among species, but not the Δ(15)N values. The Δ(13)C values from blood and skin and Δ(15)N values from blood were positively correlated with size/age. The Δ(13)C values from scat were negatively correlated with size (not age). Treatment with HCl (scat) and lipid extraction (skin) did not affect the isotope values. These results should aid in the understanding of processes driving stable carbon and nitrogen isotope discrimination factors in reptiles. We provide estimates of Δ(13)C and Δ(15)N values and linear relationships between iguana size/age and discrimination factors for the best interpretation of wild reptile foraging ecology. Copyright © 2015 John Wiley & Sons, Ltd.
DEFF Research Database (Denmark)
Rasmussen, Jim; Kusliene, Gedrime; Jacobsen, Ole Stig
2013-01-01
that 15N also had a heterogeneous distribution (up to two orders of magnitude). Conclusion Bicarbonate can efficiently be used to introduce 14C or 13C into plant via the leaf-labeling method. Both 14C and 15N showed heterogeneous distribution in the plant, although the distribution of 15N was more even......Aims: Application of carbon (C) and nitrogen (N) isotopes is an essential tool to study C and N flows in plant-soil-microorganisms systems. When targeting single plants in a community the tracers need to be added via e.g., leaf-labeling or stem-feeding approaches. In this study we: (i) investigated...... if bicarbonate can be used to introduce 14C (or 13C) into white clover and ryegrass, and (ii) compared the patterns of 14C and 15N allocation in white clover and ryegrass to evaluate the homogeneity of tracer distribution after two alternative labeling approaches. Methods Perennial ryegrass and white clover were...
International Nuclear Information System (INIS)
Freitas, J.R. de.
1984-12-01
An experiment, carried out under field conditions in 12 lysimeters, each containing 3.0 ton of Oxic Paleudalf soil with four replicates, is described. This objective is labelling soil organic N. Nitrogen was incorporated into soil as maize straw, non-labelled and labelled with 15 N and ammonium sulphate - 15 N. The soil was sampled every 15 days in three different depths. N as NH + 4 , NO - 3 , total-N and (%)C and (%) moisture was analysed. (M.A.C.) [pt
Reaction π-p→ωn in the (15/40) GeV/c momentum range
International Nuclear Information System (INIS)
Apel, W.D.; Augenstein, K.H.; Krueger, M.; Mueller, H.; Schneider, H.; Sigurdsson, G.; Donskov, S.V.; Inyakin, A.V.; Kachanov, V.A.; Krasnokutsky, R.N.; Lednev, A.A.; Mikhailov, Yu.V.; Prokoshkin, Yu.D.; Shuvalov, R.S.; Leder, G.
1979-01-01
A high statistics measurement of the reaction π - p→ωn with ω→π 0 γ has been performed at the 70 GeV Serpukhov accelerator for 15, 20.2, 25, 30 and 40 GeV/c incident pion momentum, using the NICE set-up with its associated 648-channel γ-ray spectrometer. Values of the density matrix elements, differential and integral cross sections are reported. Already at 15 GeV/c, the unnatural parity exchange contribution to ω production in helicity 1 state is negligible. After a maximum around /t/ approximately equal to 0.12 (GeV/c) 2 , the differential cross section decreases exponentially up to /t/ approximately equal to 0.7 (GeV/c) 2 , where a break is seen in its slope. (author)
International Nuclear Information System (INIS)
Fushman, David; Cowburn, David
1999-01-01
Current approaches to 15N relaxation in proteins assume that the 15N-1H dipolar and 15N CSA tensors are collinear. We show theoretically that, when there is significant anisotropy of molecular rotation, different orientations of the two tensors, experimentally observed in proteins, nucleic acids, and small peptides, will result in differences in site- specific correlation functions and spectral densities. The standard treatments of the rates of longitudinal and transverse relaxation of amide 15N nuclei, of the 15N CSA/15N-1H dipolar cross correlation, and of the TROSY experiment are extended to account for the effect of noncollinearity of the 15N-1H dipolar and 15N CSA (chemical shift anisotropy) tensors. This effect, proportional to the degree of anisotropy of the overall motion, (D-parallel /D-perpendicular -1), is sensitive to the relative orientation of the two tensors and to the orientation of the peptide plane with respect to the diffusion coordinate frame. The effect is negligible at small degrees of anisotropy, but is predicted to become significant for D-parallel /D-perpendicular ≥1.5, and at high magnetic fields. The effect of noncollinearity of 15N CSA and 15N-1H dipolar interaction is sensitive to both gross (hydrodynamic) properties and atomic-level details of protein structure. Incorporation of this effect into relaxation data analysis is likely to improve both precision and accuracy of the derived characteristics of protein dynamics, especially at high magnetic fields and for molecules with a high degree of anisotropy of the overall motion. The effect will also make TROSY efficiency dependent on local orientation in moderately anisotropic systems
Energy Technology Data Exchange (ETDEWEB)
Trivelin, P C.O. [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil)
1988-05-01
The dynamic of N fertilizers, urea and aqua ammonia, in the soil of sugar cane crops are studied with an emphasis on the horizontal and vertical moving. The nitrogen routing from urea and aqua ammonia sources, by isotopic technique with {sup 15} N in relation to the leaching, volatilization and extraction by the cultivation and residue of N immobilized manure in the soil with sugar cane plantation is also analysed. (C.G.C.).
Capture cross-section and rate of the 14 C (n, γ) 15 C reaction from ...
Indian Academy of Sciences (India)
We calculate the Coulomb dissociation of 15C on a Pb target at 68 MeV/u incident beam energy within the fully quantum mechanical distorted wave Born approximation formalism of breakup reactions. The capture cross-section and the subsequent rate of the 14C(, )15C reaction are calculated from the ...
Energy Technology Data Exchange (ETDEWEB)
Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J. [Los Alamos National Laboratory, NM (United States)
1994-12-01
Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study uses nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy for DNA molecules with mw > 10,000 requires stable isotope enrichment. We present strategies for site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of (U-{sup 13}C, {sup 15}N) DNA from methylotropic bacteria. With commercially available 6-chloropurine, an effective two-step route leads to 2{prime}-deoxy-(amino-{sup 15}N)adenosine (dA). The resulting d(amino-{sup 15}N)A is used in a series of reactions to synthesize 2{prime}-deoxy-(2-{sup 13}C,1,amino-{sup 15}N{sub 2})guanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4 g of methanol to yield 1 g of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. We are currently developing large-scale isolation protocols. General synthetic pathways to oligomeric DNA will be presented.
Synthesis of organic compounds 15 N enriched
International Nuclear Information System (INIS)
Oliveira, Claudineia Raquel de; Bendassolli, Jose Albertino; Prestes, Clelber Vieira; Tavares, Glauco Arnold
2002-01-01
The aim of this work was to develop urea- 15 N and glycine- 15 N synthesis for agronomic and biological studies. The production of these compounds was evaluated due to the fact of increasing use of urea, comparing to others solid fertilizers and the importance of glycine in the studies of protein metabolism. A non-conventional method was carried out to synthesize urea. The process involved reaction among Co, NH 3 anidrid and S at low temperature (100 deg C) and of pressure (0,81 mPa) compared to the conventional method. Monolise halets reaction was carried out for glycine synthesis with chloroacetic and ammonia 2 deg C. Both compounds are economic viable, they can be produced at a lower price than the trade market one. (author)
Ner protein of phage Mu: Assignments using {sup 13}C/{sup 15}N-labeled protein
Energy Technology Data Exchange (ETDEWEB)
Strzelecka, T.; Gronenborn, A.M.; Clore, G.M. [National Institutes of Health, Bethesda, MD (United States)
1994-12-01
The Ner protein is a small (74-amino acid) DNA-binding protein that regulates a switch between the lysogenic and lytic stages of phage Mu. It inhibits expression of the C repressor gene and down-regulates its own expression. Two-dimensional NMR experiments on uniformly {sup 15}N-labeled protein provided most of the backbone and some of the sidechain proton assignments. The secondary structure determination using two-dimensional NOESY experiments showed that Ner consists of five {alpha}-helices. However, because most of the sidechain protons could not be assigned, the full structure was not determined. Using uniformly {sup 13}C/{sup 15}N-labeled Ner and a set of three-dimensional experiments, we were able to assign all of the backbone and 98% of the sidechain protons. In particular, the CBCANH and CBCA(CO)NH experiments were used to sequentially assign the C{alpha} and C{beta} resonances; the HCCH-CTOCSY and HCCH-COSY were used to assign sidechain carbon and proton resonances.
International Nuclear Information System (INIS)
Kurdali, F.; Al-Shamma'a, M.
2007-12-01
Variability in the natural abundance isotopes of 15 N and 13 C in leaves of several legume and non-legume plant species grown at different sites of two areas in semi-arid regions of Syria was determined. In the first area (non-saline soil), the 15 N values of a number of fixing and non-fixing reference plants ranged from -2.09 to +9.46, depending on plant species and studied site. 15 N in a number of legume species including Acacia cyanopylla (-1.73), Acacia farnesiana (-0.55), Prosopis juliflora (-1.64) and Medicago arborea (+1.6) were close to the atmospheric value pointing to a major contribution of N 2 fixing in these species; whereas, those of reference plants were highly positive (between +3.6 and +9.46%). In the actinorhizal tree, Elaeagnus angustifolia, the 15 N abundance was far lower (-0.46 to -2.1%) strongly suggesting that the plant obtained large proportional contribution from BNF. In contrast, δ 15 N values in some other legumes and actinorhizal plants were relatively similar to those of reference plants, suggesting that the contribution of fixed N 2 is negligible. On the other hand, δ 13 C% values in leaves of C3 plants were affected by plant species, ranging from a minimum of -28.67% to a maximum of -23%. However, they were the same within each plant species although they were grown at different sites. Moreover, dual stable isotope analysis in leaves of Prosopis juliflora and other non- legumes grown on a salt affected soil (second area) was also conducted. Results showed that salinity did not affect C assimilation in this woody legume since a higher carbon discrimination was obtained indicating that this plant is a salt tolerant species; whereas, N2-fixation was drastically affected (δ 15 N= +7.03). (Author)
Energy Technology Data Exchange (ETDEWEB)
Billault, Isabelle [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France)]. E-mail: Isabelle.Billault@univ-nantes.fr; Courant, Frederique [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France); Pasquereau, Leo [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France); Derrien, Solene [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France); Robins, Richard J. [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France); Naulet, Norbert [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France)
2007-06-12
The active ingredient of ecstasy, N-methyl-3,4-methyldioxyphenylisopropylamine (MDMA) can be manufactured by a number of easy routes from simple precursors. We have synthesised 45 samples of MDMA following the five most common routes using N-precursors from 12 different origins and three different precursors for the aromatic moiety. The {sup 13}C and {sup 15}N contents of both the precursors and the MDMA samples derived therefrom were measured by isotope ratio mass spectrometry coupled to an elemental analyser (EA-IRMS). We show that within-pathway correlation between the {sup 15}N content of the precursor and that of the derived MDMA can be strong but that no general pattern of correlation can be defined. Rather, it is evident that the {delta} {sup 15}N values of MDMA are strongly influenced by a combination of the {delta} {sup 15}N values of the source of nitrogen used, the route by which the MDMA is synthesised, and the experimental conditions employed. Multivariate analysis (PCA) based on the {delta} {sup 15}N values of the synthetic MDMA and of the {delta} {sup 15}N and {delta} {sup 13}C values of the N-precursors leads to good discrimination between the majority of the reaction conditions tested.
International Nuclear Information System (INIS)
Silva, Vilma M.; Colaco, Waldeciro; Encarnacao, Fernando A.F.
1999-01-01
Changes in N derived from 15 N sources (urea and vinasse), applied to two soils differing in texture (PV sandy, LR clayey), incorporated or not to sugar cane straw (dry leaves and sheathes) and incubated in an open system for 35 days, were evaluated through an isotope technique. Soil samples were collected 7, 14, 21, 28 and 35 days after applications to determine nitrogen fractions (total-N, N H 4 + - N and NO 3 - - N) derived from the labelled sources. Mineral N was taken as the sum of N H 4 + - N and N H 3 - -N. 15 N-abundances were determined in the concentrated extracts of these fractions. The mineral N net transformation rates were found from the mineral N obtained by taking the difference between the values of two subsequent incubation times. The results showed that mineral N transformation rates were initially positives in the treatments of 15 N-urea, and significantly higher (10,30 mg kg -1 d -1 , PV and 8,08 mg kg -1 d -1 , LR) than those obtained in the treatments with 15 N vinasse (1,11 mg kg -1 dia -1 , PV and 0,55 mg kg -1 dia -1 , LR). In general terms, mineral-N net transformation rates were negative (0,06 and 0,26 mg.kg -1 d -1 , PV; -1,44 and 0,07 mg.kg -1 .d -1 , LR, respective;y for urea and vinasse) indicating prevalence of immobilization. The results also showed small fluctuations among treatments at some of the incubation periods, which reflects the influence of characteristics and properties of both soils. (author)
Dabundo, Richard; Lehmann, Moritz F; Treibergs, Lija; Tobias, Craig R; Altabet, Mark A; Moisander, Pia H; Granger, Julie
2014-01-01
We report on the contamination of commercial 15-nitrogen (15N) N2 gas stocks with 15N-enriched ammonium, nitrate and/or nitrite, and nitrous oxide. 15N2 gas is used to estimate N2 fixation rates from incubations of environmental samples by monitoring the incorporation of isotopically labeled 15N2 into organic matter. However, the microbial assimilation of bioavailable 15N-labeled N2 gas contaminants, nitrate, nitrite, and ammonium, is liable to lead to the inflation or false detection of N2 fixation rates. 15N2 gas procured from three major suppliers was analyzed for the presence of these 15N-contaminants. Substantial concentrations of 15N-contaminants were detected in four Sigma-Aldrich 15N2 lecture bottles from two discrete batch syntheses. Per mole of 15N2 gas, 34 to 1900 µmoles of 15N-ammonium, 1.8 to 420 µmoles of 15N-nitrate/nitrite, and ≥21 µmoles of 15N-nitrous oxide were detected. One 15N2 lecture bottle from Campro Scientific contained ≥11 µmoles of 15N-nitrous oxide per mole of 15N2 gas, and no detected 15N-nitrate/nitrite at the given experimental 15N2 tracer dilutions. Two Cambridge Isotopes lecture bottles from discrete batch syntheses contained ≥0.81 µmoles 15N-nitrous oxide per mole 15N2, and trace concentrations of 15N-ammonium and 15N-nitrate/nitrite. 15N2 gas equilibrated cultures of the green algae Dunaliella tertiolecta confirmed that the 15N-contaminants are assimilable. A finite-differencing model parameterized using oceanic field conditions typical of N2 fixation assays suggests that the degree of detected 15N-ammonium contamination could yield inferred N2 fixation rates ranging from undetectable, detected in field assays. These results indicate that past reports of N2 fixation should be interpreted with caution, and demonstrate that the purity of commercial 15N2 gas must be ensured prior to use in future N2 fixation rate determinations.
International Nuclear Information System (INIS)
Corbett, Patricia A.; King, Catherine K.; Mondon, Julie A.
2015-01-01
Highlights: • Elevated δ15N and δ13C observed in fish tissue up to 4 km from the Davis Station wastewater outfall. • δ15N decreased stepwise with concentrations decreasing with distance from the discharge point. • The trend observed for δ13C almost mirrored δ15N. • Current wastewater treatment practices are insufficient to avoid uptake of contaminants in fish. - Abstract: Stable isotope ratios, δ15N and δ13C were effectively used to determine the geographical dispersion of human derived sewage from Davis Station, East Antarctica, using Antarctic rock cod (Trematomus bernacchii). Fish within 0–4 km downstream of the outfall exhibited higher δ15N and δ13C values relative to reference sites. Nitrogen in particular showed a stepped decrease in δ15N with increasing distance from the discharge point by 1–2‰. Stable isotopes were better able to detect the extent of wastewater contamination than other techniques including faecal coliform and sterol measures. Uptake and assimilation of δ15N and δ13C up to 4 km from the outfall adds to growing evidence indicating the current level of wastewater treatment at Davis Station is not sufficient to avoid impact to the surrounding environment. Isotopic assimilation in T. bernacchii is a viable biomarker for investigation of initial sewage exposure and longer term monitoring in the future
Chemienzymatic synthesis of Uridine. Nucleotides labeled with [15N] and [13C
DEFF Research Database (Denmark)
Gilles, Anne-Marie; Cristea, Ioan; Palibroda, Nicolae
1995-01-01
+necessary for the oxidation of glucose 6-phosphate and 6-phosphogluconate was recycled by glutamate dehydrogenase and excess of ammonia and a-oxoglutarate. Despite the number and complexity of the enzymatic steps, the synthesis of [15N,13C]UTP is straightforward with an overall yield exceeding 60%. This method, extended...... and diversified to the synthesis of all natural ribonucleotides, is a more economical alternative for obtaining nucleic acids for structural analysis by heteronuclear NMR spectroscopy....
Auto-inducing media for uniform isotope labeling of proteins with 15N, 13C and 2H
International Nuclear Information System (INIS)
Guthertz, Nicolas; Klopp, Julia; Winterhalter, Aurélie; Fernández, César; Gossert, Alvar D.
2015-01-01
Auto-inducing media for protein expression offer many advantages like robust reproducibility, high yields of soluble protein and much reduced workload. Here, an auto-inducing medium for uniform isotope labelling of proteins with 15 N, 13 C and/or 2 H in E. coli is presented. So far, auto-inducing media have not found widespread application in the NMR field, because of the prohibitively high cost of labeled lactose, which is an essential ingredient of such media. Here, we propose using lactose that is only selectively labeled on the glucose moiety. It can be synthesized from inexpensive and readily available substrates: labeled glucose and unlabeled activated galactose. With this approach, uniformly isotope labeled proteins were expressed in unattended auto-inducing cultures with incorporation of 13 C, 15 N of 96.6 % and 2 H, 15 N of 98.8 %. With the present protocol, the NMR community could profit from the many advantages that auto-inducing media offer
15 N separation in the Nitrox system under pressure
International Nuclear Information System (INIS)
Axente, D.; Baldea, A.; Teaca, C.; Horga, R.; Abrudean, M.
1999-01-01
The basic isotope exchange reaction responsible for the separation of 15 N in Nitrox system is that between gaseous nitrogen oxides and aqueous nitric acid with single stage separation factor α = 1.055 for M.l -1 nitric acid, at 25 deg. C and atmospheric pressure. The rate of nitrogen isotope exchange between NO and HNO 3 has been measured as a function of nitric oxide pressure 0.1 - 0.4 MPa for 1 and 2 M.l -1 . It is concluded that 15 N/ 14 N exchange rate in NO-HNO 3 system has a linear dependence on NO pressure as indicated by rate measurements at different NO partial pressure and constant overall pressure, by adding helium in reactor. Using the rate law: R = [HNO 3 ] 2 [N 2 O 3 ] the 15 N/ 14 N exchange rates for nitric acid concentrations 1.5 - 10 M.l -1 were calculated. In order to know what happens in 15 N separation at higher pressure, when the isotopic transport between two phases is improved, a stainless steel laboratory experimental setup with 1000 mm long x 18 mm i,d. column, packed with triangular wire springs 1.8 x 1.8 x 0.2 mm was utilised. At 0.15 MPA and 2.36 ml.cm -2 . min -1 flow rate HETP was 7% smaller than at atmospheric pressure and 1.5 times smaller flow rate. HETP at 3.14 ml . cm -2 . min -1 flow rate and 0.18 MPa is practically equal with that obtained at atmospheric pressure and 2 times smaller flow rate. The operation of the 15 N separation setup at 0.18 MPa, instead of atmospheric pressure, will permit to double the 10 M.l -1 nitric acid flow rate and of 15 N production of the given column. (authors)
Energy Technology Data Exchange (ETDEWEB)
Jung, K; Metzner, C; Teichmann, B [Akademie der Wissenschaften der DDR, Leipzig (German Democratic Republic). Zentralinstitut fuer Isotopen- und Strahlenforschung Leipzig Univ. (German Democratic Republic). Bereich Medizin
1989-01-01
By use of the {sup 15}N-ammonium test the liver function is investigated under influence of hormonal contraceptives in women and in liver diseases in children. With the described noninvasive nonradioactive isotope test the ammonia detoxification capability and the urea synthesis capacity of the liver is determined by measuring of the {sup 15}N excretion in ammonia and urea in urine after oral administering of {sup 15}N-ammonium chloride. The {sup 15}N-ammonium test shows a significant influence of the hormonal contraceptives on the liver function and gives diagnostic evidence for liver diseases in children. (author).
π-p→ωn reaction at momenta from 15 to 40 GeV/c
International Nuclear Information System (INIS)
Apel, W.D.; Augenstein, K.H.; Bertolucci, E.; Vincelli, M.L.; Donskov, S.V.; Inyakin, A.; Kachanov, V.A.; Quaglia, M.; Krasnokutsky, R.N.; Krueger, M.; Leder, G.; Lednev, A.A.; Mannelli, I.; Mikhailov, Y.V.; Mueller, H.; Prokoshkin, Y.D.; Pierazzini, G.M.; Sergiampietri, F.; Sigurdsson, G.; Scribano, A.; Schneider, H.; Shuvalov, R.S.
1980-01-01
Cross sections for the reaction π - p→ωn, ω→π 0 γ have been measured with good statistics at incident-pion momenta of 15, 20, 25, 30, and 40 GeV/c. The experiments were performed at the 70-GeV IHEP accelerator, using the NICE 648-channel hodoscopic spectrometer. The density matrix elements and the differential and integrated cross sections for the reaction have been determined. The unnatural-parity exchange contribution to the production of ω mesons in the state with helicity 1 is already insignificant at 15 GeV/c. With increasing Vertical BartVertical Bar the differential cross sections pass through a maximum at Vertical BartVertical Barapprox. =0.12 (GeV/c) 2 and then fall exponentially until Vertical BartVertical Barapprox. =0.7 (GeV/c) 2 ; at that point the curve bends sharply, the cross section falling off much less rapidly for larger values of Vertical BartVertical Bar
Qi, Haiping; Coplen, Tyler B.; Geilmann, Heike; Brand, Willi A.; Böhlke, J.K.
2003-01-01
Analytical grade L-glutamic acid is chemically stable and has a C/N mole ratio of 5, which is close to that of many of natural biological materials, such as blood and animal tissue. Two L-glutamic acid reference materials with substantially different 13C and 15N abundances have been prepared for use as organic reference materials for C and N isotopic measurements. USGS40 is analytical grade L-glutamic acid and has a δ13C value of −26.24‰ relative to VPDB and a δ15N value of −4.52‰ relative to N2 in air. USGS41 was prepared by dissolving analytical grade L-glutamic acid with L-glutamic acid enriched in 13C and 15N. USGS41 has a δ13C value of +37.76‰ and a δ15N value of +47.57‰. The δ13C and δ15N values of both materials were measured against the international reference materials NBS 19 calcium carbonate (δ13C = +1.95‰), L-SVEC lithium carbonate (δ13C = −46.48‰), IAEA-N-1 ammonium sulfate (δ15N = 0.43‰), and USGS32 potassium nitrate (δ15N = 180‰) by on-line combustion continuous-flow and off-line dual-inlet isotope-ratio mass spectrometry. Both USGS40 and USGS41 are isotopically homogeneous; reproducibility of δ13C is better than 0.13‰, and that of δ15N is better than 0.13‰ in 100-μg amounts. These two isotopic reference materials can be used for (i) calibrating local laboratory reference materials, and (ii) quantifying drift with time, mass-dependent fractionations, and isotope-ratio-scale contraction in the isotopic analysis of various biological materials. Isotopic results presented in this paper yield a δ13C value for NBS 22 oil of −29.91‰, in contrast to the commonly accepted value of −29.78‰ for which off-line blank corrections probably have not been quantified satisfactorily.
International Nuclear Information System (INIS)
Cho, Kun-Ching; Lee, Do Gyun; Fuller, Mark E.; Hatzinger, Paul B.; Condee, Charles W.; Chu, Kung-Hui
2015-01-01
Highlights: • SIP characterized RDX-degrading communities under different e-accepting conditions. • Dominant RDX degradation pathways differed under different e-accepting conditions. • More complete detoxification of RDX occurred under methanogenic and sulfate-reducing conditions than under manganese(IV) and iron(III)-reducing conditions. - Abstract: This study identified microorganisms capable of using the explosive hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) or its metabolites as carbon and/or nitrogen sources under different electron-accepting conditions using 13 C and 15 N stable isotope probing (SIP). Mesocosms were constructed using groundwater and aquifer solids from an RDX-contaminated aquifer. The mesocosms received succinate as a carbon source and one of four electron acceptors (nitrate, manganese(IV), iron(III), or sulfate) or no additional electron acceptor (to stimulate methanogenesis). When RDX degradation was observed, subsamples from each mesocosm were removed and amended with 13 C 3 - or ring- 15 N 3 -, nitro- 15 N 3 -, or fully-labeled 15 N 6 -RDX, followed by additional incubation and isolation of labeled nucleic acids. A total of fifteen 16S rRNA sequences, clustering in α- and γ-Proteobacteria, Clostridia, and Actinobacteria, were detected in the 13 C-DNA fractions. A total of twenty seven sequences were derived from different 15 N-DNA fractions, with the sequences clustered in α- and γ-Proteobacteria, and Clostridia. Interestingly, sequences identified as Desulfosporosinus sp. (in the Clostridia) were not only observed to incorporate the labeled 13 C or 15 N from labeled RDX, but also were detected under each of the different electron-accepting conditions. The data suggest that 13 C- and 15 N-SIP can be used to characterize microbial communities involved in RDX biodegradation, and that the dominant pathway of RDX biodegradation may differ under different electron-accepting conditions
Production of 15N for nitride type nuclear fuel
International Nuclear Information System (INIS)
Axente, Damian
2005-01-01
Full text: Nitride nuclear fuel is the choice for advanced nuclear reactors and ADS, considering its favorable properties as: melting point, excellent thermal conductivity, high fissile density, lower fission gas release and good radiation tolerance. The application of nitride fuels in different nuclear reactors requires use of 15 N enriched nitrogen to suppress 14 C production due to (n,p) reaction on 14 N. Nitride fuel is a promising candidate for transmutation in ADSs of radioactive minor actinides, which are converted into nitrides with 15 N for that purpose. Taking into account that at present the world wide 15 N market is about 20 - 40 Kg 15 N/y, the supply of that isotope for nitride type nuclear fuel, would demand an increase in production capacity by a factor of 1000. For an industrial plant producing 100 t/y 15 N at 99 at. % 15 N concentration, using present technology of 15 N/ 14 N isotopic exchange in Nitrox system, the first separation stage of the cascade would be fed with 10M HNO 3 solution at a 600 m 3 /h flow-rate. If conversion of HNO 3 into NO, NO 2 , at the enriching end of the columns, would be done with gaseous SO 2 , for an industrial plant of 100 t/y 15 N a consumption of 4 million t SO 2 /y and a production of 70 % H 2 SO 4 waste solution of 4.5 million m 3 /y are estimated. The reconversion of H 2 SO 4 into SO 2 in order to recycle SO 2 is a problem to be solved to compensate the cost of sulfur dioxide and to diminish the amount of sulfuric acid waste solution. It should be taken into consideration an important price reduction of 15 N in order to make possible its utilization for industrial production of nitride type nuclear fuel. (authors)
Directory of Open Access Journals (Sweden)
Bacher Adelbert
2005-11-01
Full Text Available Abstract Background Insect cells can serve as host systems for the recombinant expression of eukaryotic proteins. Using this platform, the controlled expression of 15N/13C labelled proteins requires the analysis of incorporation paths and rates of isotope-labelled precursors present in the medium into amino acids. For this purpose, Spodoptera frugiperda cells were grown in a complex medium containing [U-13C6]glucose. In a second experiment, cultures of S. frugiperda were grown in the presence of 15N-phenylalanine. Results Quantitative NMR analysis showed incorporation of the proffered [U-13C6]glucose into the ribose moiety of ribonucleosides (40 – 45% and into the amino acids, alanine (41%, glutamic acid/glutamine (C-4 and C-5, 30% and aspartate/asparagine (15%. Other amino acids and the purine ring of nucleosides were not formed from exogenous glucose in significant amounts (> 5%. Prior to the incorporation into protein the proffered 15N-phenylalanine lost about 70% of its label by transamination and the labelled compound was not converted into tyrosine to a significant extent. Conclusion Growth of S. frugiperda cells in the presence of [U-13C6]glucose is conducive to the fractional labelling of ribonucleosides, alanine, glutamic acid/glutamine and aspartic acid/asparagine. The isotopolog compositions of the ribonucleosides and of alanine indicate considerable recycling of carbohydrate intermediates in the reductive branch of the pentose phosphate pathway. The incorporation of 15N-labelled amino acids may be hampered by loss of the 15N-label by transamination.
Biosynthetic preparation of L-[13C]- and [15N]glutamate by Brevibacterium flavum
International Nuclear Information System (INIS)
Walker, T.E.; London, R.E.
1987-01-01
The biosynthesis of isotopically labeled L-glutamic acid by the microorganism Brevibacterium flavum was studied with a variety of carbon-13-enriched precursors. The purpose of this study was twofold: (i) to develop techniques for the efficient preparation of labeled L-glutamate with a variety of useful labeling patterns which can be used for other metabolic studies, and (ii) to better understand the metabolic events leading to label scrambling in these strains. B. flavum, which is used commercially for the production of monosodium glutamate, has the capability of utilizing glucose or acetate as a sole carbon source, and important criterion from the standpoint of developing labeling strategies. Unfortunately, singly labeled glucose precursors lead to excessive isotopic dilution which reduces their usefulness. Studies with [3- 13 C]pyruvate indicate that this problem can in principle be overcome by using labeled three-carbon precursors; however, conditions could not be found which would lead to an acceptable yield of isotopically labeled L-glutamate. In contrast, [1- 13 C]- or [2- 13 C]acetate provides relatively inexpensive, readily available precursors for the production of selectively labeled, high enriched L-glutamate. The preparation of L-[ 15 N]glutamate from [ 15 N]ammonium sulfate was carried out and is a very effective labeling strategy. Analysis of the isotopic distribution in labeled glutamate provides details about the metabolic pathways in these interesting organisms
Energy Technology Data Exchange (ETDEWEB)
Azam, F.; Haider, K.; Malik, K.A.
1985-01-01
Uniformly /sup 14/C labeled glucose, cellulose and wheat straw and specifically /sup 14/C labeled lignin component in corn stalks were aerobically incubated for 12 weeks in a chernozem soil along with /sup 15/N labeled ammonium sulfate. Glucose was most readily decomposed, followed in order by cellulose, wheat straw and corn stalk lignins labeled at methoxyl-, side chain 2- and ring-C. More than 50% of /sup 14/C applied as glucose, cellulose and wheat straw evolved as CO/sub 2/ during the first week. Lignin however, decomposed relatively slowly. A higher proportion of /sup 14/C was transformed into microbial biomass whereas lignins contributed a little to this fraction. After 12 weeks of incubation nearly 60% of the lignin /sup 14/C was found in humic compounds of which more than 70% was resistant to hydrolysis with 6N HCl. Maximum incorporation of /sup 15/N in humic compounds was observed in cellulose amended soil. However, in this case more than 80% of the /sup 15/N was in hydrolysable forms. Immobilization-remineralization of applied /sup 15/N was most rapid in glucose treated soil and a complete immobilization followed by remineralization was observed after 3 days. The process was much slow in soil treated with cellulose, wheat straw or corn stalks. More than 70% of the newly immobilized N was in hydrolysable forms mainly representing the microbial component. Serial hydrolysis of soil at different incubation intervals showed a greater proportion of 6N HCl hydrolysable /sup 14/C and /sup 15/N in fractions representing microbial material. /sup 14/C from lignin carbons was relatively more uniformly distributed in different fractions as compared to glucose, cellulose and wheat straw where a major portion of /sup 14/C was in easily hydrolysable fractions. 25 refs., 3 figs., 4 tabs.
International Nuclear Information System (INIS)
Shinnaka, Yoshiharu; Kawakita, Hideyo; Kobayashi, Hitomi; Jehin, Emmanuel; Manfroid, Jean; Hutsemekers, Damien; Arpigny, Claude
2011-01-01
The ortho-to-para abundance ratio (OPR) of cometary molecules is considered to be one of the primordial characteristics of cometary ices. We present OPRs of ammonia (NH 3 ) in 15 comets based on optical high-dispersion spectroscopic observations of NH 2 , which is a photodissociation product of ammonia in the gaseous coma. The observations were mainly carried out with the VLT/UVES. The OPR of ammonia is estimated from the OPR of NH 2 based on the observations of the NH 2 (0, 9, 0) vibronic band. The absorption lines by the telluric atmosphere are corrected and the cometary C 2 emission lines blended with NH 2 lines are removed in our analysis. The ammonia OPRs show a cluster between 1.1 and 1.2 (this corresponds to a nuclear spin temperature of ∼30 K) for all comets in our sample except for 73P/Schwassmann-Wachmann 3 (73P/SW3). Comet 73P/SW3 (both B- and C-fragments) shows the OPR of ammonia consistent with nuclear spin statistical weight ratio (1.0) that indicates a high-temperature limit as nuclear spin temperature. We compared the ammonia OPRs with other properties ( 14 N/ 15 N ratios in CN, D/H ratios of water, and mixing ratios of volatiles). Comet 73P/SW3 is clearly different from the other comets in the plot of ammonia OPRs versus 14 N/ 15 N ratios in CN. The ammonia OPRs of 1.0 and lower 15 N-fractionation of CN in comet 73P/SW3 imply that icy materials in this comet formed under warmer conditions than other comets. Comets may be classified into two groups in the plot of ammonia OPRs against 14 N/ 15 N ratios in CN.
Emission spectroscopic 15N analysis 1985
International Nuclear Information System (INIS)
Meier, G.
1986-01-01
The state of the art of emission spectroscopic 15 N analysis is demonstrated taking the NOI-6e 15 N analyzer as an example. The analyzer is equipped with a microcomputer to ensure a high operational comfort, computer control, and both data acquisition and data processing. In small amounts of nitrogen-containing substances (10 to 50 μg N 2 ) the 15 N abundance can be very quickly determined in standard discharge tubes or in aqueous ammonium salt solutions with a standard deviation less than 0.6 percent
Klaus, Valentin H; Hölzel, Norbert; Prati, Daniel; Schmitt, Barbara; Schöning, Ingo; Schrumpf, Marion; Fischer, Markus; Kleinebecker, Till
2013-01-01
Distinguishing organic and conventional products is a major issue of food security and authenticity. Previous studies successfully used stable isotopes to separate organic and conventional products, but up to now, this approach was not tested for organic grassland hay and soil. Moreover, isotopic abundances could be a powerful tool to elucidate differences in ecosystem functioning and driving mechanisms of element cycling in organic and conventional management systems. Here, we studied the δ(15)N and δ(13)C isotopic composition of soil and hay samples of 21 organic and 34 conventional grasslands in two German regions. We also used Δδ(15)N (δ(15)N plant - δ(15)N soil) to characterize nitrogen dynamics. In order to detect temporal trends, isotopic abundances in organic grasslands were related to the time since certification. Furthermore, discriminant analysis was used to test whether the respective management type can be deduced from observed isotopic abundances. Isotopic analyses revealed no significant differences in δ(13)C in hay and δ(15)N in both soil and hay between management types, but showed that δ(13)C abundances were significantly lower in soil of organic compared to conventional grasslands. Δδ(15)N values implied that management types did not substantially differ in nitrogen cycling. Only δ(13)C in soil and hay showed significant negative relationships with the time since certification. Thus, our result suggest that organic grasslands suffered less from drought stress compared to conventional grasslands most likely due to a benefit of higher plant species richness, as previously shown by manipulative biodiversity experiments. Finally, it was possible to correctly classify about two third of the samples according to their management using isotopic abundances in soil and hay. However, as more than half of the organic samples were incorrectly classified, we infer that more research is needed to improve this approach before it can be efficiently
Klaus, Valentin H.; Hölzel, Norbert; Prati, Daniel; Schmitt, Barbara; Schöning, Ingo; Schrumpf, Marion; Fischer, Markus; Kleinebecker, Till
2013-01-01
Distinguishing organic and conventional products is a major issue of food security and authenticity. Previous studies successfully used stable isotopes to separate organic and conventional products, but up to now, this approach was not tested for organic grassland hay and soil. Moreover, isotopic abundances could be a powerful tool to elucidate differences in ecosystem functioning and driving mechanisms of element cycling in organic and conventional management systems. Here, we studied the δ15N and δ13C isotopic composition of soil and hay samples of 21 organic and 34 conventional grasslands in two German regions. We also used Δδ15N (δ15N plant - δ15N soil) to characterize nitrogen dynamics. In order to detect temporal trends, isotopic abundances in organic grasslands were related to the time since certification. Furthermore, discriminant analysis was used to test whether the respective management type can be deduced from observed isotopic abundances. Isotopic analyses revealed no significant differences in δ13C in hay and δ15N in both soil and hay between management types, but showed that δ13C abundances were significantly lower in soil of organic compared to conventional grasslands. Δδ15N values implied that management types did not substantially differ in nitrogen cycling. Only δ13C in soil and hay showed significant negative relationships with the time since certification. Thus, our result suggest that organic grasslands suffered less from drought stress compared to conventional grasslands most likely due to a benefit of higher plant species richness, as previously shown by manipulative biodiversity experiments. Finally, it was possible to correctly classify about two third of the samples according to their management using isotopic abundances in soil and hay. However, as more than half of the organic samples were incorrectly classified, we infer that more research is needed to improve this approach before it can be efficiently used in practice
Newsome, Seth D.; Etnier, Michael A.; Monson, Daniel H.; Fogel, Marilyn L.
2009-01-01
Metabolically inert, accretionary structures such as the dentin growth layers in teeth provide a life history record of individual diet with near-annual resolution. We constructed ontogenetic δ13C and δ15N profiles by analyzing tooth dentin growth layers from 13 individual killer whales Orcinus orca collected in the eastern northeast Pacific Ocean between 1961 and 2003. The individuals sampled were 6 to 52 yr old, representing 2 ecotypes—resident and transient—collected across ~25° of latitude. The average isotopic values of transient individuals (n = 10) are consistent with a reliance on mammalian prey, while the average isotopic values of residents (n = 3) are consistent with piscivory. Regardless of ecotype, most individuals show a decrease in δ15N values of ~2.5‰ through the first 3 yr of life, roughly equivalent to a decrease of one trophic level. We interpret this as evidence of gradual weaning, after which, ontogenetic shifts in isotopic values are highly variable. A few individuals (n = 2) maintained relatively stable δ15N and δ13C values throughout the remainder of their lives, whereas δ15N values of most (n = 11) increased by ~1.5‰, suggestive of an ontogenetic increase in trophic level. Significant differences in mean δ13C and δ15N values among transients collected off California suggest that individuality in prey preferences may be prevalent within this ecotype. Our approach provides retrospective individual life history and dietary information that cannot be obtained through traditional field observations of free-ranging and elusive species such as killer whales, including unique historic ecological information that pre-dates modern studies. By providing insights into individual diet composition, stable isotope analysis of teeth and/or bones may be the only means of evaluating a number of hypothesized historical dietary shifts in killer whales of the northeast Pacific Ocean
Resolution of the 15N balance enigma?
International Nuclear Information System (INIS)
Clough, T.J.; Sherlock, R.R.; Cameron, K.C.; Stevens, R.J.; Laughlin, R.J.; Mueller, C.
2001-01-01
The enigma of soil nitrogen balance sheets has been discussed for over 40 years. Many reasons have been considered for the incomplete recovery of 15 N applied to soils, including sampling uncertainty, gaseous N losses from plants, and entrapment of soil gases. The entrapment of soil gases has been well documented for rice paddy and marshy soils but little or no work appears to have been done to determine entrapment in drained pasture soils. In this study 15 N-labelled nitrate was applied to a soil core in a gas-tight glovebox. Water was applied, inducing drainage, which was immediately collected. Dinitrogen and N -2 were determined in the flux through the soil surface, and in the gases released into the glovebox as a result of irrigation or physical destruction of the core. Other components of the N balance were also measured, including soil inorganic-N and organic-N. Quantitative recovery of the applied 15 N was achieved when the experiment was terminated 484 h after the 15 N-labelled material was applied. Nearly 23% of the 15 N was recovered in the glovebox atmosphere as N 2 and N 2 O due to diffusion from the base of the soil core, convective flow after irrigation, and destructive soil sampling. This 15 N would normally be unaccounted for using the sampling methodology typically employed in 15 N recovery experiments. Copyright (2001) CSIRO Publishing
Kurdali, F; Al-Shamma'a, M
2009-09-01
A survey study was conducted on man-made plantations located at two different areas in the arid region of Syria to determine the variations in natural abundances of the (15)N and (13)C isotopes in leaves of several woody legume and non-legume species, and to better understand the consequence of such variations on nitrogen fixation and carbon assimilation. In the first study area (non-saline soil), the delta(15)N values in four legume species (Acacia cyanophylla,-1.73 per thousand Acacia farnesiana,-0.55 per thousand Prosopis juliflora,-1.64 per thousand; and Medicago arborea,+1.6 \\textperthousand) and one actinorhizal plant (Elaeagnus angustifolia,-0.46 to-2.1 per thousand) were found to be close to that of the atmospheric value pointing to a major contribution of N(2) fixing in these species; whereas, delta(15)N values of the non-fixing plant species were highly positive. delta(13)C per thousand; in leaves of the C3 plants were found to be affected by plant species, ranging from a minimum of-28.67 per thousand; to a maximum of-23 per thousand. However, they were relatively similar within each plant species although they were grown at different sites. In the second study area (salt affected soil), a higher carbon discrimination value (Delta(13)C per thousand) was exhibited by P. juliflora, indicating that the latter is a salt tolerant species; however, its delta(15)N was highly positive (+7.03 per thousand) suggesting a negligible contribution of the fixed N(2). Hence, it was concluded that the enhancement of N(2) fixation might be achieved by selection of salt-tolerant Rhizobium strains.
15N-labelled glycine synthesis
International Nuclear Information System (INIS)
Tavares, Claudineia R.O.; Bendassolli, Jose A.; Sant'Ana Filho, Carlos R.; Prestes, Clelber V.; Coelho, Fernando
2006-01-01
This work describes a method for 15 N-isotope-labeled glycine synthesis, as well as details about a recovery line for nitrogen residues. To that effect, amination of α-haloacids was performed, using carboxylic chloroacetic acid and labeled aqueous ammonia ( 15 NH 3 ). Special care was taken to avoid possible 15 NH 3 losses, since its production cost is high. In that respect, although the purchase cost of the 13 N-labeled compound (radioactive) is lower, the stable tracer produced constitutes an important tool for N cycling studies in living organisms, also minimizing labor and environmental hazards, as well as time limitation problems in field studies. The tests were carried out with three replications, and variable 15 NH 3(aq) volumes in the reaction were used (50, 100, and 150 mL), in order to calibrate the best operational condition; glycine masses obtained were 1.7, 2, and 3.2 g, respectively. With the development of a system for 15 NH 3 recovery, it was possible to recover 71, 83, and 87% of the ammonia initially used in the synthesis. With the required adaptations, the same system was used to recover methanol, and 75% of the methanol initially used in the amino acid purification process were recovered. (author)
New structures in the continuum of 15C populated by two-neutron transfer
International Nuclear Information System (INIS)
Cappuzzello, F.; Rea, C.; Bonaccorso, A.; Bondì, M.; Carbone, D.; Cavallaro, M.; Cunsolo, A.; Foti, A.; Orrigo, S.E.A.; Rodrigues, M.R.D.; Taranto, G.
2012-01-01
The 13 C( 18 O, 16 O) 15 C reaction has been studied at 84 MeV incident energy. The ejectiles have been detected at forward angles and 15 C excitation energy spectra have been obtained up to about 20 MeV. Several known bound and resonant states of 15 C have been identified together with two unknown structures at 10.5 MeV (FWHM=2.5 MeV) and 13.6 MeV (FWHM=2.5 MeV). Calculations based on the removal of two uncorrelated neutrons from the projectile describe a significant part of the continuum observed in the energy spectra. In particular the structure at 10.5 MeV is dominated by a resonance of 15 C near the 13 C+n+n threshold. Similar structures are found in nearby nuclei such as 14 C and 11 Be.
N-15 analysis by emission spectroscopy
Energy Technology Data Exchange (ETDEWEB)
NONE
1983-12-31
The stable isotope of nitrogen, N-15, has become widely used as tracer in agriculture, medicine and biology research. The film gives an overview of the sample preparation and analytical procedures followed in the analysis of the nitrogen isotopic composition (14N/15N ratio) by optical emission spectrometry at the Seibersdorf Laboratory. The subsampling of plant material and the several steps of chemical pretreatment such as Kjeldahl digestion, distillation, titration and adjustment of the proper N concentration in the extract are demonstrated. The preparation of the discharge tubes is shown in detail. Final measurement of the 14N/15N ratio is carried out with the NOI-5 and JASCO emission spectrometers
Energy Technology Data Exchange (ETDEWEB)
Benedito, E.; Takeda, A.M., E-mail: eva@nupelia.uem.br [Universidade Estadual de Maringa (UEM), PR (Brazil). Nucleo de Pesquisas em Limnologia, Ictiologia e Aquicultura; Figueroa, L. [Universidade Estadual de Maringa (UEM), PR (Brazil). Pos-Graduacao em Ecologia de Ambientes Aquaticos Continentais; Manetta, GI. [Universidade Estadual de Maringa (UEM), PR (Brazil). Pos-Graduacao em Biologia Comparada
2013-11-15
The objective of this study was to evaluate the effect of Oreochromis niloticus cage culture promoted variations in the δ{sup 13}C and δ{sup 15}N in Corbicula fluminea (Mollusca; Bivalvia) and in the sediment of an aquatic food web. Samples were taken before and after net cage installation in the Rosana Reservoir (Paranapanema River, PR-SP). Samples of specimens of the bivalve filter C. fluminea and samples of sediment were collected using a modified Petersen grab. All samples were dried in an oven (60 °C) for 72 hours, macerated to obtain homogenous fine powders and sent for carbon (δ{sup 13}C) and nitrogen (δ{sup 15}N) isotopic value analysis in a mass spectrometer. There were significant differences in the δ{sup 13}C and δ{sup 15}N values of the invertebrate C. fluminea between the beginning and the end of the experiment. There were no differences between the δ{sup 13}C and δ{sup 15}N values of sediment. These results indicate that the installation of fish cage culture promoted impacts in the isotopic composition of the aquatic food web organisms, which could exert influence over the native species and the ecosystem. (author)
15N-ammonium test in clinical research
International Nuclear Information System (INIS)
Jung, K.; Metzner, C.; Teichmann, B.; Leipzig Univ.
1989-01-01
By use of the 15 N-ammonium test the liver function is investigated under influence of hormonal contraceptives in women and in liver diseases in children. With the described noninvasive nonradioactive isotope test the ammonia detoxification capability and the urea synthesis capacity of the liver is determined by measuring of the 15 N excretion in ammonia and urea in urine after oral administering of 15 N-ammonium chloride. The 15 N-ammonium test shows a significant influence of the hormonal contraceptives on the liver function and gives diagnostic evidence for liver diseases in children. (author)
Creating 13C- and 15N-enriched tree leaf litter for decomposition experiments
Szlavecz, K. A.; Pitz, S.; Chang, C.; Bernard, M.
2013-12-01
Labeling plant material with heavy isotopes of carbon and nitrogen can produce a traceable nutrient signal that can be followed into the different trophic levels and decomposer food web. We treated 60 tree saplings with 13C-enriched CO2 gas and 15N-enriched ammonium nitrate over a three-month period to create dually-labeled plant material for future decomposition experiments. The trees included both early (Red maple, Sweetgum, Tulip poplar) and late (American beech, White oak) successional deciduous tree species, and a conifer, White pine. We constructed a 2.4 m × 2.4 m × 2.4 m environmental chamber that was climate-controlled using an air conditioning system. An Arduino microcontroller interfaced with a Vaisala GMP343 CO2 probe maintained a CO2 concentration between 500-520 ppm by controlling a solenoid valve on the CO2 tank regulator. The trees were placed into the chamber in August 2012 and remained until senescence unless they were lost to death or disease. Ammonium nitrate was added twice, in September and October. Leaf samples were collected prior to the start of the experiment and after senescence, whereas root samples were collected only in December. Samples were dried, ground and analyzed using an isotope ratio mass spectrometer. American beech and White oak had 40% mortality, and 34% of tulip poplar trees were removed because of powdery mildew overgrowth or death. Most tulip poplar trees exhibited a second leaf out following senescence in late September. Nearly 1 kg of litter was produced with tulip poplar representing over half of the total mass. Levels of enrichment varied greatly by species. Beech (-14.2‰) and White oak (-4.8‰) had low levels of enrichment in comparison to early successional species such as Sweetgum (41.7‰) and Tulip poplar (30.7‰ [first leaf fall] and 238.0‰ [second leaf fall]). Leaf enrichment with 15N followed a similar pattern, though it was achieved at a higher level with δ15N values varying from 271.6‰ to 1354.2
International Nuclear Information System (INIS)
Bougharouat, B.
1981-01-01
Clinical use of three short-lived radioisotopes: 15 O, 13 N and 11 C is studied on two complementary aspects. A production and purification system is realized; detection instruments in medical use are studied. The production of labelled molecules with the three radiotracers 15 O, 13 N, 11 C from the target bombardment with charged and accelerated particles was studied [fr
Absorption of ammonium sulphate 15N by coffee plants
International Nuclear Information System (INIS)
Fenilli, Tatiele Anete Bergamo; Reichardt, Klaus; Bacchi, Osny Oliveira Santos; Trivelin, Paulo Cesar Ocheuze; Dourado Neto, Durval
2005-01-01
The objective of this study was to quantify the absorption of ammonium sulphate 15 N by coffee plants. Treatments consisted of five sub-plots of 9 plants, of which the three central ones received 280 kg ha -1 of 15 N, applied at four times: 1/4 on 01 Set 03; 1/4 on 03 Nov 03; 1/4 on 15 Dec 03 and 1/4 on 30 Jan 04. The isotopic enrichment was 2,072 ± 0,001 atom % 15 N. The dry matter of the shoot was evaluated every 60 days, using one plant per replicate, collected outside the sub-plot. They were as similar as possible to the labeled plants, which were used only for isotopic and Total N analysis, after being dried at 65 deg C until constant weight. At harvest, plants had absorbed 42,88% of the fertilizer N. Leaves accumulated the largest amount of fertilizer N, and were also the compartments that received most N from other parts of the plant. The following partition of the fertilizer N was found at harvest: 23.01% in young leaves, 6.23% in old leaves, 4,46% in stem, 3.46% in fruits, 3.10% in young branches and 2.63% in old branches. (author)
International Nuclear Information System (INIS)
Kurdali, F.
2007-06-01
A field experiment on dhaincha C 3 (Sesbania aculeata Pers), sunflower C 3 (Helianthus annuus L.) and sorghum C 4 (Sorghum bicolor L.) plants grown in monocropping and intercropping systems was conducted to evaluate seed yield, dry matter production, total N yield, land equivalent ratio (LER), intraspecific competition for soil N uptake, water use efficiency (WUE) and N 2 -fixation using the 15 N natural abundance technique (δ 15 N ). Moreover, carbon isotope discrimination (Δ13 C ) was determined to assess factors responsible for crop performance variability in the different cropping systems. Intercropping of sesbania/sorghum showed greater efficiency over monocropping in producing dry matter, during the entire growth period, as indicated by the LERs (>1); whereas, the efficiency of producing dry matter in the sesbania /sunflower intercropping was similar to that in the monocropping system (LER=1). Moreover, sorghum plants (C 4 ) was more competitive than sesbania (C 3 ) for soil N uptake; whereas, sesbania seemed to be more competitive than its associated sunflower (C 3 ). N uptake in the mixed stand of sesbania/sorghum was improved due to the increase in soil N uptake by the component sorghum and the higher root nodule activity of component sesbania without affecting the amount of N 2 fixed. In both cropping systems, sesbania plants fixed almost the same amount of N 2 (an average of 105 kg N/ha) although the number of rows in the mixed stand was 2/3 of that in the pure stand. This gives an advantage of the intercropping over sole cropping system with regards to N 2 -fixation. 13 C discrimination in plant materials was found to be affected by plant species and the cropping system. Factors affected Δ13 C in plants grown in the mixed stand relative to solely grown crops are discussed.(author)
Johnson, Craig A.; Stricker, Craig A.; Gulbransen, Cayce A.; Emmons, Matthew P.
2018-02-14
This report describes procedures used in the Geology, Geophysics, and Geochemistry Science Center of the U.S. Geological Survey in Denver, Colorado, to determine the stable-isotope ratios 13C/12C, 15N/14N, and 34S/32S in solid materials. The procedures use elemental analyzers connected directly to gas-source isotope-ratio mass spectrometers. A different elemental–analyzer–mass-spectrometer system is used for 13C/12C and 15N/14N than is used for 34S/32S to accommodate differences in reagents, catalysts, and instrument settings.
Energy Technology Data Exchange (ETDEWEB)
Fenilli, Tatiele Anete Bergamo; Reichardt, Klaus; Bacchi, Osny Oliveira Santos [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Fisica do Solo]. E-mail: tatiele@cena.usp.br; Trivelin, Paulo Cesar Ocheuze [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Isotopos Estaveis; Dourado Neto, Durval [Sao Paulo Univ., Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz. Dept. de Producao Vegetal
2005-07-01
The objective of this study was to quantify the absorption of ammonium sulphate {sup 15}N by coffee plants. Treatments consisted of five sub-plots of 9 plants, of which the three central ones received 280 kg ha{sup -1} of {sup 15}N, applied at four times: 1/4 on 01 Set 03; 1/4 on 03 Nov 03; 1/4 on 15 Dec 03 and 1/4 on 30 Jan 04. The isotopic enrichment was 2,072 {+-} 0,001 atom % {sup 15}N. The dry matter of the shoot was evaluated every 60 days, using one plant per replicate, collected outside the sub-plot. They were as similar as possible to the labeled plants, which were used only for isotopic and Total N analysis, after being dried at 65 deg C until constant weight. At harvest, plants had absorbed 42,88% of the fertilizer N. Leaves accumulated the largest amount of fertilizer N, and were also the compartments that received most N from other parts of the plant. The following partition of the fertilizer N was found at harvest: 23.01% in young leaves, 6.23% in old leaves, 4,46% in stem, 3.46% in fruits, 3.10% in young branches and 2.63% in old branches. (author)
Investigation into endogenous N metabolism in 15N-labelled pigs. 1
International Nuclear Information System (INIS)
Bergner, H.; Bergner, U.; Adam, K.
1984-01-01
4 male castrated pigs (55-65 kg) either received a wheat-fish meal diet (1 and 2) or a wheat-horse bean diet (3 and 4) without straw meal supplement (1 and 3) or with a supplement of 20% dry matter (2 and 4). In order to investigate whether a 15 N labelling of the pigs is also possible with a protein excess in the ration, the animals received 24.8 g (1 and 2) and 11.6 g crude protein/kg/sup 0.75/ live weight (3 and 4). During a 10-day 15 N-labelling 385 mg 15 N excess ( 15 N') per kg/sup 0.75/ were applied with 15 N labelling the following quotas of the applied 15 N amount were incorporated: 1 = 10.2%, 2 = 7.2%, 3 = 18.7%, 4 = 14.4%. 15 N excretion in both TCA fractions of feces showed a highly significant positive correlation to the increasing content of crude fibre in the 4 diets. The immediate 15 N incorporation into the TCA-precipitable fraction of feces proves that 15 N enters the large intestine endogenously and serves bacterial protein synthesis. 3 days after the last 15 application the pigs were killed. The values of atom-% 15 N' were determined in the TCA-precipitable blood plasma and in the TCA-precipitable fraction of the liver. The other examined organs and tissues showed smaller differences between the test animals. The results show that the 15 N labelling of tissues and organs of pigs is also possible at a high level of protein supply by means of an oral application of [ 15 N] ammonia salts. (author)
Affordable uniform isotope labeling with {sup 2}H, {sup 13}C and {sup 15}N in insect cells
Energy Technology Data Exchange (ETDEWEB)
Sitarska, Agnieszka; Skora, Lukasz; Klopp, Julia; Roest, Susan; Fernández, César; Shrestha, Binesh; Gossert, Alvar D., E-mail: alvar.gossert@novartis.com [Novartis Institutes for BioMedical Research (Switzerland)
2015-06-15
For a wide range of proteins of high interest, the major obstacle for NMR studies is the lack of an affordable eukaryotic expression system for isotope labeling. Here, a simple and affordable protocol is presented to produce uniform labeled proteins in the most prevalent eukaryotic expression system for structural biology, namely Spodoptera frugiperda insect cells. Incorporation levels of 80 % can be achieved for {sup 15}N and {sup 13}C with yields comparable to expression in full media. For {sup 2}H,{sup 15}N and {sup 2}H,{sup 13}C,{sup 15}N labeling, incorporation is only slightly lower with 75 and 73 %, respectively, and yields are typically twofold reduced. The media were optimized for isotope incorporation, reproducibility, simplicity and cost. High isotope incorporation levels for all labeling patterns are achieved by using labeled algal amino acid extracts and exploiting well-known biochemical pathways. The final formulation consists of just five commercially available components, at costs 12-fold lower than labeling media from vendors. The approach was applied to several cytosolic and secreted target proteins.
Directory of Open Access Journals (Sweden)
J. K. Schjoerring
2012-05-01
Full Text Available Seasonal changes in nitrogen (N pools, carbon (C content and natural abundance of 13C and 15N in different tissues of ryegrass plants were investigated in two intensively managed grassland fields in order to address their ammonia (NH3 exchange potential. Green leaves generally had the largest total N concentration followed by stems and inflorescences. Senescent leaves had the lowest N concentration, indicating N re-allocation. The seasonal pattern of the Γ value, i.e. the ratio between NH4+ and H+ concentrations, was similar for the various tissues of the ryegrass plants but the magnitude of Γ differed considerably among the different tissues. Green leaves and stems generally had substantially lower Γ values than senescent leaves and litter. Substantial peaks in Γ were observed during spring and summer in response to fertilization and grazing. These peaks were associated with high NH4+ rather than with low H+ concentrations. Peaks in Γ also appeared during the winter, coinciding with increasing δ15N values, indicating absorption of N derived from mineralization of soil organic matter. At the same time, δ13C values were declining, suggesting reduced photosynthesis and capacity for N assimilation. δ15N and δ13C values were more influenced by mean monthly temperature than by the accumulated monthly precipitation. In conclusion, ryegrass plants showed a clear seasonal pattern in N pools. Green leaves and stems of ryegrass plants generally seem to constitute a sink for NH3, while senescent leaves have a large potential for NH3 emission. However, management events such as fertilisation and grazing may create a high NH3 emission potential even in green plant parts. The obtained results provide input for future modelling of plant-atmosphere NH3 exchange.
δ15N value does not reflect fasting in mysticetes.
Aguilar, Alex; Giménez, Joan; Gómez-Campos, Encarna; Cardona, Luís; Borrell, Asunción
2014-01-01
The finding that tissue δ(15)N values increase with protein catabolism has led researchers to apply this value to gauge nutritive condition in vertebrates. However, its application to marine mammals has in most occasions failed. We investigated the relationship between δ(15)N values and the fattening/fasting cycle in a model species, the fin whale, a migratory capital breeder that experiences severe seasonal variation in body condition. We analyzed two tissues providing complementary insights: one with isotopic turnover (muscle) and one that keeps a permanent record of variations in isotopic values (baleen plates). In both tissues δ(15)N values increased with intensive feeding but decreased with fasting, thus contradicting the pattern previously anticipated. The apparent inconsistency during fasting is explained by the fact that a) individuals migrate between different isotopic isoscapes, b) starvation may not trigger significant negative nitrogen balance, and c) excretion drops and elimination of 15N-depleted urine is minimized. Conversely, when intensive feeding is resumed in the northern grounds, protein anabolism and excretion start again, triggering 15N enrichment. It can be concluded that in whales and other mammals that accrue massive depots of lipids as energetic reserves and which have limited access to drinking water, the δ15N value is not affected by fasting and therefore cannot be used as an indication of nutritive condition.
Synthesis of [1,3 - 15 N2] uracil
International Nuclear Information System (INIS)
Chiriac, M.; Axente, D.
2001-01-01
The synthesis of 15 N labelled uracil, using CO( 15 NH 2 ) 2 as starting material, is presented. The experimental procedure is an adaptation of the synthesis methods for the corresponding unlabelled compounds. Urea- 15 N 2 used as starting material was obtained from H 15 NO 3 (99 at.% 15 N) produced at National Institute for Research and Development of Isotopic and Molecular Technologies, Cluj-Napoca.The uracil structure was determined using the mass spectrometry method and the isotopic labelling was determined by the same method on the molecular compound. The synthesis scheme of (1,3- 15 N 2 ) uracil is presented. (authors)
15N tracer techniques in pediatric research
International Nuclear Information System (INIS)
Heine, W.; Richter, I.; Plath, C.; Wutzke, K.; Stolpe, H.J.; Tiess, M.; Toewe, J.
1983-01-01
The main topics of the review comprise mathematical fundamentals of the determination of N metabolism parameters using the 3-pool method, the value of different 15 N tracer substances for the determination of whole-body protein parameters, the utilization of parenterally applied D-amino acids, studies on the influence of different diets on the N metabolism of premature infants with the 15 N tracer technique, the application of the 15 N-glycine-STH-test for the evaluation of the therapeutic effect of STH in children suffering from hypothalamico-hypophyseal dwarfism, in vivo studies on urea utilization by the infant intestinal flora under various dietary regimens as well as in vitro investigations on the utilization of 15 N-labelled urea and NH 4 Cl, resp., by the intestinal flora
Partial Molar Volumes of 15-Crown-5 Ether in Mixtures of N,N-Dimethylformamide with Water.
Tyczyńska, Magdalena; Jóźwiak, Małgorzata
2014-01-01
The density of 15-crown-5 ether (15C5) solutions in the mixtures of N,N -dimethylformamide (DMF) and water (H 2 O) was measured within the temperature range 293.15-308.15 K using an Anton Paar oscillatory U-tube densimeter. The results were used to calculate the apparent molar volumes ( V Φ ) of 15C5 in the mixtures of DMF + H 2 O over the whole concentration range. Using the apparent molar volumes and Redlich and Mayer equation, the standard partial molar volumes of 15-crown-5 were calculated at infinite dilution ([Formula: see text]). The limiting apparent molar expansibilities ( α ) were also calculated. The data are discussed from the point of view of the effect of concentration changes on interactions in solution.
On-line measurement of 13C/12C and 15N/14N ratios by E/A-diluter-IRMS
International Nuclear Information System (INIS)
Foerstel, H.; Boner, M.; Prast, H.
2001-01-01
Efficient food control requires rapid procedures for testing source authenticity. Food is produced inside a closed 'isotopic environment' from where it inherits a specific isotopic composition or fingerprint. Isotope ratio mass spectrometry (IRMS) measures isotopic compositions using simple gases like CO 2 or N 2 exclusively. From food samples these gases may be produced by combustion in a commercial CHN analyser (Elemental Analyser, EA). Following GC separation of the combustion gases the elemental content is determined using a thermal conductivity detector (TCD) . The effluent of the EA is coupled to the mass spectrometer via an open split. Because the relative amounts of the bio-elements vary significantly, (often C/N is 25/1 or larger), the amount of analyte gas produced from a single sample must be adjusted e.g. using a diluter. Our diluter configuration can be adjusted to measure repeatedly the 13 C/ 12 C ratio of carbon dioxide in mineral waters, as well as to measure 15 N/ 14 N and 13 C/ 12 C ratios from biological or soil samples simultaneously. In the first application different types of carbon dioxide, produced naturally (well) or technically (process), can be distinguished. The second application offers the possibility to trace the fate of a fertilizer in vineyards by determining the isotopic variation of nitrogen and carbon in soil and vines. (author)
Mangrove isotopic (δ15N and δ13C) fractionation across a nitrogen vs. phosphorus limitation gradient
Mckee, Karen L.; Feller, Ilka C.; Popp, Marianne; Wanek, Wolfgang
2002-01-01
Mangrove islands in Belize are characterized by a unique switching from nitrogen (N) to phosphorus (P) limitation to tree growth from shoreline to interior. Fertilization has previously shown that Rhizophora mangle (red mangrove) fringe trees (5–6 m tall) growing along the shoreline are N limited; dwarf trees (!1.5 m tall) in the forestinterior are P limited; and transition trees (2–4 m tall) are co-limited by both N and P. Growth patterns paralleled a landward decrease in soil flushing by tides and an increase in bioavailable N, but P availability remained consistently low across the gradient. Stable isotopic composition was measured in R. mangle leaves to aid in explaining this nutrient switching pattern and growth variation. Along control transects, leaf !15N decreased from "0.10‰ (fringe) to #5.38‰ (dwarf). The !15N of N-fertilized trees also varied spatially, but the values were consistently more negative (by $3‰) compared to control trees. Spatial variation in !15N values disappeared when the trees were fertilized with P, and values averaged "0.12‰, similar to that in control fringe trees. Neither variation in source inputs nor microbial fractionation could fully account for the observed patterns in !15N. The results instead suggest that the lower !15N values in transition and dwarf control trees were due to plant fractionation as a consequence of slower growth and lower N demand. P fertilization increased N demand and decreased fractionation. Although leaf !13C was unaffected by fertilization, values increased from fringe (#28.6‰) to transition (#27.9‰) to dwarf (#26.4‰) zones, indicating spatial variation in environmental stresses affecting stomatal conductance or carboxylation. The results thus suggest an interaction of external supply, internal demand, and plant ability to acquire nutrients under different hydro-edaphic conditions that vary across this tree-height gradient. The findings not only aid in understanding
Romek, Katarzyna M; Julien, Maxime; Frasquet-Darrieux, Marine; Tea, Illa; Antheaume, Ingrid; Hankard, Régis; Robins, Richard J
2013-12-01
Since exclusively breast-suckled infants obtain their nutrient only from their mother's milk, it might be anticipated that a correlation will exist between the (15)N/(14)N isotope ratios of amino acids of protein of young infants and those supplied by their mother. The work presented here aimed to determine whether amino nitrogen transfer from human milk to infant hair protein synthesized within the first month of life conserves the maternal isotopic signature or whether post-ingestion fractionation dominates the nitrogen isotope spectrum. The study was conducted at 1 month post-birth on 100 mother-infant pairs. Isotope ratios (15)N/(14)N and (13)C/(12)C were measured using isotope ratio measurement by Mass Spectrometry (irm-MS) for whole maternal milk, and infant hair and (15)N/(14)N ratios were also measured by GC-irm-MS for the N-pivaloyl-O-isopropyl esters of amino acids obtained from the hydrolysis of milk and hair proteins. The δ(15)N and δ(13)C (‰) were found to be significantly higher in infant hair than in breast milk (δ(15)N, P amino acids in infant hair was also significantly higher than that in maternal milk (P < 0.001). By calculation, the observed shift in isotope ratio was shown not to be accounted for by the amino acid composition of hair and milk proteins, indicating that it is not simply due to differences in the composition in the proteins present. Rather, it would appear that each pool-mother and infant-turns over independently, and that fractionation in infant N-metabolism even in the first month of life dominates over the nutrient N-content.
International Nuclear Information System (INIS)
Tumba, Kaniki; Reddy, Prashant; Naidoo, Paramespri; Ramjugernath, Deresh
2011-01-01
Research highlights: → Activity coefficients at infinite dilution in the ionic liquid [3C 6 C 14 P][BF 4 ]. → Twenty-seven solutes investigated at T = (313.15, 333.15, 353.15, and 373.15) K. → [3C 6 C 14 P][BF 4 ] shows promise for the separation of aromatic and alcohol mixtures. - Abstract: Activity coefficients at infinite dilution have been measured by gas-liquid chromatography for 27 organic solutes (n-alkanes, 1-alkenes, 1-alkynes, cycloalkanes, aromatics, alcohols, and ketones) in the ionic liquid trihexyl(tetradecyl)phosphonium tetrafluoroborate [3C 6 C 14 P][BF 4 ]. The measurements were carried out at four different temperatures viz.T = (313.15, 333.15, 353.15, and 373.15) K. From the experimental data, partial molar excess enthalpy values at infinite dilution were calculated for the experimental temperature range. The selectivity values for the separation of n-hexane/benzene, cyclohexane/benzene, and methanol/benzene mixtures were determined from the experimental infinite dilution activity coefficient values. These values were compared to those available in the literature for other ionic liquids and commercial solvents, so as to assess the feasibility of employing [3C 6 C 14 P][BF 4 ] in solvent-enhanced industrial separations.
International Nuclear Information System (INIS)
Kurdali, F.; Al-Shamma'a, M.
2010-01-01
A survey study was conducted on man-made plantations located at two different areas in the arid region of Syria to determine the variations in natural abundances of the 12 N and 13 C isotopes in leaves of several woody legume and non-legume species, and to better understand the consequence of such variations on nitrogen fixation and carbon assimilation. In the first study area (non-saline soil), the δ 15 N values in four legume species (Acacia cyanopylla, -1.73 %; Acacia farnesiana, -0.55%; Prosopis juliflora, -1.64%, and Medicago arborea, +1.6%) and one actinorhizal plant (Elaeagnus angustifolia, -0.46 to -2.1%) were found to be close to that of the atmospheric value pointing to a major contribution of N 2 fixing in these species; whereas, δ 15 N values of the non-fixing plant species were highly positive.δ 13 C% in leaves of the C 3 plants were found to be affected by plant species, ranging from a minimum of -28.67% to a maximum of -23%. However, they were relatively similar within each plant species although they were grown at different sites. In the second study area (salt affected soil) a higher carbon discrimination value (Δ 3 C%) was exhibited by Prosopis juliflora indicating that the latter is a salt tolerant species; however, its δ 15 N was highly positive (+7.03%) suggesting a negligible contribution of the fixed N 2 . Hence, it was concluded that the enhancement of N 2 fixation might be achieved by selection of salt-tolerant rhizobium strains. (author)
International Nuclear Information System (INIS)
Bergner, H.; Bergner, U.; Adam, K.
1980-01-01
After nine days of adaptation to a whole-egg diet, albino rats were given 14 C-U-L-leucine and 15 N-L-leucine in addition by the oral route. Each rat received the labelled leucine via a pellet made from the whole-egg diet after food deprivation for 15 h. Thereafter, the experimental animals consumed the unlabelled experimental diet ad libitum. Four times, 30 min, and 1, 2, 4 and 8 h after ingestion of the labelled food, four experimental rats were sacrificed. The contents of the digestive tract and tissue samples were examined for 14 C and 15 N. The halftime of disappearance of the 14 C activity and of the 15 N excess from the TCA-soluble fraction of the gastric contents lay between 1.9 and 2.2 h. Up to the fourth hour of experiment, the 15 N level of the TCA-soluble fraction of the gastric contents was high. The free leucine is obviously absorbed in the stomach and is used for the synthesis of enzyme protein and mucoproteides. In the TCA-soluble fraction of the total contents of the small intestine, the following values (expressed as percentages of the total amounts ingested at the times of measurement) were found: 14 C = 2.0; 6.5; 9.6; 7.4 and 1.5; 15 N excess = 0.8; 1.2; 1.6; 1.6 and 1.2 Were these values regarded as non-absorbed leucine, the 14 C values obtained during the one-to-four hour period of experiment would unequivocally be too high. Presumably, they are simulated by other 14 C-metabolites which originate from the leucine catabolism and reach the intestinal lumen through the intestinal wall. Amino acids labelled with 15 N should be preferred in studies on the absorption of amino acids because, in case of catabolization, the 15 N-amino group is excreted mainly in the form of urea. 14 C-amino acids can be recommended for such studies only if the specific 14 C activity of the amino acid used is also measured. (author)
Benchmark fragment-based 1H, 13C, 15N and 17O chemical shift predictions in molecular crystals†
Hartman, Joshua D.; Kudla, Ryan A.; Day, Graeme M.; Mueller, Leonard J.; Beran, Gregory J. O.
2016-01-01
The performance of fragment-based ab initio 1H, 13C, 15N and 17O chemical shift predictions is assessed against experimental NMR chemical shift data in four benchmark sets of molecular crystals. Employing a variety of commonly used density functionals (PBE0, B3LYP, TPSSh, OPBE, PBE, TPSS), we explore the relative performance of cluster, two-body fragment, and combined cluster/fragment models. The hybrid density functionals (PBE0, B3LYP and TPSSh) generally out-perform their generalized gradient approximation (GGA)-based counterparts. 1H, 13C, 15N, and 17O isotropic chemical shifts can be predicted with root-mean-square errors of 0.3, 1.5, 4.2, and 9.8 ppm, respectively, using a computationally inexpensive electrostatically embedded two-body PBE0 fragment model. Oxygen chemical shieldings prove particularly sensitive to local many-body effects, and using a combined cluster/fragment model instead of the simple two-body fragment model decreases the root-mean-square errors to 7.6 ppm. These fragment-based model errors compare favorably with GIPAW PBE ones of 0.4, 2.2, 5.4, and 7.2 ppm for the same 1H, 13C, 15N, and 17O test sets. Using these benchmark calculations, a set of recommended linear regression parameters for mapping between calculated chemical shieldings and observed chemical shifts are provided and their robustness assessed using statistical cross-validation. We demonstrate the utility of these approaches and the reported scaling parameters on applications to 9-tertbutyl anthracene, several histidine co-crystals, benzoic acid and the C-nitrosoarene SnCl2(CH3)2(NODMA)2. PMID:27431490
Hartman, Joshua D; Kudla, Ryan A; Day, Graeme M; Mueller, Leonard J; Beran, Gregory J O
2016-08-21
The performance of fragment-based ab initio(1)H, (13)C, (15)N and (17)O chemical shift predictions is assessed against experimental NMR chemical shift data in four benchmark sets of molecular crystals. Employing a variety of commonly used density functionals (PBE0, B3LYP, TPSSh, OPBE, PBE, TPSS), we explore the relative performance of cluster, two-body fragment, and combined cluster/fragment models. The hybrid density functionals (PBE0, B3LYP and TPSSh) generally out-perform their generalized gradient approximation (GGA)-based counterparts. (1)H, (13)C, (15)N, and (17)O isotropic chemical shifts can be predicted with root-mean-square errors of 0.3, 1.5, 4.2, and 9.8 ppm, respectively, using a computationally inexpensive electrostatically embedded two-body PBE0 fragment model. Oxygen chemical shieldings prove particularly sensitive to local many-body effects, and using a combined cluster/fragment model instead of the simple two-body fragment model decreases the root-mean-square errors to 7.6 ppm. These fragment-based model errors compare favorably with GIPAW PBE ones of 0.4, 2.2, 5.4, and 7.2 ppm for the same (1)H, (13)C, (15)N, and (17)O test sets. Using these benchmark calculations, a set of recommended linear regression parameters for mapping between calculated chemical shieldings and observed chemical shifts are provided and their robustness assessed using statistical cross-validation. We demonstrate the utility of these approaches and the reported scaling parameters on applications to 9-tert-butyl anthracene, several histidine co-crystals, benzoic acid and the C-nitrosoarene SnCl2(CH3)2(NODMA)2.
Mogusu, Emmanuel O; Wolbert, J Benjamin; Kujawinski, Dorothea M; Jochmann, Maik A; Elsner, Martin
2015-07-01
To assess sources and degradation of the herbicide glyphosate [N-(phosphonomethyl) glycine] and its metabolite AMPA (aminomethylphosphonic acid), concentration measurements are often inconclusive and even (13)C/(12)C analysis alone may give limited information. To advance isotope ratio analysis of an additional element, we present compound-specific (15)N/(14)N analysis of glyphosate and AMPA by a two step derivatization in combination with gas chromatography/isotope ratio mass spectrometry (GC/IRMS). The N-H group was derivatized with isopropyl chloroformate (iso-PCF), and remaining acidic groups were subsequently methylated with trimethylsilyldiazomethane (TMSD). Iso-PCF treatment at pH 10 indicated decomposition of the derivative. At pH 10, and with an excess of iso-PCF by 10-24, greatest yields and accurate (15)N/(14)N ratios were obtained (deviation from elemental analyzer-IRMS: -0.2 ± 0.9% for glyphosate; -0.4 ± 0.7% for AMPA). Limits for accurate δ(15)N analysis of glyphosate and AMPA were 150 and 250 ng injected, respectively. A combination of δ(15)N and δ(13)C analysis by liquid chromatography/isotope ratio mass spectrometry (LC/IRMS) (1) enabled an improved distinction of commercial glyphosate products and (2) showed that glyphosate isotope values during degradation by MnO2 clearly fell outside the commercial product range. This highlights the potential of combined carbon and nitrogen isotopes analysis to trace sources and degradation of glyphosate.
Directory of Open Access Journals (Sweden)
Isabell eKlawonn
2015-08-01
Full Text Available Recent findings revealed that the commonly used 15N2 tracer assay for the determination of dinitrogen (N2 fixation can underestimate the activity of aquatic N2-fixing organisms. Therefore, a modification to the method using pre-prepared 15-15N2-enriched water was proposed. Here, we present a rigorous assessment and outline a simple procedure for the preparation of 15-15N2-enriched water. We recommend to fill sterile-filtered water into serum bottles and to add 15-15N2 gas to the water in amounts exceeding the standard N2 solubility, followed by vigorous agitation (vortex mixing ≥5 min. Optionally, water can be degassed at low-pressure (≥950 mbar for ten minutes prior to the 15-15N2 gas addition to indirectly facilitate the 15-15N2 dissolution. This preparation of 15-15N2-enriched water can be done within one hour using standard laboratory equipment. The final 15N-atom% excess was 5% after replacing 2–5% of the incubation volume with 15-15N2-enriched water. Notably, the addition of 15-15N2-enriched water can alter levels of trace elements in the incubation water due to the contact of 15-15N2-enriched water with glass, plastic and rubber ware during its preparation. In our tests, levels of trace elements (Fe, P, Mn, Mo, Cu, Zn increased by up to 0.1 nmol L-1 in the final incubation volume, which may bias rate measurements in regions where N2 fixation is limited by trace elements. For these regions, we tested an alternative way to enrich water with 15-15N2. The 15-15N2 was injected as a bubble directly to the incubation water, followed by gentle shaking. Immediately thereafter, the bubble was replaced with water to stop the 15-15N2 equilibration. This method achieved a 15N-atom excess of 6.6±1.7% when adding 2 mL 15-15N2 per liter of incubation water. The herein presented methodological tests offer guidelines for the 15N2 tracer assay and thus, are crucial to circumvent methodological draw-backs for future N2 fixation assessments.
International Nuclear Information System (INIS)
Hansen, A.P.; Petros, A.M.; Meadows, R.P.; Mazar, A.P.; Nettesheim, D.G.; Pederson, T.M.; Fesik, S.W.
1994-01-01
Urokinase-type plasminogen activator (u-PA) is a 54-kDa glycoprotein that catalyzes the conversion of plasminogen to plasmin, a broad-specificity protease responsible for the degradation of fibrin clots and extracellular matrix components. The u-PA protein consists of three individual modules: a growth factor domain (GFD), a kringle, and a serine protease domain. The amino terminal fragment (ATF) includes the GFD-responsible for u-PA binding to its receptor-and the kringle domains. This protein was expressed and uniformly 15 N-and 15 N/ 13 C-labeled in mammalian cells by methods that will be described. In addition, we present the three-dimensional structure of ATF that was derived from 1299 NOE-derived distance restraints along with the φ angle and hydrogen bonding restraints. Although the individual domains in the structures were highly converged, the two domains are structurally independent. The overall structures of the individual domains are very similar to the structures of homologous proteins. However, important structural differences between the growth factor domain of u-PA and other homologous proteins were observed in the region that has been implicated in binding the urokinase receptor. These results may explain, in part, why other growth factors show no appreciable affinity for the urokinase receptor
15N liver function tests - concept, validity, clinical use
International Nuclear Information System (INIS)
Faust, H.; Jung, K.; Krumbiegel, P.; Hirschberg, K.; Reinhardt, R.; Junghans, P.
1987-01-01
Several liver function tests using the oral application of a nitrogen compound labelled with 15 N and the subsequent determination of 15 N in a certain fraction of urine by emission spectrometry are described. Because of the key position of the liver in the metabolism of nitrogen compounds the results of these tests allow conclusions concerning disturbances of special liver functions. Instructions for the clinical use of the '[ 15 N]Ammonium Test', '[ 15 N]Hippurate Test' the '[ 15 N]Methacetin Test', and the '[ 15 N]Glycine Test' are given. (author)
Energy Technology Data Exchange (ETDEWEB)
DeNiro, M J [California Univ., Los Angeles (USA). Dept. of Earth and Space Sciences; Hastorf, C A [California Univ., Los Angeles (USA). Dept. of Anthropology
1985-01-01
The stable carbon and nitrogen isotope ratios of plants extracted from Peruvian archaeological sites, ranging in age from 400 to 4000 years B.P., have been measured. The delta/sup 13/C and delta/sup 15/N values of prehistoric plants that were carbonized prior to deposition are similar to those of modern plants which have the same carbon dioxide fixation or nitrogen assimilation mechanisms. In contrast, the delta/sup 15/N values of prehistoric plants that were not carbonized are generally 10 to 20 per mille and as much as 35 per mille more positive than those of their modern counterparts. The delta/sup 13/C and delta/sup 15/N values of different parts of prehistoric uncarbonized plants differ by as much as 8 per mille and 21 per mille respectively, whereas the same parts of modern plants have delta/sup 13/C or delta/sup 15/N values that lie within 2 per mille of one another. SEM analysis eliminated the possibility that diagenetic alteration of the isotope ratios of the prehistoric uncarbonized plants was caused by the adsorption of particulate soil matter. The results are discussed.
Sub-cellular localisation of a 15N-labelled peptide vector using NanoSIMS imaging
Römer, Winfried; Wu, Ting-Di; Duchambon, Patricia; Amessou, Mohamed; Carrez, Danièle; Johannes, Ludger; Guerquin-Kern, Jean-Luc
2006-07-01
Dynamic SIMS imaging is proposed to map sub-cellular distributions of isotopically labelled, exogenous compounds. NanoSIMS imaging allows the characterisation of the intracellular transport pathways of exogenous molecules, including peptide vectors employed in innovative therapies, using stable isotopes as molecular markers to detect the compound of interest. Shiga toxin B-subunit (STxB) was chosen as a representative peptide vector. The recombinant protein ( 15N-STxB) was synthesised in Escherichia coli using 15NH 4Cl as sole nitrogen source resulting in 15N enrichment in the molecule. Using the NanoSIMS 50 ion microprobe (Cameca), different ion species ( 12C 14N -, 12C 15N -, 31P -) originating from the same sputtered micro volume were simultaneously detected. High mass resolving power enabled the discrimination of 12C 15N - from its polyatomic isobars of mass 27. We imaged the membrane binding and internalisation of 15N-STxB in HeLa cells at spatial resolutions of less than 100 nm. Thus, the use of rare stable isotopes like 15N with dynamic SIMS imaging permits sub-cellular detection of isotopically labelled, exogenous molecules and imaging of their transport pathways at high mass and spatial resolution. Application of stable isotopes as markers can replace the large and chemically complex tags used for fluorescence microscopy, without altering the chemical and physical properties of the molecule.
Nitrogen turnover of three different agricultural soils determined by 15N triple labelling
Fiedler, Sebastian R.; Kleineidam, Kristina; Strasilla, Nicol; Schlüter, Steffen; Reent Köster, Jan; Well, Reinhard; Müller, Christoph; Wrage-Mönnig, Nicole
2017-04-01
To meet the demand for data to improve existing N turnover models and to evaluate the effect of different soil physical properties on gross nitrogen (N) transformation rates, we investigated two arable soils and a grassland soil after addition of ammonium nitrate (NH4NO3), where either ammonium (NH4+), or nitrate (NO3-), or both pools have been labelled with 15N at 60 atom% excess (triple 15N tracing method). Besides NH4+, NO3- and nitrite (NO2-) contents with their respective 15N enrichment, nitrous oxide (N2O) and dinitrogen (N2) fluxes have been determined. Each soil was adjusted to 60 % of maximum water holding capacity and pre-incubated at 20˚ C for two weeks. After application of the differently labelled N fertilizer, the soils were further incubated at 20˚ C under aerobic conditions in a He-N2-O2 atmosphere (21 % O2, 76 He, 2% N2) to increase the sensitivity of N2 rates via the 15N gas flux method. Over a 2 week period soil N pools were quantified by 2 M KCl extraction (adjusted to pH 7 to prevent nitrite losses) (Stevens and Laughlin, 1995) and N gas fluxes were measured by gas chromatography in combination with IRMS. Here, we present the pool sizes and fluxes as well as the 15N enrichments during the study. Results are discussed in light of the soil differences that were responsible for the difference in gross N dynamics quantified by the 15N tracing model Ntrace (Müller et al., 2007). References Müller, C., T. Rütting, J. Kattge, R.J. Laughlin, and R.J. Stevens, (2007) Estimation of parameters in complex 15N tracing models by Monte Carlo sampling. Soil Biology & Biochemistry. 39(3): p. 715-726. Stevens, R.J. and R.J. Laughlin, (1995) Nitrite transformations during soil extraction with potassium chloride. Soil Science Society of America Journal. 59(3): p. 933-938.
15N-Labelling and structure determination of adamantylated azolo-azines in solution
Directory of Open Access Journals (Sweden)
Sergey L. Deev
2017-11-01
Full Text Available Determining the accurate chemical structures of synthesized compounds is essential for biomedical studies and computer-assisted drug design. The unequivocal determination of N-adamantylation or N-arylation site(s in nitrogen-rich heterocycles, characterized by a low density of hydrogen atoms, using NMR methods at natural isotopic abundance is difficult. In these compounds, the heterocyclic moiety is covalently attached to the carbon atom of the substituent group that has no bound hydrogen atoms, and the connection between the two moieties of the compound cannot always be established via conventional 1H-1H and 1H-13C NMR correlation experiments (COSY and HMBC, respectively or nuclear Overhauser effect spectroscopy (NOESY or ROESY. The selective incorporation of 15N-labelled atoms in different positions of the heterocyclic core allowed for the use of 1H-15N (JHN and 13C-15N (JCN coupling constants for the structure determinations of N-alkylated nitrogen-containing heterocycles in solution. This method was tested on the N-adamantylated products in a series of azolo-1,2,4-triazines and 1,2,4-triazolo[1,5-a]pyrimidine. The syntheses of adamantylated azolo-azines were based on the interactions of azolo-azines and 1-adamatanol in TFA solution. For azolo-1,2,4-triazinones, the formation of mixtures of N-adamantyl derivatives was observed. The JHN and JCN values were measured using amplitude-modulated 1D 1H spin-echo experiments with the selective inversion of the 15N nuclei and line-shape analysis in the 1D 13С spectra acquired with selective 15N decoupling, respectively. Additional spin–spin interactions were detected in the 15N-HMBC spectra. NMR data and DFT (density functional theory calculations permitted to suggest a possible mechanism of isomerization for the adamantylated products of the azolo-1,2,4-triazines. The combined analysis of the JHN and JCN couplings in 15N-labelled compounds provides an efficient method for the structure
40 CFR 721.6505 - Polymers of C13C15 oxoalcohol ethoxolates.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymers of C13C15 oxoalcohol... Specific Chemical Substances § 721.6505 Polymers of C13C15 oxoalcohol ethoxolates. (a) Chemical substance... polymers of C13C15 oxoalcohol ethoxolates (PMNs P-96-950/951) are subject to reporting under this section...
International Nuclear Information System (INIS)
Shi Weiqi; Wang Guoan; Li Xiaolin
2008-01-01
Leymus chinensis, one of dominant species in Inner Mongolia grassland, was selected to evaluate the effects of arbuscular mycorrhizal fungi (AMF) on plant gas change parameters and stable isotope ratio in pot culture. The plant was inoculated with two mycorrhizal fungi, Glomus intraradices and Glomus claroidum, and the uninoculated plant was used as the control check. On the 45th , 60th , 75th days after sowing, gas exchange parameters and stable isotope ratio were measured. The results showed that AM infection promoted phosphoms content, stomatal conductance and photosynthetic rate of Leymus chinensis, reduced host δ 15 N, however, it did not influence host intrinsic water using efficiency and δ 13 C. It was the growth time that significantly affected the gas exchange and stable isotope ratio of δ 13 C and δ 15 N. And the interaction of inoculation and growth time also influenced on the net photosynthetic rate, δ 13 C and δ 15 N of the host. Stomatal conductance and photosynthetic rate were always changed the same direction by arbuscular mycorrhizal fungi causing no significant difference between mycorrhizal and non-mycorrhizal plant. AMF absorbed nitrogen and accumulated δ 15 N, thus, it transformed less 15 N into the host, and as a result, the mycorrhizal plant had lower δ 15 N. Therefore, the results gave a new way and reference to know of the grass balance of carbon gain and water cost and the nitrogen cycle in grassland. (authors)
Energy Technology Data Exchange (ETDEWEB)
Hodsdon, M.E.; Toner, J.J.; Cistola, D.P. [Washington Univ. School of Medicine, St. Louis, MO (United States)
1994-12-01
Intestinal fatty-acid-binding protein (I-FABP) belongs to a family of soluble, cytoplasmic proteins that are thought to function in the intracellular transport and trafficking of polar lipids. Individual members of this protein family have distinct specificities and affinities for fatty acids, cholesterol, bile salts, and retinoids. We are comparing several retinol- and fatty-acid-binding proteins from intestine in order to define the factors that control molecular recognition in this family of proteins. We have established sequential resonance assignments for uniformly {sup 13}C/{sup 15}N-enriched I-FABP complexed with perdeuterated palmitate at pH7.2 and 37{degrees}C. The assignment strategy was similar to that introduced for calmodulin. We employed seven three-dimensional NMR experiments to establish scalar couplings between backbone and sidechain atoms. Backbone atoms were correlated using triple-resonance HNCO, HNCA, TOCSY-HMQC, HCACO, and HCA(CO)N experiments. Sidechain atoms were correlated using CC-TOCSY, HCCH-TOCSY, and TOCSY-HMQC. The correlations of peaks between three-dimensional spectra were established in a computer-assisted manner using NMR COMPASS (Molecular Simulations, Inc.) Using this approach, {sup 1}H, {sup 13}C, and {sup 15}N resonance assignments have been established for 120 of the 131 residues of I-FABP. For 18 residues, amide {sup 1}H and {sup 15}N resonances were unobservable, apparently because of the rapid exchange of amide protons with bulk water at pH 7.2. The missing amide protons correspond to distinct amino acid patterns in the protein sequence, which will be discussed. During the assignment process, several sources of ambiguity in spin correlations were observed. To overcome this ambiguity, the additional inter-residue correlations often observed in the HNCA experiment were used as cross-checks for the sequential backbone assignments.
Ogaya, Romà; Peñuelas, Josep
2008-11-01
A rain exclusion experiment simulating drought conditions expected in Mediterranean areas for the following decades (15% decrease in soil moisture) was conducted in a Mediterranean holm oak forest to study the response of leaf δ13C, δ15N, and N concentrations to the predicted climatic changes for the coming decades. Plant material was sampled in 2000, 2003, 2004, and 2005 in eight plots: four of them were control plots and the other four plots received the rain exclusion treatment. Although there was a negative relationship between δ13C and soil moisture, for each species and year, the rain exclusion treatment did not have any significant effect on δ13C, and therefore on the intrinsic water use efficiency (iWUE) of the three dominant species: Phillyrea latifolia, Arbutus unedo, and Quercus ilex. On the other hand, rain exclusion clearly increased the δ15N values in the three species studied, probably indicating higher N losses at the soil level leading to a 15N enrichment of the available N. It suggested that rain exclusion exerted a greater effect on the nitrogen biogeochemical cycle than on the carbon assimilation process. δ15N values were inversely correlated with summer soil moisture in Q. ilex and A. unedo, but no relationship was observed in P. latifolia. This latter species showed the lowest iWUE values, but it was the only species with no decrease in annual basal increment in response to the rain exclusion treatment, and it also had the highest resistance to the hot and dry conditions projected for the Mediterranean basin in the coming decades. The different strategies to resist rain exclusion conditions of these species could induce changes in their competitive ability and future distribution. The losses of N from the ecosystem may further limit plant growth and ecosystem functioning.
Auto-inducing media for uniform isotope labeling of proteins with {sup 15}N, {sup 13}C and {sup 2}H
Energy Technology Data Exchange (ETDEWEB)
Guthertz, Nicolas [Institute of Cancer Research, Division of Structural Biology (United Kingdom); Klopp, Julia; Winterhalter, Aurélie; Fernández, César; Gossert, Alvar D., E-mail: alvar.gossert@novartis.com [Novartis Institutes for BioMedical Research (Switzerland)
2015-06-15
Auto-inducing media for protein expression offer many advantages like robust reproducibility, high yields of soluble protein and much reduced workload. Here, an auto-inducing medium for uniform isotope labelling of proteins with {sup 15}N, {sup 13}C and/or {sup 2}H in E. coli is presented. So far, auto-inducing media have not found widespread application in the NMR field, because of the prohibitively high cost of labeled lactose, which is an essential ingredient of such media. Here, we propose using lactose that is only selectively labeled on the glucose moiety. It can be synthesized from inexpensive and readily available substrates: labeled glucose and unlabeled activated galactose. With this approach, uniformly isotope labeled proteins were expressed in unattended auto-inducing cultures with incorporation of {sup 13}C, {sup 15}N of 96.6 % and {sup 2}H, {sup 15}N of 98.8 %. With the present protocol, the NMR community could profit from the many advantages that auto-inducing media offer.
Study of the reaction π-p→ωn in the 15-40 GeV/c momentum range
International Nuclear Information System (INIS)
Saleem, M.; Shaukat, M.A.
1981-08-01
Recent measurements of differential cross sections and density matrix elements for the reaction π - p→ωn in the 15-40 GeV/c momentum range and for 0 2 have been fitted by using a simple Regge pole model with phenomenological residue functions. (author)
Patterns of δ13C and δ15N in wolverine Gulo gulo tissues from the Brooks Range, Alaska
Directory of Open Access Journals (Sweden)
Fredrik DALERUM
2009-06-01
Full Text Available Knowledge of carnivore diets is essential to understand how carnivore populations respond demographically to variations in prey abundance. Analysis of stable isotopes is a useful complement to traditional methods of analyzing carnivore diets. We used data on d13C and d15N in wolverine tissues to investigate patterns of seasonal and annual diet variation in a wolverine Gulo gulo population in the western Brooks Range, Alaska, USA. The stable isotope ratios in wolverine tissues generally reflected that of terrestrial carnivores, corroborating previous diet studies on wolverines. We also found variation in d13C and d15N both between muscle samples collected over several years and between tissues with different assimilation rates, even after correcting for isotopic fractionation. This suggests both annual and seasonal diet variation. Our results indicate that data on d13C and d15N holds promise for qualitative assessments of wolverine diet changes over time. Such temporal variation may be important indicators of ecological responses to environmental perturbations, and we suggest that more refined studies of stable isotopes may be an important tool when studying temporal change in diets of wolverines and similar carnivores [Current Zoology 55(3: 188–192, 2009].
Energy Technology Data Exchange (ETDEWEB)
Wiench, J W; Bocian, W; Stefaniak, L [Inst. Chemii Organicznej, Polska Akademia Nauk, Warsaw (Poland)
1994-12-31
NMR spectra of 5-nitrobenzimidazole derivatives in DMSO solution show the fast exchange of protons. The line broadening in {sup 1}H,{sup 13}C and {sup 15}N spectra have been observed. The interpretation of the spectra has been done basing on chemical shifts values and couplings between nuclei in the investigated derivatives. 3 refs, 2 figs, 3 tabs.
Methods of 15N tracer research in biological systems
International Nuclear Information System (INIS)
Hirschberg, K.; Faust, H.
1985-01-01
The application of the stable isotope 15 N is of increasing importance in different scientific disciplines, especially in medicine, agriculture, and the biosciences. The close correlation between the growing interest and improvements of analytical procedures resulted in remarkable advances in the 15 N tracer technique. On the basis of the latest results of 15 N tracer research in life sciences and agriculture methods of 15 N tracer research in biological systems are compiled. The 15 N methodology is considered under three headings: Chemical analysis with a description of methods of sample preparation (including different separation and isolation methods for N-containing substances of biological and agricultural origin) and special procedures converting ammonia to molecular nitrogen. Isotopic analysis with a review on the most important methods of isotopic analysis of nitrogen: mass spectrometry (including the GC-MS technique), emission spectrometry, NMR spectroscopy, and other analytical procedures. 15 N-tracer techniques with a consideration of the role of the isotope dilution analysis as well as different labelling techniques and the mathematical interpretation of tracer data (modelling, N turnover experiments). In these chapters also sources of errors in chemical and isotopic analysis, the accuracy of the different methods and its importance on tracer experiments are discussed. Procedures for micro scale 15 N analysis and aspects of 15 N analysis on the level of natural abundance are considered. Furthermore some remarks on isotope effects in 15 N tracer experiments are made. (author)
Kraft, Rebecca A; Jahren, A Hope; Saudek, Christopher D
2008-11-01
Objective chemical biomarkers are needed in clinical studies of diet-related diseases to supplement subjective self-reporting methods. We report on several critical experiments for the development of clinically legitimate dietary stable isotope biomarkers within human blood. Our examination of human blood revealed the following: (1) Within blood clot and serum from anonymous individuals (201 males, 205 females) we observed: mean serum delta13C = -19.1 +/- 0.8 per thousand (standard deviation, SD); clot, -19.3 +/- 0.8 per thousand (SD); range = -15.8 per thousand to -23.4 per thousand. Highly statistically significant differences are observed between clot and serum, males and females for both clot and serum. For 15N (n = 206), mean serum = +8.8 +/- 0.5 per thousand (SD); clot +7.4 +/- 0.4 per thousand (SD); range = +6.3 per thousand to +10.5 per thousand. Blood serum is enriched in 15N relative to blood clot by +1.4 per thousand on average, which may reflect differing protein amino acid content. Serum nitrogen is statistically significantly different for males and females, however, clot shows no statistical difference. (2) Relative to clot, capillary blood is marginally different for 13C, but not 15N. Clot 13C is not significantly different from serum; however, it is depleted in 15N by 1.5 per thousand relative to serum. (3) We assessed the effect of blood additives (sodium fluoride and polymerized acrylamide resin) and laboratory process (autoclaving, freeze drying) commonly used to preserve or prepare venous blood. On average, no alteration in delta13C or delta15N is detected compared with unadulterated blood from the same individual. (4) Storage of blood with and without the additives described above for a period of up to 115 days exhibits statistically significant differences for 13C and 15N for sodium fluoride. However, storage for unadulterated blood and blood preserved with polymerized acrylamide resin does not change the delta13C or delta15N isotopic
Energy Technology Data Exchange (ETDEWEB)
Hirschberg, K; Jung, K; Faust, H; Matkowitz, R
1987-07-01
The /sup 15/N tracer technique was used to investigate liver-specific reactions (urea and hippurate synthesis) for studying the metabolism in the healthy and damaged pig liver. After (/sup 15/N)ammonium chloride administration the tracer distribution on non-protein compounds of serum and urine was followed. Blood samplings before and after liver passage rendered possible a direct analysis of the (/sup 15/N)ammonium metabolism. The thioacetamide-induced liver damage was used as model for an acute liver intoxication. The capacity for urea synthesis was not influenced by means of this noxious substance, but the metabolism of amino acids and hippuric acid. The considerably depressed excretion of (/sup 15/N)hippurate seems to be a suitable indicator of liver disfunction.
Dabundo, Richard; Lehmann, Moritz F.; Treibergs, Lija; Tobias, Craig R.; Altabet, Mark A.; Moisander, Pia H.; Granger, Julie
2014-01-01
We report on the contamination of commercial 15-nitrogen (15N) N2 gas stocks with 15N-enriched ammonium, nitrate and/or nitrite, and nitrous oxide. 15N2 gas is used to estimate N2 fixation rates from incubations of environmental samples by monitoring the incorporation of isotopically labeled 15N2 into organic matter. However, the microbial assimilation of bioavailable 15N-labeled N2 gas contaminants, nitrate, nitrite, and ammonium, is liable to lead to the inflation or false detection of N2 fixation rates. 15N2 gas procured from three major suppliers was analyzed for the presence of these 15N-contaminants. Substantial concentrations of 15N-contaminants were detected in four Sigma-Aldrich 15N2 lecture bottles from two discrete batch syntheses. Per mole of 15N2 gas, 34 to 1900 µmoles of 15N-ammonium, 1.8 to 420 µmoles of 15N-nitrate/nitrite, and ≥21 µmoles of 15N-nitrous oxide were detected. One 15N2 lecture bottle from Campro Scientific contained ≥11 µmoles of 15N-nitrous oxide per mole of 15N2 gas, and no detected 15N-nitrate/nitrite at the given experimental 15N2 tracer dilutions. Two Cambridge Isotopes lecture bottles from discrete batch syntheses contained ≥0.81 µmoles 15N-nitrous oxide per mole 15N2, and trace concentrations of 15N-ammonium and 15N-nitrate/nitrite. 15N2 gas equilibrated cultures of the green algae Dunaliella tertiolecta confirmed that the 15N-contaminants are assimilable. A finite-differencing model parameterized using oceanic field conditions typical of N2 fixation assays suggests that the degree of detected 15N-ammonium contamination could yield inferred N2 fixation rates ranging from undetectable, detected in field assays. These results indicate that past reports of N2 fixation should be interpreted with caution, and demonstrate that the purity of commercial 15N2 gas must be ensured prior to use in future N2 fixation rate determinations. PMID:25329300
Utilization of 15N-labelled urea in laying hens. 4
International Nuclear Information System (INIS)
Gruhn, K.; Hennig, A.
1986-01-01
In order to study the utilization of urea in poultry, 3 colostomized laying hybrids were orally supplied with a traditional ration supplemented with 1% 15 N'-labelled urea with a 15 N excess ( 15 N') of 96.06 atom-% over a period of 6 days. After another 2 days on which the hens received the same ration with unlabelled urea, they were killed. The atom-% 15 N' of the blood on an average of the 3 hens was 0.64, of the plasma 1.40 and of the corpuscles 0.47. The TCA-soluble fraction of the blood had an average 15 N' of 1.14 atom-%; the 15 N amount was 9.7% of the total amount of 15 N in the blood. The amount of 15 N' in the urea in the blood was 6.8 atom-%. This shows that the absorbed urea is decomposed very slowly. The quota of 15 N' in the basic amino acids from the total 15 N' of the blood plasma was only 0.3% and that of the corpuscles 2.2%. The average 15 N' of the mature follicles was 2.39 atom-% whereas the smallest and the remaining ovary contain 1.12 atom-%. The labelling level of lysine in mature egg cells was, in contrast to this, only 0.08 atom-% 15 N' and in infantile follicles 0.04 atom-% 15 N'. 1% of the 15 N' quota was in the follicles and the remaining ovary. Of the basic amino acids, histidine is most strongly labelled. The lower incorporation of the 15 N' from urea into the basic amino acids shows that the nitrogen of this compound can be used for the synthesis of the essential amino acids to a low degree only. (author)
Utilization of 15N-labelled urea in laying hens. 7
International Nuclear Information System (INIS)
Gruhn, K.
1987-01-01
3 colostomized laying hybrids received 1% 15 N-labelled urea with 96.06 atom-% 15 N excess ( 15 N') with a commercial ration over a period of 6 days. After the application of the same ration with unlabelled urea on the following 2 days the animals were butchered. In the muscles of breast, legs and heart, the labelling of total nitrogen and the incorporation of urea 15 N' into 15 amino acids of the 3 different kinds of muscles were ascertained. On average, significant differences could be ascertained between the atom-% 15 N of the muscles was 0.25 and 0.34 atom-%, resp.; that of the cardial proteins 0.71 atom-% 15 N'. The incorporation of urea 15 N into the basic amino acids is low and varies both between the kinds of muscles and between the amino acids. On average the highest level of labelling was found among the essential amino acids valine, isoleucine and leucine; the average atom-% 15 N' for the muscles of the breast is 0.13, of the leg 0.17, and of the heart 0.27; the 15 N' quota of branched Chain amino acids in the total 15 N' of the respective muscle is accordingly 6.0%, 5.0% and 4.5%. The non-essential amino acids, particularly glutamic acid, are more highly labelled in the muscles than the essential ones. A 15 N' for glutamic acid of 0.24 atom-% in the breast muscles, of 0.27 atom-% in those of the legs and of 0.64 atom-% in the heart muscle could be detected. The average quota of the 15 N' of these acid amino acids in the 15 N' for breast, leg and heart muscles is 7.4, 6.2 and 6.7, resp. The quota of the 15 N' in the 6 non-essential amino acids in the total 15 N' in all 3 kinds of muscles is approximately two thirds and in the 9 essential ones one third of the total 15 N'. Although the results show that there is a certain incorporation of 15 N' from urea into the amino acids of the muscle proteins, their contribution to meeting the demands is irrelevant. (author)
DEFF Research Database (Denmark)
Andresen, Louise C.; Michelsen, Anders; Jonasson, Sven Evert
2011-01-01
In the plant biosynthesis of secondary compounds, phenylalanine is a precursor of condensed tannins. Tannins are deposited into the soil in plant root exudates and dead plant material and have been suggested to precipitate some soil nutrients and hence reduce nutrient availability for plants. Free...... amino acid,inorganic and microbial N concentration during the growing season was investigated in an ecosystem with a natural tannin chemosphere. The influence of tannins on the uptake of nitrogen in plants and microbes was followed by injecting tannic acid (TA), ammonium-15N and phenylalanine-15N/13C9...
Mechanism of the reactions 14N(d,p)15N and 14N(d,n)15O by Doppler shift line shape method
International Nuclear Information System (INIS)
Abdel-Moneim, A.M.
1976-06-01
In this investigation the total and the differential absolute cross sections of the 14 N(d,p) 15 N reaction leading to excited states at 7.3, 8.3 and 9.05 MeV levels in 15 N and the 14 N(d,n) 15 O reaction leading to the 6.79 MeV level in 15 O, have been studied over the energy range from 0.5 MeV to 3 MeV. Doppler shift line shape method as well as γ-ray yield measurements have been used. The absolute cross sections are determined relative to the known 14 N(p,p) elastic differential cross sections. A comparison with previously determined values for the same reactions at selected energies shows good agreement in angular distribution as well as in absolute values. The total cross section for the d,p reaction shows a general energy dependence which is typical for direct reactions, but with minor contribution from compound nucleus formation at certain energy ranges. For the 14 N(d,n) 15 N reaction, the method applied is unique, since it allows the differential cross section to be studied all the way down to the threshold energy of deuterons at 2 MeV, with a detectorsystem efficiency which is constant over the entire range of neutron energies. The larger part of the energy range that has been investigated is dominated by a resonance at 2.55 π+ 0.05 MeV deuteron energy and a halfwidth depending on the amount of contribution from the direct reaction of the order of 200-400 keV. (JIW)
Stable isotope 15N-urea and clinical research in nephrology
International Nuclear Information System (INIS)
Sugino, Nobuhiro; Arai, Junko; Akimoto, Mitsuko; Miwa, Toichiro; Takuma, Takehide
1990-01-01
Stable isotope 15 N-compound, 15 N-urea, is useful marker to investigate nitrogen metabolism in clinical nephrology, particularly in chronic renal failure or dialysis. 15 N-urea incorporation into plasma albumin in addition to plasma 15 N disappearance was studied in 6 patients with endstage chronic renal failure. As a result, only minor fraction of administered 15 N-urea was incorporated into albumin in this study. In addition, it was also confirmed that high energy diet may promote protein synthesis through 15 N incorporation to plasma amino acids, such as alanine, in these patients with low protein meal. Therefore, administration of 15 N-compound to human subjects may contribute to provide us the important informations on nitrogen metabolism. For instance, urea kinetics are described in the endstage chronic renal failure in this review. However, less expensive 15 N-compounds should be provided and more simple but accurate measurement of 15 N activity should be developed for the further clinical application of the stable isotope. (author)
Determination of endogenous nitrogen in feces using 15N tracers
International Nuclear Information System (INIS)
Herrmann, U.; Krawielitzki, K.; Schadereit, R.; Smulikowska, S.
1986-01-01
A ration consisting of wheat gluten and N-free components was supplemented with L-lysine and L-leucine and fed to two groups of growing Wistar rats. Group 1 received 15 N Lys and unlabelled Leu, group 2 received unlabelled Lys and 15 N Leu in order to study the influence of the utilization of the 15 N marker on the labelling quota of feces and urine as well as various fractions of the body. The good utilization of Lys in group 1 results in a higher 15 N excess in feces and a reduced 15 N abundance in urine in comparison to group 2 with a lower utilization of 15 N Leu. The results show that the 15 N abundance in urine is unsuitable as an indicator of the 15 N labelling quota of endogenous metabolic fecal nitrogen. (author)
Constraints on oceanic N balance/imbalance from sedimentary 15N records
Directory of Open Access Journals (Sweden)
M. A. Altabet
2007-01-01
Full Text Available According to current best estimates, the modern ocean's N cycle is in severe deficit. N isotope budgeting provides an independent geochemical constraint in this regard as well as the only means for past reconstruction. Overall, it is the relative proportion of N2 fixation consumed by water column denitrification that sets average oceanic δ15N under steady-state conditions. Several factors (conversion of organic N to N2, Rayleigh closed and open system effects likely reduce the effective fractionation factor (ε for water column denitrification to about half the inherent microbial value for εden. If so, the average oceanic δ15N of ~5‰ is consistent with a canonical contribution from water column denitrification of 50% of the source flux from N2 fixation. If an imbalance in oceanic N sources and sinks changes this proportion then a transient in average oceanic δ15N would occur. Using a simple model, changing water column denitrification by ±30% or N2 fixation by ±15% produces detectable (>1‰ changes in average oceanic δ15N over one residence time period or more with corresponding changes in oceanic N inventory. Changing sedimentary denitrification produces no change in δ15N but does change N inventory. Sediment δ15N records from sites thought to be sensitive to oceanic average δ15N all show no detectible change over the last 3 kyr or so implying a balanced marine N budget over the latest Holocene. A mismatch in time scales is the most likely meaningful interpretation of the apparent conflict with modern flux estimates. Decadal to centennial scale oscillations between net N deficit and net surplus may occur but on the N residence timescale of several thousand years, net balance is achieved in sum. However, sediment δ15N records from the literature covering the period since the last glacial maximum show excursions of up to several ‰ that are consistent with sustained N deficit during the deglaciation followed by readjustment
Schimmelmann, Arndt; Albertino, Andrea; Sauer, Peter E; Qi, Haiping; Molinie, Roland; Mesnard, François
2009-11-01
Accurate determinations of stable isotope ratios require a calibration using at least two reference materials with different isotopic compositions to anchor the isotopic scale and compensate for differences in machine slope. Ideally, the delta values of these reference materials should bracket the isotopic range of samples with unknown delta values. While the practice of analyzing two isotopically distinct reference materials is common for water (VSMOW-SLAP) and carbonates (NBS 19 and L-SVEC), the lack of widely available organic reference materials with distinct isotopic composition has hindered the practice when analyzing organic materials by elemental analysis/isotope ratio mass spectrometry (EA-IRMS). At present only L-glutamic acids USGS40 and USGS41 satisfy these requirements for delta13C and delta15N, with the limitation that L-glutamic acid is not suitable for analysis by gas chromatography (GC). We describe the development and quality testing of (i) four nicotine laboratory reference materials for on-line (i.e. continuous flow) hydrogen reductive gas chromatography-isotope ratio mass-spectrometry (GC-IRMS), (ii) five nicotines for oxidative C, N gas chromatography-combustion-isotope ratio mass-spectrometry (GC-C-IRMS, or GC-IRMS), and (iii) also three acetanilide and three urea reference materials for on-line oxidative EA-IRMS for C and N. Isotopic off-line calibration against international stable isotope measurement standards at Indiana University adhered to the 'principle of identical treatment'. The new reference materials cover the following isotopic ranges: delta2H(nicotine) -162 to -45 per thousand, delta13C(nicotine) -30.05 to +7.72 per thousand, delta15N(nicotine) -6.03 to +33.62 per thousand; delta15N(acetanilide) +1.18 to +40.57 per thousand; delta13C(urea) -34.13 to +11.71 per thousand, delta15N(urea) +0.26 to +40.61 per thousand (recommended delta values refer to calibration with NBS 19, L-SVEC, IAEA-N-1, and IAEA-N-2). Nicotines fill a gap as
Inácio, Caio T; Magalhães, Alberto M T; Souza, Paulo O; Chalk, Phillip M; Urquiaga, Segundo
2018-05-01
Variations in the relative isotopic abundance of C and N (δ 13 C and δ 15 N) were measured during the composting of different agricultural wastes using bench-scale bioreactors. Different mixtures of agricultural wastes (horse bedding manure + legume residues; dairy manure + jatropha mill cake; dairy manure + sugarcane residues; dairy manure alone) were used for aerobic-thermophilic composting. No significant differences were found between the δ 13 C values of the feedstock and the final compost, except for dairy manure + sugarcane residues (from initial ratio of -13.6 ± 0.2 ‰ to final ratio of -14.4 ± 0.2 ‰). δ 15 N values increased significantly in composts of horse bedding manure + legumes residues (from initial ratio of +5.9 ± 0.1 ‰ to final ratio of +8.2 ± 0.5 ‰) and dairy manure + jatropha mill cake (from initial ratio of +9.5 ± 0.2 ‰ to final ratio of +12.8 ± 0.7 ‰) and was related to the total N loss (mass balance). δ 13 C can be used to differentiate composts from different feedstock (e.g. C 3 or C 4 sources). The quantitative relationship between N loss and δ 15 N variation should be determined.
Enrichment of 15N by ion exchange chromatography
International Nuclear Information System (INIS)
Ohwaki, Masao; Ohtsuka, Haruhisa; Nomura, Masao; Okamoto, Makoto; Fujii, Yasuhiko
1996-01-01
15 N isotope separation was studied using cation exchange resins which consist of functional groups: sulfonic acid, carboxylic acid and phenol at various concentration of the eluent LiOH. The isotope separation coefficients for these ion exchange resins were observed to be nearly equal, in spite of the large difference in ion exchange characteristics. The effect of flow rate on 15 N isotope separation was also studied, and the results indicate that the operation at high flow rate would be preferable for the industrial process of 15 N enrichment. Based on the preliminary investigations, a continuous operation using a series of ion exchange columns has been carried out in order to achieve high enrichment of 15 N. (author)
13C, 15N Resonance Assignment of Parts of the HET-s Prion Protein in its Amyloid Form
International Nuclear Information System (INIS)
Siemer, Ansgar B.; Ritter, Christiane; Steinmetz, Michel O.; Ernst, Matthias; Riek, Roland; Meier, Beat H.
2006-01-01
The partial 15 N and 13 C solid-state NMR resonance assignment of the HET-s prion protein fragment 218-289 in its amyloid form is presented. It is based on experiments measured at MAS frequencies in the range of 20-40 kHz using exclusively adiabatic polarization-transfer schemes. The resonance assignment within each residue is based on two-dimensional 13 C-- 13 C correlation spectra utilizing the DREAM mixing scheme. The sequential linking of the assigned residues used a set of two- and three-dimensional 15 N-- 13 C correlation experiments. Almost all cross peaks visible in the spectra are assigned, but only resonances from 43 of the 78 amino-acid residues could be detected. The missing residues are thought to be highly disordered and/or highly dynamic giving rise to broad resonance lines that escaped detection in the experiments applied. The line widths of the observed resonances are narrow and comparable to line widths observed in micro-crystalline samples. The 43 assigned residues are located in two fragments of about 20 residues
International Nuclear Information System (INIS)
Kurdali, F.; Al-Shammaa, M.
2009-01-01
The impact of two K-fertilizer treatments [K0 (0) and K1 (150 kg K 2 O/ha)] on dry matter production and N 2 fixation (Ndfa) by Lentil (Lens culinaris.) was evaluated in a pot experiment. The plants were also subjected to three soil moisture regimes starting from bud flower initiation stage to pod formation (low, 45-50%. Moderate, 55-60% and high 75-80% of field capacity, abbreviated as FC1, FC2 and FC3, respectively). The 15 N natural abundance technique (%δ 15 N) was employed to evaluate N 2 fixation using barley as a reference crop. Moreover, the carbon isotope discrimination (%Δ 13 C) was determined to assess factors responsible for crop performance variability in the different treatments. Water restriction occurring during the post-flowering period considerably affects growth and N 2 -fixation. However, K-fertilizer enhanced plant performance by overcoming water shortage influences. The delta 15 N values in lentils ranged from +0.67 to +1.36% depending on soil moisture and K-fertilizer treatments. Whereas, those of N 2 fixation and the reference plant were -0.45 and +2.94%, respectively. Consequently, Ndfa% ranged from 45 and 65%. Water stress reduced Δ 13 C values in the FC1K0 And FC1K1 treatments. However, K fertilizer enhanced the whole plants Δ 13 C along with dry matter yield and N 2 fixation. The water stressed plants amended with K (FC1K1) seemed to be the best treatment because of its highest pod yield, high N balance and N 2 -fixation with low consumption of irrigation water. This illustrates the ecological and economical importance of K-fertilizer in alleviating water stress occurring during the post-flowering period of lentil.(Authors)
Dänicke, S; Böttcher, W; Simon, O; Jeroch, H
2001-01-01
An experiment was carried out to measure fractional muscle protein synthesis rates (k(s)) in broilers with injection of a flooding dose of phenylalanine (1 ml/100 g body weight of 150 mM phenylalanine; 38 atom percent excess (APE) [15N]phenylalanine). K(s) was calculated from the [15N] enrichment in phenylalanine of tissue-free and protein-bound phenylalanine using both gas chromatography mass spectrometry (GC-MS) and gas chromatography combustion isotope ratio mass spectrometry (GC-C-IRMS) for measurements after a 10 min isotope incorporation period. The tertiary-butyldimethylsilyl (t-BDMS) derivatives of phenylalanine were used for gas chromatographic separation in both systems. GC-MS and GC-C-IRMS were calibrated for a range of 7 to 37 [15N]APE and 0 to 0.62 [15N]APE, respectively, and for sample sizes of 0.45 to 4.5 nmol phenylalanine and 7 to 40 nmol phenylalanine, respectively. Reproducibility of standards as a measure of precision varied from 0.06 to 0.29 [15N]APE and from 0.0004 to 0.0018 [15N]APE in GC-MS and GC-C-IRMS, respectively. K(s) was measured in the m. pectoralis major of broilers fed rye based diets (56%) which were provided either unsupplemented (-) or supplemented (+) with an enzyme preparation containing xylanase. K(s) in breast muscles was significantly increased from 21.8%/d to 23.9%/d due to enzyme supplementation. It can be concluded from the study that the measurement of protein synthesis in broilers with the flooding dose technique can be carried out by using [15N]phenylalanine, GC-MS and GC-C-IRMS.
Incorporation of 15N-inorganic nitrogen into free-amino acids in germinating corn
International Nuclear Information System (INIS)
Samukawa, Kisaburo; Yamaguchi, Masuro
1979-01-01
Incorporation of 15 N-labeled compounds, (K 15 NO 3 ) and ( 15 NH 4 ) 2 SO 4 , into free-amino acids was measured in germinating corn. Sterilized seeds of sweet corn (Choko No. 865) were sown on the filter papers soaked in 10 ml of the solution containing one of the labeled compounds (40 ppm N, 99 atom % excess) in petri dishes and germinated at 30 deg C. After 48 hours and 72 hours, 15 N-incorporation was measured in 5 seedlings selected owing to uniform growth. A GC-MS was used for measuring the ratio of 15 N isotopes present in free-amino acids. 15 N incorporation into free-amino acids hardly occurred when corn was germinated in the solution containing K 15 NO 3 , which suggested that endogenous nitrogen was used during the early germination stage of corn when nitrate is present. Incorporation into amino acids was greater when corn was germinated in the medium containing ( 15 NH 4 ) 2 SO 4 , than the case of the solution containing K 15 NO 3 . When corn was germinated in the solution containing ( 15 NH 4 ) 2 SO 4 , assimilation of 15 N into asparagine or aspartic acid was comparatively higher than that into the other amino acids, though the incorporation rate was low. Thus, in intact germinating corn, the hydrolyzed product of protein was utilized for germination with priority, and dependence on exogenous nitrogen was low. (Kaihara, S.)
Design of a 15N Molecular Unit to Achieve Long Retention of Hyperpolarized Spin State
Nonaka, Hiroshi; Hirano, Masashi; Imakura, Yuki; Takakusagi, Yoichi; Ichikawa, Kazuhiro; Sando, Shinsuke
2017-01-01
Nuclear hyperpolarization is a phenomenon that can be used to improve the sensitivity of magnetic resonance molecular sensors. However, such sensors typically suffer from short hyperpolarization lifetime. Herein we report that [15N, D14]trimethylphenylammonium (TMPA) has a remarkably long spin-lattice relaxation time (1128 s, 14.1 T, 30 °C, D2O) on its 15N nuclei and achieves a long retention of the hyperpolarized state. [15N, D14]TMPA-based hyperpolarized sensor for carboxylesterase allowed the highly sensitive analysis of enzymatic reaction by 15N NMR for over 40 min in phophate-buffered saline (H2O, pH 7.4, 37 °C).
Synthesis of {sup 15}N isotope labeled alanine; Sintese da alanina enriquecida com {sup 15}N
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Claudineia R. de; Bendassolli, Jose Albertino; Sant' Ana, Carlos Roberto; Tagliassachi, Romulo Barbieri; Maximo, Everaldo; Prestes, Clelber Vieira [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Dept. de Isotopos Estaveis]. E-mail: crolivei@cena.usp.br
2005-07-01
The application of light chemical elements and their stable isotopes in biological studies have been increased over the last years. The use of {sup 15}N labeled amino acids is an important tool for elucidation of peptides structures. This paper describe a method for the synthesis of {sup 15}N isotope labeled alanine at lower costs than international ones, as well as the details of the recovery system of the nitrogen residues. In the present work an amination of {alpha}-haloacids, with the bromopropionic carboxylic acid and labeled aqua ammonia ({sup 15}NH{sub 3} aq) was carried out. In order to avoid eventually losses of {sup 15}NH{sub 3}, special cares were adopted, since the production cost is high. Although the acquisition cost of the {sup 13}N (radioactive) labeled compounds is lower, the obtained stable tracer will allow the accomplishment of important studies of the nitrogen cycling in living things, less occupational and environment hazards, and the time limitation problems in field studies. The tests took place in triplicates with NH{sub 3} (aq) being employed. With the establishment of the system for {sup 15}NH{sub 3} recovery, an average of 94 % of the ammonia employed in the synthesis process was recovered. The purity of the amino acid was state determined by TLC (Thin Layer Chromatography) and HPLC (High-Performance Liquid Chromatography) with a fluorescence detector. The Rf and the retention time of the synthesized sample were similar the sigma standard. Finally, regarding the established conditions, it was possible to obtain the alanine with a production cost about 40 % lower than the international price. (author)
DEFF Research Database (Denmark)
Ravn, Nynne Marie Rand; Elberling, Bo; Michelsen, Anders
2017-01-01
Background and aim: Nutrient distribution and carbon fluxes upon spring thaw are compared in mesocosms from high arctic and subarctic ecosystems dominated by Cassiope tetragona or Salix hastata/Salix arctica, in order to evaluate the possibility of plant and microbial utilization of an organic...... compound in thawing permafrost and surface soil. Methods: Double labeled glycine (13C15N) was added to soil columns with vegetation and to permafrost. During thaw conditions ecosystem respiration 13C was measured and 13C and 15N distribution in the ecosystem pools was quantified one day and one month after...... glycine addition. Results: Near-surface soil microbes were more efficient in the uptake of intact glycine immediately upon thaw than plants. After one month plants had gained more 15N whereas microbes seemed to lose 15N originating from glycine. We observed a time lag in glycine degradation upon...
International Nuclear Information System (INIS)
Detken, Andreas; Hardy, Edme H.; Ernst, Matthias; Kainosho, Masatsune; Kawakami, Toru; Aimoto, Saburo; Meier, Beat H.
2001-01-01
The application of adiabatic polarization-transfer experiments to resonance assignment in solid, uniformly 13 C- 15 N-labelled polypeptides is demonstrated for the cyclic decapeptide antamanide. A homonuclear correlation experiment employing the DREAM sequence for adiabatic dipolar transfer yields a complete assignment of the C α and aliphatic side-chain 13 C resonances to amino acid types. The same information can be obtained from a TOBSY experiment using the recently introduced P9 1 12 TOBSY sequence, which employs the J couplings as a transfer mechanism. A comparison of the two methods is presented. Except for some aromatic phenylalanine resonances, a complete sequence-specific assignment of the 13 C and 15 N resonances in antamanide is achieved by a series of selective or broadband adiabatic triple-resonance experiments. Heteronuclear transfer by adiabatic-passage Hartmann-Hahn cross polarization is combined with adiabatic homonuclear transfer by the DREAM and rotational-resonance tickling sequences into two- and three-dimensional experiments. The performance of these experiments is evaluated quantitatively
International Nuclear Information System (INIS)
Cerda, Mauricio; Macario, Kita Damasio; Roberto Meigikos dos Anjos; Universidade Federal Fluminense; Lamego, Fernando; Universidade Federal Fluminense
2016-01-01
Eutrophication history was reconstructed by bulk organic and inorganic proxies (C, N, P) and isotope (δ 13 C and δ 15 N) analysis constrained by geochronological model derived from fallout 210 Pb in Brazilian coastal lagoon. The sedimentary record spanning the last four decades showed impact of urbanization starting from 1970s. These changes were marked by increase of TN, TP, IP fluxes that were significantly correlated with population growth. Significant covariation of C:N, MDP and δ 15 N along age-depth profiles provided linkage with sedimentation rates, serving as an independent time marker for geochronology and validating use of 210 Pb dating model based on constant initial concentration. (author)
Ndimele, Prince Emeka; Jenyo-Oni, Adetola; Chukwuka, Kanayo S; Ndimele, Chinatu Charity; Ayodele, Ibukunoluwa Augustine
2015-01-01
This study investigated the effects of inorganic fertilizer (N15P15K15) amendments on crude oil uptake by water hyacinth. Experimental units (water hyacinth grown in fresh water) were spiked with 0, 20, 40 and 60 mg/L crude oil. After 24 h, they were randomly assigned fertilizer (N15P15K15) at three different concentrations; 0, 6 and 10 mg/L. Crude oil degradation and absorption were determined by measuring total petroleum hydrocarbon (TPH) in the water column and water hyacinth, respectively. The measurements were taken monthly for six months (February-August 2010). The results showed that TPH concentration in the water column in the treatment amended at 6 mg/L (0.30 ± 0.01 mg/L) was significantly lower (p phytoremediation) absorbed significantly higher (p phytoremediation of crude oil by water hyacinth and biostimulation with fertilizer (N15P15K15) is possible.
Directory of Open Access Journals (Sweden)
C Mori
2013-03-01
Full Text Available The objective of this study was to trace the inclusion of bovine meat and bone meal (BMBM in the diet of Japanese quails by analyzing eggs and egg fractions (yolk and albumen by the technique of carbon-13 (13C and nitrogen-15 (15N stable isotopes. In the trial, 120 Japanese quails were distributed in six treatments with four replicates of five birds each. The following treatments were applied: feed based on corn and soybean meal, containing graded BMBM inclusions (0, 1, 2, 3, 4 or 5%. After 42 days, 20 eggs per treatment were randomly collected for three consecutive days. Ten eggs were used for yolk and albumen sample collection, and ten for total egg sample collection. It was possible to detect the dietary inclusion of 1% BMBM in the egg and its fractions. Therefore, the technique of isotopes 13C and 15N is able of tracing since 1% inclusion level of BMBM in the diet of Japanese quails in eggs and their fractions.
Synthesis of {sup 15}N labeled glyphosate; Sintese do glifosato enriquecido com {sup 15}N
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Claudineia R. de; Bendassolli, Jose Albertino; Tavares, Glauco Arnold; Rossete, Alexssandra L.R.M.; Tagliassachi, Romulo Barbieri; Prestes, Cleuber Vieira [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Dept. de Isotopos Estaveis]. E-mail: crolivei@cena.usp.br
2005-07-01
Amongst the actually commercialized herbicides the Glyphosate is the most used in Brazil. Its efficiency as well as the others herbicides against undesirable weeds is harmed by its final composts left at the environment. Although studies has being carried out to improve the knowledge about the herbicides behavior at the environment its complexity has led them towards innumerous to new significant research work where the use of radiolabeled composts (radiative tracers) are recommended to evaluate their bio-availability in the soil. However is the use, the manipulation and the storage of radiolabeled composts is requires an extra care under chemical safety point of view. The use of non radiolabeled composts is a world tendency especially for field researches. Under this context the presented work describes a method for the synthesis of {sup 15}N labeled glyphosate. The {sup 15}N-herbicide was undertaken by phosphometilation with the phosphit dialquil and {sup 15}N-glycine. The tests where carried out through a micro scale production plant and of equimolars amounts. At these conditions it's was possible to reach approximately a 20% of yield. At the conclusion of a best operational condition its expected to offer another important toll that shall be used in glyphosate behavior at the environment and undesirably weeds. (author)
Utilization of 15N-labelled urea in laying hens. 8
International Nuclear Information System (INIS)
Gruhn, K.; Graf, H.
1987-01-01
3 colostomized laying hybrids received orally with a conventional ration 1% urea with 96.06 atom-% 15 N excess ( 15 N') over a period of 6 days. In the period of the experiment every hen consumed 2.87 g 15 N'. After another 2 days, on which they received conventional feed urea, the animals were butchered. 15 N' was determined in the total N and in 15 amino acids of the oviduct. Of the 15 amino acids the labelling of glutamic acid, glycine and serine was highest and on average amounted to 0.80, 0.66 and 0.67 atom-% 15 N', resp. In lysine and arginine only 0.10 and 0.11 atom-% 15 N' could be detected. The amino acid N with natural isotopic frequency amounted to a quarter for the basic amino acids, a tenth for the branched chain ones and for the non-essential ones (glutamic acid, aspartic acid, serine, glycine, alanine, proline) a third of the total oviduct 14 N. The average quota of 15 N' is only 3.6%, that of the branched chain amino acids 4.5 and that of the non-essential ones 21.1%. Consequently, the 15 N' of the urea is mainly used for the synthesis of the non-essential amino acids of the oviduct. (author)
Combined solid state and solution NMR studies of α,ε-15N labeled bovine rhodopsin
International Nuclear Information System (INIS)
Werner, Karla; Lehner, Ines; Dhiman, Harpreet Kaur; Richter, Christian; Glaubitz, Clemens; Schwalbe, Harald; Klein-Seetharaman, Judith; Khorana, H. Gobind
2007-01-01
Rhodopsin is the visual pigment of the vertebrate rod photoreceptor cell and is the only member of the G protein coupled receptor family for which a crystal structure is available. Towards the study of dynamics in rhodopsin, we report NMR-spectroscopic investigations of α,ε- 15 N-tryptophan labeled rhodopsin in detergent micelles and reconstituted in phospholipids. Using a combination of solid state 13 C, 15 N-REDOR and HETCOR experiments of all possible 13 C' i-1 carbonyl/ 15 N i -tryptophan isotope labeled amide pairs, and H/D exchange 1 H, 15 N-HSQC experiments conducted in solution, we assigned chemical shifts to all five rhodopsin tryptophan backbone 15 N nuclei and partially to their bound protons. 1 H, 15 N chemical shift assignment was achieved for indole side chains of Trp35 1.30 and Trp175 4.65 . 15 N chemical shifts were found to be similar when comparing those obtained in the native like reconstituted lipid environment and those obtained in detergent micelles for all tryptophans except Trp175 4.65 at the membrane interface. The results suggest that the integrated solution and solid state NMR approach presented provides highly complementary information in the study of structure and dynamics of large membrane proteins like rhodopsin
Garcin, Edwige B; Bornet, Olivier; Pieulle, Laetitia; Guerlesquin, Françoise; Sebban-Kreuzer, Corinne
2011-10-01
Thioredoxins are ubiquitous key antioxidant enzymes which play an essential role in cell defense against oxidative stress. They maintain the redox homeostasis owing to the regulation of thiol-disulfide exchange. In the present paper, we report the full resonance assignments of (1)H, (13)C and (15)N atoms for the reduced and oxidized forms of Desulfovibrio vulgaris Hildenborough thioredoxin 1 (Trx1). 2D and 3D heteronuclear NMR experiments were performed using uniformly (15)N-, (13)C-labelled Trx1. Chemical shifts of 97% of the backbone and 90% of the side chain atoms were obtained for the oxidized and reduced form (BMRB deposits with accession number 17299 and 17300, respectively).
Qi, Haiping; Coplen, Tyler B; Mroczkowski, Stanley J; Brand, Willi A; Brandes, Lauren; Geilmann, Heike; Schimmelmann, Arndt
2016-04-15
The widely used l-glutamic acid isotopic reference material USGS41, enriched in both (13) C and (15) N, is nearly exhausted. A new material, USGS41a, has been prepared as a replacement for USGS41. USGS41a was prepared by dissolving analytical grade l-glutamic acid enriched in (13) C and (15) N together with l-glutamic acid of normal isotopic composition. The δ(13) C and δ(15) N values of USGS41a were directly or indirectly normalized with the international reference materials NBS 19 calcium carbonate (δ(13) CVPDB = +1.95 mUr, where milliurey = 0.001 = 1 ‰), LSVEC lithium carbonate (δ(13) CVPDB = -46.6 mUr), and IAEA-N-1 ammonium sulfate (δ(15) NAir = +0.43 mUr) and USGS32 potassium nitrate (δ(15) N = +180 mUr exactly) by on-line combustion, continuous-flow isotope-ratio mass spectrometry, and off-line dual-inlet isotope-ratio mass spectrometry. USGS41a is isotopically homogeneous; the reproducibility of δ(13) C and δ(15) N is better than 0.07 mUr and 0.09 mUr, respectively, in 200-μg amounts. It has a δ(13) C value of +36.55 mUr relative to VPDB and a δ(15) N value of +47.55 mUr relative to N2 in air. USGS41 was found to be hydroscopic, probably due to the presence of pyroglutamic acid. Experimental results indicate that the chemical purity of USGS41a is substantially better than that of USGS41. The new isotopic reference material USGS41a can be used with USGS40 (having a δ(13) CVPDB value of -26.39 mUr and a δ(15) NAir value of -4.52 mUr) for (i) analyzing local laboratory isotopic reference materials, and (ii) quantifying drift with time, mass-dependent isotopic fractionation, and isotope-ratio-scale contraction for isotopic analysis of biological and organic materials. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Employment. 8c.40 Section 8c.40... BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF COMMERCE § 8c.40 Employment... discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...
17 CFR 240.15c3-1d - Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1).
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Satisfactory Subordination...-Counter Markets § 240.15c3-1d Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1). (a) Introduction. (1) This Appendix sets forth minimum and non-exclusive requirements for satisfactory...
Study of the GDR in 15N using fast neutron capture
International Nuclear Information System (INIS)
Wender, S.A.; Jensen, M.; Potokar, M.; Roberson, N.R.; Tilley, D.R.; Weller, H.R.
1978-01-01
The excitation function for 15 N(γ,n) from 16 to 23 MeV was obtained by use of the detailed balance priinciple from neutron capture. As coefficients from the 14 N(n,γ) data are also shown. Similar data are shown for 14 C(p,γ) and 14 N(p,γ) studies. 2 figures
Novel DNA packaging recognition in the unusual bacteriophage N15
Energy Technology Data Exchange (ETDEWEB)
Feiss, Michael [Department of Microbiology, Roy J. and Lucille A. Carver College of Medicine, University of Iowa, Iowa City, IA 52242 (United States); Geyer, Henriette, E-mail: henriettegeyer@gmail.com [Division of Viral Infections, Robert Koch Institute, Berlin (Germany); Division of Viral Infections, Robert Koch Institute, Berlin (Germany); Klingberg, Franco, E-mail: franco.klingberg@thermofisher.com [Flow Cytometry, Imaging & Microscopy, Thermo Fisher Scientific, Frankfurter Strasse 129B 64293 Darmstadt (Germany); Flow Cytometry, Imaging & Microscopy, Thermo Fisher Scientific, Frankfurter Strasse 129B 64293 Darmstadt (Germany); Moreno, Norma, E-mail: nmoreno@islander.tamucc.edu [Texas A& M University – Corpus Christi, 6300 Ocean Drive, Corpus Christi, TX 78412, United States. (United States); Texas A& M University – Corpus Christi, 6300 Ocean Drive, Corpus Christi, TX 78412, United States. (United States); Forystek, Amanda, E-mail: eamanda-forystek@uiowa.edu [Flow Cytometry, Imaging & Microscopy, Thermo Fisher Scientific, Frankfurter Strasse 129B 64293 Darmstadt (Germany); Room # 2911 JPP, Dept. of Psychiatry, The University of Iowa, 200 Hawkins Drive, Iowa City, Iowa, 52242 (United States); Maluf, Nasib Karl, E-mail: fKarl.Maluf@ap-lab.com [Flow Cytometry, Imaging & Microscopy, Thermo Fisher Scientific, Frankfurter Strasse 129B 64293 Darmstadt (Germany); Alliance Protein Laboratories, Inc. 6042 Cornerstone Court West, Suite ASan Diego, CA 92121, USA. (United States); Sippy, Jean [Department of Microbiology, Roy J. and Lucille A. Carver College of Medicine, University of Iowa, Iowa City, IA 52242 (United States)
2015-08-15
Phage lambda's cosB packaging recognition site is tripartite, consisting of 3 TerS binding sites, called R sequences. TerS binding to the critical R3 site positions the TerL endonuclease for nicking cosN to generate cohesive ends. The N15 cos (cos{sup N15}) is closely related to cos{sup λ}, but whereas the cosB{sup N15} subsite has R3, it lacks the R2 and R1 sites and the IHF binding site of cosB{sup λ}. A bioinformatic study of N15-like phages indicates that cosB{sup N15} also has an accessory, remote rR2 site, which is proposed to increase packaging efficiency, like R2 and R1 of lambda. N15 plus five prophages all have the rR2 sequence, which is located in the TerS-encoding 1 gene, approximately 200 bp distal to R3. An additional set of four highly related prophages, exemplified by Monarch, has R3 sequence, but also has R2 and R1 sequences characteristic of cosB–λ. The DNA binding domain of TerS-N15 is a dimer. - Highlights: • There are two classes of DNA packaging signals in N15-related phages. • Phage N15's TerS binding site: a critical site and a possible remote accessory site. • Viral DNA recognition signals by the λ-like bacteriophages: the odd case of N15.
International Nuclear Information System (INIS)
Bergner, U.; Adam, K.; Bergner, H.
1981-01-01
Albino rats received after nine days of adaptation to a fish meal diet in comparison with a gelatine diet 14 C-U-L-leucine and 15 N-L-leucine via a pellet made from the specific diet after food deprivation for 15 h. Thereafter, the animals consumed the non-labelled experimental diet ad libitum. 30 min, and 1, 2, 4 and 8 h, resp., after intake of the labelled food, four rats at a time were sacrificed. The contents of the digestive tract and tissue samples were examined for 14 C and 15 N and their percentages in the TCA-soluble fraction determined. If these values are regarded as non-absorbed leucine, the 14 C values obtained up to the four hour period of the experiment would be too high. Presumably, they are in the case of both diets simulated by other 14 C metabolites which originate from the leucine catabolism and reach the intestinal lumen. Amino acids labelled with 15 N should be preferred in studies on the absorption of amino acids because, in case of catabolization, the 15 N aminogroup is excreted mainly as urea via urine. (author)
van Hardenbroek, Maarten; Rinta, Päivi; Wooller, Matthew J.; Schilder, Jos; Stötter, Tabea; Heiri, Oliver
2018-06-01
The stable isotopic composition of chitinous remains of Cladocera (water fleas) and freshwater Bryozoa (moss animals) preserved in lake sediment records can provide supporting insights into past environmental and ecosystem changes in lakes. Here we explore whether analyses of these remains isolated from lake flotsam can provide information on the driving variables affecting the isotopic composition of these remains. We collected flotsam in 53 lakes and found enough material in 33 lakes to measure the stable carbon and nitrogen isotope ratios (expressed as δ13C and δ15N values, respectively) of resting stages. These values were compared with lake characteristics, water chemistry measurements, and the isotopic composition of sedimentary organic matter (SOM) in the lakes. Mean δ13C values of cladoceran ephippia and SOM were correlated and both were also negatively correlated with deep water methane concentrations and indicators of lake stratification. This supports the findings of previous studies that methane-derived carbon can provide a significant proportion of carbon entering planktonic food webs. Mean δ15N values of bryozoan statoblasts and SOM were correlated, suggesting that both reflect the δ15N values of phytoplankton. Our results provide information on how environmental variables in lakes can influence the δ13C and δ15N values in resting stages, but flotsam samples can also potentially be used to assess seasonal stable isotope variability of resting stages. Both types of information are important to improve palaeoenvironmental interpretations of stable isotope records based on these remains in lake sediments.
International Nuclear Information System (INIS)
Karasawa, Yutaka; Koh, Katsuki; Takahashi, Akira; Sumiya, Ryuta
1985-01-01
The purpose of this study is to examine time courses of 15 N in urinary ammonia and total N when 15 N-labeled ammonium acetate was continuously infused for 1 hour into chickens fed a 5 or 20 % protein diet. 15 N-enrichment of urinary nitrogen in the two dietary groups increased sharply in ammonia for the first 20 minutes and to a less extent linearly in total N for the first 30 minutes, and then gradually in both ammonia and total N. Through the ammonia infusion, the 15 N-enrichment of urinary ammonia was higher in the chickens fed the low protein diet than in those fed the high protein diet; both of them were higher than 15 N-enrichments of urinary N, which were almost the same in the two dietary groups. The urinary total N from the infused ammonia rose linearly for the first 40 minutes but thereafter did not rise further in the two dietary groups, whereas the endogenous urinary total N tended to decrease a little in the chichens fed the high protein diet but unchanged in those fed the low protein diet. The urinary ammonia from the infused ammonia increased sharply for the first 20 minutes, then linearly but at a lower rate in the chickens fed the high protein diet, whereas that in the chickens fed the low protein diet rose linearly throughout ammonia infusion. In contrast, the endogenous urinary ammonia showed no change in the chickens fed the high protein diet while it showed a tendency to increase a little in these fed the low protein diet. These results indicate that the increased urinary ammonia and total N during ammonia infusion are derived mostly from the infused ammonia in chickens fed 5 and 20% protein diets. (author)
North Atlantic ecosystem shifts revealed by cod otolith δ15N and δ13C chronologies
DEFF Research Database (Denmark)
Pedersen, Jens Brøgger; Nielsen, Jens Munk; Steingrund, Petur
. To study the link between environmental changes and ecosystem trophic structure we developed δ15N and δ13C chronologies by analyzing the organic matrix of cod otoliths from the Faroe Shelf cod population (1950-2010) and the Nuuk Fjord cod population (1927-2009). Significant correlations between δ15N & δ13C...... of organic matrix of otolith core material (Nuuk Fjord) and annual growth increments in Ocean Quahog (A. Islandica) shells will be included.......Changes in climate and exploitation have caused large fluctuations in the productivity of many North Atlantic cod populations and the collapse of many cod fisheries. These fluctuations are most likely due to a combined effect of physical processes and changes in ecosystem trophic structure...
Steinitz, R; Lemm, JM; Pasachnik, SA; Kurle, CM
2016-01-01
Copyright © 2015 John Wiley & Sons, Ltd. Rationale Stable isotope analysis is a powerful tool for reconstructing trophic interactions to better understand drivers of community ecology. Taxon-specific stable isotope discrimination factors contribute to the best use of this tool. We determined the first Δ 13 C and Δ 15 N values for Rock Iguanas (Cyclura spp.) to better understand isotopic fractionation and estimate wild reptile foraging ecology. Methods The Δ 13 C and Δ 15 N values between di...
Asymptotic normalization coefficients for 14N+p→15O and the astrophysical S factor for 14N(p,γ)15O
International Nuclear Information System (INIS)
Mukhamedzhanov, A.M.; Gagliardi, C.A.; Pirlepesov, F.; Tribble, R.E.; Bem, P.; Burjan, V.; Kroha, V.; Novak, J.; Piskor, S.; Simeckova, E.; Vincour, J.; Brown, B.A.; Nunes, F.M.
2003-01-01
The 14 N(p,γ) 15 O reaction, which controls energy production in the CNO cycle, has contributions from both resonance and direct captures to the ground and excited states. The overall normalization of the direct captures is defined by the corresponding asymptotic normalization coefficients (ANCs). Especially important is the ANC for the subthreshold state in 15 O at -0.504 keV since direct capture through this state dominates the reaction rate at stellar energies. In order to determine the ANCs for 14 N+p→ 15 O, the 14 N( 3 He,d) 15 O proton transfer reaction has been measured at an incident energy of 26.3 MeV. Angular distributions for proton transfer to the ground and five excited states were obtained. ANCs were then extracted from comparison to both distorted-wave Born approximation and coupled-channels Born approximation calculations. Using these ANCs, we calculated the astrophysical factor and reaction rates for 14 N(p,γ) 15 O. Our analysis favors a low value for the astrophysical factor
Utilization of 15N-labelled urea in laying hens. 2
International Nuclear Information System (INIS)
Gruhn, K.; Zander, R.
1985-01-01
In an N metabolism experiment 3 colostomized laying hybrids received 2870 mg 15 N excess ( 15 N') per animal in 6 days in the form of urea with their conventional feed rations. During the 8-day experiment the 21 eggs laid were separated into egg-shell, white of egg and yolk. Weight, N content and 15 N' of the individual fractions of the eggs were determined. On an average 4.6% of the heavy nitrogen was in the egg-shells, 50% in the white of egg and 45.5% in the yolk. 2.8%, 4.5% and 5.5% (hens 1 - 3) of the 15 N' consumed were detected in the eggs. The maximum 15 N' output in the white of egg was reached on the 6th day, whereas 15 N' output in the yolk showed a nearly linear increase in the time of the experiment. The results show that labelled nitrogen from urea is incorporated into the egg to a lower degree than after the feeding of 15 N-labelled proteins and that the development of its incorporation into the white of egg and the yolk differ from that after the feeding of 15 N-labelled native proteins. (author)
Energy Technology Data Exchange (ETDEWEB)
Widerlund, Anders, E-mail: Anders.Widerlund@ltu.se; Chlot, Sara; Öhlander, Björn
2014-07-01
Organic C and total N concentrations, C/N ratios, δ{sup 15}N and δ{sup 13}C values in {sup 210}Pb-dated sediment cores were used to reconstruct historical changes in organic matter (OM) accumulation in three Swedish lakes receiving nutrient-rich mine waters. Ammonium-nitrate-based explosives and sodium cyanide (NaCN) used in gold extraction were the major N sources, while lesser amounts of P originated from apatite and flotation chemicals. The software IsoSource was used to model the relative contribution of soil, terrestrial and littoral vegetation, and phytoplankton detritus in the lake sediments. In one lake the IsoSource modelling failed, suggesting the presence of additional, unknown OM sources. In two of the lakes sedimentary detritus of littoral vegetation and phytoplankton had increased by 15–20% and 20–35%, respectively, since ∼ 1950, when N- and P-rich mine waters began to reach the lakes. Today, phytoplankton is the dominating OM component in these lake sediments, which appears to be a eutrophication effect related to mining operations. Changes in the N isotopic composition of biota, lake water, and sediments related to the use of ammonium-nitrate-based explosives and NaCN were evident in the two studied systems. However, N isotope signals in the receiving waters (δ{sup 15}N ∼ + 9‰ to + 19‰) were clearly shifted from the primary signal in explosives (δ{sup 15}N–NO{sub 3} = + 3.4 ± 0.3‰; δ{sup 15}N–NH{sub 4} = − 8.0 ± 0.3‰) and NaCN (δ{sup 15}N = + 1.1 ± 0.5‰), and direct tracing of the primary N isotope signals in mining chemicals was not possible in the receiving waters. Systems where mine waters with a well known discharge history are a major point source of N with well-defined isotopic composition should, however, be suitable for further studies of processes controlling N isotope signatures and their transformation in aquatic systems receiving mine waters. - Highlights: • Historical mining-related changes in organic
Coral skeletal δ15N reveals isotopic traces of an agricultural revolution
International Nuclear Information System (INIS)
Marion, Guy S.; Dunbar, Robert B.; Mucciarone, David A.; Kremer, James N.; Lansing, J. Stephen; Arthawiguna, Alit
2005-01-01
This study introduces a new method of tracing the history of nutrient loading in coastal oceans via δ 15 N analysis of organic nitrogen preserved in the skeleton of the massive Porites coral. Four coral cores were collected in Bali, Indonesia, from reefs exposed to high levels of fertilizers in agricultural run-off, from lagoonal corals impacted by sewage, and from a reef located 30 km offshore. Skeletal δ 15 N in the agriculturally exposed coral declined from 10.7 ± 0.4 per mille in 1970-1971, when synthetic fertilizers (-0.8 per mille ± 0.2 per mille ) were introduced to Bali, to a depleted 'anthropogenic' baseline of 3.5 per mille ± 0.4% in the mid-1990s. δ 15 N values were negatively correlated with rainfall, suggesting that marine δ 15 N lowers during flood-born influxes of waste fertilizers. Reef cores exposed to untreated sewage in terrestrial discharge were enriched (7.8 and 7.3 ± 0.4 per mille ), while the offshore core reflected background oceanic signals (6.2 ± 0.4 per mille). δ 15 N, N concentration, and C:N systematics indicate that the N isotopic composition of skeletal organic matter was generally well preserved over 30 years. We suggest that skeletal organic δ 15 N can serve as a recorder of past nitrogen sources. In Bali, this tracer suggests that the intensification of Western style agricultural practices since 1970 are contributing to the degradation of coastal coral reefs
Energy Technology Data Exchange (ETDEWEB)
Hansen, A.P.; Petros, A.M.; Meadows, R.P.; Mazar, A.P.; Nettesheim, D.G.; Pederson, T.M.; Fesik, S.W. [Abbott Laboratories, Abbott Park, IL (United States)
1994-12-01
Urokinase-type plasminogen activator (u-PA) is a 54-kDa glycoprotein that catalyzes the conversion of plasminogen to plasmin, a broad-specificity protease responsible for the degradation of fibrin clots and extracellular matrix components. The u-PA protein consists of three individual modules: a growth factor domain (GFD), a kringle, and a serine protease domain. The amino terminal fragment (ATF) includes the GFD-responsible for u-PA binding to its receptor-and the kringle domains. This protein was expressed and uniformly {sup 15}N-and {sup 15}N/{sup 13}C-labeled in mammalian cells by methods that will be described. In addition, we present the three-dimensional structure of ATF that was derived from 1299 NOE-derived distance restraints along with the {phi} angle and hydrogen bonding restraints. Although the individual domains in the structures were highly converged, the two domains are structurally independent. The overall structures of the individual domains are very similar to the structures of homologous proteins. However, important structural differences between the growth factor domain of u-PA and other homologous proteins were observed in the region that has been implicated in binding the urokinase receptor. These results may explain, in part, why other growth factors show no appreciable affinity for the urokinase receptor.
15N sample preparation for mass spectroscopy analysis
International Nuclear Information System (INIS)
Trivelin, P.C.O.; Salati, E.; Matsui, E.
1973-01-01
Technics for preparing 15 N samples to be analised is presented. Dumas method and oxidation by sodium hypobromite method are described in order to get the appropriate sample. Method to calculate 15 N ratio from mass spectrometry dates is also discussed [pt
Density of states and T/sub c/ of disordered A15 compounds
International Nuclear Information System (INIS)
Ghosh, A.K.; Strongin, M.
1979-01-01
In this paper various data for the depression of T/sub c/ and N(O) are presented for a wide class of A15 materials. The question of disorder and the limits on T/sub c/ in these materials are discussed
Energy Technology Data Exchange (ETDEWEB)
Ying Jinfa [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States); Wang Jinbu [National Cancer Institute, National Institutes of Health, Structural Biophysics Laboratory (United States); Grishaev, Alex [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States); Yu Ping; Wang Yunxing [National Cancer Institute, National Institutes of Health, Structural Biophysics Laboratory (United States); Bax, Ad, E-mail: bax@nih.gov [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States)
2011-09-15
Analogous to the recently introduced ARTSY method for measurement of one-bond {sup 1}H-{sup 15}N residual dipolar couplings (RDCs) in large perdeuterated proteins, we introduce methods for measurement of base {sup 13}C-{sup 1}H and {sup 15}N-{sup 1}H RDCs in protonated nucleic acids. Measurements are based on quantitative analysis of intensities in {sup 1}H-{sup 15}N and {sup 13}C-{sup 1}H TROSY-HSQC spectra, and are illustrated for a 71-nucleotide adenine riboswitch. Results compare favorably with those of conventional frequency-based measurements in terms of completeness and convenience of use. The ARTSY method derives the size of the coupling from the ratio of intensities observed in two TROSY-HSQC spectra recorded with different dephasing delays, thereby minimizing potential resonance overlap problems. Precision of the RDC measurements is limited by the signal-to-noise ratio, S/N, achievable in the 2D TROSY-HSQC reference spectrum, and is approximately given by 30/(S/N) Hz for {sup 15}N-{sup 1}H and 65/(S/N) Hz for {sup 13}C-{sup 1}H. The signal-to-noise ratio of both {sup 1}H-{sup 15}N and {sup 1}H-{sup 13}C spectra greatly benefits when water magnetization during the experiments is not perturbed, such that rapid magnetization transfer from bulk water to the nucleic acid, mediated by rapid amino and hydroxyl hydrogen exchange coupled with {sup 1}H-{sup 1}H NOE transfer, allows for fast repetition of the experiment. RDCs in the mutated helix 1 of the riboswitch are compatible with nucleotide-specifically modeled, idealized A-form geometry and a static orientation relative to the helix 2/3 pair, which differs by ca 6 Degree-Sign relative to the X-ray structure of the native riboswitch.
International Nuclear Information System (INIS)
Sampaio, E.V.S.; Salcedo, I.H.; Bettany, J.
1990-01-01
The decomposition of 14 C- 15 N labelled straw, incorporated at three depths in a Red-yellow Latosol from the humid, coastal zone of Pernambuco State, Brazil, was measured during two years. The straw was ground, mixed with soil portions and placed in 400-mesh bags and replaced into the original field sites at 10, 30 and 60cm depth. The decomposition was also followed in the laboratory using soil from the superficial layer. Straw carbon losses in the field reached 52% during the first month and about 80% after two years. In the first 4 months mineralization was faster in the superficial layer, with no differences thereafter. In the laboratory, mineralization was slower than in the field, reaching 34 and 50% after one month and two years, respectively. During the first month, most of the soil microbial biomass was apparently formed from straw derived material but the contribution from the straw decrease to 15-30% after two months and to less than 1% after two years. Straw N losses reached 25% in the first month and 40-50% after two years, with significant differences among soil depths in the first six months when losses were higher in the deeper layers. There were no plants to absorb the mineral N which accumulated in the soil to a concentration of up to 32μg/g soil. The contribution of straw N to this mineral N decreased with incubation period but was always less than 12%. The C:N ratio of straw derived material ( 14 C- 15 N) decreased from 22:1 to 8-10:1, at all depths. (author)
Competition for tracer 15N in tussock tundra ecosystems
International Nuclear Information System (INIS)
Marion, G.M.; Miller, P.C.; Black, C.H.
1987-01-01
The objectives of this study were to assess the roles of plant species, time, and site on competition for tracer 15 N (without carrier) in tussock tundra ecosystems. Six experimental sites were located in northern Alaska. After one year across the experimental sites, the recovery of 15 N by litter (11.3-16.3%) and mosses (5.4-16.4%) was significantly greater than for aboveground vascular plants (2.6-5.0%). 15 N recoveries by tundra vascular plants (2.6-5.0%) were low when compared to forest trees (9-25%) which suggst that competition for nitrogen is particularly severe in these colddominated tundra ecosystems. There were no significant differences among sites in 15 N recoveries by vascular plants, by mosses, or by litter. There was a statistically significant decline in 15 N recovery with time for Vaccinium vitis-idaea and Eriophoum vaginatum between the second and third year. The shallow rooted Vaccinium vitis-ideae was more highly labeled than the deep rooted Eriophorum vaginatum. Nearness to the source of the applied 15 N played a critical role in competition for surface applied nitrogen. (author)
First Measurement of the 14N/15N Ratio in the Analog of the Sun Progenitor OMC-2 FIR4
Kahane, Claudine; Jaber Al-Edhari, Ali; Ceccarelli, Cecilia; López-Sepulcre, Ana; Fontani, Francesco; Kama, Mihkel
2018-01-01
We present a complete census of the 14N/15N isotopic ratio in the most abundant N-bearing molecules toward the cold envelope of the protocluster OMC-2 FIR4, the best known Sun progenitor. To this scope, we analyzed the unbiased spectral survey obtained with the IRAM 30 m telescope at 3, 2, and 1 mm. We detected several lines of CN, HCN, HNC, HC3N, N2H+, and their respective 13C and 15N isotopologues. The lines’ relative fluxes are compatible with LTE conditions, and moderate line opacities have been corrected via a population diagram method or theoretical relative intensity ratios of the hyperfine structures. The five species lead to very similar 14N/15N isotopic ratios, without any systematic difference between amine- and nitrile-bearing species as previously found in other protostellar sources. The weighted average of the 14N/15N isotopic ratio is 270 ± 30. This 14N/15N value is remarkably consistent with the [250–350] range measured for the local galactic ratio but significantly differs from the ratio measured in comets (around 140). High-angular resolution observations are needed to examine whether this discrepancy is maintained at smaller scales. In addition, using the CN, HCN, and HC3N lines, we derived a 12C/13C isotopic ratio of 50 ± 5.
Benchmarking theoretical formalisms for (p ,p n ) reactions: The 15C(p ,p n )14C case
Yoshida, K.; Gómez-Ramos, M.; Ogata, K.; Moro, A. M.
2018-02-01
Background: Proton-induced knockout reactions of the form (p ,p N ) have experienced a renewed interest in recent years due to the possibility of performing these measurements with rare isotopes, using inverse kinematics. Several theoretical models are being used for the interpretation of these new data, such as the distorted-wave impulse approximation (DWIA), the transition amplitude formulation of the Faddeev equations due to Alt, Grassberger, and Sandhas (FAGS) and, more recently, a coupled-channels method here referred to as transfer-to-the- continuum (TC). Purpose: Our goal is to compare the momentum distributions calculated with the DWIA and TC models for the same reactions, using whenever possible the same inputs (e.g., distorting potential). A comparison with already published results for the FAGS formalism is performed as well. Method: We choose the 15C(p ,p n )14C reaction at an incident energy of 420 MeV/u, which has been previously studied with the FAGS formalism. The knocked-out neutron is assumed to be in a 2 s single-particle orbital. Longitudinal and transverse momentum distributions are calculated for different assumed separation energies. Results: For all cases considered, we find a very good agreement between DWIA and TC results. The energy dependence of the distorting optical potentials is found to affect in a modest way the shape and magnitude of the momentum distributions. Moreover, when relativistic kinematics corrections are omitted, our calculations reproduce remarkably well the FAGS result. Conclusions: The results found in this work provide confidence on the consistency and accuracy of the DWIA and TC models for analyzing momentum distributions for (p ,p n ) reactions at intermediate energies.
Highly 15N-Enriched Chondritic Clasts in the Isheyevo Meteorite
Energy Technology Data Exchange (ETDEWEB)
Bonal, L; Huss, G R; Krot, A N; Nagashima, K; Ishii, H A; Bradley, J P; Hutcheon, I D
2009-01-14
The metal-rich carbonaceous chondrites (CB and CH) have the highest whole-rock {sup 15}N enrichment ({delta}{sup 15}N up to +1500{per_thousand}), similar to {delta}{sup 15}N values reported in micron-sized regions (hotspots) of Interplanetary Dust Particles (IDPs) of possibly cometary origin and fine-grained matrices of unmetamorphosed chondrites. These {sup 15}N-rich hotspots are commonly attributed to low-temperature ion-molecule reactions in the protosolar molecular cloud or in the outer part of the protoplanetary disk. The nature of the whole-rock {sup 15}N enrichment of the metal-rich chondrites is not understood. We report a discovery of a unique type of primitive chondritic clasts in the CH/CB-like meteorite Isheyevo, which provides important constraints on the origin of {sup 15}N anomaly in metal-rich chondrites and nitrogen-isotope fractionation in the Solar System. These clasts contain tiny chondrules and refractory inclusions (5-15 {micro}m in size), and abundant ferromagnesian chondrule fragments (1-50 {micro}m in size) embedded in the partly hydrated, fine-grained matrix material composed of olivines, pyroxenes, poorly-organized aromatic organics, phyllosilicates and other hydrous phases. The mineralogy and oxygen isotope compositions of chondrules and refractory inclusions in the clasts are similar to those in the Isheyevo host, suggesting formation at similar heliocentric distances. In contrast to the previously known extraterrestrial samples, the fine-grained material in the clasts is highly and rather uniformly enriched in {sup 15}N, with bulk {delta}{sup 15}N values ranging between +1000 and +1300{per_thousand}; the {delta}{sup 15}N values in rare hotspots range from +1400 to +4000{per_thousand}. Since fine-grained matrices in the lithic clasts are the only component containing thermally unprocessed (during CAI and chondrule formation or during impact melting) materials that accreted into the metal rich chondrite parent body(ies), the {sup 15}N
17 CFR 240.15c1-2 - Fraud and misrepresentation.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...
Leen, J. B.; Gupta, M.
2014-12-01
Nitrate contamination in water is a worldwide environmental problem and source apportionment is critical to managing nitrate pollution. Fractionation caused by physical, chemical and biological processes alters the isotope ratios of nitrates (15N/14N, 18O/16O and 17O/16O) and biochemical nitrification and denitrification impart different intramolecular site preference (15N14NO vs. 14N15NO). Additionally, atmospheric nitrate is anomalously enriched in 17O compared to other nitrate sources. The anomaly (Δ17O) is conserved during fractionation processes, providing a tracer of atmospheric nitrate. All of these effects can be used to apportion nitrate in soil. Current technology for measuring nitrate isotopes is complicated and costly - it involves conversion of nitrate to nitrous oxide (N2O), purification, preconcentration and measurement by isotope ratio mass spectrometer (IRMS). Site specific measurements require a custom IRMS. There is a pressing need to make this measurement simpler and more accessible. Los Gatos Research has developed a next generation mid-infrared Off-Axis Integrated Cavity Output Spectroscopy (OA-ICOS) analyzer to quantify all stable isotope ratios of N2O (δ15N, δ15Nα, δ15Nβ, δ18O, δ17O). We present the latest performance data demonstrating the precision and accuracy of the OA-ICOS based measurement. At an N2O concentration of 322 ppb, the analyzer quantifies [N2O], δ15N, δ15Na, δ15Nb, and δ18O with a precision of ±0.05 ppb, ±0.4 ‰, ±0.45 ‰, and ±0.6 ‰, and ±0.8 ‰ respectively (1σ, 100s; 1σ, 1000s for δ18O). Measurements of gas standards demonstrate accuracy better than ±1 ‰ for isotope ratios over a wide dynamic range (200 - 100,000 ppb). The measurement of δ17O requires a higher concentration (1 - 50 ppm), easily obtainable through conversion of nitrates in water. For 10 ppm of N2O, the instrument achieves a δ17O precision of ±0.05 ‰ (1σ, 1000s). This performance is sufficient to quantify atmospheric
Synthesis of 15N-labelled urea and methylenediurea
International Nuclear Information System (INIS)
Murray, T.P.; Jones, G.T.
1985-01-01
A new technique was developed for the large-scale synthesis of 15 N-labelled urea at low enrichment levels. The synthesis is based on nucleophilic displacement of the phenoxide ion from phenyl carbonate and uses anhydrous ammonia as the nucleophile. In previous reports a copper catalyst was used; however, in this study it was found that the copper resulted in product decomposition and tar formation, which makes product purification difficult. A novel set of reaction conditions was developed: no catalyst was used, and no product decomposition or tar formation occurred. The reaction product was easily purified, and consistently high yields of 15 N-labelled urea were obtained. 15 N-labelled methylenediurea was prepared by the dilute solution reaction of formalin with 15 N-labelled urea. The methodology developed for the reclamation of unreacted urea resulted in minimum loss of labelled urea. High performance liquid chromatography has been used to determine the chemical purity of both urea and methylenediurea. (author)
Carbono, Nitrogênio, Abundância Natural de Δ13C e Δ15N do Solo sob Sistemas Agroflorestais
Directory of Open Access Journals (Sweden)
Wanderson Henrique Couto
2017-08-01
Full Text Available RESUMO O objetivo deste trabalho foi avaliar alterações nos teores de C e N e abundância natural de δ13C e δ15N de um Cambissolo Háplico Tb distrófico em uma área com sistema agroflorestal (SAF. Em cada área de estudo foram coletadas amostras de solo, em 8 profundidades de 0,0–1,0 m. O delineamento experimental utilizado foi o inteiramente casualizado, em esquema de parcelas subdivididas 2 × 8 (2 áreas florestais e 8 profundidades, com três repetições. Com exceção da camada superficial do solo (0,0-0,10, a área de SAF está preservando os teores de C e aumentando os teores de N (0,2-1,0 em relação à mata nativa. Ambas as áreas avaliadas apresentaram sinais de abundância natural de δ13C referente a plantas do ciclo fotossintético C3, e a área de mata nativa apresentou nas camadas superficiais (0,0-0,20 maiores valores de δ15N, demonstrando maior decomposição da matéria orgânica.
Qi, Haiping; Coplen, Tyler B.; Mroczkowski, Stanley J.; Brand, Willi A.; Brandes, Lauren; Geilmann, Heike; Schimmelmann, Arndt
2016-01-01
RationaleThe widely used l-glutamic acid isotopic reference material USGS41, enriched in both 13C and 15N, is nearly exhausted. A new material, USGS41a, has been prepared as a replacement for USGS41.MethodsUSGS41a was prepared by dissolving analytical grade l-glutamic acid enriched in 13C and 15N together with l-glutamic acid of normal isotopic composition. The δ13C and δ15N values of USGS41a were directly or indirectly normalized with the international reference materials NBS 19 calcium carbonate (δ13CVPDB = +1.95 mUr, where milliurey = 0.001 = 1 ‰), LSVEC lithium carbonate (δ13CVPDB = −46.6 mUr), and IAEA-N-1 ammonium sulfate (δ15NAir = +0.43 mUr) and USGS32 potassium nitrate (δ15N = +180 mUr exactly) by on-line combustion, continuous-flow isotope-ratio mass spectrometry, and off-line dual-inlet isotope-ratio mass spectrometry.ResultsUSGS41a is isotopically homogeneous; the reproducibility of δ13C and δ15N is better than 0.07 mUr and 0.09 mUr, respectively, in 200-μg amounts. It has a δ13C value of +36.55 mUr relative to VPDB and a δ15N value of +47.55 mUr relative to N2 in air. USGS41 was found to be hydroscopic, probably due to the presence of pyroglutamic acid. Experimental results indicate that the chemical purity of USGS41a is substantially better than that of USGS41.ConclusionsThe new isotopic reference material USGS41a can be used with USGS40 (having a δ13CVPDB value of −26.39 mUr and a δ15NAir value of −4.52 mUr) for (i) analyzing local laboratory isotopic reference materials, and (ii) quantifying drift with time, mass-dependent isotopic fractionation, and isotope-ratio-scale contraction for isotopic analysis of biological and organic materials. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.
1H-15N correlation spectroscopy of nanocrystalline proteins
International Nuclear Information System (INIS)
Morcombe, Corey R.; Paulson, Eric K.; Gaponenko, Vadim; Byrd, R. Andrew; Zilm, Kurt W.
2005-01-01
The limits of resolution that can be obtained in 1 H- 15 N 2D NMR spectroscopy of isotopically enriched nanocrystalline proteins are explored. Combinations of frequency switched Lee-Goldburg (FSLG) decoupling, fast magic angle sample spinning (MAS), and isotopic dilution via deuteration are investigated as methods for narrowing the amide 1 H resonances. Heteronuclear decoupling of 15 N from the 1 H resonances is also studied. Using human ubiquitin as a model system, the best resolution is most easily obtained with uniformly 2 H and 15 N enriched protein where the amides have been exchanged in normal water, MAS at ∼20 kHz, and WALTZ-16 decoupling of the 15 N nuclei. The combination of these techniques results in average 1 H lines of only ∼0.26 ppm full width at half maximum. Techniques for optimizing instrument stability and 15 N decoupling are described for achieving the best possible performance in these experiments
International Nuclear Information System (INIS)
Krumbiegel, P.
1989-01-01
As a result of liver diseases, the elimination of certain drugs is retarded. After labelling a suitable drug with 13 C, the 13 CO 2 elimination rate serves as a liver function parameter. Current contributions to the 13 CO 2 breath test method are reviewed and related to the 14 CO 2 breath test proposals. In spite of several advantages of 13 C-labelled agents, some dissatisfaction has remained with the tests, especially at using them with infants. It is the necessity of face masks and the uncertainty to consider endogeneous CO 2 contributions diluting the exhaled 13 CO 2 . The problems are avoided if the other molecule site of the drug is labelled which is known to be eliminated via urine. With 15 N as a tracer, a suitable urine test using [ 15 N]-methacetin as agent has been proposed and put into practice. (author)
Stable isotope sup 15 N-urea and clinical research in nephrology
Energy Technology Data Exchange (ETDEWEB)
Sugino, Nobuhiro; Arai, Junko; Akimoto, Mitsuko; Miwa, Toichiro; Takuma, Takehide (Tokyo Women' s Medical Coll. (Japan))
1990-08-01
Stable isotope {sup 15}N-compound, {sup 15}N-urea, is useful marker to investigate nitrogen metabolism in clinical nephrology, particularly in chronic renal failure or dialysis. {sup 15}N-urea incorporation into plasma albumin in addition to plasma {sup 15}N disappearance was studied in 6 patients with endstage chronic renal failure. As a result, only minor fraction of administered {sup 15}N-urea was incorporated into albumin in this study. In addition, it was also confirmed that high energy diet may promote protein synthesis through {sup 15}N incorporation to plasma amino acids, such as alanine, in these patients with low protein meal. Therefore, administration of {sup 15}N-compound to human subjects may contribute to provide us the important informations on nitrogen metabolism. For instance, urea kinetics are described in the endstage chronic renal failure in this review. However, less expensive {sup 15}N-compounds should be provided and more simple but accurate measurement of {sup 15}N activity should be developed for the further clinical application of the stable isotope. (author).
Junghans, Peter
2013-01-01
After oral administration of [(15)N2]urea (1.5 mmol, 95 atom% (15)N), we found that breath N2 was significantly (15)N-labelled. The result suggests that molecular nitrogen in breath must be partly produced endogenously. Based on a metabolic model, the endogenous N2 production was estimated to be 0.40±0.25 mmol kg(-1) d(-1) or 2.9±1.8 % of the total (urinary and faecal) N excretion in fasted healthy subjects (n=4). In patients infected with Helicobacter pylori (n=5), the endogenous N2 production was increased to 1.24±0.59 mmol kg(-1) d(-1) or 9.0±4.3 % of the total N excretion compared to the healthy controls (pexchange measurements may be affected by endogenously produced nitrogen, especially in metabolic situations with elevated nitrosation, for instance in oxidative and nitrosative stress-related diseases such as H. pylori infections.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT
International Nuclear Information System (INIS)
Loss, Arcangelo; Pereia, Marcos Gervasio; Costa, Elias Mendes; Beutler, Sidinei Julio; Piccolo, Marisa de Cassia
2016-01-01
Humic fractions of soil organic matter (SOM) and measurements of "1"3C and "1"5N isotope can be used to highlight differences between management systems with different intensities of land use. This study characterized soil fertility, quantified carbon levels in the humic fractions and evaluated the natural abundance of "1"3C and "1"5N in systems cultivated under no-tillage system (NTS) and conventional tillage system (CTS) or used with secondary forest or perennial pasture in Marmeleiro, Parana State, Southern Brazil. NTS was more efficient than the conventional tillage system (CTS) in increasing pH (0.0-0.10 m layer), Ca (0.0-0.05 m layer), P (except 0.05-0.10 m layer) and N (0.0-0.10 m) levels, total organic carbon (TOC) stocks (0.0-0.20 and 0.0-0.40 m layers); carbon of the humin fraction (C-HUM) in 0.0-0.40 m; the fulvic acid fraction (C-FAF) and humic acid (C-HAF) in 0.0-0.05 m. The use of grasses, in NTS and pasture, increased TOC stocks compared to the other soil use or management systems evaluated in the 0.0-0.40 m layer. In the topsoil layer, the anthropogenic influence of plowing and harrowing in CTS promoted greater loss of carbon in C-HUM, C-FAF and C-HAF than NTS, forest and pasture. In CTS, growing corn for 42 years after the removal of forest cover did not alter the "1"3C at 0.0-0.40 m. In pasture, the absence of legumes, constant deposition of cattle manure and a more stable organic matter favored high "1"5N levels (except at 0.0-0.05 m in CTS). The decrease in "1"5N values from the 0.0-0.10 to 0.10-0.20 m layer in CTS indicates that soil turnover (by plowing and harrowing) has the potential to disturb the depth-related variation in soil "1"5N, accelerating decomposition and compromising N transformations. Among the variables analyzed, the determination of carbon in humic fractions and "1"5N values were efficient in identifying soil changes produced by land use or management systems
N-15-labelled pyrazines of triterpenic acids
Czech Academy of Sciences Publication Activity Database
Vlk, M.; Mičolová, P.; Urban, M.; Kvasnica, Miroslav; Šaman, David; Šarek, J.
2016-01-01
Roč. 308, č. 2 (2016), s. 733-739 ISSN 0236-5731 R&D Projects: GA ČR GJ15-08202Y; GA MŠk(CZ) LO1304; GA MŠk(CZ) LO1204 Grant - others:GA MŠk(CZ) LK21310; GA TA ČR(CZ) TA03010027; CTU(CZ) SGS15/094/OHK4/1T/14 Institutional support: RVO:61389030 ; RVO:61388963 Keywords : N-15 * Triterpenic acid * Isotopic labelling Subject RIV: CC - Organic Chemistry Impact factor: 1.282, year: 2016
Fertilizer-n uptake and distribution in rice plants using 15N tracer technique
International Nuclear Information System (INIS)
Yan Juan; Shen Qirong; Yin Bin; Wan Xinjun
2009-01-01
Fertilizer-nitrogen (N) uptake and distribution in rice were studied using 15 N tracer technique. The results obtained were as follows. At the tillering, jointing and booting, and anthesis stages, 23.1%, 8.3% and 19.9% of N were taken from fertilizer applied in base (N1), tillering (N2) and jointing and booting (N3), respectively. The 15 N translocation from anthesis to maturity was in the order of N3>N1>N2, but the 15 N translocation efficiency was higher in N1 (base fertilizer treatment) than in the other two treatments. At maturity, the 15 N distribution in straw in the treatments of N1, N2 and N3 was only 24.3%, 26.7% and 30.4%, respectively. No matter what time the N fertilizer was applied, the 15 N uptake was mostly distributed in leaves, then in the sheath, the least in stem, and 15 N distribution in spike increased with the increased 15 N translocation from nutritional organs to spike after anthesis. The study also showed that the 15 N uptake at maturity in N1, N2 and N3 treatments was 10.3%, 5.9% and 12.4%, respectively. The results indicated that (1) when soil N content was not high, the base fertilizer application was important to rice growth, and optimal increment might help increase tillering, and improve rice quality; (2) the initiation fertilizer significantly promoted quantities during grain filling, and thus application of N fertilizer in initiation was of considerable advance in increasing N harvest index (NHI); (3) the rice plants absorbed less N applied in tillering stage due to a big N loss in that period. Therefore a little bit increase of base N fertilizer with no or very small amount of tillering fertilizer, together with some topdressing of N fertilizer during initiation could improve N uptake by rice. (authors)
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 15.23 Section 15.23 Commerce and Foreign Trade Office of the Secretary of Commerce LEGAL PROCEEDINGS Involuntary Child and... approved under part D of title IV of the Social Security Act (42 U.S.C. 651-664), who has the duty or...
International Nuclear Information System (INIS)
Plath, C.; Heine, W.; Wutzke, K.D.; Krienke, L.; Toewe, J.M.; Massute, G.; Windischmann, C.
1987-01-01
Reliable 15 N tracer substances for tracer kinetic determination of whole-body protein parameters in very small preterm infants are still a matter of intensive research, especially after some doubts have been raised about the validity of [ 15 N]glycine, a commonly used 15 N tracer. Protein turnover, synthesis, breakdown, and further protein metabolism data were determined by a paired comparison in four preterm infants. Their post-conceptual age was 32.2 +/- 0.8 weeks, and their body weight was 1670 +/- 181 g. Tracer substances applied in this study were a [ 15 N]amino acid mixture (Ia) and [ 15 N]glycine (Ib). In a second group of three infants with a post conceptual age of 15 N-labeled 32.0 +/- 1.0 weeks and a body weight of 1,907 +/- 137 g, yeast protein hydrolysate (II) was used as a tracer substance. A three-pool model was employed for the analysis of the data. This model takes into account renal and fecal 15 N losses after a single 15 N pulse. Protein turnovers were as follows: 11.9 +/- 3.1 g kg-1 d-1 (Ia), 16.2 +/- 2.5 g kg-1 d-1 (Ib), and 10.8 +/- 3.0 g kg-1 d-1 (II). We were able to demonstrate an overestimation of the protein turnover when Ib was used. There was an expected correspondence in the results obtained from Ia and II. The 15 N-labeled yeast protein hydrolysate is a relatively cheap tracer that allows reliable determination of whole-body protein parameters in very small preterm infants
Accredited Standards Committee N15 Developments And Future Directions
International Nuclear Information System (INIS)
Mathews, Caroline E.; May, Melanie; Preston, Lynne
2009-01-01
Accredited Standards Committee (ASC) N15, Methods of Nuclear Material Control, is sponsored by the Institute of Nuclear Materials Management (INMM) to develop standards for protection, control and accounting of special nuclear materials in all phases of the nuclear fuel cycle, including analytical procedures where necessary and special to this purpose, except that physical protection of special nuclear material within a nuclear power plant is not included. Voluntary consensus standards complement federal regulations and technical standards and fulfill an important role for the nuclear regulatory agencies. This paper describes the N15 standards development process, with INMM as the Standards Developing Organization (SDO) and the N15 Committee responsible for implementation. Key components of the N15 standards development process include ANSI accreditation; compliance with the ANSI Essential Requirements (ER), coordination with other SDOs, communication with stakeholders, maintenance of balance between interest categories, and ANSI periodic audits. Recent and future ASC N15 activities are discussed, with a particular focus on new directions in anticipation of renewed growth in nuclear power.
/sup 15/N analysis in nutritional and metabolic research of infancy
Energy Technology Data Exchange (ETDEWEB)
Heine, W; Richter, I; Plath, C; Wutzke, K; Drescher, U [Rostock Univ. (German Democratic Republic). Bereich Medizin
1982-01-01
Investigation of protein metabolism in nutritional pediatric research by means of /sup 15/N tracer techniques has been relatively seldom used up to now. /sup 15/N-labelled compounds for these purposes are not injurious to health. The technique is based on oral or intravenous application of the tracer substances and on /sup 15/N analysis of the urine fractions. The subsequent calculation of protein synthesis and breakdown rate, turnover, and the reutilisation of amino acids from protein breakdown as well as the size of the metabolic pool offers detailed information of protein metabolism. Determination of these parameters were performed in infants on breast milk, formula feeding and on chemically defined diet. As an example of utilisation of D-amino acids for protein synthesis the /sup 15/N-D-phenylalanine retention of parenteral nutrition was found to be 33% of the applied doses at an average. An oral /sup 15/N-glycine loading test proved to be of value for the prediction of the therapeutic effect of human growth hormone. /sup 15/N tracer technique was also tested in utilizing /sup 15/N-urea for bacterial protein synthesis of the intestinal flora and by incorporation of /sup 15/N from /sup 15/N-glycine and /sup 15/N-lysine into the jejunal mucosa for measuring the enterocyte regeneration.
International Nuclear Information System (INIS)
Pritty Rao; Reddy, G.L.N.; Vikram Kumar, S.; Ramana, J.V.; Raju, V.S.; Sanjiv Kumar
2012-01-01
The paper describes the simultaneous determination of 14 N and 15 N isotopes in opium by proton induced γ-ray emission (PIGE) technique. The isotopic ratio of 14 N and 15 N is a useful parameter for assigning provenance of (seized) illicit drugs. The measurement, non-destructive in nature, is performed on pellets made up of opium powders and is based on the prompt detection of 2.313 and 4.4 MeV γ-rays emanating from 14 N(p,p'γ) 14 N and 15 N(p,αγ) 12 C nuclear reactions respectively, induced simultaneously by 3.6-3.8 MeV proton beam. Positive as well as negative deviations from the natural isotopic abundance (99.63:0.37) were observed in the samples. The precision of the measurements is about 4%. The methodology provides an easy and rapid approach to determine the isotopic ratio of 14 N and 15 N and has been used for the first time in the analysis of opium. (author)
2005-01-01
An important but unresolved question is whether mammalian mitochondria metabolize arginine to agmatine by the ADC (arginine decarboxylase) reaction. 15N-labelled arginine was used as a precursor to address this question and to determine the flux through the ADC reaction in isolated mitochondria obtained from rat liver. In addition, liver perfusion system was used to examine a possible action of insulin, glucagon or cAMP on a flux through the ADC reaction. In mitochondria and liver perfusion, 15N-labelled agmatine was generated from external 15N-labelled arginine. The production of 15N-labelled agmatine was time- and dose-dependent. The time-course of [U-15N4]agmatine formation from 2 mM [U-15N4]arginine was best fitted to a one-phase exponential curve with a production rate of approx. 29 pmol·min−1·(mg of protein)−1. Experiments with an increasing concentration (0– 40 mM) of [guanidino-15N2]arginine showed a Michaelis constant Km for arginine of 46 mM and a Vmax of 3.7 nmol·min−1·(mg of protein)−1 for flux through the ADC reaction. Experiments with broken mitochondria showed little changes in Vmax or Km values, suggesting that mitochondrial arginine uptake had little effect on the observed Vmax or Km values. Experiments with liver perfusion demonstrated that over 95% of the effluent agmatine was derived from perfusate [guanidino-15N2]arginine regardless of the experimental condition. However, the output of 15N-labelled agmatine (nmol·min−1·g−1) increased by approx. 2-fold (P<0.05) in perfusions with cAMP. The findings of the present study provide compelling evidence that mitochondrial ADC is present in the rat liver, and suggest that cAMP may stimulate flux through this pathway. PMID:15656789
Mercury and stable isotopes (δ15N and δ13C as tracers during the ontogeny of Trichiurus lepturus
Directory of Open Access Journals (Sweden)
Ana Paula Madeira Di Beneditto
Full Text Available This study applies total mercury (THg concentration and stable isotope signature (δ15N and δ13C to evaluate the trophic status and feeding ground of Trichiurus lepturus during its ontogeny in northern Rio de Janeiro, south-eastern Brazil. The trophic position of T. lepturus is detected well by THg and δ15N as the sub-adult planktivorous specimens are distinct from the adult carnivorous specimens. The δ13C signatures suggest a feeding ground associated with marine coastal waters that are shared by fish in different ontogenetic phases. The diet tracers indicated that the fish feeding habits do not vary along seasons of the year, probably reflecting the prey availability in the study area. This fish has economic importance and the concentration of THg was compared to World Health Organization limit, showing that the adult specimens of T. lepturus are very close to the tolerable limit for safe regular ingestion.
Energy Technology Data Exchange (ETDEWEB)
Werner, Karla; Lehner, Ines [Johann Wolfgang Goethe-Universitaet Frankfurt, Center for Biomolecular Magnetic Resonance (Germany); Dhiman, Harpreet Kaur [University of Pittsburgh School of Medicine, Department of Structural Biology (United States); Richter, Christian; Glaubitz, Clemens; Schwalbe, Harald, E-mail: schwalbe@nmr.uni-frankfurt.de; Klein-Seetharaman, Judith [Johann Wolfgang Goethe-Universitaet Frankfurt, Center for Biomolecular Magnetic Resonance (Germany); Khorana, H. Gobind [Massachusetts Institute of Technology, Departments of Biology and Chemistry (United States)], E-mail: khorana@mit.edu
2007-04-15
Rhodopsin is the visual pigment of the vertebrate rod photoreceptor cell and is the only member of the G protein coupled receptor family for which a crystal structure is available. Towards the study of dynamics in rhodopsin, we report NMR-spectroscopic investigations of {alpha},{epsilon}-{sup 15}N-tryptophan labeled rhodopsin in detergent micelles and reconstituted in phospholipids. Using a combination of solid state {sup 13}C,{sup 15}N-REDOR and HETCOR experiments of all possible {sup 13}C'{sub i-1} carbonyl/{sup 15}N{sub i}-tryptophan isotope labeled amide pairs, and H/D exchange {sup 1}H,{sup 15}N-HSQC experiments conducted in solution, we assigned chemical shifts to all five rhodopsin tryptophan backbone {sup 15}N nuclei and partially to their bound protons. {sup 1}H,{sup 15}N chemical shift assignment was achieved for indole side chains of Trp35{sup 1.30} and Trp175{sup 4.65}. {sup 15}N chemical shifts were found to be similar when comparing those obtained in the native like reconstituted lipid environment and those obtained in detergent micelles for all tryptophans except Trp175{sup 4.65} at the membrane interface. The results suggest that the integrated solution and solid state NMR approach presented provides highly complementary information in the study of structure and dynamics of large membrane proteins like rhodopsin.
A liver-function test using 15N-labelled ammonium chloride
International Nuclear Information System (INIS)
Jung, K.; Hirscherg, K.; Faust, H.; Matkowitz, R.
1985-01-01
Malfunction of the liver involves disturbances of urea synthesis and ammonia detoxification. These phenomena became apparent, especially during ammonia loading of patients. The functional state of the liver can be assessed by oral administration of 15 NH 4 Cl and subsequent analysis of 15 N-urea and 15 N-ammonia in urine by emission spectrometry. Clinical tests based on the ratio of the excess abundances (see Appendix) of 15 N-ammonia to 15 N-urea excreted in urine 3 h after oral administration gave values for patients with liver disease which differed significantly from those for healthy subjects. Absorption disturbances, which often accompany liver diseases, do not influence the effectiveness of the method. (orig.)
Liver-function test using /sup 15/N-labelled ammonium chloride
Energy Technology Data Exchange (ETDEWEB)
Jung, K; Hirscherg, K; Faust, H; Matkowitz, R
1985-08-01
Malfunction of the liver involves disturbances of urea synthesis and ammonia detoxification. These phenomena became apparent, especially during ammonia loading of patients. The functional state of the liver can be assessed by oral administration of /sup 15/NH/sub 4/Cl and subsequent analysis of /sup 15/N-urea and /sup 15/N-ammonia in urine by emission spectrometry. Clinical tests based on the ratio of the excess abundances (see Appendix) of /sup 15/N-ammonia to /sup 15/N-urea excreted in urine 3 h after oral administration gave values for patients with liver disease which differed significantly from those for healthy subjects. Absorption disturbances, which often accompany liver diseases, do not influence the effectiveness of the method.
Balance study of the fate of 15N fertilizer
International Nuclear Information System (INIS)
Korte, F.; Sotiriou, N.
1980-01-01
An interim report is presented on a series of experiments with wooden box-type lysimeters (60 cm x 60 cm x 70 cm) loaded with a sandy soil, a loess soil and straw-amended soil. The lysimeters support crops rotated over a five-year period to be studied - potato, barley, sugar-beet, barley (with winter rape) and finally (1979) potato. Each lysimeter received split applications of urea at total rates of 0, 50 or 100 kg.ha -1 . The effects of soil residues of the herbicide monolinuron were also studied. The report deals with data collected during the first three years of the planned experiments (1975 - 1977 inclusive). 15 N-labelled urea (47 atom 15 N% excess) was initially used but in some experiments this was followed by applications of unlabelled urea in order to study the fate of the residual 15 N in the subsequent years. The results to date indicated that in the first year highest recoveries in the plant of the applied 15 N obtained on the sandy soil. The low recoveries of 15 N in the subsequent years when unlabelled urea was supplied also indicated significant storage by soil or root organic matter of the applied 15 N. Compared with the control (zero application of urea nitrogen), potato took up more total nitrogen in the presence of fertilizer including more of the unlabelled soil pool nitrogen. Analyses of the soil profiles in terms of total soil nitrogen and fertilizer-derived nitrogen (on the basis of 15 N assays) indicated leaching of the labelled nitrogen down the soil profile in all cases during the three-year period. Analysis of NO 3 -N in leachates confirmed the presence of labelled urea-derived nitrogen. (author)
Studies of 15N transamination following application of various tracer substances. 1
International Nuclear Information System (INIS)
Schadereit, R.; Krawielitzki, K.; Herrmann, U.
1986-01-01
4 groups of 3 growing Wistar rats each were orally given 15 N-labelled methionine, lysine, glycine and ammonia sulphate, resp., over 10 days. Measuring the 15 N accumulation in the amino acids (AA) of the body protein, the transamination of the individual 15 N substances and thus their suitability as tracer substances for studies of N metabolism was determined. None of the tested 15 N-AA achieved a proportionate labelling of all AA of the body protein. The AA used as tracer in each case showed the highest 15 N labelling. Of the amino- 15 N detected in the animal body, about 19% were found in Met after 15 N Met application, 88% in Lys after 15 N Lys application and 50% in Gly after 15 N Gly application. After the application of 15 N-ammonia sulphate about 42% of the body amino- 15 N are apportioned to the essential and 58% to the non-essential AA. Thus, this substance produces a more proportional labelling of the essential and non-essential AA of the body protein than 15 N-Gly. The following quotas of the 15 N amounts applied were found in the AA of the animal bodies: tracer substance lysine 52%, glycine 32%, ammonia sulphate 24%, methionine 21%. After summing up the amino acid 15 N amounts in the animal body, eliminating in each case the tracer AA and taking into account the molecular weight of the AA, there was a good agreement of the intensity of the accumulation of 15 N in the individual AA, irrespective of the applied tracer substance. (author)
Sharma, Alok K; Lee, Seung-Joo; Rigby, Alan C; Townson, Sharon A
2018-05-02
K-Ras is a key driver of oncogenesis, accounting for approximately 80% of Ras-driven human cancers. The small GTPase cycles between an inactive, GDP-bound and an active, GTP-bound state, regulated by guanine nucleotide exchange factors and GTPase activating proteins, respectively. Activated K-Ras regulates cell proliferation, differentiation and survival by signaling through several effector pathways, including Raf-MAPK. Oncogenic mutations that impair the GTPase activity of K-Ras result in a hyperactivated state, leading to uncontrolled cellular proliferation and tumorogenesis. A cysteine mutation at glycine 12 is commonly found in K-Ras associated cancers, and has become a recent focus for therapeutic intervention. We report here 1 H N, 15 N, and 13 C resonance assignments for the 19.3 kDa (aa 1-169) human K-Ras protein harboring an oncogenic G12C mutation in the GDP-bound form (K-RAS G12C-GDP ), using heteronuclear, multidimensional NMR spectroscopy. Backbone 1 H- 15 N correlations have been assigned for all non-proline residues, except for the first methionine residue.
Metabolic studies in colostomized laying hens using 15N-labelled wheat. 4
International Nuclear Information System (INIS)
Gruhn, K.; Glotz, D.
1979-01-01
3 colostomized laying hybrids received over 4 days a dosage of 672 mg 15 N excess ( 15 N'), 20.3 mg lysine 15 N', 23.0 mg histidine 15 N' and 66.7 mg arginine 15 N' with a ration customary in production. After feeding the same unlabelled ration for another 4 days the hens were killed and the N content of the blood as well as of its fractions (cells, plasma, free amino acids of the plasma) was determined. The 15 N' was determined in the total blood, the corpuscles, the plasma, the nonprotein-N (NPN) fraction as well as in the amino acids lysine, histidine and arginine. The average amount of the blood cell N in the total blood N was 58.5% and that of the plasma 40.3%; the corresponding 15 N' values amounted to 66.1% and 33.9%, respectively. The sum of the 15 N' of the basic amino acids of the blood cells, on an average, amounted to 39.7% of the total cell 15 N'; the corresponding average value for the total 15 N' in lysine, histidine and arginine of the blood plasma 15 N' was 23.6.% and the quota of the three free amino acids of the total NP 15 N' of the plasma was 6.2%. (author)
Results from the BRACE 1.5 study: Climate change impacts of 1.5 C and 2 C warming
O'Neill, B. C.; Anderson, B.; Monaghan, A. J.; Ren, X.; Sanderson, B.; Tebaldi, C.
2017-12-01
In 2015, 195 countries negotiated the Paris Agreement on climate change, which set long-term goals of limiting global mean warming to well below 2 C and possibly 1.5 C. This event stimulated substantial scientific interest in climate outcomes and impacts on society associated with those levels of warming. Recently, the first set of global climate model simulations explicitly designed to meet those targets were undertaken with the Community Earth System Model (CESM) for use by the research community (Sanderson et al, accepted). The BRACE 1.5 project models societal impacts from these climate outcomes, combined with assumptions about future socioeconomic conditions according to the Shared Socioeconomic Pathways. These analyses build on a recently completed study of the Benefits of Reduced Anthropogenic Climate changE (BRACE), published as a set of 20 papers in Climatic Change, which examined the difference in impacts between two higher scenarios resulting in about 2.5 C and 3.7 C warming by late this century. BRACE 1.5 consists of a set of six papers to be submitted to a special collection in Environmental Research Letters that takes a similar approach but focuses on impacts at 1.5 and 2 C warming. We ask whether impacts differ substantially between the two climate scenarios, accounting for uncertainty in climate outcomes through the use of initial condition ensembles of CESM simulations, and in societal conditions by using alternative SSP-based development pathways. Impact assessment focuses on the health and agricultural sectors; modeling approaches include the use of a global mutli-region CGE model for economic analysis, both a process-based and an empirical crop model, a model of spatial population change, a model of climatic suitability for the aedes aegypti mosquito, and an epidemiological model of heat-related mortality. A methodological analysis also evaluates the use of climate model emulation techniques for providing climate information sufficient to
15N-labelled pyrazines of triterpenic acids
International Nuclear Information System (INIS)
Vlk, Martin; Micolova, Petra; Sarek, Jan
2016-01-01
Triterpenoid pyrazines from our research group were found selectively cytotoxic on several cancer cell lines with IC 50 in low micromolar range. This sparked our interest in preparing their labeled analogs for metabolic studies. In this work, we prepared a set of non-labeled pyrazines from seven triterpenoid skeletal types along with their 15 N labelled analogs. In this work, we present the synthesis and characterization of the target 15 N labelled pyrazines. Currently, these compounds are being studied in complex metabolic studies. (author)
Doubly 15N-substituted diazenylium: THz laboratory spectra and fractionation models
Dore, L.; Bizzocchi, L.; Wirström, E. S.; Degli Esposti, C.; Tamassia, F.; Charnley, S. B.
2017-07-01
Context. Isotopic fractionation in dense molecular cores has been suggested as a possible origin of large 14N/15N ratio variations in solar system materials. While chemical models can explain some observed variations with different fractionation patterns for molecules with -NH or -CN functional groups, they fail to reproduce the observed ratios in diazenylium (N2H+). Aims: Observations of doubly 15N-substituted species could provide important constraints and insights for theoretical chemical models of isotopic fractionation. However, spectroscopic data are very scarce. Methods: The rotational spectra of the fully 15N-substituted isopologues of the diazenylium ion, 15N2H+ and 15N2D+, have been investigated in the laboratory well into the THz region by using a source-modulation microwave spectrometer equipped with a negative glow discharge cell. An extended chemical reaction network has been used to estimate what ranges of 15N fractionation in doubly 15N-substituted species could be expected in the interstellar medium (ISM). Results: For each isotopologue of the H- and D-containing pair, nine rotational transitions were accurately measured in the frequency region 88 GHz-1.2 THz. The analysis of the spectrum provided very precise rest frequencies at millimeter and sub-millimeter wavelengths, useful for the radioastronomical identification of the rotational lines of 15N2H+ and 15N2D+ in the ISM.
{sup 13}C, {sup 15}N Resonance Assignment of Parts of the HET-s Prion Protein in its Amyloid Form
Energy Technology Data Exchange (ETDEWEB)
Siemer, Ansgar B. [Physical Chemistry (Switzerland); Ritter, Christiane [Salk Institute, Structural Biology Laboratory (United States); Steinmetz, Michel O. [Paul Scherrer Institut, Biomolecular Research, Structural Biology (Switzerland); Ernst, Matthias [Physical Chemistry (Switzerland); Riek, Roland [Salk Institute, Structural Biology Laboratory (United States); Meier, Beat H. [Physical Chemistry (Switzerland)
2006-02-15
The partial {sup 15}N and {sup 13}C solid-state NMR resonance assignment of the HET-s prion protein fragment 218-289 in its amyloid form is presented. It is based on experiments measured at MAS frequencies in the range of 20-40 kHz using exclusively adiabatic polarization-transfer schemes. The resonance assignment within each residue is based on two-dimensional {sup 13}C--{sup 13}C correlation spectra utilizing the DREAM mixing scheme. The sequential linking of the assigned residues used a set of two- and three-dimensional {sup 15}N--{sup 13}C correlation experiments. Almost all cross peaks visible in the spectra are assigned, but only resonances from 43 of the 78 amino-acid residues could be detected. The missing residues are thought to be highly disordered and/or highly dynamic giving rise to broad resonance lines that escaped detection in the experiments applied. The line widths of the observed resonances are narrow and comparable to line widths observed in micro-crystalline samples. The 43 assigned residues are located in two fragments of about 20 residues.
15N/14N isotopic ratio and statistical analysis: an efficient way of linking seized Ecstasy tablets
International Nuclear Information System (INIS)
Palhol, Fabien; Lamoureux, Catherine; Chabrillat, Martine; Naulet, Norbert
2004-01-01
In this study, the 15 N/ 14 N isotopic ratios of 106 samples of 3,4-methylenedioxymethamphetamine (MDMA) extracted from Ecstasy tablets are presented. These ratios, measured using gas chromatography-combustion-isotope ratio mass spectrometry (GC-C-IRMS), show a large discrimination between samples with a range of δ 15 N values between -17 and +19%o, depending on the precursors and the method used in clandestine laboratories. Thus, δ 15 N values can be used in a statistical analysis carried out in order to link Ecstasy tablets prepared with the same precursors and synthetic pathway. The similarity index obtained after principal component analysis and hierarchical cluster analysis appears to be an efficient way to group tablets seized in different places
Geomorphic control on the δ15N of mountain forests
Directory of Open Access Journals (Sweden)
R. G. Hilton
2013-03-01
Full Text Available Mountain forests are subject to high rates of physical erosion which can export particulate nitrogen from ecosystems. However, the impact of geomorphic processes on nitrogen budgets remains poorly constrained. We have used the elemental and isotopic composition of soil and plant organic matter to investigate nitrogen cycling in the mountain forest of Taiwan, from 24 sites with distinct geomorphic (topographic slope and climatic (precipitation, temperature characteristics. The organic carbon to nitrogen ratio of soil organic matter decreased with soil 14C age, providing constraint on average rates of nitrogen loss using a mass balance model. Model predictions suggest that present day estimates of nitrogen deposition exceed contemporary and historic nitrogen losses. We found ∼6‰ variability in the stable isotopic composition (δ15N of soil and plants which was not related to soil 14C age or climatic conditions. Instead, δ15N was significantly, negatively correlated with topographic slope. Using the mass balance model, we demonstrate that the correlation can be explained by an increase in nitrogen loss by non-fractioning pathways on steeper slopes, where physical erosion most effectively removes particulate nitrogen. Published data from forests on steep slopes are consistent with the correlation. Based on our dataset and these observations, we hypothesise that variable physical erosion rates can significantly influence soil δ15N, and suggest particulate nitrogen export is a major, yet underappreciated, loss term in the nitrogen budget of mountain forests.
Synthesis of 15N isotope labeled alanine
International Nuclear Information System (INIS)
Oliveira, Claudineia R. de; Bendassolli, Jose Albertino; Sant'Ana, Carlos Roberto; Tagliassachi, Romulo Barbieri; Maximo, Everaldo; Prestes, Clelber Vieira
2005-01-01
The application of light chemical elements and their stable isotopes in biological studies have been increased over the last years. The use of 15 N labeled amino acids is an important tool for elucidation of peptides structures. This paper describe a method for the synthesis of 15 N isotope labeled alanine at lower costs than international ones, as well as the details of the recovery system of the nitrogen residues. In the present work an amination of α-haloacids, with the bromopropionic carboxylic acid and labeled aqua ammonia ( 15 NH 3 aq) was carried out. In order to avoid eventually losses of 15 NH 3 , special cares were adopted, since the production cost is high. Although the acquisition cost of the 13 N (radioactive) labeled compounds is lower, the obtained stable tracer will allow the accomplishment of important studies of the nitrogen cycling in living things, less occupational and environment hazards, and the time limitation problems in field studies. The tests took place in triplicates with NH 3 (aq) being employed. With the establishment of the system for 15 NH 3 recovery, an average of 94 % of the ammonia employed in the synthesis process was recovered. The purity of the amino acid was state determined by TLC (Thin Layer Chromatography) and HPLC (High-Performance Liquid Chromatography) with a fluorescence detector. The Rf and the retention time of the synthesized sample were similar the sigma standard. Finally, regarding the established conditions, it was possible to obtain the alanine with a production cost about 40 % lower than the international price. (author)
Coral skeletal {delta}{sup 15}N reveals isotopic traces of an agricultural revolution
Energy Technology Data Exchange (ETDEWEB)
Marion, Guy S. [Department of Biological Sciences, Stanford University, Stanford, CA 94305 (United States)]. E-mail: g.marion@uq.edu.au; Dunbar, Robert B. [Department of Geological and Environmental Sciences, Stanford University, Stanford, CA 94305 (United States); Mucciarone, David A. [Department of Geological and Environmental Sciences, Stanford University, Stanford, CA 94305 (United States); Kremer, James N. [Department of Marine Sciences, University of Connecticut at Avery Point, Groton, CT 06340 (United States); Lansing, J. Stephen [Department of Anthropology, University of Arizona, Tucson, AZ 85721 (United States); Arthawiguna, Alit [Installation for Agricultural Research (IP 2TP), Kotak Pos 3480, Denpasar, Bali (Indonesia)
2005-09-01
This study introduces a new method of tracing the history of nutrient loading in coastal oceans via {delta}{sup 15}N analysis of organic nitrogen preserved in the skeleton of the massive Porites coral. Four coral cores were collected in Bali, Indonesia, from reefs exposed to high levels of fertilizers in agricultural run-off, from lagoonal corals impacted by sewage, and from a reef located 30 km offshore. Skeletal {delta}{sup 15}N in the agriculturally exposed coral declined from 10.7 {+-} 0.4 per mille in 1970-1971, when synthetic fertilizers (-0.8 per mille {+-} 0.2 per mille ) were introduced to Bali, to a depleted 'anthropogenic' baseline of 3.5 per mille {+-} 0.4% in the mid-1990s. {delta}{sup 15}N values were negatively correlated with rainfall, suggesting that marine {delta}{sup 15}N lowers during flood-born influxes of waste fertilizers. Reef cores exposed to untreated sewage in terrestrial discharge were enriched (7.8 and 7.3 {+-} 0.4 per mille ), while the offshore core reflected background oceanic signals (6.2 {+-} 0.4 per mille). {delta}{sup 15}N, N concentration, and C:N systematics indicate that the N isotopic composition of skeletal organic matter was generally well preserved over 30 years. We suggest that skeletal organic {delta}{sup 15}N can serve as a recorder of past nitrogen sources. In Bali, this tracer suggests that the intensification of Western style agricultural practices since 1970 are contributing to the degradation of coastal coral reefs.
Energy Technology Data Exchange (ETDEWEB)
Bernal-Garcia, J. Manuel [Instituto Mexicano del Petroleo, Mexico D.F. C.P. 07330 (Mexico); Hall, Kenneth R. [Chemical Engineering Department, Texas A and M University, College Station, TX 77843 (United States); Estrada-Baltazar, Alejandro [Departamento de Ingenieria Quimica, Instituto Tecnologico de Celaya, Celaya, Guanajuato, CP 38010 (Mexico); Iglesias-Silva, Gustavo A. [Departamento de Ingenieria Quimica, Instituto Tecnologico de Celaya, Celaya, Guanajuato, CP 38010 (Mexico)]. E-mail: gais@iqcelaya.itc.mx
2005-08-15
This work presents atmospheric density and viscosity values for (N,N-dimethylethanolamine + water) over the entire composition range from T (293.15 to 363.15) K for density and from T = (313.15 to 353.15) K for viscosity. Density measurements come from a vibrating tube densimeter while we have used three different Cannon-Fenske viscosimeters for the viscosity measurements. Excess molar volumes and viscosity deviations are calculated using a Redlich-Kister type equation. Excess molar volumes present negative deviations from ideality and viscosity deviations are positive at all temperatures and compositions in this work.
International Nuclear Information System (INIS)
Bernal-Garcia, J. Manuel; Hall, Kenneth R.; Estrada-Baltazar, Alejandro; Iglesias-Silva, Gustavo A.
2005-01-01
This work presents atmospheric density and viscosity values for (N,N-dimethylethanolamine + water) over the entire composition range from T (293.15 to 363.15) K for density and from T = (313.15 to 353.15) K for viscosity. Density measurements come from a vibrating tube densimeter while we have used three different Cannon-Fenske viscosimeters for the viscosity measurements. Excess molar volumes and viscosity deviations are calculated using a Redlich-Kister type equation. Excess molar volumes present negative deviations from ideality and viscosity deviations are positive at all temperatures and compositions in this work
Energy Technology Data Exchange (ETDEWEB)
Brumovska, Eva [University of South Bohemia and Biology Centre AS CR v.v.i., Faculty of Science (Czech Republic); Sychrovsky, Vladimir; Vokacova, Zuzana [Institute of Organic Chemistry and Biochemistry, AS CR v.v.i. (Czech Republic); Sponer, Jiri [Institute of Biophysics, AS CR v.v.i. (Czech Republic); Schneider, Bohdan [Biotechnological Institute AS CR (Czech Republic); Trantirek, Lukas [University of South Bohemia and Biology Centre AS CR v.v.i., Faculty of Science (Czech Republic)], E-mail: trant@paru.cas.cz
2008-11-15
Density functional theory was employed to study the dependence of {sup 13}C and {sup 15}N magnetic shielding tensors on the glycosidic torsion angle ({chi}) and conformation of the sugar ring in 2'-deoxyadenosine, 2'-deoxyguanosine, 2'-deoxycytidine, and 2'-deoxythymidine. In general, the magnetic shielding of the glycosidic nitrogens and the sugar carbons was found to depend on both the conformation of the sugar ring and {chi}. Our calculations indicate that the magnetic shielding anisotropy of the C6 atom in pyrimidine and the C8 atom in purine bases depends strongly on {chi}. The remaining base carbons were found to be insensitive to both sugar pucker and {chi} re-orientation. These results call into question the underlying assumptions of currently established methods for interpreting residual chemical shift anisotropies and {sup 13}C and {sup 15}N auto- and cross-correlated relaxation rates and highlight possible limitations of DNA applications of these methods.
DEFF Research Database (Denmark)
Jensen, Erik Steen; Andersen, A. J.; Thomsen, J. D.
1985-01-01
The distriution of seed-borne N in shoot and root of pea and field bean was studied using three methods: 1) determination of the N content in shoot and root of plants grown in sand culture without other N sources. 2) 15N isotope dilution in plants grown in Rhizobium-free medium supplied with 15N-...... of corrections for seed-borne N in studies of nitrogen fixation in legumes is discussed....
Comparison of halo of 11Be, 15C, and 19C
Kharab, R.; Kumar, R.; Singh, P.; Sharma, H. C.
2007-12-01
We have compared the halo of 11Be, 15C, and 19C nuclei by analyzing the one-neutron stripping reaction data on the Be target at 60-, 54-, and 57-MeV/ A beam energies, respectively, within the framework of the eikonal approximation approach. The determination of effective range through the comparison of the total cross section data and prediction has revealed that the halo of 19C is the well developed, while that of 15C is the least and that of 11Be lies in between these two. The longitudinal momentum distribution data also strengthen these observations.
δ15N of seagrass leaves for monitoring anthropogenic nutrient increases in coral reef ecosystems
International Nuclear Information System (INIS)
Yamamuro, M.; Kayanne, H.; Yamano, H.
2003-01-01
In a coral reef environment, a slight increase in dissolved inorganic nitrogen (DIN;≥1.0 μM) can alter the ecosystem via macroalgal blooms. We collected seagrass leaves from the tropical and subtropical Pacific Ocean in five countries and examined the interactions between nutrient concentrations (C, N, P), molar ratios of nutrients, and δ 15 N to find a possible indicator of the DIN conditions. Within most sites, the concentrations of nutrients and their molar ratios showed large variations owing to species-specific values. On the other hand, almost identical δ 15 N values were found in seagrass leaves of several species at each site. The correlations between δ 15 N and nutrient concentrations and between δ 15 N and molar ratios of nutrients suggested that nutrient availability did not affect the δ 15 N value of seagrass leaves by altering the physiological condition of the plants. Increases in δ 15 N of seagrass leaves mostly matched increases in DIN concentrations in the bottom water. We suggest that δ 15 N in seagrass leaves can be a good tool to monitor time-integrated decrease/increase of DIN concentrations at a site, both in the water column and the interstitial water
International Nuclear Information System (INIS)
Amarger, N.; Durr, J.C.; Bourguignon, C.; Lagacherie, B.; Mariotti, A.; Mariotti, F.
1979-01-01
The use of variations in natural abundance of 15 N between nitrogen fixing and non nitrogen fixing soybeans was investigated for quantitative estimate of symbiotic nitrogen fixation. Isotopic analysis of 4 varieties of inoculated and non-inoculated soybeans growing under field conditions, with and without N-fertilizer was determined. It was found that inoculated soybeans had a significantly lower 15 N content than non-inoculated ones. Estimates of the participation of fixed N to the total nitrogen content of inoculated soybeans were calculated from these differences. They were compared to estimates calculated from differences in N yield between inoculated and non-inoculated plants and to the nitrogenase activity, measured by the C 2 H 2 reduction assay over the growing season. Estimates given by the 15 N measurements were correlated with the C 2 H 2 reducing activity but not with the differences in the N yield. This shows that the isotopic composition was dependent on the amount of fixed nitrogen and consequently that the estimates of fixed nitrogen based on natural 15 N abundance should be reliable. The absence of correlation between estimates based on 15 N content and estimates based on N yield was explained by differences in the uptake of soil nitrogen between inoculated and non inoculated soybeans. (Auth.)
Directory of Open Access Journals (Sweden)
Natasha L Vokhshoori
Full Text Available We explored δ(15N compound-specific amino acid isotope data (CSI-AA in filter-feeding intertidal mussels (Mytilus californianus as a new approach to construct integrated isoscapes of coastal primary production. We examined spatial δ(15N gradients in the California Upwelling Ecosystem (CUE, determining bulk δ(15N values of mussel tissue from 28 sites between Port Orford, Oregon and La Jolla, California, and applying CSI-AA at selected sites to decouple trophic effects from isotopic values at the base of the food web. Bulk δ(15N values showed a strong linear trend with latitude, increasing from North to South (from ∼ 7‰ to ∼ 12‰, R(2 = 0.759. In contrast, CSI-AA trophic position estimates showed no correlation with latitude. The δ(15N trend is therefore most consistent with a baseline δ(15N gradient, likely due to the mixing of two source waters: low δ(15N nitrate from the southward flowing surface California Current, and the northward transport of the California Undercurrent (CUC, with (15N-enriched nitrate. This interpretation is strongly supported by a similar linear gradient in δ(15N values of phenylalanine (δ(15NPhe, the best AA proxy for baseline δ(15N values. We hypothesize δ(15N(Phe values in intertidal mussels can approximate annual integrated δ(15N values of coastal phytoplankton primary production. We therefore used δ(15N(Phe values to generate the first compound-specific nitrogen isoscape for the coastal Northeast Pacific, which indicates a remarkably linear gradient in coastal primary production δ(15N values. We propose that δ(15N(Phe isoscapes derived from filter feeders can directly characterize baseline δ(15N values across major biochemical provinces, with potential applications for understanding migratory and feeding patterns of top predators, monitoring effects of climate change, and study of paleo- archives.
Directory of Open Access Journals (Sweden)
P. Sperlich
2013-08-01
Full Text Available Air bubbles in ice core samples represent the only opportunity to study the mixing ratio and isotopic variability of palaeoatmospheric CH4 and N2O. The highest possible precision in isotope measurements is required to maximize the resolving power for CH4 and N2O sink and source reconstructions. We present a new setup to measure δ13C-CH4, δ15N-N2O and δ18O-N2O isotope ratios in one ice core sample and with one single IRMS instrument, with a precision of 0.09, 0.6 and 0.7‰, respectively, as determined on 0.6–1.6 nmol CH4 and 0.25–0.6 nmol N2O. The isotope ratios are referenced to the VPDB scale (δ13C-CH4, the N2-air scale (δ15N-N2O and the VSMOW scale (δ18O-N2O. Ice core samples of 200–500 g are melted while the air is constantly extracted to minimize gas dissolution. A helium carrier gas flow transports the sample through the analytical system. We introduce a new gold catalyst to oxidize CO to CO2 in the air sample. CH4 and N2O are then separated from N2, O2, Ar and CO2 before they get pre-concentrated and separated by gas chromatography. A combustion unit is required for δ13C-CH4 analysis, which is equipped with a constant oxygen supply as well as a post-combustion trap and a post-combustion GC column (GC-C-GC-IRMS. The post-combustion trap and the second GC column in the GC-C-GC-IRMS combination prevent Kr and N2O interferences during the isotopic analysis of CH4-derived CO2. These steps increase the time for δ13C-CH4 measurements, which is used to measure δ15N-N2O and δ18O-N2O first and then δ13C-CH4. The analytical time is adjusted to ensure stable conditions in the ion source before each sample gas enters the IRMS, thereby improving the precision achieved for measurements of CH4 and N2O on the same IRMS. The precision of our measurements is comparable to or better than that of recently published systems. Our setup is calibrated by analysing multiple reference gases that were injected over bubble-free ice samples. We show
Energy Technology Data Exchange (ETDEWEB)
Bergner, U; Adam, K; Bergner, H [Humboldt-Universitaet, Berlin (German Democratic Republic). Sektion Tierproduktion und Veterinaermedizin
1981-01-01
Albino rats received after nine days of adaptation to a fish meal diet in comparison with a gelatine diet /sup 14/C-U-L-leucine and /sup 15/N-L-leucine via a pellet made from the specific diet after food deprivation for 15 h. Thereafter, the animals consumed the non-labelled experimental diet ad libitum. 30 min, and 1, 2, 4 and 8 h, resp., after intake of the labelled food, four rats at a time were sacrificed. The contents of the digestive tract and tissue samples were examined for /sup 14/C and /sup 15/N and their percentages in the TCA-soluble fraction determined. If these values are regarded as non-absorbed leucine, the /sup 14/C values obtained up to the four hour period of the experiment would be too high. Presumably, they are in the case of both diets simulated by other /sup 14/C metabolites which originate from the leucine catabolism and reach the intestinal lumen. Amino acids labelled with /sup 15/N should be preferred in studies on the absorption of amino acids because, in case of catabolization, the /sup 15/N aminogroup is excreted mainly as urea via urine.
Metabolism of [15N]alanine in the ectomycorrhizal fungus Paxillus involutus
International Nuclear Information System (INIS)
Chalot, M.; Finlay, R.D.; Ek, H.; Söderström, B.
1995-01-01
Chalot, M., Finlay, R. D., Ek, H., and Söderström, B. 1995. Metabolism of [ 15 N]alanine in the ectomycorrhizal fungus Paxillus involutus. Experimental Mycology 19, 297-304. Alanine metabolism in the ectomycorrhizal fungus Paxillus involutus was investigated using [ 15 N]alanine. Short-term exposure of mycelial discs to [ 15 N]alanine showed that the greatest flow of 15 N was to glutamate and to aspartate. Levels of enrichment were as high as 15-20% for glutamate and 13-18% for aspartate, whereas that of alanine reached 30%. Label was also detected in the amino-N of glutamine and in serine and glycine, although at lower levels. Preincubation of mycelia with aminooxyacetate, an inhibitor of transamination reactions. resulted in complete inhibition of the flow of the label to glutamate, aspartate, and amino-N of glutamine, whereas [ 15 N]alanine rapidly accumulated. This evidence indicates the direct involvement of alanine aminotransferase for translocation of 15 N from alanine to glutamate. Alanine may be a convenient reservoir of both nitrogen and carbon. (author)
Directory of Open Access Journals (Sweden)
Edmilson José Ambrosano
2003-02-01
Full Text Available Most studies dealing with the utilization of 15N labeled plant material do not present details about the labeling technique. This is especially relevant for legume species since biological nitrogen fixation difficults plant enrichment. A technique was developed for labeling leguminous plant tissue with 15N to obtain labeled material for nitrogen dynamics studies. Sun hemp (Crotalaria juncea L. was grown on a Paleudalf, under field conditions. An amount of 58.32 g of urea with 70.57 ± 0.04 atom % 15N was sprayed three times on plants grown on eight 6-m²-plots. The labelled material presented 2.412 atom % 15N in a total dry matter equivalent to 9 Mg ha-1 This degree of enrichment enables the use of the green manure in pot or field experiments requiring 15N-labeled material.A grande maioria dos estudos com a utilização de material vegetal marcado com o isótopo 15N não apresentam detalhes tão importantes sobre como foram obtidos esses materiais. Em se tratando de marcação de leguminosas as dificuldades em se obter material marcado com 15N são ainda maiores pelo fato de serem plantas fixadoras de nitrogênio. Isso posto foi estabelecida uma técnica de marcação de leguminosas com nitrogênio (15N, com o objetivo de obter material vegetal marcado isotopicamente para estudos de dinâmica do nitrogênio. Cultivou-se a leguminosa crotalária júncea (Crotalaria juncea L., em Argissolo Vermelho Amarelo distrófico, em campo. Ao se aplicarem via foliar 58,32 gramas de uréia em oito canteiros experimentais, (uréia com 70,57 ± 0,04% de átomos de 15N parceladas em três vezes, obteve-se material vegetal marcado seco que continha 2,412 % em átomos de 15N em uma massa seca equivalente a 9 Mg ha-1. Essa marcação permite o uso dessa massa vegetal em estudos de dinâmica de nitrogênio.
International Nuclear Information System (INIS)
Bersch, Beate; Rossy, Emmanuel; Coves, Jacques; Brutscher, Bernhard
2003-01-01
NMR experiments are presented which allow backbone resonance assignment, secondary structure identification, and in favorable cases also molecular fold topology determination from a series of two-dimensional 1 H- 15 N HSQC-like spectra. The 1 H- 15 N correlation peaks are frequency shifted by an amount ± ω X along the 15 N dimension, where ω X is the C α , C β , or H α frequency of the same or the preceding residue. Because of the low dimensionality (2D) of the experiments, high-resolution spectra are obtained in a short overall experimental time. The whole series of seven experiments can be performed in typically less than one day. This approach significantly reduces experimental time when compared to the standard 3D-based methods. The here presented methodology is thus especially appealing in the context of high-throughput NMR studies of protein structure, dynamics or molecular interfaces
The crystal structure of the mixed-layer Aurivillius phase Bi 5Ti 1.5W 1.5O 15
Tellier, J.; Boullay, Ph.; Créon, N.; Mercurio, D.
2005-09-01
The crystal structure of the 1+2 mixed-layer Aurivillius phase Bi 5Ti 1.5W 1.5O 15 (SG I2cm n o 46: -cba, Z=4, a=5.4092(3) Å, b=5.3843(3) Å and c=41.529(3) Å) consisting of the ordered intergrowth of one and two octahedra thick perovskite-type blocks separated by [Bi 2O 2] 2+ slabs is reported. Supported by an electron diffraction investigation and, using the Rietveld analysis, it is shown that this compound should be described using a I-centering lattice in agreement with the generalised structural model of the Aurivillius type compounds recently presented by the authors. The structure of this Bi 5Ti 1.5W 1.5O 15 phase is analyzed in comparison with the related simple members (Bi 2WO 6 and Bi 3Ti 1.5W 0.5O 9). The crystal structure of Bi 3Ti 1.5W 0.5O 9 is also reported.
International Nuclear Information System (INIS)
Liu Aizhuo; Riek, Roland; Wider, Gerhard; Schroetter, Christine von; Zahn, Ralph; Wuethrich, Kurt
2000-01-01
A combination of three heteronuclear three-dimensional NMR experiments tailored for sequential resonance assignments in uniformly 15 N, 13 C-labeled flexible polypeptide chains is described. The 3D (H)N(CO-TOCSY)NH, 3D (H)CA(CO-TOCSY)NH and 3D (H)CBCA(CO-TOCSY)NH schemes make use of the favorable 15 N chemical shift dispersion in unfolded polypeptides, exploit the slow transverse 15 N relaxation rates of unfolded polypeptides in high resolution constant-time [ 1 H, 15 N]-correlation experiments, and use carbonyl carbon homonuclear isotropic mixing to transfer magnetization sequentially along the amino acid sequence. Practical applications are demonstrated with the 100-residue flexible tail of the recombinant human prion protein, making use of spectral resolution up to 0.6 Hz in the 15 N dimension, simultaneous correlation with the two adjacent amino acid residues to overcome problems associated with spectral overlap, and the potential of the presently described experiments to establish nearest-neighbor correlations across proline residues in the amino acid sequence
Directory of Open Access Journals (Sweden)
Roni Fernandes Guareschi
2014-08-01
Full Text Available A conversão do cerrado nativo em sistemas agropecuários pode alterar com o passar dos anos de cultivo os teores de C e N, bem como o sinal isotópico do δ13C e δ15N do solo. Desta forma, o objetivo deste trabalho foi avaliar os teores de C, N e abundância natural de δ13C e δ15N no perfil do solo em uma cronossequência de agricultura sob sistema plantio direto (SPD no cerrado goiano. Para isso, em Montividiu, GO, foram selecionadas áreas sob SPD com diferentes tempos de implantação: SPD com três anos de implantação (SPD3, SPD com 15 anos de implantação (SPD15 e SPD com 20 anos de implantação (SPD20, as quais foram comparadas com áreas de cerrado nativo (CE e pastagem (PA. Foram coletadas amostras de solo nas profundidades de 0,00-0,05; 0,05-0,10; 0,10-0,20; 0,20-0,30; 0,30-0,40; 0,40-0,50; 0,50-0,60; 0,60-0,80; e 0,80-1,00 m. O solo das áreas de estudo foi classificado como Latossolo Vermelho distroférrico. O manejo do solo sob SPD após 20 anos aumentou os teores de C e N na camada superficial do solo (0,00-0,05 m, em relação às outras áreas avaliadas. Nas demais profundidades avaliadas, observou-se que está ocorrendo aumento nos teores C e N com o passar dos anos de adoção do SPD (três para 15 anos; no entanto, tais áreas ainda não foram capazes de recuperar os teores desses elementos em relação à vegetação nativa de CE. Por meio dos resultados de δ13C, pôde-se constatar que a origem da MOS nas áreas de SPD é referente à plantas do ciclo fotossintético C4. Verificou-se que até os 0,30 m do perfil do solo os resultados de δ13C estão reduzindo com o passar dos anos de adoção do SPD. Os menores e maiores valores de δ15N foram encontrados nas áreas de CE e PA, SPD3, enquanto SPD15 e SPD20 apresentaram valores intermediários de δ15N, em relação às demais áreas avaliadas.
International Nuclear Information System (INIS)
Asante, Kwadwo Ansong; Agusa, Tetsuro; Mochizuki, Hiroko; Ramu, Karri; Inoue, Suguru; Kubodera, Tsunemi; Takahashi, Shin; Subramanian, Annamalai; Tanabe, Shinsuke
2008-01-01
Trace elements (22) and stable isotope ratios (δ 15 N and δ 13 C) were analyzed in marine organisms from shallow (SW) and deep-water (DW) of the East China Sea to understand biomagnification and prey source of trace elements. In the benthic marine organisms from DW, δ 15 N values were negatively correlated with Ba, Cu, Ag, Mo, Sr, As, and Co concentrations. This may be due to the specific accumulation in lower trophic animals and/or the biodilution through the food web in DW. Relationships between δ 15 N and concentrations of Co, Cr, Bi, and Tl in fish and Ag, Bi, V, Hg, and Tl in crustaceans showed positive correlations, suggesting that trophic position was affecting the concentrations of those elements in phyla, with higher trophic animals retaining higher concentrations than the lower trophic animals. Positive correlations between δ 13 C and Rb were observed in marine organisms. Therefore, Rb may be a possible substitute of δ 13 C as tracer of prey source in the East China Sea although further investigation is required. - This is the first study on trophic transfer and prey source of trace elements in marine organisms from the East China Sea
Reaction π-p → eta'n in the 15-40 GeV/c momentum range
International Nuclear Information System (INIS)
Apel, W.D.; Augenstein, K.H.; Krueger, M.; Mueller, H.; Schinzel, D.; Schneider, H.; Sigurdsson, G.; Bertolucci, E.; Mannelli, I.; Pierazzini, G.M.; Quaglia, M.; Scribano, A.; Sergiampietri, F.; Vincelli, M.L.; Donskov, S.V.; Inyakin, A.V.; Johnson, R.; Kachanov, V.A.; Krasnokutsky, R.N.; Lednev, A.A.; Mikhailov, Yu.V.; Prokoshkin, Yu.D.; Shuvalov, R.S.; Kittenberger, V.; Leder, G.; Steuer, M.
1979-01-01
Measurements were made of the cross section of the reactions π - p → eta'(958)n, eta' → 2γ at momenta of 15, 20, 25, 30, and 40 GeV/c. The experiment was carried out on the IHEP 70 GeV accelerator using the 648 channel hodoscope spectrometer NICE for γ-ray detection. A total of 6000 eta' mesons were recorded. A sharp drop is seen in the differential cross section for t → 0. The dependences of the differential cross sections π - p → eta'n and π-p → etan on t are identical. On the basis of the ratio of the cross sections for these reactions at t = 0, i.e. R(eta'/n)sub(t=0) = 0.55 +- 0.06, the singlet-octet mixing angle for pseudoscalar mesons was determined to be β = -(18.2 +- 1.4) 0 . (Auth.)
Metabolic rates of 15N-D- and 15N-L-phenylalanine in an amino acid mixture for parenteral feeding
International Nuclear Information System (INIS)
Wutzke, K.; Heine, W.; Drescher, U.
1982-01-01
15 N investigations on the metabolism of L- and D-phenylalanine under conditions of parenteral feeding with the aminoacid solution Infesol in 6 infants revealed a retention rate of 83.4 +- 3.4 per cent for the L-form and of 36.6 +- 5.2 per cent for the D-form. When the D-isomer was raised from 1:3 to 1:1 in relation to the L-Form, 32.6 per cent of the infused D-phenylalanine were still retained. After continuous 24-hour infusion of the tracers, the maximum of 15 N excretion in the urine was reached between the 24th and the 30th hour. But little incorporation of 15 N-nitrogen was found in the serum and erythrocytes because of the relatively long half-life period of these proteins. Changes in the composition of commercial DL-amino acid mixtures will only be possible after determining the utilization rates of all essential and non-essential D-amino acids being used in such mixtures. (author)
Directory of Open Access Journals (Sweden)
Matthew J Perkins
Full Text Available Increasingly, stable isotope ratios of nitrogen (δ(15N and carbon (δ(13C are used to quantify trophic structure, though relatively few studies have tested accuracy of isotopic structural measures. For laboratory-raised and wild-collected plant-invertebrate food chains spanning four trophic levels we estimated nitrogen range (NR using δ(15N, and carbon range (CR using δ(13C, which are used to quantify food chain length and breadth of trophic resources respectively. Across a range of known food chain lengths we examined how NR and CR changed within and between food chains. Our isotopic estimates of structure are robust because they were calculated using resampling procedures that propagate variance in sample means through to quantified uncertainty in final estimates. To identify origins of uncertainty in estimates of NR and CR, we additionally examined variation in discrimination (which is change in δ(15N or δ(13C from source to consumer between trophic levels and among food chains. δ(15N discrimination showed significant enrichment, while variation in enrichment was species and system specific, ranged broadly (1.4‰ to 3.3‰, and importantly, propagated variation to subsequent estimates of NR. However, NR proved robust to such variation and distinguished food chain length well, though some overlap between longer food chains infers a need for awareness of such limitations. δ(13C discrimination was inconsistent; generally no change or small significant enrichment was observed. Consequently, estimates of CR changed little with increasing food chain length, showing the potential utility of δ(13C as a tracer of energy pathways. This study serves as a robust test of isotopic quantification of food chain structure, and given global estimates of aquatic food chains approximate four trophic levels while many food chains include invertebrates, our use of four trophic level plant-invertebrate food chains makes our findings relevant for a majority
Perkins, Matthew J.; McDonald, Robbie A.; van Veen, F. J. Frank; Kelly, Simon D.; Rees, Gareth; Bearhop, Stuart
2014-01-01
Increasingly, stable isotope ratios of nitrogen (δ15N) and carbon (δ13C) are used to quantify trophic structure, though relatively few studies have tested accuracy of isotopic structural measures. For laboratory-raised and wild-collected plant-invertebrate food chains spanning four trophic levels we estimated nitrogen range (NR) using δ15N, and carbon range (CR) using δ13C, which are used to quantify food chain length and breadth of trophic resources respectively. Across a range of known food chain lengths we examined how NR and CR changed within and between food chains. Our isotopic estimates of structure are robust because they were calculated using resampling procedures that propagate variance in sample means through to quantified uncertainty in final estimates. To identify origins of uncertainty in estimates of NR and CR, we additionally examined variation in discrimination (which is change in δ15N or δ13C from source to consumer) between trophic levels and among food chains. δ15N discrimination showed significant enrichment, while variation in enrichment was species and system specific, ranged broadly (1.4‰ to 3.3‰), and importantly, propagated variation to subsequent estimates of NR. However, NR proved robust to such variation and distinguished food chain length well, though some overlap between longer food chains infers a need for awareness of such limitations. δ13C discrimination was inconsistent; generally no change or small significant enrichment was observed. Consequently, estimates of CR changed little with increasing food chain length, showing the potential utility of δ13C as a tracer of energy pathways. This study serves as a robust test of isotopic quantification of food chain structure, and given global estimates of aquatic food chains approximate four trophic levels while many food chains include invertebrates, our use of four trophic level plant-invertebrate food chains makes our findings relevant for a majority of ecological systems
Perkins, Matthew J; McDonald, Robbie A; van Veen, F J Frank; Kelly, Simon D; Rees, Gareth; Bearhop, Stuart
2014-01-01
Increasingly, stable isotope ratios of nitrogen (δ(15)N) and carbon (δ(13)C) are used to quantify trophic structure, though relatively few studies have tested accuracy of isotopic structural measures. For laboratory-raised and wild-collected plant-invertebrate food chains spanning four trophic levels we estimated nitrogen range (NR) using δ(15)N, and carbon range (CR) using δ(13)C, which are used to quantify food chain length and breadth of trophic resources respectively. Across a range of known food chain lengths we examined how NR and CR changed within and between food chains. Our isotopic estimates of structure are robust because they were calculated using resampling procedures that propagate variance in sample means through to quantified uncertainty in final estimates. To identify origins of uncertainty in estimates of NR and CR, we additionally examined variation in discrimination (which is change in δ(15)N or δ(13)C from source to consumer) between trophic levels and among food chains. δ(15)N discrimination showed significant enrichment, while variation in enrichment was species and system specific, ranged broadly (1.4‰ to 3.3‰), and importantly, propagated variation to subsequent estimates of NR. However, NR proved robust to such variation and distinguished food chain length well, though some overlap between longer food chains infers a need for awareness of such limitations. δ(13)C discrimination was inconsistent; generally no change or small significant enrichment was observed. Consequently, estimates of CR changed little with increasing food chain length, showing the potential utility of δ(13)C as a tracer of energy pathways. This study serves as a robust test of isotopic quantification of food chain structure, and given global estimates of aquatic food chains approximate four trophic levels while many food chains include invertebrates, our use of four trophic level plant-invertebrate food chains makes our findings relevant for a majority of
International Nuclear Information System (INIS)
Doehler, G.; Biermann, I.; Zink, J.
1986-01-01
The cyanobacteria Anabaena cylindrica and Synechococcus leopoliensis (=Anacystis nidulans) were grown at different levels of UV-B radiation (439, 717, 1230 and 1405 J m -2 d -1 , weighted according Caldwell, 1971) for 2 days. Dry weight was hardly affected but phycocyanin content of both species decreased linearly to the level of UV-B radiation. Contents of protein, carotenoids and chlorophyll a were reduced only after exposure to high doses (1230 J m -2 d -1 ) of UV-B radiation. Photosynthetic 14 CO 2 fixation of Anabaena cells was reduced linearly with increasing UV-B dose whereas no effect could be observed in Synechococcus. A depression of photosynthetic 15 N-nitrate uptake was found after UV-B stress in both species. UV-B irradiance caused an increase of 15 N-incorporation into glutamine, but no effect was noted for incorporation into alanine or aspartic acid. An increase of 15 N-excess in glutamic acid linear with the UV-B dose was observed in Synechococcus, only. Patterns of 14 C-labelled photosynthetic products were either less affected by UV-B radiation (Anabaena) or an enhancement of 14 C-label in total amino acids was detected (Synechococcus). The amount of total free amino acids increased parallel to the level of UV-B radiation. Only, the high dose of UV-B (1405 J m -2 d -1 , weighted) results in a decrease of the glutamine pool. Our results indicate an inhibition of glutamate synthase by UV-B irradiation in Anabaena, only. Results were discussed with reference to the damage of the photosynthetic apparatus. (orig.)
DEFF Research Database (Denmark)
Kusliene, Gedrime; Rasmussen, Jim; Kuzyakov, Yakov
2014-01-01
and actinomycetes was unaffected by plant species, but pool of Gram-negative and Gram-positive bacteria was greater under white clover at the 10 percent significance level. In the short term, microorganisms more actively utilised fresh exudates (13C-labelled) of ryegrass than of white clover. We expected ryegrass...... microbial groups in soil under white clover (Trifolium repens L.) and ryegrass (Lolium perenne L.) following leaf-labelling with 13C-bicarbonate and 15N-urea. In this way microbial N and 15N and the composition of PLFAs reflect the medium-term (two months) response of microorganisms to rhizodeposits......, whereas the 13C-label of the PLFAs reflects the short-term (one week) utilisation of root exudates following labelling of shoots. In the medium term, microbial biomass N and 15N were greater under the ryegrass, whereas total PLFA was higher under white clover. The relative abundance of fungi...
Ullah, Saif; Zhang, Wei; Hansen, Poul Erik
2010-07-01
Secondary deuterium isotope effects on 13C and 15N nuclear shieldings in a series of cyclic enamino-diesters and enamino-esters and acyclic enaminones and enamino-esters have been examined and analysed using NMR and DFT (B3LYP/6-31G(d,p)) methods. One-dimensional and two-dimensional NMR spectra of enaminocarbonyl and their deuterated analogues were recorded in CDCl 3 and CD 2Cl 2 at variable temperatures and assigned. 1JNH coupling constants for the derivatives of Meldrum's and tetronic acids reveal that they exist at the NH-form. It was demonstrated that deuterium isotope effects, for the hydrogen bonded compounds, due to the deuterium substitution at the nitrogen nucleus lead to large one-bond isotope effects at nitrogen, 1Δ 15N(D), and two-bond isotope effects on carbon nuclei, 2ΔC(ND), respectively. A linear correlations exist between 2ΔC(ND) and 1Δ 15N(D) whereas the correlation with δNH is divided into two. A good agreement between the experimentally observed 2ΔC(ND) and calculated dσ 13C/dR NH was obtained. A very good correlation between calculated NH bond lengths and observed NH chemical shifts is found. The observed isotope effects are shown to depend strongly on Resonance Assisted Hydrogen bonding.
Studies of liver-specific metabolic reactions with 15N. 1
International Nuclear Information System (INIS)
Hirschberg, K.; Jung, K.; Faust, H.; Matkowitz, R.
1987-01-01
The 15 N tracer technique was used to investigate liver-specific reactions (urea and hippurate synthesis) for studying the metabolism in the healthy and damaged pig liver. After [ 15 N]ammonium chloride administration the tracer distribution on non-protein compounds of serum and urine was followed. Blood samplings before and after liver passage rendered possible a direct analysis of the [ 15 N]ammonium metabolism. The thioacetamide-induced liver damage was used as model for an acute liver intoxication. The capacity for urea synthesis was not influenced by means of this noxious substance, but the metabolism of amino acids and hippuric acid. The considerably depressed excretion of [ 15 N]hippurate seems to be a suitable indicator of liver disfunction. (author)
Schimmelmann, A.; Albertino, A.; Sauer, P.E.; Qi, H.; Molinie, R.; Mesnard, F.
2009-01-01
Accurate determinations of stable isotope ratios require a calibration using at least two reference materials with different isotopic compositions to anchor the isotopic scale and compensate for differences in machine slope. Ideally, the S values of these reference materials should bracket the isotopic range of samples with unknown S values. While the practice of analyzing two isotopically distinct reference materials is common for water (VSMOW-SLAP) and carbonates (NBS 19 and L-SVEC), the lack of widely available organic reference materials with distinct isotopic composition has hindered the practice when analyzing organic materials by elemental analysis/isotope ratio mass spectrometry (EA-IRMS). At present only L-glutamic acids USGS40 and USGS41 satisfy these requirements for ??13C and ??13N, with the limitation that L-glutamic acid is not suitable for analysis by gas chromatography (GC). We describe the development and quality testing of (i) four nicotine laboratory reference materials for on-line (i.e. continuous flow) hydrogen reductive gas chromatography-isotope ratio mass-spectrometry (GC-IRMS), (ii) five nicotines for oxidative C, N gas chromatography-combustion-isotope ratio mass-spectrometry (GC-C-IRMS, or GC-IRMS), and (iii) also three acetanilide and three urea reference materials for on-line oxidative EA-IRMS for C and N. Isotopic off-line calibration against international stable isotope measurement standards at Indiana University adhered to the 'principle of identical treatment'. The new reference materials cover the following isotopic ranges: ??2Hnicotine -162 to -45%o, ??13Cnicotine -30.05 to +7.72%, ?? 15Nnicotine -6.03 to +33.62%; ??15N acetanilide +1-18 to +40.57%; ??13Curea -34.13 to +11.71%, ??15Nurea +0.26 to +40.61% (recommended ?? values refer to calibration with NBS 19, L-SVEC, IAEA-N-1, and IAEA-N-2). Nicotines fill a gap as the first organic nitrogen stable isotope reference materials for GC-IRMS that are available with different ??13N
Rau, G.H.; Arthur, M.A.; Dean, W.E.
1987-01-01
At two locations in the Atlantic Ocean (DSDP Sites 367 and 530) early to middle Cretaceous organic-carbon-rich beds ("black shales") were found to have significantly lower ??15N values (lower 15N/14N ratios) than adjacent organic-carbon-poor beds (white limestones or green claystones). While these lithologies are of marine origin, the black strata in particular have ??15N values that are significantly lower than those previously found in the marine sediment record and most contemporary marine nitrogen pools. In contrast, black, organic-carbon-rich beds at a third site (DSDP Site 603) contain predominantly terrestrial organic matter and have C- and N-isotopic compositions similar to organic matter of modern terrestrial origin. The recurring 15N depletion in the marine-derived Cretaceous sequences prove that the nitrogen they contain is the end result of an episodic and atypical biogeochemistry. Existing isotopic and other data indicate that the low 15N relative abundance is the consequence of pelagic rather than post-depositional processes. Reduced ocean circulation, increased denitrification, and, hence, reduced euphotic zone nitrate availability may have led to Cretaceous phytoplankton assemblages that were periodically dominated by N2-fixing blue-green algae, a possible source of this sediment 15N-depletion. Lack of parallel isotopic shifts in Cretaceous terrestrially-derived nitrogen (Site 603) argues that the above change in nitrogen cycling during this period did not extend beyond the marine environment. ?? 1987.
International Nuclear Information System (INIS)
Kurdali, F.; Al-Shammaa, M.
2007-12-01
The impact of two K-fertilizer treatments [K0 (0) and K1 (150 kg K 2 O/ha)] on dry matter production and N 2 fixation (Ndfa) by Lentil (Lens culinaris.) was evaluated in a pot experiment. The plants were also subjected to three soil moisture regimes starting from bud flower initiation stage to pod formation (low, 45-50%; moderate, 55-60% and high 75-80% of field capacity, abbreviated as FC1, FC2 and FC3, respectively). The 15 N natural abundance technique (%δ 1 5 N) was employed to evaluate N 2 fixation using barley as a reference crop. Moreover, the carbon isotope discrimination (%Δ 13 C) was determined to assess factors responsible for crop performance variability in the different treatments. Water restriction occurring during the post-flowering period considerably affects growth and N 2 -fixation. However, K-fertilizer enhanced plant performance by overcoming water shortage influences. The δ 15 N values in lentils ranged from +0.67 to +1.36% depending on soil moisture and K-fertilizer treatments; whereas, those of N 2 fixation and the reference plant were -0.45 and +2.94%, respectively. Consequently, Ndfa% ranged from 45 and 65%. Water stress reduced Δ 13 C values in the FC1K0 And FC1K1 treatments. However, K fertilizer enhanced the whole plants Δ 13 C along with dry matter yield and N 2 fixation. The water stressed plants amended with K (FC1K1) seemed to be the best treatment because of its highest pod yield, high N balance and N 2 -fixation with low consumption of irrigation water. This illustrates the ecological and economical importance of K-fertilizer in alleviating water stress occurring during the post-flowering period of lentil.(Authors)
Arctic sea ice at 1.5 and 2 °C
Screen, James A.
2018-05-01
In the Paris Agreement, nations committed to a more ambitious climate policy target, aiming to limit global warming to 1.5 °C rather than 2 °C above pre-industrial levels. Climate models now show that achieving the 1.5 °C goal would make a big difference for Arctic sea ice.
Study of some excited states in 21Ne-21Na, 18O-18F and 15N-15O nuclei
International Nuclear Information System (INIS)
Drain, D.
1977-01-01
The study of 21 Ne- 21 Na, 18 O- 18 F and 15 N- 15 O nuclei was performed through proton capture and transfer reactions and allows to determine the spins and parities of some excited states, give the gamma deexcitation schemes of these levels, compute the neutron and proton reduced width γ 2 sub(n) and γ 2 sub(p). The levels studied are: in 21 Na 4.15 20 Ne(p,p), (p,p'), (p,p'γ) and (pγ) reactions) and in 21 Ne: E(exc)=4.73, 5.69 and 5.78 MeV ( 20 Ne (p,p) reaction); in 18 O: E(exc) 17 O(d,p) reaction); in 15 O: 8.92 MeV doublet and 8.98 MeV level (angular correlation 14 N(p,γγ) and in 15 N: 9.05 14 N(d,p) reaction). A comparison with theoretical results is discussed and analog states are pointed out [fr
International Nuclear Information System (INIS)
Fiedler, R.
1984-01-01
The use of mass spectrometry and emission spectrometry for the determination of 15 N in stable tracer studies is reviewed. Mass spectrometry has the advantage that more accurate results compared to emission spectrometry are possible. Emission spectrometry, however, is less expensive and only requires samples at least 50 times smaller for analysis. The sample preparation method is similar for both techniques. (U.K.)
On the differences between 1.5oC and 2oC of global warming
King, A.
2017-12-01
The Paris Agreement of 2015 has resulted in a drive to limit global warming to 2oC with an aim for a lower 1.5oC target. It is therefore vital that we understand some of the differences we would expect between these two levels of global warming. My research uses coupled climate model projections to investigate where and for what variables we can differentiate between worlds of 1.5oC and 2oC global warming. I place a particular focus on climate extremes and population exposure to those extremes. I have found that there are perceptible benefits in limiting global warming to 1.5oC as opposed to 2oC through reduced frequency and intensity of heat extremes, both over land and in ocean areas where thermal stress on coral has resulted in bleaching. Differences in high and low precipitation extremes between the 1.5oC and 2oC global warming levels are projected for some regions. I have also examined how "scalable" changes from the 1.5oC to 2oC level are. In areas of the world such as Eastern China I find that changes in anthropogenic aerosol concentrations will influence the level of change projected at 1.5oC and 2oC, such that past warming is likely to be a poor indicator of future changes. Overall, my research finds clear benefits to limiting global warming to 1.5oC relative to higher levels.
International Nuclear Information System (INIS)
Lown, J.W.; Chauhan, S.M.S.
1981-01-01
The synthesis of certain specifically 15 N, 13 C, and 2 H isotope labeled 1-(2-chloroethyl)-3-alkyl-1-nitrosoureas (CENUs) is described. Spectroscopic examination of CENUs and their isotope-labeled counterparts by 1 H, 15 N, and 13 C NMR and infrared spectra indicates that they adopt preferred conformations in nonpolar aprotic solvents in which the NO group is aligned toward the 2-chloroethyl group. The result is in accord with the conformation of MeCCNU in the crystalline state derived from X-ray diffraction. The chemical shifts and coupling constants in the CENUs change with both solvent polarity and basicity. In aqueous phosphate buffer there is evidence for the formation of a tetrahedral intermediate, the conformation of which alters according to the reaction conditions and ultimately controls the formation of the aqueous decomposition products of CENUs. This is revealed most clearly by 13 C NMR of carbonyl- 13 C- and nitroso- 15 N-labeled BCNU and CCNU where two distinct 15 N-coupled 13 C doublets with different chemical shifts are observed. The rate of conformational change is comparable with the rate of decomposition of CENUs (via the second conformer) and may therefore represent the critical initial step of the latter process in vivo. The intermediacy of the postulated tetrahedral intermediates for CENUs is supported by observed 18 O exchange into the carbonyl group in 18 O-enriched water. Consideration of the conformations of the intermediates and of the alignment of the heteroatom lone pairs provides a satisfactory interpretation of the reactions of CENUs in aqueous solution as well as their pH dependence in terms of strict steroelectronic control and accounts for the formation of the observed products
Gautam, Mukesh Kumar; Lee, Kwang-Sik; Song, Byeong-Yeol; Lee, Dongho; Bong, Yeon-Sik
2016-05-01
Decomposition, nutrient, and isotopic (δ(13)C and δ(15)N) dynamics during 1 year were studied for leaf and twig litters of Pinus densiflora, Castanea crenata, Erigeron annuus, and Miscanthus sinensis growing on a highly weathered soil with constrained nutrient supply using litterbags in a cool temperate region of South Korea. Decay constant (k/year) ranged from 0.58 to 1.29/year, and mass loss ranged from 22.36 to 58.43 % among litter types. The results demonstrate that mass loss and nutrient dynamics of decomposing litter were influenced by the seasonality of mineralization and immobilization processes. In general, most nutrients exhibited alternate phases of rapid mineralization followed by gradual immobilization, except K, which was released throughout the field incubation. At the end of study, among all the nutrients only N and P showed net immobilization. Mobility of different nutrients from decomposing litter as the percentage of initial litter nutrient concentration was in the order of K > Mg > Ca > N ≈ P. The δ(13)C (0.32-6.70 ‰) and δ(15)N (0.74-3.90 ‰) values of residual litters showed nonlinear increase and decrease, respectively compared to initial isotopic values during decomposition. Litter of different functional types and chemical quality converged toward a conservative nutrient use strategy through mechanisms of slow decomposition and slow nutrient mobilization. Our results indicate that litter quality and season, are the most important regulators of litter decomposition in these forests. The results revealed significant relationships between litter decomposition rates and N, C:N ratio and P, and seasonality (temperature). These results and the convergence of different litters towards conservative nutrient use in these nutrient constrained ecosystems imply optimization of litter management because litter removal can have cascading effects on litter decomposition and nutrient availability in these systems.
International Nuclear Information System (INIS)
Nasirzadeh, Karamat; Neueder, Roland; Kunz, Werner
2005-01-01
Precise vapor pressure data for LiCl and LiBr solutions in N,N-dimethylacetamide are given for T = (323.15 to 423.15) K. The molality ranges covered in this study are about m = (0.073 to 1.89) mol . kg -1 for lithium chloride and m = (0.06 to 1.75) mol . kg -1 for lithium bromide. Osmotic coefficients are calculated by taking into account the second virial coefficient of N,N-dimethylacetamide. The parameters of the extended Pitzer-ion interaction model of Archer, of the MSA-NRTL model and of the chemical model of Barthel are evaluated. These models accurately reproduce the experimental osmotic coefficients within different concentration ranges. The parameters of the Pitzer-ion interaction model of Archer are used to calculate the mean molal activity coefficients and excess Gibbs free energies. The non-ideal behaviors of these systems are discussed in terms of the model parameters
Influence of organic N Sources on N transformation and uptake by lupine plants using 15N technique
International Nuclear Information System (INIS)
Abdel-Salam, A.A.; Gadalla, A.M.; Abdel- Aziz, H.A.; Galal, Y.G.M.; EL-degwy, S.M.
2008-01-01
A pot experiment was carried out under greenhouse conditions to evaluate the comparative efficiency and transformation of nitrogen applied either as mineral or organic forms. The obtained data showed that shoot dry weight was enhanced by compost and its mixture with leucaena. When organic sources were combined with 15 N, the leucaena.compost mixture (LC p ) gave the highest yield, and the other two were not significantly different from each other. Reinforcing the organic N with mineral N caused an average greater N.uptake over the non reinforced treatment. Similar trend was noticed with root system. Nitrogen uptake by roots was increased according to the order of LC > L > C. N derived from fertilizer (% Ndff) by lupine shoots was significantly affected by fertilizer addition either alone or reinforced with organic plant residues. Both, the portions (%) or absolute values (mg pot -1 ) of Ndff were increased by adding the organic residues. The highest value of Ndfs was recorded with application of leucaena followed by compost, then Leucaena + compost. Portion Ndfa reflected an effective response of lupines plants to Rhizobium inoculation. Addition of LC mixture combined with 15 N-fertilizer had enhanced the N 2 fixation and increased Ndfa value by about 66.7 % over those recorded with 15 N0 treatment. Organic amendment of leucaena could be an efficient source for N to infertile sandy soils
N-15 tracing helps explaining N leaching losses from contrasting forest ecosystems
Staelens, J.; Rütting, T.; Huygens, D.; Müller, C.; Verheyen, K.; Boeckx, P.
2009-04-01
Despite chronically enhanced nitrogen (N) deposition to forest ecosystems in Europe and NE America, considerable N retention by forests has been observed, reducing N leaching losses. Organic and mineral soil layers typically immobilize more N than the aboveground biomass, but it is unclear which factors determine N retention in forest ecoystems. However, this knowledge is crucial to assess the impact of changing anthropogenic N emissions on future N cycling and N loss of forests. For coniferous and deciduous forest stands at comparable sites, it is known that both N deposition onto the forest floor as well as N loss by leaching below the rooting zone are significantly higher in coniferous stands. In addition, the N loss in coniferous stands is often more enhanced than can be explained by the higher N input only. This suggests lower N retention by coniferous stands, and may be related to differences in litter and soil characteristics, microbial activity, and N uptake by plant roots. To test this hypothesis, we studied the effect of forest type on N retention using 15N tracing techniques: a field tracer experiment and a combination of in situ isotope pool dilution and a tracing model. The N dynamics were examined for two adjacent forest stands (pedunculate oak (Quercus robur L.) and Scots pine (Pinus sylvestris L.)) on a well-drained sandy soil and with a similar stand history, located in a region with high N deposition (Belgium). Input-output N budgets were established by quantifying atmospheric deposition and leaching below the rooting zone, and confirmed the above finding of higher N deposition and disproportionately higher N loss for the pine stand compared to the oak stand. First, the fate of inorganic N within the ecosystems was studied by spraying three pulses of dissolved 15N, either as ammonium or as nitrate, onto the forest floor in 12 plots of 25 m2. The organic and mineral soil layers, tree roots, soil water percolate, ferns, and tree foliage were sampled
Application time of nitrogen fertilizer 15N by a potato crop (Solanum Tuberosum L.)
International Nuclear Information System (INIS)
Bastidas, O.G.; Urquiaga, S.
1987-01-01
This study was performed at the ''San Jorge'' experimental farm of the Instituto Colombiano Agropecuario (ICA), Bogota, Colombia. The study was performed to investigate the effect of timing of application of nitrogen fertilizer on the productivity of, and the efficiency of utilization of 15 N-labelled fertilizer by, a potato crop (Solanum tuberosum L.), cv. Tequendama. The crop was fertilized with 100, 200 and 100 Kg/ha -1 of N, P 2 O 5 and K 2 O respectively. The N fertilizers were either added as 15 N labelled urea (2.955 at.% 15 N excess) or as labelled ammonium sulphate (2.071 at.% 15 N excess). In all treatments with nitrogen, a total of 100 Kg N ha -1 was added, but the nitrogen was added either in two or three split doses (only one dose being labelled with 15 N) at the following times: at planting, 35 days after emergence (DAE) and/or 60 DAE. It was found that: a) Nitrogen fertilization increased tuber production from 24 to 43 t/ha -1 ; b) The tubers constituted approximately 80% of total plant dry matter and 70% of the total nitrogen and fertilizer N accumulated by the plant; c) The fertilizer use efficiency varied between 49 and 68%, and the highest efficiency occurred when the nitrogen was split in three doses; d) The urea and ammonium sulphate gave similar results in all parameters evaluated; e) When the total nitrogen difference method was applied to interpretation of the results the fertilizer use efficiency was overestimated by 15 to 30%
Kerma factors and reaction cross sections for n + 12C between 15 and 18 MeV
International Nuclear Information System (INIS)
Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.
1988-01-01
Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from 12 C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The 12 C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range. (author)
Energy Technology Data Exchange (ETDEWEB)
Yamamuro, M.; Kayanne, H.; Yamano, H
2003-04-01
In a coral reef environment, a slight increase in dissolved inorganic nitrogen (DIN;{>=}1.0 {mu}M) can alter the ecosystem via macroalgal blooms. We collected seagrass leaves from the tropical and subtropical Pacific Ocean in five countries and examined the interactions between nutrient concentrations (C, N, P), molar ratios of nutrients, and {delta}{sup 15}N to find a possible indicator of the DIN conditions. Within most sites, the concentrations of nutrients and their molar ratios showed large variations owing to species-specific values. On the other hand, almost identical {delta}{sup 15}N values were found in seagrass leaves of several species at each site. The correlations between {delta}{sup 15}N and nutrient concentrations and between {delta}{sup 15}N and molar ratios of nutrients suggested that nutrient availability did not affect the {delta}{sup 15}N value of seagrass leaves by altering the physiological condition of the plants. Increases in {delta}{sup 15}N of seagrass leaves mostly matched increases in DIN concentrations in the bottom water. We suggest that {delta}{sup 15}N in seagrass leaves can be a good tool to monitor time-integrated decrease/increase of DIN concentrations at a site, both in the water column and the interstitial water.
Methodical investigation of the endogenous N excretion in feces by 15N-labelled rats
International Nuclear Information System (INIS)
Bergner, U.; Bergner, H.
1983-01-01
Wistar rats (approximately 100g live weight, n = 8) received a wheat diet and were labelled over a period of 7 days with 15 N-ammonium acetate. From day 1 - 5 of the experiment after the end of the labelling feces and urine were collected and analysed. After the animals were killed (day 5 of the experiment) the atom-% 15 N excess ( 15 N') in the contents of the digestive tract as well as in the tissues of stomach wall, intestinal wall, liver, pancreas and blood plasma was determined. The TCA-soluble fraction of the blood plasma showed 0.44 atom-% 15 N' on day 5 after the end of 15 N labelling. 3 hours before the killing fecal N also showed 0.44 and during the last collection period (24 hours before) an average of 0.51 atom-% 15 N'. Urine decreased in the same period from 0.71 to 0.59 atom-% 15 N'. The endogenous fecal N is calculated to 88%. As the tissues of the digestive tract are likely to supply the biggest part of the endogenous fecal protein, the values of atom-% 15 N' from the TCA-precipitable fraction of the intestinal wall and of the pancreas gland was calculed to an average of 0.526. According to this the calculation endogenous fecal N is 84%. It is probable that the quota of endogenous fecal N in the total amount of fecal N varies in dependence on the fermentable crude fiber in the diet as well as on the age of the test animals and thus the bacterial protein synthesis in the colon. As the N used by the bacteria is likely to come from the TCA-soluble fraction of the blood, the calculation formula suggested, which uses the TCA-soluble fraction of the blood plasma, achieves good approximate values also for higher bacterial protein synthesis in the colon. (author)
International Nuclear Information System (INIS)
Camp, A.L.; Dingman, S.E.
1987-05-01
This report describes HECTR Version 1.5N, which is a special version of HECTR developed specifically for application to the N Reactor. HECTR is a fast-running, lumped-parameter containment analysis computer program that is most useful for performing parametric studies. The main purpose of HECTR is to analyze nuclear reactor accidents involving the transport and combustion of hydrogen, but HECTR can also function as an experiment analysis tool and can solve a limited set of other types of containment problems. Version 1.5N is a modification of Version 1.5 and includes changes to the spray actuation logic, and models for steam vents, vacuum breakers, and building cross-vents. Thus, all of the key features of the N Reactor confinement can be modeled. HECTR is designed for flexibility and provides for user control of many important parameters, if built-in correlations and default values are not desired
International Nuclear Information System (INIS)
Ayranci, Guler; Sahin, Melike; Ayranci, Erol
2007-01-01
Apparent molar volumes and apparent molar isentropic compressibilities of ascorbic acid (vitamin C) and thiamine hydrochloride (vitamin B 1 ) were determined from accurately measured density and sound velocity data in water and in aqueous NaCl solutions at (283.15, 293.15, 298.15, 303.15, 308.15, and 313.15) K. These volume and compressibility data were extrapolated to zero concentration using suitable empirical or theoretical equations to determine the corresponding infinite dilution values. Apparent molar expansibilities at infinite dilution were determined from slopes of apparent molar volume vs. temperature plots. Ionization of both ascorbic acid and thiamine hydrochloride were suppressed using sufficiently acidic solutions. Apparent molar volumes at infinite dilution for ascorbic acid and thiamine hydrochloride were found to increase with temperature in acidic solutions and in the presence of co-solute, NaCl. Apparent molar expansibility at infinite dilution were found to be constant over the temperature range studied and were all positive, indicating the hydrophilic character of the two vitamins studied in water and in the presence of co-solute, NaCl. Apparent molar isentropic compressibilities of ascorbic acid at infinite dilution were positive in water and in the presence of co-solute, NaCl, at low molalities. Those of thiamine hydrochloride at infinitive dilution were all negative, consistent with its ionic nature. Transfer apparent molar volumes of vitamins at infinite dilution from water solutions to NaCl solutions at various temperatures were determined. The results were interpreted in terms of complex vitamin-water-co-solute (NaCl) interactions
(13)C and (15)N solid-state NMR studies on albendazole and cyclodextrin albendazole complexes.
Ferreira, M João G; García, A; Leonardi, D; Salomon, Claudio J; Lamas, M Celina; Nunes, Teresa G
2015-06-05
(13)C and (15)N solid-state nuclear magnetic resonance (NMR) spectra were recorded from albendazole (ABZ) and from ABZ:β-cyclodextrin, ABZ:methyl-β-cyclodextrin, ABZ:hydroxypropyl-β-cyclodextrin and ABZ:citrate-β-cyclodextrin, which were prepared by the spray-drying technique. ABZ signals were typical of a crystalline solid for the pure drug and of an amorphous compound obtained from ABZ:cyclodextrin samples. Relevant spectral differences were correlated with chemical interaction between ABZ and cyclodextrins. The number and type of complexes revealed a strong dependence on the cyclodextrin group substituent. Solid-state NMR data were consistent with the presence of stable inclusion complexes. Copyright © 2015 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Nasirzadeh, Karamat [Institut fuer Physikalische and Theoretische Chemie, Universitaet Regensburg, D-93040 Regensburg (Germany) and Department of Chemistry, Azarbaijan University of Tarbiat Moallem, Tabriz (Iran, Islamic Republic of)]. E-mail: Karamat.Nasirzadeh@chemie.uni-regensburg.de; Neueder, Roland [Institut fuer Physikalische and Theoretische Chemie, Universitaet Regensburg, D-93040 Regensburg (Germany); Kunz, Werner [Institut fuer Physikalische and Theoretische Chemie, Universitaet Regensburg, D-93040 Regensburg (Germany)
2005-04-15
Precise vapor pressure data for LiCl and LiBr solutions in N,N-dimethylacetamide are given for T = (323.15 to 423.15) K. The molality ranges covered in this study are about m = (0.073 to 1.89) mol . kg{sup -1} for lithium chloride and m = (0.06 to 1.75) mol . kg{sup -1} for lithium bromide. Osmotic coefficients are calculated by taking into account the second virial coefficient of N,N-dimethylacetamide. The parameters of the extended Pitzer-ion interaction model of Archer, of the MSA-NRTL model and of the chemical model of Barthel are evaluated. These models accurately reproduce the experimental osmotic coefficients within different concentration ranges. The parameters of the Pitzer-ion interaction model of Archer are used to calculate the mean molal activity coefficients and excess Gibbs free energies. The non-ideal behaviors of these systems are discussed in terms of the model parameters.
International Nuclear Information System (INIS)
Doehler, G.; Stolter, H.
1986-01-01
The marine diatoms Ditylum brigthwellii, Lithodesmium variabile, Odontella sinensis, Synedra planctonica and Thalassiosira rotula grown at 18 0 C under normal air conditions (0.035 vol.% CO 2 ) were exposed to different levels (439 and 717 J m -2 d -1 , weighted) of UV-B radiation for 2 d (5 h/d). Pigmentation, protein and total nitrogen content were reduced linearly to the dose of UV-B radiation. Photosynthesis-mediated uptake of 15 N-ammonia was more affected by UV-B irradiance in all tested diatoms than that of 15 N-nitrate. A species-dependent behavior in the assimilation of inorganic nitrogenous compounds has been observed: Synedra was a very sensitive species to UV-B radiation whereas the same UV-B doses had no effect on the assimilation rate of ammonia and nitrate of the Lithodesmium cells. The results were discussed with reference to the inhibition of the enzymes of the nitrogen metabolism. (author)
Nitrogen and water regime effects on corn yields determined by N-15 methodology
International Nuclear Information System (INIS)
Halitligil, M.B.; Akin, A.
2002-01-01
This investigation was carried out to determine the relationships between fertilizer N leaching and N fertilizer application time, method and irrigation rate by using 15 N methodology. Therefore, in the field experiments, the effects of three factors namely a) Irrigation rate (optimum 240 mm, high 360 mm), b) N application time (All at planting, 1/2 at planting and 1/2 after planting when plant heights were 50 cm), c) N application method (side dress and broadcast) were investigated. The field experiments were conducted using randomized block design as split-split plot and 4 replications. As the test plant hybrid corn was selected and at planting row spaces were arranged as 0.80 m x 0.25 m. Nitrogen was applied 120 kg N/ha to the all treatments as urea fertilizer (46 % N). In addition, to the sub-plots (which received half of N at planting and the other half when plant heights were 50 cm) 15 N labelled urea (2.63 % 15 N a.e. as 120 kg N/ha) was applied. After harvesting, total N and 15 N analyses were done for plant and soil samples. The results showed that the seed and total yields were increased with higher (360 mm) irrigation. When N application was side dressed the availability of N was increased, and also its loss by leaching from the active root zone was decreased. In conclusion, it was observed that at high irrigation rate was saved about 84 kg N/ha by side dressing rather than broadcasting of the applied N fertilizer
Interannual changes in δ15N values in Fucus vesiculosus L
International Nuclear Information System (INIS)
Carballeira, Carlos; Rey-Asensio, Ana; Carballeira, Alejo
2014-01-01
Highlights: • Isotopic values change along the thallus of F. vesiculosus. • δ 15 N values along the thallus are different between control and polluted sites. • δ 15 N values are temporally unstable at polluted sites. - Abstract: The natural abundance of 15 N (δ 15 N) has been widely used to detect anthropogenically derived N loads in environmental impact studies. The present study involved retrospective analysis of subsamples of Fucus vesiculosus L. collected during a period of three years (2008–2010) from two sites: a control site, within a coastal reference area, and an area affected by the effluents of a marine land-based fish farm. The isotopic signal in different subsamples of the macroalgae thalli (tissue that has grown during the same period) varied depending on the age of the tissue. Moreover, the isotopic signal decreased significantly with the age of the frond to within a certain range. The δ 15 N of F. vesiculosus is temporally unstable; therefore, measurement of the δ 15 N of macroalgal tissues does not allow reliable retrospective biomonitoring of environmental pollution. Further knowledge about the growth and other biological aspects of this species is required
Energy Technology Data Exchange (ETDEWEB)
Wang Liya [Cold Spring Harbor Laboratory (United States); Markley, John L. [University of Wisconsin, Biochemistry Department (United States)], E-mail: markley@nmrfam.wisc.edu
2009-06-15
The linear analysis of chemical shifts (LACS) has provided a robust method for identifying and correcting {sup 13}C chemical shift referencing problems in data from protein NMR spectroscopy. Unlike other approaches, LACS does not require prior knowledge of the three-dimensional structure or inference of the secondary structure of the protein. It also does not require extensive assignment of the NMR data. We report here a way of extending the LACS approach to {sup 15}N NMR data from proteins, so as to enable the detection and correction of inconsistencies in chemical shift referencing for this nucleus. The approach is based on our finding that the secondary {sup 15}N chemical shift of the backbone nitrogen atom of residue i is strongly correlated with the secondary chemical shift difference (experimental minus random coil) between the alpha and beta carbons of residue i - 1. Thus once alpha and beta {sup 13}C chemical shifts are available (their difference is referencing error-free), the {sup 15}N referencing can be validated, and an appropriate offset correction can be derived. This approach can be implemented prior to a structure determination and can be used to analyze potential referencing problems in database data not associated with three-dimensional structure. Application of the LACS algorithm to the current BMRB protein chemical shift database, revealed that nearly 35% of the BMRB entries have {delta}{sup 15}N values mis-referenced by over 0.7 ppm and over 25% of them have {delta}{sup 1}H{sup N} values mis-referenced by over 0.12 ppm. One implication of the findings reported here is that a backbone {sup 15}N chemical shift provides a better indicator of the conformation of the preceding residue than of the residue itself.
International Nuclear Information System (INIS)
Pahle, T.; Koehler, R.; Souffrant, W.B.; Gebhardt, G.; Matkowitz, R.; Hartig, W.
1983-01-01
Two female pigs (25 kg live weight) received a continuous infusion of 15 N-glycine and 15 N-lysine solutions, resp., for 45 h and for further 72 h unlabelled amino acid solutions. The main protein and energy sources, however, were administered orally. The time course of the 15 N level and the differential urinary N excretion were determined from blood urea and urine. For the demonstration of synthesis and decay rates of the total body protein a mathematical model has been developed. The suitability of 15 N-lysine and 15 N-glycine for the determination of N metabolism parameters is discussed
Adsorption, translocation and redistribution of nitrogen (15N) in orange trees
International Nuclear Information System (INIS)
Fenilli, Tatiele Anete Bergamo; Boaretto, Antonio Enedi Boaretto; Bendassolli, Jose Albertino; Trivelin, Paulo Cesar Ocheuze; Muraoka, Takashi
2002-01-01
The objective was to evaluate the absorption of 15 N from nutrient solution by young orange trees and the translocation and the redistribution of the absorbed N. The treatments were constituted by four periods of 15 N labelling (spring, summer, autumn and winter). In the first treatment, the young orange trees received 15 N in the nutrient solution during the spring and five replicates of the plants were picked at the end of the period. The new part, which was developed during the 15 N labelling period, was separated from the other part (old part) in branch and leaf, and also in flower and fruit when they were. The old part was separated in leaf, stem and root. This same procedure was followed in the other treatments. The total N and the isotope ratios 15 N/ 14 N were performed by mass spectrometry. The major part of absorbed N during the spring and summer was translocated to the new part of the orange trees, but in autumn and winter the absorbed N was concentrated in the old plant part. The redistribution of N from of old plant parts was more intensive during the autumn and winter. (author)
Thermodynamic properties of LiCl solutions in N-methylacetamide at 308.15-328.15 K
Manin, N. G.; Kolker, A. M.
2017-12-01
Enthalpies of dissolution of crystalline LiCl and enthalpies of dilution of LiCl solutions in N-methylacetamide (NMA) with electrolyte concentrations no greater than 0.32 m are measured on an isoperibolic calorimeter at 308.15, 318.15, and 328.5 K. Standard enthalpies of the dissolution of LiCl in NMA are calculated at different temperatures. The thermodynamic properties of the solution and its components are calculated and analyzed in the investigated range of concentrations and temperatures.
Energy Technology Data Exchange (ETDEWEB)
Amarger, N; Durr, J C; Bourguignon, C; Lagacherie, B [INRA Centre de Recherches de Dijon, 21 (France). Lab. de Microbiologie des Sols; Mariotti, A; Mariotti, F [Paris-6 Univ., 75 (France). Lab. de Geologie Dynamique
1979-07-01
The use of variations in natural abundance of /sup 15/N between nitrogen fixing and non nitrogen fixing soybeans was investigated for quantitative estimate of symbiotic nitrogen fixation. Isotopic analysis of 4 varieties of inoculated and non-inoculated soybeans growing under field conditions, with and without N-fertilizer was determined. It was found that inoculated soybeans had a significantly lower /sup 15/N content than non-inoculated ones. Estimates of the participation of fixed N to the total nitrogen content of inoculated soybeans were calculated from these differences. They were compared to estimates calculated from differences in N yield between inoculated and non-inoculated plants and to the nitrogenase activity, measured by the C/sub 2/H/sub 2/ reduction assay over the growing season. Estimates given by the /sup 15/N measurements were correlated with the C/sub 2/H/sub 2/ reducing activity but not with the differences in the N yield. This shows that the isotopic composition was dependent on the amount of fixed nitrogen and consequently that the estimates of fixed nitrogen based on natural /sup 15/N abundance should be reliable. The absence of correlation between estimates based on /sup 15/N content and estimates based on N yield was explained by differences in the uptake of soil nitrogen between inoculated and non inoculated soybeans.
Energy Technology Data Exchange (ETDEWEB)
Palhol, Fabien; Lamoureux, Catherine; Chabrillat, Martine; Naulet, Norbert
2004-05-10
In this study, the {sup 15}N/{sup 14}N isotopic ratios of 106 samples of 3,4-methylenedioxymethamphetamine (MDMA) extracted from Ecstasy tablets are presented. These ratios, measured using gas chromatography-combustion-isotope ratio mass spectrometry (GC-C-IRMS), show a large discrimination between samples with a range of {delta}{sup 15}N values between -17 and +19%o, depending on the precursors and the method used in clandestine laboratories. Thus, {delta}{sup 15}N values can be used in a statistical analysis carried out in order to link Ecstasy tablets prepared with the same precursors and synthetic pathway. The similarity index obtained after principal component analysis and hierarchical cluster analysis appears to be an efficient way to group tablets seized in different places.
Directory of Open Access Journals (Sweden)
Rodrigo Marcelli Boaretto
2007-01-01
Full Text Available Informações sobre absorção de nutrientes em pomares cítricos são importantes para recomendações do manejo da fertilidade do solo. Contudo, estudos sobre a distribuição dos nutrientes na planta e a validação das doses de nitrogênio (N recomendadas são escassos na literatura brasileira. O presente trabalho avaliou (i o acúmulo de nutrientes e a distribuição do N (15N aplicado em citros e (ii validou a dose de N recomendada para pomares em início de produção. Em laranjeiras 'Pêra' sobre limoeiro 'Cravo', com 3 a 4 anos de idade, foram aplicadas doses de 150; 300; 450 e 600 g de N por planta, como sulfato de amônio, divididas em três parcelas, entre a primavera e o verão. Incluiu-se um tratamento-testemunha sem N. No mesmo pomar, em outras três plantas, aplicaram-se 300 g por planta de N-[(15NH42SO 4] enriquecido em 15N, para estudar o destino do N do fertilizante no pomar. Foram avaliadas a produção de frutos e o aproveitamento do 15N pela biomassa da planta. A eficiência do fertilizante, estimada com base na absorção de N pela planta, variou entre 20% e 27% do total aplicado. Os frutos exportaram 35% do N absorvido do fertilizante, e a dose de 400 g de N proporcionou a máxima produção de laranjas.Information about nutrient absorption of citrus orchards is important to establish guidelines for best soil fertility management. However, studies on the fate of applied N fertilizers and validation of nitrogen (N dose recommendations are scarce in the literature. The present work evaluated (i the accumulation of nutrients and the distribution of N (15N applied to citrus orchard and (ii validated the N fertilization rate applied to young bearing orange trees. Three- to four-year-old Pêra sweet orange trees Pera grafted on Rangpur lime were fertilized with 150, 300, 450, and 600 g of N per tree, as ammonium sulfate, split in three applications from spring to summer. A control treatment without N was included. In the same
International Nuclear Information System (INIS)
Inbar, L.; Lapidot, A.
1988-01-01
Recent studies have suggested that the onset of synthesis of actinomycin D in Streptomyces is due to a release from L-glutamate catabolic repression. In the present investigation we showed that S. parvulus has the capacity to maintain high levels of intracellular glutamate during the synthesis of actinomycin D. The results seem contradictory, since actinomycin D synthesis cannot start before a release from L-glutamate catabolic repression, but a relatively high intracellular pool of glutamate is needed for the synthesis of actinomycin D. Utilizing different labeled precursors, D-[U- 13 C]fructose and 13 C- and 15 N-labeled L-glutamate, and nuclear magnetic resonance techniques, we showed that carbon atoms of an intracellular glutamate pool of S. parvulus were not derived biosynthetically from the culture medium glutamte source but rather from D-fructose catabolism. A new intracellular pyrimidine derivative whose nitrogen and carbon skeletons were derived from exogenous L-glutamate was obtained as the main glutamate metabolite. Another new pyrimidine derivative that had a significantly reduced intracellular mobility and that was derived from D-fructose catabolism was identified in the cell extracts of S. parvulus during actinomycin D synthesis. These pyrimidine derivatives may serve as a nitrogen store for actinomycin D synthesis. In the present study, the N-trimethyl group of a choline derivative was observed by 13 C nuclear magnetic resonance spectroscopy in growing S. parvulus cells. The choline group, as well as the N-methyl groups of sarcosine, N-methyl-valine, and the methyl groups of an actinomycin D chromophore, arose from D-fructose catabolism. The 13 C enrichments found in the peptide moieties of actinomycin D were in accordance with a mechanism of actinomycin D synthesis from L-glutamate and D-fructose
Chaudhary, Doongar R; Seo, Juyoung; Kang, Hojeong; Rathore, Aditya P; Jha, Bhavanath
2018-05-01
High and fluctuating salinity is characteristic for coastal salt marshes, which strongly affect the physiology of halophytes consequently resulting in changes in stable isotope distribution. The natural abundance of stable isotopes (δ 13 C and δ 15 N) of the halophyte plant Salicornia brachiata and physico-chemical characteristics of soils were analysed in order to investigate the relationship of stable isotope distribution in different populations in a growing period in the coastal area of Gujarat, India. Aboveground and belowground biomass of S. brachiata was collected from six different populations at five times (September 2014, November 2014, January 2015, March 2015 and May 2015). The δ 13 C values in aboveground (-30.8 to -23.6 ‰, average: -26.6 ± 0.4 ‰) and belowground biomass (-30.0 to -23.1 ‰, average: -26.3 ± 0.4 ‰) were similar. The δ 13 C values were positively correlated with soil salinity and Na concentration, and negatively correlated with soil mineral nitrogen. The δ 15 N values of aboveground (6.7-16.1 ‰, average: 9.6 ± 0.4 ‰) were comparatively higher than belowground biomass (5.4-13.2 ‰, average: 7.8 ± 0.3 ‰). The δ 15 N values were negatively correlated with soil available P. We conclude that the variation in δ 13 C values of S. brachiata was possibly caused by soil salinity (associated Na content) and N limitation which demonstrates the potential of δ 13 C as an indicator of stress in plants.
International Nuclear Information System (INIS)
Xu Xinyu; Zhang Yumei; Xiang Hua; Hu Jisheng
1991-10-01
By using 15 N trace technique, the effect of applying wheat stubble on the preservation and utilization rate of 15 N- ammonium sulphate have been studied. The abundance of ( 15 NH 4 ) 2 SO 4 fertilizer was 8.92%. After three years pot test and field plot test, the results showed that the yields with ' 15 N+mulching' and ' 15 N+incorporating' treated were increased by 5.4∼30.0% for spring wheat and millet(pot test), and 18∼23% for winter wheat and summer corn(field plot test), as compared with only ' 15 N' treatment. The results of 15 N-fertilizer labelled tests showed that the utilization rates of 15 N-fertilizer treated by ' 15 N+mulching' for cropping seasons were 57.8%, 65.8%, 36.6% and 8.5% respectively. These were increased 3.7%, 10.2%, 21.5% and 2.8% as compared with only ' 15 N' treatment. Comparing with only ' 15 N'treatment, the N leached off by percolation water was decreasing 50%, the loss of N caused by volatilization was decreasing 30.3% and the N in humus was increasing 21.1%. All of these proved that the applying of wheat stubble in different mode would adjust and control the activation of microbe in the soil, and the preservation and utilization rate of fertilizer in the soul would be increased
Physical properties of {anisole + n-alkanes} at temperatures between (293.15 and 303.15) K
International Nuclear Information System (INIS)
Al-Jimaz, Adel S.; Al-Kandary, Jasem A.; Abdul-latif, Abdul-Haq M.; Al-Zanki, Adnan M.
2005-01-01
Density ρ, viscosity η, and refractive index n D , values of {anisole + hexane, or heptane, or octane, or nonane, or decane, or dodecane} binary mixtures over the entire range of mole fraction at temperatures (293.15, 298.15, and 303.15) K, have been investigated at atmospheric pressure. The excess molar volume V E , has been calculated from the experimental measurements. These results were fitted to Redlich and Kister polynomial equation to estimate the binary interaction parameters. The viscosity data were correlated with equations of Grunberg and Nissan, and McAllister. The refractive indices data were used to calculate the specific refractivity R 12 , and also correlated with Lorentz-Lorenz equation. While the excess molar volumes of {anisole + hexane} are negative, and {anisole + heptane} are sigmoidal S-shaped, the remaining binary mixtures are positive. The effects of n-alkanes chain length as well as the temperature on the excess molar volume have been studied. The calculated values have been qualitatively used to explain the intermolecular interaction between the mixing components
Liver function tests using the stable istope 15N
International Nuclear Information System (INIS)
Faust, H.; Jung, K.; Hirschberg, K.; Krumbiegel, P.; Junghans, P.; Reinhardt, R.; Teichmann, B.
1988-01-01
Several liver function tests using oral application of a nitrogen compound labelled with 15 N and the subsequent determination of 15 N in a certain fraction of urine or in the total urine by emission spectrometry are described. Because of the key function of the liver in the metabolism of nitrogen compounds, the results of these tests allow conclusions concerning some disturbances of liver functions. (author)
Field plated 0.15 μm GaN HEMTs for millimeter-wave application
International Nuclear Information System (INIS)
Ren Chunjiang; Li Zhonghui; Yu Xuming; Wang Quanhui; Wang Wen; Chen Tangsheng; Zhang Bin
2013-01-01
SiN dielectrically-defined 0.15 μm field plated GaN HEMTs for millimeter-wave application have been presented. The AlGaN/GaN hetero-structure epitaxial material for HEMTs fabrication was grown on a 3-inch SiC substrate with an Fe doped GaN buffer layer by metal-organic chemical deposition. Electron beam lithography was used to define both the gate footprint and the cap of the gate with an integrated field plate. Gate recessing was performed to control the threshold voltage of the devices. The fabricated GaN HEMTs exhibited a unit current gain cut-off frequency of 39 GHz and a maximum frequency of oscillation of 63 GHz. Load-pull measurements carried out at 35 GHz showed a power density of 4 W/mm with associated power gain and power added efficiency of 5.3 dB and 35%, respectively, for a 0.15 mm gate width device operated at a 24 V drain bias. The developed 0.15 μm gate length GaN HEMT technology is suitable for Ka band applications and is ready for millimeter-wave power MMICs development. (semiconductor devices)
International Nuclear Information System (INIS)
Karasawa, Yutaka; Koh, Katsuki
1985-01-01
In this experment, the blood ammonia and glutamine amide came from infused ammonia were determined when N-15 labeled ammonium acetate was intraportally infused into the chickens fed 5 or 20 % protein diet. The data obtained indicated that the infused ammonia was taken into blood glutamine amide, and also accumulated in blood as it is, in both dietary groups. 10 to 12 months old White Leghorn male birds were used. The experimental diet was fed once a day for 5 days to the birds weighting about 1.2 kg by 35 g per kg body weight. The experimental diet was consumed within 40 min in all cases. Cardiac and portal catheterization were performed for blood collection and ammonia infusion, respectively. After finishing the infusion, blood samples were taken to analyze the ammonia and glutamine contents and their N-15 enrichment. Statistical difference was not observed in the appearance of N-15 in ammonia and glutamine amide between two dietary groups. The N-15 enrichment in blood ammonia and the amide of plasma glutamine, and the calculated exogenous nitrogen in the ammonia and glutamine amide tended to be more in the 5 % protein diet group than the other. (Kako, I.)
Investigation of the metabolism of colostomized laying hens with 15N-labelled wheat. 6
International Nuclear Information System (INIS)
Gruhn, K.; Hennig, A.
1980-01-01
Three colostomized laving hens received 40 g 15 N-labelled wheat with 20.13 atom-% 15 N excess ( 15 N'), 19.18 atom-% 15 N'-lysine, 18.17 atom-% 15 N'-histidine and 20.43 atom-% 15 N'-arginine per day over a period of four days. After having received the same non-labelled feed ration on the following four days, the hens were slaughtered. The incorporation and distribution of 15 N' in the total nitrogen and the nitrogen of the basic amino acids was determined in liver, kidneys, muscles, bones and the remaining carcass (excluding blood, digestive tract and genital organs). The quota of nitrogen of natural isotope frequency ( 14 N) of the total 14 N of the hens' carcasses was 47% in the muscles, 14% in the bones and 20% in the feathers; the relative 15 N' values were 37%, 8% and 1%, resp. The atom-% 15 N' in the kidneys was twice as much as in the liver four days after the last 15 N' application. The average percentage of the nitrogen in the three basic amino acids of the total nitrogen in the tissues and organs (excluding feathers) is 25% concerning both 14 N and 15 N'. The 15N' balance revealed that in hen 1 100%, in hen 2 102% and in hen 3 101% of the consumed wheat 15 N' were found. (author)
Comparison of polarization and analyzing power for the /sup 15/N(p,n)/sup 15/O reaction
Energy Technology Data Exchange (ETDEWEB)
Byrd, R.C.; Tornow, W.; Lisowski, P.W.; Murphy, K.; Walter, R.L. (Duke Univ., Durham, NC (USA). Dept. of Physics; Triangle Universities Nuclear Lab., Durham, NC (USA))
1983-11-21
The analyzing power Asub(y)(theta) and polarization Psup(y)(theta) for the /sup 15/N(p,n/sub 0/)/sup 15/O reaction have been measured for Esub(p)=4.5-11.3 MeV. The values of the two observables are nearly the same above 11 MeV, where a ''quasi-elastic'' view of the (p,n) reaction to the analog state should be applicable. Below 10 MeV, however, large spin-flip amplitudes and isospin-mixing ratios provide the two major conditions needed to obtain Psup(y)(theta)not=Asub(y)(theta) and dramatic differences between the two observables are observed. The size of the differences and their dependence on energy are similar to the results predicted by shell-model calculations. The Psup(y)(theta) and Asub(y)(theta) measurements have been combined with existing cross-section data to provide information about spin-flip processes. We also comment on the connection between comparisons of Psup(y)(theta) and Asup(y)(theta) in charge-symmetric (p,n) reactions and the recent controversial measurements of a difference between the values of Psup(y)(theta) for a reaction and Asub(y)(theta) for the inverse reaction.
International Nuclear Information System (INIS)
Hadibi-Olschewski, Nathalie
1991-01-01
The aim of this study was to investigate the dissolution behavior of nitride fuels in nitric acid. The use of nitride fuels in nuclear reactor has many advantages compared with the oxide fuels. One problem in employing nitrides as fuels is the formation of radio-toxic 14 C upon irradiation of natural nitrogen ( 14 N:99.64 pc, 15 N:0.36 pc) in a nuclear reactor ( 14 N (n,p) 14 C reaction). The use of 15 N-enriched fuels avoids these drawbacks. This study was undertaken so as to better understand the mechanisms of the dissolution process and also to follow the distribution of the expensive nitrogen isotope 15 N from the point of view of its behaviour during the recycling process. This study is based on previous work, where the evolution of the nitrogen compounds formed during the dissolution was measured as a function of time for different dissolution parameters. Using 15 N-enriched uranium nitrides or 15 N-enriched nitric acid, two methods were developed to study the influence of the dissolution parameters, nitric acid temperature and concentration, on the 15 N/ 14 N ratios of the nitrogen, nitrogen oxides and ammonium ions utilising a coupled gas-chromatograph/mass spectrometer. The main results are: - similar isotopic composition for NH 4 + and UN; - mixed 14 N/ 15 N composition for N 2 and N 2 O; - similar isotopic composition for NO, NO 2 and HNO 3 ; - no influence of the dissolution parameters on the isotopic composition of the products; an exception maybe made for the N 2 case, which contains more 15 N with increasing acidity and temperature. This work confirms that the first dissolution step is the oxidation of UN with HNO 3 to form NH 4 + and HNO 2 and that HNO 2 has a catalytic role in the dissolution to form other products. And we can conclude that to recycle 15 N, the ammonium ions must be recycled, at least for the case where nitrides are dissolved directly in HNO 3 . (author) [fr
Human dietary δ(15)N intake: representative data for principle food items.
Huelsemann, F; Koehler, K; Braun, H; Schaenzer, W; Flenker, U
2013-09-01
Dietary analysis using δ(15)N values of human remains such as bone and hair is usually based on general principles and limited data sets. Even for modern humans, the direct ascertainment of dietary δ(15)N is difficult and laborious, due to the complexity of metabolism and nitrogen fractionation, differing dietary habits and variation of δ(15)N values of food items. The objective of this study was to summarize contemporary regional experimental and global literature data to ascertain mean representative δ(15)N values for distinct food categories. A comprehensive data set of more than 12,000 analyzed food samples was summarized from the literature. Data originated from studies dealing with (1) authenticity tracing or origin control of food items, and (2) effects of fertilization or nutrition on δ(15)N values of plants or animals. Regional German food δ(15)N values revealed no major differences compared with the mean global values derived from the literature. We found that, in contrast to other food categories, historical faunal remains of pig and poultry are significantly enriched in (15)N compared to modern samples. This difference may be due to modern industrialized breeding practices. In some food categories variations in agricultural and feeding regimens cause significant differences in δ(15)N values that may lead to misinterpretations when only limited information is available. Copyright © 2013 Wiley Periodicals, Inc.
δ(15) N from soil to wine in bulk samples and proline.
Paolini, Mauro; Ziller, Luca; Bertoldi, Daniela; Bontempo, Luana; Larcher, Roberto; Nicolini, Giorgio; Camin, Federica
2016-09-01
The feasibility of using δ(15) N as an additional isotopic marker able to link wine to its area of origin was investigated. The whole production chain (soil-leaves-grape-wine) was considered. Moreover, the research included evaluation of the effect of the fermentation process, the use of different types of yeast and white and red vinification, the addition of nitrogen adjuvants and ultrasound lysis simulating wine ageing. The δ(15) N of grapes and wine was measured in bulk samples and compounds, specifically in proline, for the first time. Despite isotopic fractionation from soil to wine, the δ(15) N values of leaves, grapes, wine and particularly must and wine proline conserved the variability of δ(15) N in the growing soil. Fermentation and ultrasound treatment did not affect the δ(15) N values of grape must, which was therefore conserved in wine. The addition of inorganic or organic adjuvants was able to influence the δ(15) N of bulk wine, depending on the amount and the difference between the δ(15) N of must and that of the adjuvant. The δ(15) N of wine proline was not influenced by adjuvant addition and is therefore the best marker for tracing the geographical origin of wine. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Cui, Li; Yang, Kai; Li, Hong-Zhe; Zhang, Han; Su, Jian-Qiang; Paraskevaidi, Maria; Martin, Francis L; Ren, Bin; Zhu, Yong-Guan
2018-04-17
Nitrogen (N) fixation is the conversion of inert nitrogen gas (N 2 ) to bioavailable N essential for all forms of life. N 2 -fixing microorganisms (diazotrophs), which play a key role in global N cycling, remain largely obscure because a large majority are uncultured. Direct probing of active diazotrophs in the environment is still a major challenge. Herein, a novel culture-independent single-cell approach combining resonance Raman (RR) spectroscopy with 15 N 2 stable isotope probing (SIP) was developed to discern N 2 -fixing bacteria in a complex soil community. Strong RR signals of cytochrome c (Cyt c, frequently present in diverse N 2 -fixing bacteria), along with a marked 15 N 2 -induced Cyt c band shift, generated a highly distinguishable biomarker for N 2 fixation. 15 N 2 -induced shift was consistent well with 15 N abundance in cell determined by isotope ratio mass spectroscopy. By applying this biomarker and Raman imaging, N 2 -fixing bacteria in both artificial and complex soil communities were discerned and imaged at the single-cell level. The linear band shift of Cyt c versus 15 N 2 percentage allowed quantification of N 2 fixation extent of diverse soil bacteria. This single-cell approach will advance the exploration of hitherto uncultured diazotrophs in diverse ecosystems.
Fate of 15N-urea applied to wheat-soybean succession crop
International Nuclear Information System (INIS)
Boaretto, Antonio Enedi; Trivelin, Paulo Cesar Ocheuze; Muraoka, Takashi; Spolidorio, Eduardo Scarpari; Freitas, Jose Guilherme de; Cantarella, Heitor
2004-01-01
The wheat crop in Sao Paulo State, Brazil, is fertilized with N, P and K. The rate of applied N (0 to 120 kg.ha -1 ) depends on the previous grown crop and the irrigation possibility. The response of wheat to rates and time of N application and the fate of N applied to irrigated wheat were studied during two years. Residual N recovery by soybean grown after the wheat was also studied. The maximum grain productivity was obtained with 92 kg.ha -1 of N. The efficiency of 15 N-urea utilization ranged from 52% to 85%. The main loss of applied 15 N, 5% to 12% occurred as ammonia volatilized from urea applied on soil surface. The N loss by leaching even at the N rate of 135 kg.ha -1 , was less than 1% of applied 15 N, due to the low amount of rainfall during the wheat grown season and a controlled amount of irrigated water, that were sufficient to moisten only the wheat root zone. The residual 15 N after wheat harvest represents around 40% of N applied as urea: 20% in soil, 3% in wheat root system and 16% in the wheat straw. Soybean recovered less than 2% of the 15 N applied to wheat at sowing or at tillering stage. (author)
Ro, Hee-Myong; Kim, Pan-Gun; Park, Ji-Suk; Yun, Seok-In; Han, Junho
2018-04-01
Constructed coastal marsh regulates land-born nitrogen (N) loadings through salinity-dependent microbial N transformation processes. A hypothesis that salinity predominantly controls N removal in marsh was tested through incubation in a closed system with added- 15 NH 4 + using sediments collected from five sub-marshes in Shihwa marsh, Korea. Time-course patterns of concentrations and 15 N-atom% of soil-N pools were analyzed. Sediments having higher salinity and lower soil organic-C and acid-extractable organic-N exhibited slower rates of N mineralization and immobilization, nitrification, and denitrification. Rates of denitrification were not predicted well by sediment salinity but by its organic-C, indicating heterotrophic denitrification. Denitrification dominated N-loss from this marsh, and nitrogen removal capacity of this marsh was estimated at 337 kg N day -1 (9.9% of the daily N-loadings) considering the current rooting depth of common reeds (1.0 m). We showed that sediment N removal decreases with increasing salinity and can increase with increasing organic-C for heterotrophic denitrification. Copyright © 2018 Elsevier Ltd. All rights reserved.
Inácio, Caio T; Urquiaga, Segundo; Chalk, Phillip M; Mata, Maria Gabriela F; Souza, Paulo O
2015-12-01
This study was conducted in areas of vegetable production in tropical Brazil, with the objectives of (i) measuring the variation in δ(15) N in soils, organic N fertilizer sources and lettuce (Lactuca sativa L.) from different farming systems, (ii) measuring whether plant δ(15) N can differentiate organic versus conventional lettuce and (iii) identifying the factors affecting lettuce δ(15) N. Samples of soil, lettuce and organic inputs were taken from two organic, one conventional and one hydroponic farm. The two organic farms had different N-sources with δ(15) N values ranging from 0.0 to +14.9‰ (e.g. leguminous green manure and animal manure compost, respectively), and differed significantly (P hydroponic lettuce δ(15) N (+4.5 ± 0.2‰) due to manure inputs. The N from leguminous green manure made a small contribution to the N nutrition of lettuce in the multi-N-source organic farm. To differentiate organic versus conventional farms using δ(15) N the several subsets of mode of fertilization should be considered. Comparisons of δ(15) N of soil, organic inputs and lettuce allowed a qualitative analysis of the relative importance of different N inputs. © 2015 Society of Chemical Industry.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV
International Nuclear Information System (INIS)
Roy, Rabindra N.; Roy, Lakshmi N.; LeNoue, Sean R.; Denton, Cole E.; Simon, Ashley N.; Richards, Sarah J.; Moore, Andrew C.; Roy, Chandra N.; Redmond, R. Ryan; Bryant, Paul A.
2006-01-01
Values of the second thermodynamic dissociation constant pK 2 of N-[tris(hydroxymethyl)methyl-3-amino]propanesulfonic acid (Taps) have been determined at twelve temperatures from 278.15 K to 328.15 K including 310.15 K by measurements of the electromotive-force for cells without liquid junction of the type: Pt|H 2 (g, p - bar =101.325 kPa)|Taps (m 1 ), NaTapsate (m 2 ), NaCl (m 3 )|AgCl|Ag, where m denotes molality. The pK 2 values for the dissociation of Taps are represented by the equation: pK 2 =2969.61.(K/T) - 17.05052+2.73697.ln(T/K). The values of pK 2 for Taps were found to be (8.502+/-0.0007) at T=298.15 K and (8.225+/-0.0009) at T=310.15 K, respectively, indicating thereby to be useful as buffer solutions for pH control in the region 7.4 to 8.5. The thermodynamic quantities, ΔG - bar , ΔH - bar , ΔS - bar , and ΔC p - bar dissociation process of Taps have been derived from the temperature coefficients of the pK 2
Ecosystem N distribution and δ15N during a century of forest regrowth after agricultural abandonment
Compton, J.E.; Hooker, T.D.; Perakis, S.S.
2007-01-01
Stable isotope ratios of terrestrial ecosystem nitrogen (N) pools reflect internal processes and input–output balances. Disturbance generally increases N cycling and loss, yet few studies have examined ecosystem δ15N over a disturbance-recovery sequence. We used a chronosequence approach to examine N distribution and δ15N during forest regrowth after agricultural abandonment. Site ages ranged from 10 to 115 years, with similar soils, climate, land-use history, and overstory vegetation (white pine Pinus strobus). Foliar N and δ15N decreased as stands aged, consistent with a progressive tightening of the N cycle during forest regrowth on agricultural lands. Over time, foliar δ15N became more negative, indicating increased fractionation along the mineralization–mycorrhizal–plant uptake pathway. Total ecosystem N was constant across the chronosequence, but substantial internal N redistribution occurred from the mineral soil to plants and litter over 115 years (>25% of ecosystem N or 1,610 kg ha−1). Temporal trends in soil δ15N generally reflected a redistribution of depleted N from the mineral soil to the developing O horizon. Although plants and soil δ15N are coupled over millennial time scales of ecosystem development, our observed divergence between plants and soil suggests that they can be uncoupled during the disturbance-regrowth sequence. The approximate 2‰ decrease in ecosystem δ15N over the century scale suggests significant incorporation of atmospheric N, which was not detected by traditional ecosystem N accounting. Consideration of temporal trends and disturbance legacies can improve our understanding of the influence of broader factors such as climate or N deposition on ecosystem N balances and δ15N.
δ15N constraints on long-term nitrogen balances in temperate forests
Perakis, S.S.; Sinkhorn, E.R.; Compton, J.E.
2011-01-01
Biogeochemical theory emphasizes nitrogen (N) limitation and the many factors that can restrict N accumulation in temperate forests, yet lacks a working model of conditions that can promote naturally high N accumulation. We used a dynamic simulation model of ecosystem N and δ15N to evaluate which combination of N input and loss pathways could produce a range of high ecosystem N contents characteristic of forests in the Oregon Coast Range. Total ecosystem N at nine study sites ranged from 8,788 to 22,667 kg ha−1 and carbon (C) ranged from 188 to 460 Mg ha−1, with highest values near the coast. Ecosystem δ15N displayed a curvilinear relationship with ecosystem N content, and largely reflected mineral soil, which accounted for 96–98% of total ecosystem N. Model simulations of ecosystem N balances parameterized with field rates of N leaching required long-term average N inputs that exceed atmospheric deposition and asymbiotic and epiphytic N2-fixation, and that were consistent with cycles of post-fire N2-fixation by early-successional red alder. Soil water δ15NO3 − patterns suggested a shift in relative N losses from denitrification to nitrate leaching as N accumulated, and simulations identified nitrate leaching as the primary N loss pathway that constrains maximum N accumulation. Whereas current theory emphasizes constraints on biological N2-fixation and disturbance-mediated N losses as factors that limit N accumulation in temperate forests, our results suggest that wildfire can foster substantial long-term N accumulation in ecosystems that are colonized by symbiotic N2-fixing vegetation.
Arctic Sea Ice in a 1.5°C Warmer World
Niederdrenk, Anne Laura; Notz, Dirk
2018-02-01
We examine the seasonal cycle of Arctic sea ice in scenarios with limited future global warming. To do so, we analyze two sets of observational records that cover the observational uncertainty of Arctic sea ice loss per degree of global warming. The observations are combined with 100 simulations of historical and future climate evolution from the Max Planck Institute Earth System Model Grand Ensemble. Based on the high-sensitivity observations, we find that Arctic September sea ice is lost with low probability (P≈ 10%) for global warming of +1.5°C above preindustrial levels and with very high probability (P> 99%) for global warming of +2°C above preindustrial levels. For the low-sensitivity observations, September sea ice is extremely unlikely to disappear for +1.5°C warming (P≪ 1%) and has low likelihood (P≈ 10%) to disappear even for +2°C global warming. For March, both observational records suggest a loss of 15% to 20% of Arctic sea ice area for 1.5°C to 2°C global warming.
Kerma factors and reaction cross sections for n + /sup 12/C between 15 and 18 MeV
Energy Technology Data Exchange (ETDEWEB)
Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.
1988-07-01
Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from /sup 12/C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The /sup 12/C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range.
Natural 15N abundance of soil N pools and N2O reflect the nitrogen dynamics of forest soils
DEFF Research Database (Denmark)
Pörtl, K.; Zechmeister-Boltenstern, S.; Wanek, W.
2007-01-01
Natural N-15 abundance measurements of ecosystem nitrogen (N) pools and N-15 pool dilution assays of gross N transformation rates were applied to investigate the potential of delta N-15 signatures of soil N pools to reflect the dynamics in the forest soil N cycle. Intact soil cores were collected...
Espectro infrarrojo de [zn(mh34](re042 com substituicion isotópica 14n/15n
Directory of Open Access Journals (Sweden)
Claudio Téllez
1983-11-01
Full Text Available The infrared spectra of [Zn(15NH34] (Re042 and the isotopoc shift 14N/15N (Zn-n for the metal-ligand band, is reportedInforma-se o espectro infravermelho do complexo de Zn(II, [Zn(15NH341(Re04 e o deslocamento isotópico 14N/15N, para a banda metal - ligante v(Zn-N.
Distribution of 15N-labeled urea injected into field-grown corn plants
International Nuclear Information System (INIS)
Zhou, X.; Madrmootoo, C.A.; Mackenzie, A.F.; Smith, D.L.
1998-01-01
Nitrogen (N) assimilate supply to developing corn (Zea mays L.) ears plays a critical role in grain dry weight accumulation. The use of stem-perfused/injected 15N labeled compounds to determine the effects of an artificial N source on the subsequent distribution of injected N and grain weight of field-grown corn plants has not been reported previously. Our objective was to assess the distribution of N added via an artificial source. Three soil N fertilizer levels (0, 180, and 270 kg N ha-1) and three N solutions (distilled water control and 15N enriched urea at 15 and 30 mM N) were arranged in a split-plot design. Three N concentrations were injected using a pressurized stem injection technique. The injection started fifteen days after silking and continued until immediately prior to plant physiological maturity. The average uptake volume was 256 mL over the 30-day injection period. The N supplied via injection represented 1.5 to 3% of the total plant N. Neither soil applied N fertilizer nor injected N altered dry matter distribution among plant tissues. As the concentration of N in the injected solutions increased, N concentrations increased in the grain and upper stalks, and % 15N atom excess in ear+1 leaves and leaves increased. The relative degree of 15N enrichment for each of the tissues measured was injected internode grain upper stalks leaves lower stalks cob husk ear + 1 leaf ear leaf. This study indicated that the exogenous N supplied via stem-injection, was incorporated into all the measured plant parts, although not uniformly. The distribution of the injected 15N was affected both by the proximity of sinks to the point of injection and the strength of the various sinks
Using N-15 Technique for Assessing Organic.N Turnover in Sandy Soil
International Nuclear Information System (INIS)
Soliman, S.; El-Akel, E.A.; Ismail, M.M.; El-Sherbiny, E.; Awad, E.E.
2008-01-01
Turnover of organic-N was traced under greenhouse condition. 15 N-labelled wheat and/or soybean residues were used as organic additives which applied individually or in combinations. These residues were applied at rates of 100, 75 and 25μg N g - 1 soil. Also, labelled ammonium sulfate with 2% 15 N atom excess, was applied either alone or in combination with the plant residues, at rates of 100, 75 and 25μg N g - 1 soil as single dose after 10 days from planting. Relative positive effect of the nitrogen plant residues on N-uptake and yield components can be arranged as follows: Soybean > wheat + > soybean > wheat residues. Tracer technique indicated that the mixture of labeled residues and ammonium sulfate at rates of (*50 + 50) and (*25 + 75), was effective on dry matter and N uptake. Effect of organic and inorganic nitrogen sources on portions N derived from residue (Ndfr) and N derived from fertilizer (Ndff) to wheat could be arranged as following: ammonium sulfate > soybean > mixture > wheat. Higher 15 N recovery percentage was noticed in grains as affected by addition of soybean residues combined with ordinary ammonium sulfate at rates of (*25 + 75) and (*50 + 50), respectively
Symes, Craig; Skhosana, Felix; Butler, Mike; Gardner, Brett; Woodborne, Stephan
2017-12-01
Diet-tissue isotopic relationships established under controlled conditions are informative for determining the dietary sources and geographic provenance of organisms. We analysed δ 13 C, δ 15 N, and non-exchangeable δ 2 H values of captive African grey parrot Psittacus erithacus feathers grown on a fixed mixed-diet and borehole water. Diet-feather Δ 13 C and Δ 15 N discrimination values were +3.8 ± 0.3 ‰ and +6.3 ± 0.7 ‰ respectively; significantly greater than expected. Non-exchangeable δ 2 H feather values (-62.4 ± 6.4 ‰) were more negative than water (-26.1 ± 2.5 ‰) offered during feather growth. There was no positive relationship between the δ 13 C and δ 15 N values of the samples along each feather with the associated samples of food offered, or the feather non-exchangeable hydrogen isotope values with δ 2 H values of water, emphasising the complex processes involved in carbohydrate, protein, and income water routing to feather growth. Understanding the isotopic relationship between diet and feathers may provide greater clarity in the use of stable isotopes in feathers as a tool in determining origins of captive and wild-caught African grey parrots, a species that is widespread in aviculture and faces significant threats to wild populations. We suggest that these isotopic results, determined even in controlled laboratory conditions, be used with caution.
Energy Technology Data Exchange (ETDEWEB)
Klein, P D; Szczepanik, P A; Hachey, D L [Argonne National Lab., Evanston, Ill. (USA)
1974-08-01
The function of the Argonne Program is to provide synthetic, analytical instrumental capability in a core facility for the clinical investigator who needs to use /sup 2/H, /sup 13/C, or /sup 15/N labelled compounds for metabolic or clinical research on pregnant women, newborn infants, young children, or for mass screening. To carry out such application development, there were six stages which were recurrent steps in every application. Five fundamental strategies should be adopted to establish the use of stable isotopes in clinical work. The instrument required for measurements was a combined gas chromatograph-mass spectrometer, and its use was schematically illustrated. Some of the successful experiences with compounds labelled by stable isotopes, such as deuterium labelled chenodeoxycholic acid, and respective /sup 13/C and /sup 15/N-labelled glycine were described. Deutrium labelled bile acid enabled easy and safe determination of the size of the bile acid pool and the replacement rate, providing clearer diagnoses for cholestatic liver disease and gallstones. /sup 13/C and /sup 15/N labelled compounds were used in clinical studies, of children with genetic disorders of amino acid metabolism, i.e., non ketotic hyperflycinemia, B/sub 12/-responsive methyl malonic acidemia, and Lesch-Nyhan syndrome. /sup 15/N-labelled glycine was also studied in a child with Lesch-Nyhan syndrome.
Bathaie, S Zahra; Ajloo, Davood; Daraie, Marzieh; Ghadamgahi, Maryam
2015-01-01
Interaction between a cationic porphyrin and its ferric derivative with oligo(dA.dT)15 and oligo(dG.dC)15 was studied by UV-vis spectroscopy, resonance light scattering (RLS), and circular dichroism (CD) at different ionic strengths; molecular docking and molecular dynamics simulation were also used for completion. Followings are the observed changes in the spectral properties of meso-tetrakis (N-para-trimethyl-anilium) porphyrin (TMAP), as a free-base porphyrin with no axial ligand, and its Fe derivative (FeTMAP) upon interaction with oligo(dA.dT)15 and oligo(dG.dC)15: (1) the substantial red shift and hypochromicity at the Soret maximum in the UV-vis spectra; (2) the increased RLS intensity by increasing the ionic strength; and (3) an intense bisignate excitonic CD signal. All of them are the reasons for TMAP and FeTMAP binding to oligo(dA.dT)15 and oligo(dG.dC)15 with the outside binding mode, accompanied by the self-stacking of the ligands along the oligonucleotide helix. The CD results demonstrated a drastic change from excitonic in monomeric behavior at higher ionic strengths, which indicates the groove binding of the ligands with oligonucleotides. Molecular docking also confirmed the groove binding mode of the ligands and estimated the binding constants and energies of the interactions. Their interaction trend was further confirmed by molecular dynamics technique and structure parameters obtained from simulation. It showed that TMAP reduced the number of intermolecular hydrogen bonds and increased the solvent accessible surface area in the oligonucleotide. The self-aggregation of ligands at lower concentrations was also confirmed.
Elastic and inelastic scattering of {sup 15}N ions by {sup 9}Be at 84 MeV
Energy Technology Data Exchange (ETDEWEB)
Rudchik, A.T., E-mail: rudchik@kinr.kiev.ua [Institute for Nuclear Research, Ukrainian Academy of Sciences, Prospect Nauki 47, 03680 Kyiv (Ukraine); Chercas, K.A. [Institute for Nuclear Research, Ukrainian Academy of Sciences, Prospect Nauki 47, 03680 Kyiv (Ukraine); Kemper, K.W. [Physics Department, Florida State University, Tallahassee, FL 32306-4350 (United States); Rusek, K. [Heavy Ion Laboratory of Warsaw University, ul. L. Pasteura 5A, PL-02-093 Warsaw (Poland); Rudchik, A.A.; Herashchenko, O.V. [Institute for Nuclear Research, Ukrainian Academy of Sciences, Prospect Nauki 47, 03680 Kyiv (Ukraine); Koshchy, E.I. [Kharkiv National University, pl. Svobody 4, 61077 Kharkiv (Ukraine); Pirnak, Val.M. [Institute for Nuclear Research, Ukrainian Academy of Sciences, Prospect Nauki 47, 03680 Kyiv (Ukraine); Piasecki, E.; Trzcińska, A. [Heavy Ion Laboratory of Warsaw University, ul. L. Pasteura 5A, PL-02-093 Warsaw (Poland); Sakuta, S.B. [Russian Research Center “Kurchatov Institute”, Kurchatov Sq. 1, 123182 Moscow (Russian Federation); Siudak, R. [H. Niewodniczański Institute of Nuclear Physics, Polish Academy of Sciences, ul. Radzikowskiego 152, PL-31-342 Cracow (Poland); Strojek, I. [National Center for Nuclear Researches, ul. Hoża 69, PL-00-681 Warsaw (Poland); Stolarz, A. [Heavy Ion Laboratory of Warsaw University, ul. L. Pasteura 5A, PL-02-093 Warsaw (Poland); Ilyin, A.P.; Ponkratenko, O.A.; Stepanenko, Yu.M.; Shyrma, Yu.O. [Institute for Nuclear Research, Ukrainian Academy of Sciences, Prospect Nauki 47, 03680 Kyiv (Ukraine); Szczurek, A. [H. Niewodniczański Institute of Nuclear Physics, Polish Academy of Sciences, ul. Radzikowskiego 152, PL-31-342 Cracow (Poland); Uleshchenko, V.V. [Institute for Nuclear Research, Ukrainian Academy of Sciences, Prospect Nauki 47, 03680 Kyiv (Ukraine)
2016-03-15
Angular distributions of the {sup 9}Be + {sup 15}N elastic and inelastic scattering were measured at E{sub lab}({sup 15}N) = 84 MeV (E{sub c.m.} = 31.5 MeV) for the 0–6.76 MeV states of {sup 9}Be and 0–6.32 MeV states of {sup 15}N. The data were analyzed within the optical model and coupled-reaction-channels method. The elastic and inelastic scattering, spin reorientations of {sup 9}Be in ground and excited states and {sup 15}N in excited states as well as the most important one- and two-step transfer reactions were included in the channels-coupling scheme. The parameters of the {sup 9}Be + {sup 15}N optical potential of Woods–Saxon form as well as deformation parameters of these nuclei were deduced. The analysis showed that the {sup 9}Be + {sup 15}N pure potential elastic scattering dominates at the forward angles whereas the ground state spin reorientation of {sup 9}Be gives a major contribution to the elastic scattering cross sections at the large angles. Contributions from particle transfers are found to be negligible for the present scattering system.
DEFF Research Database (Denmark)
Jensen, E.S.
1997-01-01
The immobilization and mineralization of N following plant residue incorporation were studied in a sandy loam soil using N-15-labelled field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) straw. Both crop residues caused a net immobilization of soil-derived inorganic N during...... the complete incubation period of 84 days. The maximum rate of N immobilization was found to 12 and 18 mg soil-derived N g(-1) added C after incorporation of pea and barley residues, respectively. After 7 days of incubation, 21% of the pea and 17% of the barley residue N were assimilated by the soil microbial...... the decomposition of the barley residue. The net mineralization of residue-derived N was 2% in the barley and 22% in the pea residue treatment after 84 days of incubation. The results demonstrated that even if crop residues have a relative low C/N ratio (15), transient immobilization of soil N in the microbial...
Synthesis and NMR of {sup 15}N-labeled DNA fragments
Energy Technology Data Exchange (ETDEWEB)
Jones, R.A. [Rutgers, The State Univ. of New Jersey, Piscataway, NJ (United States)
1994-12-01
DNA fragments labeled with {sup 15}N at the ring nitrogens and at the exocyclic amino groups can be used to obtain novel insight into interactions such as base pairing, hydration, drug binding, and protein binding. A number of synthetic routes to {sup 15}N-labeled pyrimidine nucleosides, purines, and purine nucleosides have been reported. Moreover, many of these labeled bases or monomers have been incorporated into nucleic acids, either by chemical synthesis or by biosynthetic procedures. The focus of this chapter will be on the preparation of {sup 15}N-labeled purine 2{prime}-deoxynucleosides, their incorporation into DNA fragments by chemical synthesis, and the results of NMR studies using these labeled DNA fragments.
Energy Technology Data Exchange (ETDEWEB)
Iwahara, Junji; Clore, G. Marius [National Institutes of Health, Laboratory of Chemical Physics, Building 5, National Institute of Diabetes and Digestive and Kidney Disease (United States)], E-mail: mariusc@intra.niddk.nih.gov
2006-12-15
Due to practical limitations in available {sup 15}N rf field strength, imperfections in {sup 15}N 180{sup o} pulses arising from off-resonance effects can result in significant sensitivity loss, even if the chemical shift offset is relatively small. Indeed, in multi-dimensional NMR experiments optimized for protein backbone amide groups, cross-peaks arising from the Arg guanidino {sup 15}N{epsilon} ({approx}85 ppm) are highly attenuated by the presence of multiple INEPT transfer steps. To improve the sensitivity for correlations involving Arg N{epsilon}-H{epsilon} groups, we have incorporated {sup 15}N broadband 180 deg. pulses into 3D {sup 15}N-separated NOE-HSQC and HNCACB experiments. Two {sup 15}N-WURST pulses incorporated at the INEPT transfer steps of the 3D {sup 15}N-separated NOE-HSQC pulse sequence resulted in a {approx}1.5-fold increase in sensitivity for the Arg N{epsilon}-H{epsilon} signals at 800 MHz. For the 3D HNCACB experiment, five {sup 15}N Abramovich-Vega pulses were incorporated for broadband inversion and refocusing, and the sensitivity of Arg{sup 1}H{epsilon}-{sup 15}N{epsilon}-{sup 13}C{gamma}/{sup 13}C{delta} correlation peaks was enhanced by a factor of {approx}1.7 at 500 MHz. These experiments eliminate the necessity for additional experiments to assign Arg {sup 1}H{epsilon} and {sup 15}N{epsilon} resonances. In addition, the increased sensitivity afforded for the detection of NOE cross-peaks involving correlations with the {sup 15}N{epsilon}/{sup 1}H{epsilon} of Arg in 3D {sup 15}N-separated NOE experiments should prove to be very useful for structural analysis of interactions involving Arg side-chains.
International Nuclear Information System (INIS)
Tumba, Kaniki; Letcher, Trevor M.; Naidoo, Paramespri; Ramjugernath, Deresh
2013-01-01
Highlights: • Activity coefficients at infinite dilution measured in the ionic liquid [3C 6 C 14 P][BTI]. • 22 solutes investigated at T = (313.15, 333.15, 353.15, 373.15) K using glc. • Selectivities and capacities for selected separations compared to other IL’s and solvents. -- Abstract: Activity coefficients at infinite dilution for organic solutes, which include n-alkanes, alk-1-enes, alk-1-ynes, cycloalkanes, alkylbenzenes, alcohols and ketones, in the ionic liquid trihexyltetradecylphosphonium bis (trifluoromethylsulfonyl) imide were measured by gas–liquid chromatography using the latter as the stationary phase. This ionic liquid had previously been studied and reported in literature; however due to significant discrepancies in the reported infinite activity coefficient values, there was justification for further study and reporting. The temperature range investigated in this study is significantly wider and at higher temperatures than presented previously in the literature. From the experimental infinite dilution activity coefficient data at the four different temperatures T = (313.15, 333.15, 353.15 and 373.15) K, partial molar excess enthalpies at infinite dilution were calculated. Values of the selectivity for hexane/benzene and methanol/benzene separations were determined from experimental values of the activity coefficients at infinite dilution and these results were compared to literature values for other ionic liquids, as well as for industrial solvents. The capacities were also determined as it gives an indication of the solvent extraction behavior of the ionic liquid
26 CFR 1.381(c)(15)-1 - Indebtedness of certain personal holding companies.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Indebtedness of certain personal holding companies. 1.381(c)(15)-1 Section 1.381(c)(15)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(15...
Energy Technology Data Exchange (ETDEWEB)
Pahle, T; Koehler, R; Souffrant, W B; Gebhardt, G [Karl-Marx-Universitaet, Leipzig (German Democratic Republic). Sektion Tierproduktion und Veterinaermedizin; Matkowitz, R; Hartig, W [Bezirkskrankenhaus Leipzig (German Democratic Republic). Chirurgische Klinik
1983-01-01
Two female pigs (25 kg live weight) received a continuous infusion of /sup 15/N-glycine and /sup 15/N-lysine solutions, resp., for 45 h and for further 72 h unlabelled amino acid solutions. The main protein and energy sources, however, were administered orally. The time course of the /sup 15/N level and the differential urinary N excretion were determined from blood urea and urine. For the demonstration of synthesis and decay rates of the total body protein a mathematical model has been developed. The suitability of /sup 15/N-lysine and /sup 15/N-glycine for the determination of N metabolism parameters is discussed.
Comparison of unenriched versus 15N-enriched fertilizer as a tracer for N fertilizer uptake
International Nuclear Information System (INIS)
Meints, V.W.; Shearer, G.; Kohl, D.H.; Kurtz, L.T.
1975-01-01
A greenhouse experiment was conducted on three soils with differing cropping and fertilization histories to determine whether unenriched fertilizer N can be used in the same manner as 15 N-enriched fertilizer to estimate the amount of plant N derived from fertilizer. Estimates using unenriched fertilizer N were compared with estimates using two 15 N enrichment levels. Use of unenriched fertilizer N led to underestimation of the amount of fertilizer N in the plant material in four of six cases when compared to 15 N-enriched fertilizer. Standard deviations of the estimates of fertilizer-derived N in plant material were considerably greater when unenriched fertilizer was used. (U.S.)
Deuterium and 15N fractionation in N2H+ during the formation of a Sun-like star
De Simone, M.; Fontani, F.; Codella, C.; Ceccarelli, C.; Lefloch, B.; Bachiller, R.; López-Sepulcre, A.; Caux, E.; Vastel, C.; Soldateschi, J.
2018-05-01
Although chemical models predict that the deuterium fractionation in N2H+ is a good evolutionary tracer in the star formation process, the fractionation of nitrogen is still a poorly understood process. Recent models have questioned the similar evolutionary trend expected for the two fractionation mechanisms in N2H+, based on a classical scenario in which ion-neutral reactions occurring in cold gas should have caused an enhancement of the abundance of N2D+, 15NNH+, and N15NH+. In the framework of the ASAI IRAM-30m large program, we have investigated the fractionation of deuterium and 15N in N2H+ in the best known representatives of the different evolutionary stages of the Sun-like star formation process. The goal is to ultimately confirm (or deny) the classical `ion-neutral reactions' scenario that predicts a similar trend for D and 15N fractionation. We do not find any evolutionary trend of the 14N/15N ratio from both the 15NNH+ and N15NH+ isotopologues. Therefore, our findings confirm that, during the formation of a Sun-like star, the core evolution is irrelevant in the fractionation of 15N. The independence of the 14N/15N ratio with time, found also in high-mass star-forming cores, indicates that the enrichment in 15N revealed in comets and protoplanetary discs is unlikely to happen at core scales. Nevertheless, we have firmly confirmed the evolutionary trend expected for the H/D ratio, with the N2H+/N2D+ ratio decreasing before the pre-stellar core phase, and increasing monotonically during the protostellar phase. We have also confirmed clearly that the two fractionation mechanisms are not related.
A 15N study on dietary urea utility in young pigs fed with a low protein diet
International Nuclear Information System (INIS)
Niiyama, Masayoshi; Kagota, Katsumoto; Iwase, Toshio; Namioka, Shigeo
1978-01-01
To investigate effect of a low protein diet on urea utilization, a tracer study was conducted with 15 N-urea on pigs fed a low protein diet (DCP 5.7%) with 2% urea (group B), and on pigs fed and optimal protein diet (DCP 13.3%) with 2% urea (group A). 15 N was incorporated into protein of liver, serum and muscle, which were obtained 8 days after the last administration of 15 N-urea. The 15 N incorporation rate into the tissue protein tended to be higher in group B than in group A. Approximately 70% of 15 N, however, was excreted into urine within 48 hours in group B. A comparison was made on growth and urea level in blood and urine to evaluate efficacy of the administered urea on growth between group B pigs and pigs fed the same low protein diet without urea supplementation (group C). Since group B pigs always maintained a higher level of blood urea, they were considered to have had more ammonia nitrogen which was available for protein synthesis than group C animals. A similar amount of urea to ingested dose, however, was excessively eliminated in urine. The increased ammonia nitrogen by urea ingestion may be excreted in form of urinary urea in group B pigs. There was no difference in growth between group B and group C animals; therefore, poor efficacy of administered urea on growth may have resulted not only from its loss into urine in early stage after ingestion, but also to poor utility of ammonia for protein synthesis. (author)
Díaz, Francisca P.; Frugone, Matías; Gutiérrez, Rodrigo A.; Latorre, Claudio
2016-03-01
Climate controls on the nitrogen cycle are suggested by the negative correlation between precipitation and δ15N values across different ecosystems. For arid ecosystems this is unclear, as water limitation among other factors can confound this relationship. We measured herbivore feces, foliar and soil δ15N and δ13C values and chemically characterized soils (pH and elemental composition) along an elevational/climatic gradient in the Atacama Desert, northern Chile. Although very positive δ15N values span the entire gradient, soil δ15N values show a positive correlation with aridity as expected. In contrast, foliar δ15N values and herbivore feces show a hump-shaped relationship with elevation, suggesting that plants are using a different N source, possibly of biotic origin. Thus at the extreme limits of plant life, biotic interactions may be just as important as abiotic processes, such as climate in explaining ecosystem δ15N values.
Díaz, Francisca P; Frugone, Matías; Gutiérrez, Rodrigo A; Latorre, Claudio
2016-03-09
Climate controls on the nitrogen cycle are suggested by the negative correlation between precipitation and δ(15)N values across different ecosystems. For arid ecosystems this is unclear, as water limitation among other factors can confound this relationship. We measured herbivore feces, foliar and soil δ(15)N and δ(13)C values and chemically characterized soils (pH and elemental composition) along an elevational/climatic gradient in the Atacama Desert, northern Chile. Although very positive δ(15)N values span the entire gradient, soil δ(15)N values show a positive correlation with aridity as expected. In contrast, foliar δ(15)N values and herbivore feces show a hump-shaped relationship with elevation, suggesting that plants are using a different N source, possibly of biotic origin. Thus at the extreme limits of plant life, biotic interactions may be just as important as abiotic processes, such as climate in explaining ecosystem δ(15)N values.
International Nuclear Information System (INIS)
Inoue, A.; Masumoto, T.
1984-01-01
The effect of cold rolling on the superconducting properties was examined for amorphous Nb 50 Zr 35 Si 15 and Nb 70 Zr 15 Si 15 superconductors. Cold rolling to 10 to 20% reduction in thickness results in a rise of superconducting transition temperature (Tsub(c)) and a decrease in transition width (ΔTsub(c)), upper critical field gradient near Tsub(c) [dHsub(c2)/dT)sub(Tsub(c)], critical current density [Jsub(c)(H)] and normal electrical resistivity (rhosub(n)). Changes of about 7% for Tsub(c), 33% for ΔTsub(c), 12% for -(dHsub(c2)/dT)sub(Tsub(c) and 70% for Jsub(c)(H) are found. The rise of Tsub(c) upon cold rolling was considered to originate from the increase in the electron-phonon coupling constant (lambda) due to an increase in the electronic density of states at the Fermi level [N(Esub(f))] and a decrease in the phonon frequency (ω), while the decreases in ΔTsub(c), Jsub(c)(H) and rhosub(n) were attributed to the decrease in fluxoid pinning force due to an increase in homogeneity in the amorphous structure. From the results described above, the following two conclusions were derived: (a) cold rolling causes changes in electronic and phonon-states in the quenched amorphous phase, and (b) deformation upon cold rolling occurs not only in the coarse deformation bands observable by optical microscopy, but also on a much finer scale comparable to the coherence length (approx. = 7.7 nm). (author)
Energy Technology Data Exchange (ETDEWEB)
Roy, Rabindra N. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States)]. E-mail: rroy@drury.edu; Roy, Lakshmi N. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); LeNoue, Sean R. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Denton, Cole E. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Simon, Ashley N. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Richards, Sarah J. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Moore, Andrew C. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Roy, Chandra N. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Redmond, R. Ryan [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Bryant, Paul A. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States)
2006-04-15
Values of the second thermodynamic dissociation constant pK{sub 2} of N-[tris(hydroxymethyl)methyl-3-amino]propanesulfonic acid (Taps) have been determined at twelve temperatures from 278.15 K to 328.15 K including 310.15 K by measurements of the electromotive-force for cells without liquid junction of the type: Pt|H{sub 2} (g, p{sup -}bar =101.325 kPa)|Taps (m{sub 1}), NaTapsate (m{sub 2}), NaCl (m{sub 3})|AgCl|Ag, where m denotes molality. The pK{sub 2} values for the dissociation of Taps are represented by the equation: pK{sub 2}=2969.61.(K/T) - 17.05052+2.73697.ln(T/K). The values of pK{sub 2} for Taps were found to be (8.502+/-0.0007) at T=298.15 K and (8.225+/-0.0009) at T=310.15 K, respectively, indicating thereby to be useful as buffer solutions for pH control in the region 7.4 to 8.5. The thermodynamic quantities, {delta}G{sup -}bar , {delta}H{sup -}bar , {delta}S{sup -}bar , and {delta}C{sub p}{sup -}bar dissociation process of Taps have been derived from the temperature coefficients of the pK{sub 2}.
15N in biological nitrogen fixation studies
International Nuclear Information System (INIS)
Faust, H.
1986-05-01
A bibliography with 298 references on the use of the stable nitrogen isotope 15 N in the research on the biological fixation of dinitrogen is presented. The literature pertaining to this bibliography covers the period from 1975 to the middle of 1985. (author)
Baker, D. M.; Kim, K.; Andras, J. P.; Sparks, J. P.
2011-09-01
The stable nitrogen isotope ratio ( δ 15N) of coral tissue is a useful recorder of anthropogenic pollution in tropical marine ecosystems. However, little is known of the natural environmentally induced fractionations that affect our interpretation of coral δ 15N values. In symbiotic scleractinians, light affects metabolic fractionation of N during photosynthesis, which may confound the identification of N pollution between sites of varied depth or turbidity. Given the superiority of octocorals for δ 15N studies, our goal was to quantify the effect of light on gorgonian δ 15N in the context of monitoring N pollution sources. Using field collections, we show that δ 15N declined by 1.4‰ over 20 m depth in two species of gorgonians, the common sea fan, Gorgonia ventalina, and the slimy sea plume, Pseudopterogorgia americana. An 8-week laboratory experiment with P. americana showed that light, not temperature causes this variation, whereby the lowest fractionation of the N source was observed in the highest light treatment. Finally, we used a yearlong reciprocal depth transplant experiment to quantify the time frame over which δ 15N changes in G. ventalina as a function of light regime . Over the year, δ 15N was unchanged and increased slightly in the deep control colonies and shallow colonies transplanted to the deep site, respectively. Within 6 months, colonies transplanted from deep to shallow became enriched by 0.8‰, mirroring the enrichment observed in the shallow controls, which was likely due to the combined effect of an increase in the source δ 15N and reduced fractionation. We conclude that light affects gorgonian δ 15N fractionation and should be considered in sampling designs for N pollution monitoring. However, these fractionations are small relative to differences observed between natural and anthropogenic N sources.
Use of low enriched 15N2 for symbiotic fixation tests
International Nuclear Information System (INIS)
Victoria, R.L.
1975-01-01
Gaseous atmospheres containing 15 N 2 with low enrichment were used to test symbiotic nitrogen fixation in beans (Phaseolus vulgari, L.). The tests of fixation in nodulated roots and the tests of fixation in the whole plant, in which the plants were placed inside a specially constructed growth chamber, gave positive results and suggest that the methodology used can be very helpfull in more detailed studies on symbiotic fixation. Samples of atmospheric air were purified by absorption of O 2 and CO 2 by two methods. The purified N 2 obtained was analysed and the results were compared. Samples of bean plant material were collected in natural conditions and analysed for 15 N natural variation. Several samples were prepared for 15 N isotopic analysis by two methods. The results obtained were compared. All samples were analysed in an Atlas-Varian Ch-4 model mass spectrometer, and the results were given in delta 15 N 0 / 00 variation in relation to a standard gas
Rescattering in the nucleus for π-d interactions at 15 GeV/c
International Nuclear Information System (INIS)
Porter, F.C.; Bingham, H.H.; Fretter, W.B.; Graves, W.R.; Yost, G.P.; Dunn, L.A.; Lubatti, H.J.; Moriyasu, K.
1980-01-01
We present the π - d charged multiplicity distributions at 15 GeV/c and examine the probability that the products of a π - n collision in a deuterium nucleus rescatter on the proton. Averaged over all topologies, this probability is 0.13 +- 0.02. The rescatter probability as a function of the number of charged particles produced in the π - n interaction exhibits an increase at high multiplicity
DEFF Research Database (Denmark)
Skøt, Leif
1983-01-01
for N2 reduction, is often stated as the relative efficiency (1-H2/C2H2). This factor varied significantly (P 2 and N2, expressed as the H2/N2 ratio, was independent of plant age, however. This discrepancy and the observation......The quantitative relationship between C2H2 reduction, H2 evolution and 15N2 fixation was investigated in excised root nodules from pea plants (Pisum sativum L. cv. Bodil) grown under controlled conditions. The C2H2/N2 conversion factor varied from 3.31 to 5.12 between the 32nd and the 67th day...... after planting. After correction for H2 evolution in air, the factor (C2H2-H2)/N2 decreased to values near the theoretical value 3, or in one case to a value significantly (P 2 production but used...
Studies on the N mineralization behavior of various plants in soil by means of 15N tracers
International Nuclear Information System (INIS)
Schulz, E.
1986-01-01
Nitrogen mineralization of different 15 N-labelled plant matter in three soils with different C/sub t/ content was investigated in an incubation experiment (54 days, 25 0 C, 60% maximum water capacity) in the laboratory. Plant matter decomposition was most intensive at the start of the incubation experiment. Between 19 and 29% of the plant nitrogen was mineralized after three days. This seems to be due to an intensified internal nitrogen cycling. The dynamics of the further N mineralization process depends largely on the C:N ratio of the organic primary matter. The critical C:N ratio was found to be about 21. A close correlation exists between the immobilization of released nitrogen and the C/sub t/ content of the soil. (author)
Separation of 15N by isotopic exchange in NO, NO2-HNO3 system under pressure
International Nuclear Information System (INIS)
Axente, D.; Baldea, A.; Teaca, C.; Horga, R.; Abrudean, M.
1998-01-01
One of the most used method for production of 15 N with 99% at. concentration is the isotopic exchange between gaseous nitrogen oxides and HNO 3 solution 10M: ( 15 NO, 15 NO 2 ) g + H 14 NO 3,l = ( 14 NO, 14 NO 2 ) g + H 15 NO 3,l . The isotopic exchange is characterized by an elemental separation factor α=1.055 at 25 deg. C and atmospheric pressure. Recently, kinetics data pointed to the linear dependence of the exchange rate 15 N/ 14 N(R) on the nitrogen oxide pressure with a rate law R = k[HNO 3 ] 2 · [N 2 O 3 ]. In this work, the influence of the nitrogen oxide pressure on the 15 N separation efficiency was determined by the use of a laboratory equipment with a separation column pack of Helipack type, with dimensions 1.8 mm x 1.8 mm x 0.2 mm. The increase of nitrogen oxide pressure led to a better isotopic transfer between the two counter-flow phases in the column pack. The HETP (Height Equivalent to a Theoretical Plate) determined for a 3.14 ml ·cm -2 · min -1 load is equal to that obtained at atmospheric pressure for a two times lower load. The operation of the equipment for isotopic separation of 15 N at 1.8 atm instead of atmospheric pressure allows doubling the HNO 3 10 M load of the column and consequently, doubling the production rate. A better performance of the separation process at higher pressure is essential for the industrial production of 15 N isotope which is used for the production of uranium nitride in FBR type reactors. (authors)
Liver function tests using the stable isotope /sup 15/N
Energy Technology Data Exchange (ETDEWEB)
Faust, H; Jung, K; Hirschberg, K; Krumbiegel, P; Junghans, P; Reinhardt, R; Matkowitz, R; Teichmann, B
1988-01-01
Several liver function tests using oral application of a nitrogen compound labelled with /sup 15/N and the subsequent determination of /sup 15/N in a certain fraction of urine or in the total urine by emission spectrometry are described. Because of the key function of the liver in the metabolism of nitrogen compounds, the results of these tests allow conclusions concerning some disturbances of liver functions.
Impact of seaweed beachings on dynamics of δ15N isotopic signatures in marine macroalgae
International Nuclear Information System (INIS)
Lemesle, Stéphanie; Mussio, Isabelle; Rusig, Anne-Marie; Menet-Nédélec, Florence; Claquin, Pascal
2015-01-01
Highlights: • Two coastal sites (COU, GM) in the Bay of Seine affected by summer seaweed beachings. • The same temporal dynamics of the algal δ 15 N at the two sites. • N and P concentrations in seawater of the two sites dominated by riverine sources. • A coupling between seaweed beachings and N sources of intertidal macroalgae. - Abstract: A fine-scale survey of δ 15 N, δ 13 C, tissue-N in seaweeds was conducted using samples from 17 sampling points at two sites (Grandcamp-Maisy (GM), Courseulles/Mer (COU)) along the French coast of the English Channel in 2012 and 2013. Partial triadic analysis was performed on the parameter data sets and revealed the functioning of three areas: one estuary (EstA) and two rocky areas (GM ∗ , COU ∗ ). In contrast to oceanic and anthropogenic reference points similar temporal dynamics characterized δ 15 N signatures and N contents at GM ∗ and COU ∗ . Nutrient dynamics were similar: the N-concentrations in seawater originated from the River Seine and local coastal rivers while P-concentrations mainly from these local rivers. δ 15 N at GM ∗ were linked to turbidity suggesting inputs of autochthonous organic matter from large-scale summer seaweed beachings made up of a mixture of Rhodophyta, Phaeophyta and Chlorophyta species. This study highlights the coupling between seaweed beachings and nitrogen sources of intertidal macroalgae
Fertilizer 15N balance and recovery of N from organic sources by rice in Typic Ustochrept
International Nuclear Information System (INIS)
Bhattacharyya, Ranjan; Sachdev, M.S.; Sachdev, P.; Kundu, S.; Sutradhar, G.
2002-01-01
To investigate the fertilizer-N balance and recovery of N from organics (as determined by A-value technique) by rice as affected by urea application alone or in combination with FYM or green manure, a field experiment was conducted in the khariff season if 1997 at IARI, New Delhi on a sandy loam soil (Typic Ustochrept). 15 N-labelled urea was applied at 0.90 and 120 kg N ha -1 levels alone and in combination with either FYM or green manure in 2:1 or 1:1 ratios. Organic sources were incorporated seven days before transplanting whereas, urea was applied in three equal splits at 15 DAT, 28 DAT and 42 DAT. The residual 15 N in soil was determined only in the surface soil layer (0-15 cm) of rice crop. The combined source helped in conserving more of urea-N in soil as residual (42-45%) than urea alone (23-27%) treatment due to the fact that the unaccounted fertilizer 15 N was more in urea alone treatment (43-45%) than combined sources (12-15%) at both the levels. The efficiency of uptake of organic N by rice as determined through A-value technique was similar or better than urea-N at both the levels. (author)
Isotopic enrichment of 15N by ionic exchange chromatography
International Nuclear Information System (INIS)
Trivelin, P.C.O.
1979-01-01
The present paper presents some studies on production of 15 N-enriched ammonium sulphate with 5% atoms by ionic exchange chromatography method. Two systems are described of columns of resin, where experiments were conducted by eluition of NH 4 + bands with sodium hydroxide solution. Analyses were made of the cost of production of 15 N-enriched ammonium sulphate 5% atoms and, based on the experiments developed, a cost was obtained which was compatible with the international price of the product. The isotopic analyses of nitrogen were made by mass spectrometry. (Author) [pt
Cross sections and analyzing powers of 15N(p,n)15O at 200 MeV and 494 MeV
International Nuclear Information System (INIS)
Ciskowski, D.E.
1989-11-01
Differential cross sections and analyzing powers have been measured for the 15 N(p,n) 15 O(g.s.) reaction at bombarding energies of 200 MeV and 494 MeV. The 494 MeV data were obtained at the LAMPF Neutron Time-Of-Flight Facility on an 82 m flight path with a resolution of about 2.7 MeV. The 200 MeV data were obtained at IUCF on a 76m flight path with a resolution of about 1.1 MeV. At both energies, the measured analyzing power is small, the magnitude is less than .2 for momentum transfers of less than 1 fm -1 . In contrast, both Relativistic and standard DWIA calculations predict a maximum of A=-.7 near q=0.7 fm -1 . 53 refs., 44 figs
Neutron scattering from 12C between 15.6 and 17.3 MeV
International Nuclear Information System (INIS)
Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L.
1993-01-01
The differential cross section σ(θ) for neutron elastic scattering from 12 C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The σ(θ) data, together with published analysing power A y (θ) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present 12 C(n,n) 12 C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in 11 C via an iterative-moment approach or a dispersive optical-model analysis. (author)
Investigation of the metabolism of colostomized laying hens with 15N-labelled wheat. 5
International Nuclear Information System (INIS)
Gruhn, K.
1980-01-01
In an experiment with 3 colostomized laying hybrids each animal received 80 g pelleted mixed feed and 40 g 15 N-labelled wheat with 20.13 atom-% 15 N excess ( 15 N') over a period of four days. On the following four days the hens received rations composed in the same way with unlabelled wheat, however in the tissues and organs of the slaughtered hens 15 N' was determined in the total N and the amino acids lysine, histidine and arginine in both the segments of the gastro intestinal tract and in its content. The amount of 15 N' stomach, small intestine and colon was 43.7%, 27.2% and 29.1%, respectively. The tissue of the small intestine contained, on an average, the highest 15 N' in lysine of all the basic amino acids. It was 0.82 atom-% 15 N' for lysine, 0.55% for histidine and 0.63% for arginine. The percentage of the 15 N' of the basic amino acids from the corresponding total 15 N' amount of the charges was 20.5% in the contents of the gastrointestinal tract, 28.0% in the stomach tissue and in the tissues of the small intestine 24.4% of the cecum 21.5% and of the rectum 25.7%. (author)
Modified micro-diffusion method for 15N-enriched soil solutions
International Nuclear Information System (INIS)
Aigner, M.
2000-01-01
The preparation of solutions for determination of 15 N/ 14 N isotope ratios is described, with special reference to dilute samples. A micro-diffusion method has been simplified to be more suitable for rapid isotope-ratio determination in soil solutions collected in tensionics. Ammonia expelled during micro-diffusion is captured on acidified filter discs fixed to the caps of gas-tight vials. The discs are transferred to tin capsules for shipment to the Soil Science Unit for 15 N-enrichment determination. (author)
Spencer, Brady L; Shenoy, Anukul T; Orihuela, Carlos J; Nahm, Moon H
2017-08-01
As a species, Streptococcus pneumoniae (the pneumococcus) utilizes a diverse array of capsular polysaccharides to evade the host. In contrast to large variations in sugar composition and linkage formation, O-acetylation is a subtle capsular modification that nonetheless has a large impact on capsular shielding and recognition of the capsule by vaccine-elicited antibodies. Serotype 15B, which is included in the 23-valent pneumococcal polysaccharide vaccine (PPV23), carries the putative O-acetyltransferase gene wciZ The coding sequence of wciZ contains eight consecutive TA repeats [(TA) 8 ]. Replication slippage is thought to result in the addition or loss of TA repeats, subsequently causing frameshift and truncation of WciZ to yield a nonacetylated serotype, 15C. Using sensitive serological tools, we show that serotype 15C isolates whose wciZ contains seven or nine TA repeats retain partial O-acetylation, while serotype 15C isolates whose wciZ contains six TA repeats have barely detectable O-acetylation. We confirmed by inhibition enzyme-linked immunosorbent assay that (TA) 7 serotype 15C is ∼0.1% as acetylated as serotype 15B, while serotype 15X is nonacetylated. To eliminate the impact of genetic background, we created isogenic serotype 15B, (TA) 7 serotype 15C, and 15BΔ wciZ (15X) strains and found that reduction or absence of WciZ-mediated O-acetylation did not affect capsular shielding from phagocytes, biofilm formation, adhesion to nasopharyngeal cells, desiccation tolerance, or murine colonization. Sera from PPV23-immunized persons opsonized serotype 15B significantly but only slightly better than serotypes 15C and 15X; thus, PPV23 may not result in expansion of serotype 15C. Copyright © 2017 American Society for Microbiology.
Extreme heat waves under 1.5 °C and 2 °C global warming
Dosio, Alessandro; Mentaschi, Lorenzo; Fischer, Erich M.; Wyser, Klaus
2018-05-01
Severe, extreme, and exceptional heat waves, such as those that occurred over the Balkans (2007), France (2003), or Russia (2010), are associated with increased mortality, human discomfort and reduced labour productivity. Based on the results of a very high-resolution global model, we show that, even at 1.5 °C warming, a significant increase in heat wave magnitude is expected over Africa, South America, and Southeast Asia. Compared to a 1.5 °C world, under 2 °C warming the frequency of extreme heat waves would double over most of the globe. In a 1.5 °C world, 13.8% of the world population will be exposed to severe heat waves at least once every 5 years. This fraction becomes nearly three times larger (36.9%) under 2 °C warming, i.e. a difference of around 1.7 billion people. Limiting global warming to 1.5 °C will also result in around 420 million fewer people being frequently exposed to extreme heat waves, and ~65 million to exceptional heat waves. Nearly 700 million people (9.0% of world population) will be exposed to extreme heat waves at least once every 20 years in a 1.5 °C world, but more than 2 billion people (28.2%) in a 2 °C world. With current emission trends threatening even the 2 °C target, our study is helpful to identify regions where limiting the warming to 1.5 °C would have the strongest benefits in reducing population exposure to extreme heat.
Dos, Alexandra; Schimming, Volkmar; Tosoni, Sergio; Limbach, Hans-Heinrich
2008-12-11
The interactions of the 15N-labeled amino groups of dry solid poly-L-lysine (PLL) with various halogen and oxygen acids HX and the relation to the secondary structure have been studied using solid-state 15N and 13C CPMAS NMR spectroscopy (CP = cross polarization and MAS = magic angle spinning). For comparison, 15N NMR spectra of an aqueous solution of PLL were measured as a function of pH. In order to understand the effects of protonation and hydration on the 15N chemical shifts of the amino groups, DFT and chemical shielding calculations were performed on isolated methylamine-acid complexes and on periodic halide clusters of the type (CH3NH3(+)X(-))n. The combined experimental and computational results reveal low-field shifts of the amino nitrogens upon interaction with the oxygen acids HX = HF, H2SO4, CH3COOH, (CH3)2POOH, H3PO4, HNO3, and internal carbamic acid formed by reaction of the amino groups with gaseous CO2. Evidence is obtained that only hydrogen-bonded species of the type (Lys-NH2***H-X)n are formed in the absence of water. 15N chemical shifts are maximum when H is located in the hydrogen bond center and then decrease again upon full protonation, as found for aqueous solution at low pH. By contrast, halogen acids interact in a different way. They form internal salts of the type (Lys-NH3(+)X(-))n via the interaction of many acid-base pairs. This salt formation is possible only in the beta-sheet conformation. By contrast, the formation of hydrogen-bonded complexes can occur both in beta-sheet domains as well as in alpha-helical domains. The 15N chemical shifts of the protonated ammonium groups increase when the size of the interacting halogen anions is increased from chloride to iodide and when the number of the interacting anions is increased. Thus, the observed high-field 15N shift of ammonium groups upon hydration is the consequence of replacing interacting halogen atoms by oxygen atoms.
/sup 15/N study on dietary urea utility in young pigs fed with a low protein diet
Energy Technology Data Exchange (ETDEWEB)
Niiyama, M; Kagota, K; Iwase, T; Namioka, S [Hokkaido Univ., Sapporo (Japan)
1978-10-01
To investigate effect of a low protein diet on urea utilization, a tracer study was conducted with /sup 15/N-urea on pigs fed a low protein diet (DCP 5.7%) with 2% urea (group B), and on pigs fed and optimal protein diet (DCP 13.3%) with 2% urea (group A). /sup 15/N was incorporated into protein of liver, serum and muscle, which were obtained 8 days after the last administration of /sup 15/N-urea. The /sup 15/N incorporation rate into the tissue protein tended to be higher in group B than in group A. Approximately 70% of /sup 15/N, however, was excreted into urine within 48 hours in group B. A comparison was made on growth and urea level in blood and urine to evaluate efficacy of the administered urea on growth between group B pigs and pigs fed the same low protein diet without urea supplementation (group C). Since group B pigs always maintained a higher level of blood urea, they were considered to have had more ammonia nitrogen which was available for protein synthesis than group C animals. A similar amount of urea to ingested dose, however, was excessively eliminated in urine. The increased ammonia nitrogen by urea ingestion may be excreted in form of urinary urea in group B pigs. There was no difference in growth between group B and group C animals; therefore, poor efficacy of administered urea on growth may have resulted not only from its loss into urine in early stage after ingestion, but also to poor utility of ammonia for protein synthesis.
Reaction π-p→X deg n, X deg → 2γ at momenta 15 and 40 GeV/c
International Nuclear Information System (INIS)
Apel, W.D.; Bertolucci, E; Donskov, S.V.
1974-01-01
The cross sections for reaction π - p→X deg n with X deg → 2γ decay have been measured at momenta 15 and 40 GeV/c. About 500 events have been detected. A hodoscope spectrometer with the computer on-line was used to detect photon pairs. t-dependence of differential cross section has been obtained similar to that of reaction π - p→eta deg n. From the ratio of differential cross section for X deg and eta deg production at t=0 an angle of the singlet-octet mixing of pseudoscalar mesons has been found to be equal to β=-19 deg
17 CFR 240.15c1-8 - Sales at the market.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales at the market. 240.15c1... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-8 Sales at the market... securities exchange that such security is being offered to such customer “at the market” or at a price...
Quantification Of 15N Internal Transformation To Assess Nitrogen Supply Capacity In Deforested Soil
International Nuclear Information System (INIS)
Handayani, I.P.; Prawito, P.; Sisworo, E.L.
2002-01-01
Quantification of deforested soil's capacity to supply available N via mineralization and immobilization using 15N pool dilution is crucial to make fertilizer recommendation. The objective of this research was to measure the soil's capacity to minemlize and ilmnobilize N, so that the actual value of available N released by soil can be predicted. The results showed that Imperata grassland released the highest available N (amonium + nitrate) about 33.93 mg/kg/d and can immobilize 11.68 mg/kg/d of N. On the other hand, agriculture lields had the lowest inorganic N by nearly 23.15 mg/kg/d, and no immobilization occurred. The implication is that agriculture fields have a very low labile and stabile pool N (nearly 0), while Imperata grassland have capacity to store more pool N into labile or stabil pool (about 34%). In conclusion, dynamics of N cycling in ecosystem are dependent upon the content of pool C-N utilized by microorganisms and plants
Perakis, Steven S.; Compton, J.E.; Hedin, L.O.
2005-01-01
Accelerated nitrogen (N) inputs can drive nonlinear changes in N cycling, retention, and loss in forest ecosystems. Nitrogen processing in soils is critical to understanding these changes, since soils typically are the largest N sink in forests. To elucidate soil mechanisms that underlie shifts in N cycling across a wide gradient of N supply, we added 15NH415NO3 at nine treatment levels ranging in geometric sequence from 0.2 kg to 640 kg NA? ha-1A? yr-1 to an unpolluted old-growth temperate forest in southern Chile. We recovered roughly half of tracers in 0-25 cm of soil, primarily in the surface 10 cm. Low to moderate rates of N supply failed to stimulate N leaching, which suggests that most unrecovered 15N was transferred from soils to unmeasured sinks above ground. However, soil solution losses of nitrate increased sharply at inputs > 160 kg NA? ha-1A? yr-1, corresponding to a threshold of elevated soil N availability and declining 15N retention in soil. Soil organic matter (15N in soils at the highest N inputs and may explain a substantial fraction of the 'missing N' often reported in studies of fates of N inputs to forests. Contrary to expectations, N additions did not stimulate gross N cycling, potential nitrification, or ammonium oxidizer populations. Our results indicate that the nonlinearity in N retention and loss resulted directly from excessive N supply relative to sinks, independent of plant-soil-microbial feedbacks. However, N additions did induce a sharp decrease in microbial biomass C:N that is predicted by N saturation theory, and which could increase long-term N storage in soil organic matter by lowering the critical C:N ratio for net N mineralization. All measured sinks accumulated 15N tracers across the full gradient of N supply, suggesting that short-term nonlinearity in N retention resulted from saturation of uptake kinetics, not uptake capacity, in plant, soil, and microbial pools.
Impact of seaweed beachings on dynamics of δ(15)N isotopic signatures in marine macroalgae.
Lemesle, Stéphanie; Mussio, Isabelle; Rusig, Anne-Marie; Menet-Nédélec, Florence; Claquin, Pascal
2015-08-15
A fine-scale survey of δ(15)N, δ(13)C, tissue-N in seaweeds was conducted using samples from 17 sampling points at two sites (Grandcamp-Maisy (GM), Courseulles/Mer (COU)) along the French coast of the English Channel in 2012 and 2013. Partial triadic analysis was performed on the parameter data sets and revealed the functioning of three areas: one estuary (EstA) and two rocky areas (GM(∗), COU(∗)). In contrast to oceanic and anthropogenic reference points similar temporal dynamics characterized δ(15)N signatures and N contents at GM(∗) and COU(∗). Nutrient dynamics were similar: the N-concentrations in seawater originated from the River Seine and local coastal rivers while P-concentrations mainly from these local rivers. δ(15)N at GM(∗) were linked to turbidity suggesting inputs of autochthonous organic matter from large-scale summer seaweed beachings made up of a mixture of Rhodophyta, Phaeophyta and Chlorophyta species. This study highlights the coupling between seaweed beachings and nitrogen sources of intertidal macroalgae. Copyright © 2015 Elsevier Ltd. All rights reserved.
Isotopic enrichment of 15N by ionic exchange cromatography
International Nuclear Information System (INIS)
Trivelin, P.C.O.; Matsui, E.; Salati, E.
1979-01-01
The ionic exchange chromatographic method in columns of resin which is employed in the study of isotopic enrichment of 15 N is presented. Determinations are made of the isotopic separation constant for the exchange of isotopes 15 N and 14 N in the equilibrium involving ammonium hidroxide in the solution phase and ions NH 4 + adsorbed in cationic resins: Dowex 50W-X8 and X12, 100-200 mesh. Experiments are also conducted for determination of height of theoretical plates for situations of equilibrium of the NH 4 + band in two systems of resin's columns aimed at estimating the experimental conditions used. The isotopic analyses of nitrogen are carried out by mass spectrometry [pt
International Nuclear Information System (INIS)
Dubey, Gyan Prakash; Sharma, Monika; Dubey, Neelima
2008-01-01
The densities (ρ) and speeds of sound (u) have been measured over the whole composition range for (butan-1-ol with hexane, or octane, or decane) at T = (298.15, 303.15, and 308.15) K and atmospheric pressure along with the properties of the pure components. Viscosities (η) of these binary mixtures have also been measured over the entire composition range at T 298.15 K. Experimental values of density, viscosity and speed of sound have been used to evaluate excess properties viz. excess molar volumes (V E ), deviation in viscosity (Δη), deviation in speeds of sound (Δu), deviation in isentropic compressibility (Δκ s ) and excess Gibbs free energy of activation of viscous flow (ΔG *E ). The excess properties have been correlated using the Redlich-Kister polynomial equation. The sign and magnitude of these excess properties have been used to interpret the results in terms of intermolecular interactions and structural effects. The viscosity data have also been correlated by Grunberg and Nissan, Tamura-Kurata, and Hind correlation equations
International Nuclear Information System (INIS)
Wutzke, K.D.; Plath, C.; Richter, I.; Heine, W.; Zhukova, T.P.; Sorokina, E.G.; Friedrich, M.
1987-01-01
A short-chain 15 N-peptide mixture characterized by an average chain length of 2.3 was obtained when 15 N-labelled yeast protein was hydrolyzed enzymatically by thermitase from Thermoactinomyces vulgaris. Fifteen newborn Wistar rats were given a single pulse of [ 15 N]glycine. [ 15 N]H 4 Cl and [ 15 N]yeast protein thermitasehydrolysate (YPTH) in a dosage of 50 mg 15 N excess kg -1 by gastric tube. In comparison with [ 15 N]glycine the 15 N incorporation rates of brain, muscle and liver were approximately 150% higher after [ 15 N]YPTH application. Uniform labelling, high 15 N enrichment, almost complete absorption, avoidance of imbalances and the low price make this tracer substance superior to other tracers conventionally used for organ labelling. (author)
Characterization of amino acid metabolism by cultured rat kidney cells: Study with 15N
International Nuclear Information System (INIS)
Nissim, I.; States, B.; Yudkoff, M.; Segal, S.
1987-01-01
The present study evaluates the metabolism of glutamine and glutamate by normal rat kidney (NRK) cells. The major aim was to evaluate the effect of acute acidosis on the metabolism of amino acid and ammonia formation by cultured NRK cells. Experiments at either pH 7.0 or 7.4 were conducted with phosphate-buffered saline supplemented with either 1 mM [5- 15 N]glutamine, [2- 15 N]glutamine, or [ 15 N]glutamate. Incubation with either glutamine or glutamate as a precursor showed that production of ammonia and glucose was increased significantly at pH 7.0 vs 7.4. In experiments with [5- 15 N]glutamine, the authors found that ∼57 and 43% of ammonia N was derived from 5-N of glutamine at pH 7.4 and 7.0, respectively. Three major metabolic pathways of [2- 15 N]glutamine or [ 15 N]glutamate disposal were identified: (1) transamination reactions involving the pH-independent formation of [ 15 N] aspartate and [ 15 N]alanine; (2) the synthesis of [6- 15 NH 2 ]adenine nucleotide, a process more active at pH 7.4 vs. 7.0; and (3) glutamine synthesis from [ 15 N]glutamate, especially at pH 7.4. The data indicate that NRK cells in culture consume glutamine and glutamate and generate ammonia and various amino acids, depending on the H + concentration in the media. The studies suggest that these cell lines may provide a useful model for studying various aspects of the effect of pH on rat renal ammoniagenesis
Letourneur, Y.; Lison de Loma, T.; Richard, P.; Harmelin-Vivien, M. L.; Cresson, P.; Banaru, D.; Fontaine, M.-F.; Gref, T.; Planes, S.
2013-12-01
Stable isotope ratios (δ15N and δ13C) and diet of three fish species, Stegastes nigricans, Chaetodon citrinellus and Epinephelus merra, were analyzed on the fringing coral reefs of two bays that are differentially exposed to river runoff on Moorea Island, French Polynesia. S. nigricans and C. citrinellus relied mostly on turf algae and presented similar trophic levels and δ15N values, whereas E. merra fed on large invertebrates (crabs and shrimps) and had higher trophic levels and δ15N values. Discrepancies existed between stomach content and stable isotope analyses for the relative importance of food items. Bayesian mixing models indicated that sedimented organic matter was also an important additional food for S. nigricans and C. citrinellus, and fishes for E. merra. The main sources of organic matter involved in the food webs ending with these species were algal turfs and surface sediments, while water particulate organic matter was barely used. Significant spatial differences in C and N isotopic ratios for sources and fishes were found within and between bays. Lower 13C and higher 15N values were observed for various compartments of the studied trophic network at the end of each bay than at the entrance. Differences were observed between bays, with organic sources and consumers being, on average, slightly more 13C-depleted and 15N-enriched in Cook's Bay than in Opunohu Bay, linked with a higher mean annual flow of the river at Cook's Bay. Our results suggest that rivers bring continental material into these two bays, which is partly incorporated into the food webs of fringing coral reefs at least close to river mouths. Thus, continental inputs can influence the transfer of organic matter within coral reef food webs depending on the diet of organisms.
Recovery of 15N-urea in soil-plant system of tanzania grass pasture
International Nuclear Information System (INIS)
Martha Junior, Geraldo Bueno; Vilela, Lourival; Corsi, Moacyr; Trivelin, Paulo Cesar Ocheuze
2009-01-01
The economic attractiveness and negative environmental impact of nitrogen (N) fertilization in pastures depend on the N use efficiency in the soil-plant system. However, the recovery of urea- 15 N by Panicum maximum cv. Tanzania pastures, one of the most widely used forage species in intensified pastoral systems, is still unknown. This experiment was conducted in a randomized complete block design with four treatments (0, 40, 80 and 120 kg ha-1 of N-urea) and three replications, to determine the recovery of 15 N urea by Tanzania grass. Forage production, total N content and N yield were not affected by fertilization (p > 0.05), reflecting the high losses of applied N under the experimental conditions. The recovery of 15 N urea (% of applied N) in forage and roots was not affected by fertilization levels (p > 0.05), but decreased exponentially in the soil and soil-plant system (p 15 N (kg ha -1 ) in forage and roots (15 to 30 cm) increased with increasing urea doses (p < 0.05). (author)
Wirstrom, E. S.; Charnley, S. B.; Cordiner, M. A.; Milam, S. N.
2012-01-01
Many meteoritic and interplanetary dust particle (IDP) samples contain bulk enhancements and hotspots rich in N-15. Similarly low C(14)N/C(15)N ratios have been observed in numerous comets, An almost constant enrichment factor in comets from disti'nct formation zones in the nebular disk (i.e. both Jupiter Family and Oort Cloud comets), strongly suggests that this fractionation is primordial and was set in the protsolar cloud core. Deuterium enrichment is observed in both meteorites and IDPs
International Nuclear Information System (INIS)
Simon, O.; Bergner, H.; Adam, K.
1977-01-01
Male Wistar rats (of 60 g live weight) allotted in 10 groups were fed diets with gradually increasing lysine levels ranging from 1.4 to 7.4 g lysine/16 g N. Feed intake was restricted so much that the experimental animals did not change their live weights during the last 3 days of the 8-day experimental period. On the 7the experimental day, 4 animals of each group were injected, i. p. 14 C-L-lysine, the 14 CO 2 -excretion being subsequently measured over a period of 2 hours. On the next day, 6 animals of each group were applied an i. p. injection of 15 N-L-lysine, the urine being collected over the following 24-hour period to measure the 15 N-frequency. Applying both labelling methods, an increased catabolisation of the amino acid was observed after the metabolically necessary lysine requirement had been covered. The methods are very sensitive and revealed, under the experimental conditions chosen, a lysine requirement coverage of about 3 g lysine/16 g N. The possibility of using also 15 N-labelled compounds in the metabolism-oriented amino acid requirement determination is likely to facilitate the transfer of the methodology to farm animals would thus allow to study the amino acid requirement of man. The metabolism-oriented amino acid requirement determination will likewise allow to estimate exact amino acid requirement data under conditions that cannot be rated on the basis of productive yields. (author)
Directory of Open Access Journals (Sweden)
Michaela D. Filiou
2013-01-01
Full Text Available Pesquisas em psiquiatria ainda necessitam de estudos não dirigidos por hipóteses para revelar fundamentos neurobiológicos e biomarcadores moleculares para distúrbios psiquiátricos. Metodologias proteômicas disponibilizam uma série de ferramentas para esses fins. Apresentamos o princípio de rotulação metabólica utilizando 15N para proteômica quantitativa e suas aplicações em modelos animais de fenótipos psiquiátricos com um foco particular em esquizofrenia. Exploramos o potencial de rotulação metabólica por 15N em diferentes tipos de experimentos, bem como suas considerações metodológicas.Psychiatric research is in need of non-hypothesis driven approaches to unravel the neurobiological underpinnings and identify molecular biomarkers for psychiatric disorders. Proteomics methodologies constitute a state-of-the-art toolbox for biomarker discovery in psychiatric research. Here we present the principle of in vivo 15N metabolic labeling for quantitative proteomics experiments and applications of this method in animal models of psychiatric phenotypes, with a particular focus on schizophrenia. Additionally we explore the potential of 15N metabolic labeling in different experimental set-ups as well as methodological considerations of 15N metabolic labeling-based quantification studies.
International Nuclear Information System (INIS)
Aigner, Martina
2014-01-01
Eight out of twelve laboratories (67%) participating in the nitrogen analysis reported 15 N-data within the control limits for the enriched plant sample and eight out of nine (89%) participating laboratories for carbon analysis reported 13 C isotopic abundance results within the control limits for this test sample. The reported analytical data and WEPAL evaluation of the 15 N enriched plant material produced by SWMCNL is shown. All participants received a certificate of participation. Worldwide comparison of stable 15 N and 13 C isotope measurements will provide confidence in the laboratory's analytical performance and is hence an invaluable tool for external quality control. It is hoped that in the future more stable isotope laboratories will make use of this unique opportunity to assess their analytical performance and provide evidence of the high quality of their analytical data
Effects of biofertilizers on N-uptake (N-15) of corn (Zea mays L.) plant at early growth-stage
International Nuclear Information System (INIS)
Taufiq Bachtiar; Anggi Nico Flatian; Nurrobifahmi; Setiyo Hadi Waluyo
2016-01-01
Were studied in pot experiment at the green house in PAIR-BATAN. Broth culture of Azotobacter vinelandii (A), Bacillus cereus (B), Bacillus megaterium (C), and a mixture of those three microbes (ABC) were used as bio-fertilizers, and applied directly on plant grown in pots. Randomized Block Design (RBD) was used in this experiment with six treatments and four replicates. The measured parameters were nitrogen (N) uptake, N derived from the soil, N derived from fertilizer, and plant dry weight. These parameters were determined at 20 days after planting. N derived from bio-fertilizer and N derived from soil were determined by N-15 isotope technique. The results showed that ABC treatment most significantly increase the total N plant (142,42 %) and plant dry weight plant (129.03 %) by the control plant. Based on N-15 isotope technique analysis showed that the significantly contribution to increase N plant was found in ABC treatment (67.92 %). (author)
Schostakowitsch: Sinfonie N15, Op. 141 / Hanspeter Krellmann
Krellmann, Hanspeter
1990-01-01
Uuest heliplaadist "Schostakowitsch: Sinfonie N15, Op. 141, Oktober, Op. 131, Ouvertüre über russische und kirgisische Volksthemen, Op. 115. Göteborger Sinfonie-Orchester, Neeme Järvi". DG CD 427 616-2
Przybylski, Piotr; Pyta, Krystian; Klich, Katarzyna; Schilf, Wojciech; Kamieński, Bohdan
2014-01-01
(13)C, (15)N CP/MAS, including (1)H-(13)C and (1)H-(15)N short contact time CP/MAS experiments, and FTIR methods were applied for detailed structural characterization of ansa-macrolides as 3-formylrifamycin SV (1) and its derivatives (2-6) in crystal and in powder forms. Although HPLC chromatograms for 2/CH3 OH and 2/CH3 CCl3 were the same for rifampicin crystals dissolved in respective solvents, the UV-vis data recorded for them were different in 300-375 nm region. Detailed solid state (13)C and (15)N CP/MAS NMR and FTIR studies revealed that rifampicin (2), in contrast to 3-formylrifamycin SV (1) and its amino derivatives (3-6), can occur in pure non-ionic or zwitterionic forms in crystal and in pure these forms or a mixture of them in a powder. Multinuclear CP/MAS and FTIR studies demonstrated also that 3-6 derivatives were present exclusively in pure zwitterionic forms, both in powder and in crystal. On the basis of the solid state NMR and FTIR studies, two conformers of 3-formylrifamycin SV were detected in powder form due to the different orientations of carbonyl group of amide moiety. The PM6 molecular modeling at the semi-empirical level of theory, allowed visualization the most energetically favorable non-ionic and zwitterionic forms of 1-6 antibiotics, strongly stabilized via intramolecular H-bonds. FTIR studies indicated that the originally adopted forms of these type antibiotics in crystal or in powder are stable in standard laboratory conditions in time. The results presented point to the fact that because of a possible presence of two forms of rifampicin (compound 2), quantification of the content of this antibiotic in relevant pharmaceuticals needs caution. Copyright © 2013 John Wiley & Sons, Ltd.
Biological nitrogen fixation in Crotalaria species estimated using the 15N isotope dilution method
International Nuclear Information System (INIS)
Samba, R.T.; Neyra, M.; Gueye, M.; Sylla, S.N.; Ndoye, I.; Dreyfus, B.
2002-01-01
Growing in Senegal by using 15 N direct isotope dilution technique. Two non-fixing plants, Senna obtusifolia and Senna occidentalis served as reference plants. The amount of nitrogen fixed two months after planting was obtained using the average of the two reference plants. The atom % 15 N excess in the Crotalaria species was significantly lower than that of the reference plants, indicating that significant nitrogen fixation occurred in the three plants. Significant differences were observed between the Crotalaria species; C. ochroleuca yielded more dry matter weight and total nitrogen than did C. perrottetti and C. retusa. The % nitrogen derived from atmosphere (%Ndfa) in leaves and stems was also higher in C. ochroleuca. There was no significant difference in %Ndfa in the whole plant between the three Crotalaria species (47% to 53%). In contrast, interspecific variability was observed based on the %Ndfa. C. ochroleuca significantly exhibited the higher amount of total nitrogen fixed, equivalent to 83 kg of nitrogen fixed per hectare. Based on these data, it was concluded that C. ochroleuca could be used in multiple cropping systems in Senegal for making more nitrogen available to other plants. (author)
Kelemen, P.; Klumperman, B.
2003-01-01
The macroradicals taking part in the copolymn. of Me acrylate and styrene were trapped by reaction with a 15N labeled stable nitroxyl radical at 70 DegC. The nitroxyl radical is formed in situ from a thermally instable alkoxyamine precursor. 15N NMR spectroscopy is applied to detect the trapping
Directory of Open Access Journals (Sweden)
Hobson Keith A.
2017-02-01
Full Text Available Increasingly, stable isotope measurements are being used to assign individuals to broad geographic origins based on established relationships between animal tissues and tissue-specific isoscapes. In particular, the eastern North American population of the monarch butterfly (Danaus plexippus has been the subject of several studies using established δ2H and δ13C wingtissue isoscapes to infer natal origins of migrating and overwintering individuals. However, there has been no study investigating potential variance that can derive from subsampling different regions of the wings, especially those regions differing in pigmentation (orange versus black. Within-wing isotopic (δ2H, δ13C, δ15N variance of 40 monarch butterflies collected from natural overwinter mortality on Mexican roost sites were split evenly into two groups: unwashed samples and those washed in a 2:1 chloroform:methanol solvent. Isotopic variance in δ2H and δ13C was related to pigment (within-wing range 5‰ and 0.5‰, respectively, but not region of subsampling. This variance was reduced 3 to 4 fold through solvent washing that removed pigmented surface scales and any adhered oils. Wing δ15N was similarly influenced by pigment (range 0.3‰, but this effect was not reduced through washing. We recommend future isotopic studies of monarchs and other butterflies for migration research to use the same region for subsampling consistently and to wash samples with solvent to reduce isotopic variance related to uncontrolled variance in discrimination (δ2H, δ13C, δ15N and/or adsorbed water vapor (δ2H. These data also need to be included in description of methods.
Does δ 15N in river food webs reflect the intensity and origin of N loads from the watershed?
International Nuclear Information System (INIS)
Anderson, Caroline; Cabana, Gilbert
2006-01-01
Stable nitrogen isotope ratios (δ 15 N) were measured in invertebrates and fish collected from 82 river sites located in the Saint-Lawrence Lowlands in Quebec, Canada, to examine the relationship between aquatic biota δ 15 N and anthropogenic nitrogen (N) loads. Mean δ 15 N values of all three trophic levels examined (primary consumers, predatory invertebrates and invertebrate-feeding fish) were highly correlated with total anthropogenic N loads on the watershed (kg N km -2 year -1 ; r 2 > 0.61, p 2 > 0.62, p 2 > 0.45, p 2 > 0.29, p 15 N and N loads originating from each of the three livestock species examined (bovines, pigs and poultry; p 15 N (multiple r 2 = 0.67, p 15 N values increasing slowly over a wide range of low levels of N loads, but increasing much faster as N loads grew larger. The three anthropogenic N sources examined were highly correlated with one another, preventing us from statistically isolating their respective effects on δ 15 N. When these loads were expressed as a proportion of total N load, δ 15 N of aquatic biota was still highly correlated with N from livestock and fertilizers, but not with N from human population. Overall, these results suggest that δ 15 N values of aquatic consumers could be used as indicators of the intensity of anthropogenic N loading on watersheds, but not as tracers of the relative importance of individual N sources
International Nuclear Information System (INIS)
Castellino, S.; Leo, G.C.; Sammons, R.D.; Sikorski, J.A.
1989-01-01
The herbicidal dead-end ternary complex (E S3P Glyph ) of glyphosate [N-(phosphonomethyl)glycine] with 5-enolpyruvoylshikimate-3-phosphate synthase (EPSPS) and the substrate shikimate 3-phosphate (S3P) has been characterized by 31 P, 15 N, and 13 C NMR. The NMR spectra of EPSPS-bound glyphosate show unique chemical shifts (δ) for each of the three nuclei. By 31 P NMR, glyphosate in the dead-end complex is a distinct species 3.5 ppm downfield from free glyphosate. The 13 C signal of glyphosate in the dead-end complex is shifted 4 ppm downfield from that of free glyphosate. The 15 N signal for glyphosate (99%) in the dead-end complex is 5 ppm further downfield than that of any free zwitterionic species and 10 ppm downfield from that of the average free species at pH 10.1. The structures of each ionic state of glyphosate are modeled with force field calculations by using MacroModel. A correlation is made for the 31 P δ and the C-P-O bond angle, and the 13 C and 15 N δ values are postulated to be related to C-C-O and C-N-C bond angles, respectively. The downfield 31 P chemical shift perturbation for S3P in the EPSPS binary complex is consistent with ionization of the 3-phosphate of S3P upon binding. Comparison with the S3P 31 P δ vs pH titration curve specifies predominantly the dianion of the 3-phosphate in the E S3P binary complex, while the E S3P Glyph complex indicates net protonation at the 3-phosphate. Chemical shift perturbations of this latter type may be explained by changes in the O-P-O bond angle
Disturbance and topography shape nitrogen availability and δ15 N over long-term forest succession
Perakis, Steven; Tepley, Alan J.; Compton, Jana
2015-01-01
Forest disturbance and long-term succession towards old-growth are thought to increase nitrogen (N) availability and N loss, which should increase soil δ15N values. We examined soil and foliar patterns in N and δ15N, and soil N mineralization, across 800 years of forest succession in a topographically complex montane landscape influenced by human logging and wildfire. In contrast to expectations, we found that disturbance caused declines in surface mineral soil δ15N values, both in logged forests measured 40–50 years after disturbance, and in unlogged forests disturbed by severe wildfire within the last 200 years. Both symbiotic N fixation and N transfers from disturbed vegetation and detritus could lower soil δ15N values after disturbance. A more important role for symbiotic N fixation is suggested by lower soil δ15N values in slow-successional sites with slow canopy closure, which favors early-successional N fixers. Soil δ15N values increased only marginally throughout 800 years of succession, reflecting soil N uptake by vegetation and strong overall N retention. Although post-disturbance N inputs lowered surface soil δ15N values, steady-state mass balance calculations suggest that wildfire combustion of vegetation and detritus can dominate long-term N loss and increase whole-ecosystem δ15N. On steeper topography, declining soil δ15N values highlight erosion and accelerated soil turnover as an additional abiotic control on N balances. We conclude for N-limited montane forests that soil δ15N and N availability are less influenced by nitrate leaching and denitrification loss than by interactions between disturbance, N fixation, and erosion.
Absorption and translocation of 15N in Japonica (Hinohikari) and Indica (Hadsaduri) rice varieties
International Nuclear Information System (INIS)
Islam, N.; Inagaki, S.; Chishaki, N.; Horiguchi, T.
1997-01-01
The absorption and translocation of 15 N-labeled nitrogen (N) applied as three N levels of ammonium nitrate at the stages of panicle initiation (PI) and heading (HD) were compared between a japonica rice variety (var. Hinohikari) and a tall indica rice variety (var. Hadsaduri) by growing them hydroponically. With the supply of low N level, 15 N absorption by the japonica variety was larger, but at medium and high N levels, the tall indica variety absorbed larger amounts of 15 N at both stages. However, the amount of 15 N partitioned to the panicles at maturity was considerably smaller in the indica variety, since dry matter allocation to the panicles was also smaller in this variety. The tall indica variety showed a considerable loss of 15 N from heading to maturity at the high N-level unlike the japonica variety. (author)
International Nuclear Information System (INIS)
Robertson, Ian M.; Boyko, Robert F.; Sykes, Brian D.
2011-01-01
Laboratories often repeatedly determine the structure of a given protein under a variety of conditions, mutations, modifications, or in a number of states. This approach can be cumbersome and tedious. Given then a database of structures, identifiers, and corresponding 1 H, 15 N-HSQC NMR spectra for homologous proteins, we investigated whether structural information could be ascertained for a new homolog solely from its 1 H, 15 N-HSQC NMR spectrum. We addressed this question with two different approaches. First, we used a semi-automated approach with the program, ORBplus. ORBplus looks for patterns in the chemical shifts and correlates these commonalities to the explicit property of interest. ORBplus ranks resonances based on consistency of the magnitude and direction of the chemical shifts within the database, and the chemical shift correlation of the unknown protein with the database. ORBplus visualizes the results by a histogram and a vector diagram, and provides residue specific predictions on structural similarities with the database. The second method we used was partial least squares (PLS), which is a multivariate statistical technique used to correlate response and predictor variables. We investigated the ability of these methods to predict the tertiary structure of the contractile regulatory protein troponin C. Troponin C undergoes a closed-to-open conformational change, which is coupled to its function in muscle. We found that both ORBplus and PLS were able to identify patterns in the 1 H, 15 N-HSQC NMR data from different states of troponin C that correlated to its conformation.
Utilization of 15N in the sequence of mineral fertilizer - forage - animal - slurry - forage
International Nuclear Information System (INIS)
Peschke, H.
1981-01-01
After systematic application of 15 N-ammonium nitrate, the change of the dinuclidic composition and 15 N quantity was studied by isotope analysis of several open systems in the sequence mineral fertilizer - (soil) - forage - (animal) - slurry - (soil) - forage. The relative 15 N isotope frequency of 50 atom% in the mineral fertilizer declined to 12.2 to 21.4 atom% in the forage (beet, oats, hay) and went down to 3.15 atom% in the slurry of a dairy cow fed on this forage. Silage maize manured with the slurry of the dairy cow only showed 1.98 atom %, green oats grown after the silage maize on the same area was found to have 0.45 atom%. The 15 N quantity of 104.5 g N in the fertilizer gradually decreased to 41.6 g N in the forage, 30.5 g N in the slurry and 22.6 g N in the silage maize. The causes discussed are 15 N isotope dilution as qualitative factor and productive and unproductive N losses as quantitative factors. (author)
Directory of Open Access Journals (Sweden)
Wayan Bebas
2015-08-01
Full Text Available The aims of this study were to determine the viability and motility of Landrace pig’sspermatozoa in the Beltsville Thawing Solution (BTS diluent with addition vitamin C which werestored at a temperature of 15ºC. During the storage process, metabolic activity of spermatozoaproduce free radicals that can reduce the viability and motility of spermatozoa thus it needs theaddition of antioxidants. Vitamin C is an antioxidant that can be used to scavengethe free radicals.This study used vitamin C added into the BTS diluent with scavenge dose is 0.1 mg/ml, 0.2 mg/mland a dose of 0.3 mg/ml. The results showed that a dose of 0.1 mg/ml is the best dose to maintainthe viability and motility of Landrace pigs spermatozoa were storage at a temperature of 15ºC.
International Nuclear Information System (INIS)
Secer, M.
1988-01-01
The amino acids separated with two dimensional paper chromatography were isolated in two ways which make their 15 N determination possible 1) After developing the spots of chromatograms with ninhydrin they were cut out and shaken 30' with 2 ml dist. H 2 O. To destroy the ninhydrin-NH 3 colour complex, the extraction solution was heated in boiling waterbath for 10' and then 0.5 ml 2 N HCl was added to the solution and continued to heat for further 10'. For the 15 N determination of amino acids by emissionspectrometer this colour complex must be destroyed completely. It was reached with adding 2 ml 30% H 2 O 2 to the solution and heating it 5' in 100 0 C waterbath. After the evaporation of colourless solution under IR-lamp at 70 0 C, the white powder was dissolved with 50 ul dist. H 2 O and centrifuged 10'. The clear supernatant was used to gain N 2 gas by the CuO/CaO combustion. N 2 gas is necessary for the 15 N/ 14 N ratio determination by emissionsspectrometer. 2) In the second way, the destroying of ninhydrin-NH 3 colour complex was easier and quicker this way the spots were eluted (extracted) with 50% alcohol and 30% H 2O2 with 1:1 ratio. After shaking the solution 30', it turns quite colourless. It means that the ninhydrin-NH 3 colour complex was completely destroyed. Further works have been done as described in the first way. We have found out that one amino acid should have 10-20 ug N in it to assess the 15 N enrichment. In order to attain this quantity of N for certain amino acids, the spots of three separately run chromatograms were combined
δ15N in the turtle grass from the Mexican Caribbean
Talavera-Saenz, A.; Sanchez, A.; Ortiz-Hernandez, M.
2013-05-01
Nutrient inputs associated with population growth threaten the integrity of coastal ecosystems. To assess the rapid increase in tourism, we compared the δ15N from Thalassia testudinum collected at sites with different levels of tourism development and population to detect the N inputs of wastewater discharge (WD) along the coast of Quintana Roo. The contributions of nitrogen enriched in 15N are directly related to the increase of WD inputs in areas of high tourism development (Nichupte Lagoon in Cancun, >3 million tourists per year from 2007 to 2011 and 0.7 million of resident population) and decreased towards Bahia Akumal and Tulum (>3 million tourists per year from 2007 to 2011 and 0.15 million of resident population). The δ15N from T. testudinum was significantly lower at Mahahual and Puerto Morelos (about 0.4 million tourists per year in 2007 to 2011 and 0.25 million of resident population) than other the sites. In areas of the lowest development and with tourist activity restricted and small population, such as the Yum Balam Reserve and Sian Ka'an Biosphere Reserve, the δ15N values were in much higher enrichment that Mahahual and Puerto Morelos. Therefore is suggested that Mahahual and Puerto Morelos may be used for baseline isotopic monitoring, over environmental pressure on the reef lagoon ecosystem, where tourist activities and population are growing very slow rate. The anthropogenic N input has the potential to impact, both environmentally and economically, the seagrass meadows and the coral reefs along the coast of Quintana Roo and the Caribbean.
New Perspectives on Nitrogen Fixation Measurements Using 15N2 Gas
Directory of Open Access Journals (Sweden)
Nicola Wannicke
2018-04-01
Full Text Available Recently, the method widely used to determine 15N2 fixation rates in marine and freshwater environments was found to underestimate rates because the dissolution of the added 15N2 gas bubble in seawater takes longer than theoretically calculated. As a solution to the potential underestimate of rate measurements, the usage of the enriched water method was proposed to provide constant 15N2 enrichment. Still, the superiority of enriched water method over the previously used bubble injection remains inconclusive. To clarify this issue, we performed laboratory based experiments and implemented the results into an error analysis of 15N2 fixation rates. Moreover, we conducted a literature search on the comparison of the two methods to calculate a mean effect size using a meta-analysis approach. Our results indicate that the error potentially introduced by an equilibrium phase of the 15N2 gas is −72% at maximum for experiments with very short incubation times of 1 h. In contrast, the underestimation was negligible for incubations lasting 12–24 h (error is −0.2%. Our meta-analysis indicates that 84% of the measurements in the two groups will overlap and there is a 61% chance that a sample picked at random from the enriched water group will have a higher value than one picked at random from the bubble group. Overall, the underestimation of N2 fixation rates when using the bubble method relative to the enriched water method is highly dependent on incubation time and other experimental conditions and cannot be generalized.
Regional assessment of N saturation using foliar and root δ15N
L.H. Pardo; P.H. Templer; C.L. Goodale; S. Duke; P.M. Groffman; M.B. Adams; P. Boeckx; J. Boggs; J. Campbell; B. Colman; J. Compton; B. Emmett; P. Gundersen; J. Kjonaas; G. Lovett; M. Mack; A. Magill; M. Mbila; M.J. Mitchell; G. McGee; S. McNulty; K. Nadelhoffer; S. Ollinger; D. Ross; H. Rueth; L. Rustad; P. Schaberg; S. Schiff; P. Schleppi; J. Spoelstra; W. Wessel
2006-01-01
N saturation induced by atmospheric N deposition can have serious consequences for forest health in many regions. In order to evaluate whether foliar δ15N may be a robust, regional-scale measure of the onset of N saturation in forest ecosystems, we assembled a large dataset on atmospheric N deposition, foliar and root δ
Using a macroalgal δ15N bioassay to detect cruise ship waste water effluent inputs
International Nuclear Information System (INIS)
Kaldy, James
2011-01-01
Highlights: → Green macroalgae exposed to nutrient solutions exhibited changes in tissue 15 N signatures. → Macroalgae exhibited no fractionation with NO 3 and slight fractionation with NH 4 . → Algae exposed to cruise ship waste water had increased tissue δ 15 N indicating a heavy N source. → Field bioassays exhibited decreased δ 15 N indicating isotopically light riverine δ 15 N-NO 3 was likely the dominant N source. → Algal bioassays could not detect a δ 15 N cruise ship waste water signal in this system. - Abstract: Green macroalgae bioassays were used to determine if the δ 15 N signature of cruise ship waste water effluent (CSWWE) could be detected in a small harbor. Opportunistic green macroalgae (Ulva spp.) were collected, cultured under nutrient depleted conditions and characterized with regard to N content and δ 15 N. Samples of algae were used in controlled incubations to evaluate the direction of isotope shift from exposure to CSWWE. Algae samples exposed to CSWWE exhibited an increase of 1-2.5 per mille in δ 15 N values indicating that the CSWWE had an enriched isotope signature. In contrast, algae samples exposed to field conditions exhibited a significant decrease in the observed δ 15 N indicating that a light N source was used. Isotopically light, riverine nitrogen derived from N 2 -fixing trees in the watershed may be a N source utilized by algae. These experiments indicate that the δ 15 N CSWWE signature was not detectable under the CSWWE loading conditions of this experiment.
Directory of Open Access Journals (Sweden)
Eeva-Liisa Syväoja
1979-01-01
Full Text Available The utilization of the non-protein nitrogen and carbon of feed by rumen microorganisms for the synthesis of protein was studied by administering [U-14C] sucrose and 15NH4Cl to a cow on urea-rich, low-protein feed. By studying the labelling of the protozoa and bacteria and the amino acids isolated from them at intervals up to 48 hours afterwards, it was found that the bacteria synthesized amino acids from nonprotein nitrogen much more rapidly and effectively than the protozoa. Also the labelling of the carbon in the amino acids of the bacteria was more rapid than in the protozoa. In both protozoa and bacteria there was intracellular storage of [14C] sucrose. Of the bacterial amino acids the most vigorous 14C labelling was found in Glu, Arg, Lys, Val and Ala and the weakest labelling in Gly, His and Ser. Of the protozoal amino acids Ala, Asp, Glu, Leu and Lys had the highest labelling and Pro, Gly, His and Phe the lowest. In the bacterial protein the labelling of Pro and Arg was ten times that of the corresponding protozoal amino acids, and Asp, Ser and Ala four times. After the 15NH4Cl dose the half-life of 15N in the rumen fluid was estimated to be 3.3 h. Labelled ammonium nitrogen was about 11 —15 % of the bacterial nitrogen and 2—3 % of the protozoal nitrogen after 1 h. Of the protozoal amino acids Ala, Glu, Val, Asp and Met had the most vigorous labelling, and of the bacterial amino acids Glu, Asp, Ser, He and Tyr. The slowest incorporation of ammonium nitrogen was into His, Pro, Arg and Gly in both bacteria and protozoa. The labelling of the bacterial amino acids was approximately 7—8 times more vigorous than that of the protozoal amino acids. The labelling of Ala was only 4 times, and that of Val, Met and Glu 5 times more vigorous than with protozoal protein. The pathway of histidine synthesis seemed to be restricted in both bacteria and protozoa and therefore may be a limiting factor in protein synthesis, particularly in cows fed
Australian climate extremes at 1.5 °C and 2 °C of global warming
King, Andrew D.; Karoly, David J.; Henley, Benjamin J.
2017-06-01
To avoid more severe impacts from climate change, there is international agreement to strive to limit warming to below 1.5 °C. However, there is a lack of literature assessing climate change at 1.5 °C and the potential benefits in terms of reduced frequency of extreme events. Here, we demonstrate that existing model simulations provide a basis for rapid and rigorous analysis of the effects of different levels of warming on large-scale climate extremes, using Australia as a case study. We show that limiting warming to 1.5 °C, relative to 2 °C, would perceptibly reduce the frequency of extreme heat events in Australia. The Australian continent experiences a variety of high-impact climate extremes that result in loss of life, and economic and environmental damage. Events similar to the record-hot summer of 2012-2013 and warm seas associated with bleaching of the Great Barrier Reef in 2016 would be substantially less likely, by about 25% in both cases, if warming is kept to lower levels. The benefits of limiting warming on hydrometeorological extremes are less clear. This study provides a framework for analysing climate extremes at 1.5 °C global warming.
Buchen, Caroline; Eschenbach, Wolfram; Flessa, Heinz; Giesemann, Anette; Lewicka-Szczebak, Dominika; Well, Reinhard
2015-04-01
Denitrification, the reduction of oxidized forms of inorganic N to N2O and N2 is an important pathway of gaseous nitrogen losses. Measuring denitrification, especially the reduction of N2O to N2, expressed in the product ratio (N2O/(N2O + N2)), is rather difficult and hence rarely performed under field conditions. But using the 15N gas-flux method allows determining N transformation processes in their natural environment. In order to develop effective climate mitigation strategies understanding the N2O source is essential. We used the 15N gas-flux method to determine N2O and N2 emissions following grassland renewal and conversion techniques. Therefore we selected three different treatments: control (C), mechanical grassland renovation (GR) (autumn 2013) and grassland conversion to maize (GM) (spring 2014) from field plot trials on two different sites (Histic Gleysoil and Plaggic Anthrosol) near Oldenburg, Lower Saxony, Germany. We applied 15N labeled KNO3- (60 atom. % 15N) at a rate equivalent to common farming practices (150 kg N*ha-1) using needle injection of fertilizer solution in three different depths (10 cm, 15 cm, 20 cm) for homogeneous soil labeling up to 30 cm in microplots. During the first 10 days after application (May 2014) gas flux measurements from closed chambers were performed every second day and then weekly following a period of 8 weeks. Gas samples were analyzed for δ15N of N2 and N2O by IRMS according to Lewicka-Szczebak et al. (2013). Concentration and 15N enrichment of NO3- in soil water was determined on weekly samples using the SPIN-MAS technique (Stange et al. 2007). Fluxes of N2 and N2O evolved from the 15N labeled soil nitrogen pool were calculated using the equations of Spott et al. (2006). Peak events of N2 and N2O emissions occurred during the first 10 days of measurement, showing differences in soil types, as well as treatment variations. N2 fluxes up to 178 g*ha-1*day-1 and N2O fluxes up to 280 g*ha-1*day-1 were measured on the
Fields of application and results of analytic procedures with 15N in pediatric alimentary research
International Nuclear Information System (INIS)
Heine, W.; Richter, I.; Plath, C.; Wutzke, K.; Kupatz, P.; Drescher, U.
1981-01-01
Investigation of protein metabolism in nutritional pediatric research by means of 15 N tracer techniques has been relatively seldom used up to now. 15 N labelled compounds for these purposes are not injurious to health. The technique is based on oral or intravenous application of the tracer substances and on 15 N analysis of the urine fractions. The subsequent calculation of protein synthesis and breakdown rate, turnover and reutilisation of amino acids from protein breakdown as well as the size of the metabolic pool offers detailed information of protein metabolism. Determination of these parameters was performed in infants on mother's milk and formula feeding and on chemically defined diet. As an example of utilisation of D-amino acids for protein synthesis the 15 N-D-phenylalanin retention on parenteral nutrition was found to be 33% of the applied dosis at an average. An oral 15 N glycine loading test proved to be of value for the prediction of the therapeutic effect of human growth hormon in numerous types of dwarfism. Further application of 15 N tracer technique dealt with utilisation of 15 N urea for bacterial protein synthesis of the intestinal flora and with incorporation of 15 N from 15 N glycine and 15 N lysine into the jejunal mucosa for measuring the enterocyte regeneration. (author)
Behavior of 15N-labelled amino acids in germinated corn
International Nuclear Information System (INIS)
Samukawa, Kisaburo; Yamaguchi, Masuro
1979-01-01
By investigating the rise and fall of 15 N-labelled amino acids in germinated corns, the behavior of amino radicals in free amino acids, the influence of the hydrolysis products of stored proteins on free amino acids and the change from heterotrophy to autotrophy of seeds were clarified. The amount of amino acid production depending on external nitrogen was very small in the early period of germination. 15 N incorporation into proline was not observed in the early period of germination, which suggested that the proline may be nitrogen-storing source. Most of the amino-state nitrogen of asparagine accumulated at the time of germination was internal nitrogen, and this fact suggested that aspartic acid serve as the acceptor of ammonia produced in the early stage of germination. 15 N content increased significantly on 9 th day after germination, and decreased on 12 th day. These facts prove that there are always active decomposition and production of protein in plant body. (Kobatake, H.)
The use of N-15 labelling to study the turnover and utilization of ruminant manure N
DEFF Research Database (Denmark)
Sørensen, P.; Jensen, E.S.
1998-01-01
An improved understanding of the cycling of animal manure N is a prerequisite for malting better use of this N source. A sheep was fed N-15-Iabelled grass in order to study the fate of N-15-Iabelled ruminant manure N in the plant-soil system. The uniformity of labelling was found to be satisfactory...
Energy Technology Data Exchange (ETDEWEB)
Kenani, A. [Tunis Univ. (Tunisia). Faculte de Medecine; Bernier, J.-L. [Laboratoire de Chimie Organique Physique (France); Henichart, J.-P. [UCB-Pharma (Belgium)
1995-02-01
HPLC and mass spectrometry can be used to isolate and identify all metabolites of caffeine in plasma of patients. The synthesis of [1,3-{sup 15}N{sub 2}] xanthine and [1,3-{sup 15}N{sub 2}] caffeine are of interest in the elucidation of mass spectrometry fragmentation pathways and unambiguous determination of metabolites, especially uric acid which exists as a natural constituent of human plasma. (Author).
Energy Technology Data Exchange (ETDEWEB)
Golden, M H.N.; Waterlow, J C [London School of Hygiene and Tropical Medicine (UK)
1977-09-01
Total body protein turnover was studied in six elderly patients. During the study they were fed by continuous infusion of a liquid formula through a nasogastric tube. L-(1-/sup 14/C)leucine and (/sup 15/N)-glycine were infused at a constant rate for 30 h. The labelled glycine was infused into the intragastric line; the labelled leucine was given either by this route or intravenously. The specific radioactivity of free leucine in plasma and the rate of output of /sup 14/CO/sub 2/ in expired air both reached a plateau at 10 h, and remained constant until the end of the infusion at 30 h. The /sup 15/N abundance in urinary urea and total N was very similar. In neither was a plateau reached by 30 h but in four out of the six patients the abundance in urinary NH/sub 4//sup +/ had attained a plateau by the end of the infusion. Flux rates and rates of protein synthesis were calculated in four ways and a comparison of methods was used to examine the validity of the assumptions on which the different methods depended. The results suggest that the rate of protein turnover is reduced in the elderly, compared with younger subjects.
Localization of 15N uptake in a Tibetan alpine Kobresia pasture
Schleuß, Per-Marten; Kuzyakov, Yakov
2014-05-01
The Kobresia Pygmea ecotone covers approximately 450.000 km2 and is of large global and regional importance due several socio-ecological aspects. For instance Kobresia pastures store high amounts of carbon, nitrogen and other nutrients, represent large grazing areas for herbivores, provide a fast regrowth after grazing events and protect against mechanical degradation and soil erosion. However, Kobresia pastures are assumed to be a grazing induced and are accompanied with distinct root mats varying in thickness between 5-30 cm. Yet, less is known about the morphology and the functions of this root mats, especially in the background of a progressing degradation due to changes of climate and management. Thus we aimed to identify the importance of single soil layers for plant nutrition. Accordingly, nitrogen uptake from different soil depths and its remain in above-ground biomass (AGB), belowground biomass (BGB) and soil were determined by using a 15N pulse labeling approach during the vegetation period in summer 2012. 15N urea was injected into six different soil depths (0.5 cm, 2.5 cm, 7.5 cm, 12.5 cm, 17.5 cm, 22.5 cm / for each 4 replicates) and plots were sampled 45 days after the labeling. For soil and BGB samples were taken in strict sample intervals of 0-1 cm, 1-5 cm, 5-10 cm, 10-15 cm, 15-20 cm, 20-25 cm. Results indicate that total recovery (including AGB, BGB and soil) was highest, if tracer was injected into the top 5 cm and subsequently decreased with decreasing injection depth. This is especially the case for the 15N recovery of BGB, which is clearly attributed to the root density and strongly decreased with soil depth. In contrast, the root activity derived from the 15N content of roots increased with soil depth, which is primary associated to a proportionate increase of living roots related to dead roots. However, most 15N was captured in plant biomass (67.5-85.3 % of total recovery), indicating high 15N uptake efficiency possibly due to N limitation
Neutron scattering from [sup 12]C between 15. 6 and 17. 3 MeV
Energy Technology Data Exchange (ETDEWEB)
Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L. (Duke Univ., Durham, NC (United States). Dept. of Physics Triangle Universities Nuclear Lab., Durham, NC (United States))
1993-06-01
The differential cross section [sigma]([theta]) for neutron elastic scattering from [sup 12]C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The [sigma]([theta]) data, together with published analysing power A[sub y]([theta]) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present [sup 12]C(n,n)[sup 12]C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in [sup 11]C via an iterative-moment approach or a dispersive optical-model analysis. (author).
International Nuclear Information System (INIS)
Geng, Jiwei; Teng, Xinying; Zhou, Guorong; Leng, Jinfeng; Zhao, Degang
2014-01-01
In situ synthesized TiC particles were prepared by a thermal explosion method. Adding “in situ synthesized” TiC into Zr 60 Cu 10 Al 15 Ni 15 glass matrix to obtain amorphous matrix composites was achieved. The corrosion behavior of Zr 60 Cu 10 Al 15 Ni 15 amorphous composites was evaluated using potentiodynamic polarization measurements in 3.5 wt% NaCl solution at room temperature. The results show that the microhardness and thermal stability are improved apparently, while the TiC (≤0.6 wt%) does not significantly affect the supercooled liquid behavior. Moreover, the corrosion resistance is improved apparently because the nanocrystals accelerate the diffusion of passive elements for faster formation of the protective passive film at nanocrystals/amorphous interfaces. However, when the TiC content is more than 0.6 wt%, both glass forming ability and corrosion resistance are reduced significantly
Effect of estrogens on urinary 15N balance in girls
International Nuclear Information System (INIS)
Zachmann, M.; Kempken, B.; Prader, A.
1984-01-01
While the anabolic and growth-promoting effects of testosterone are known to be important for pubertal growth in boys, the role of estrogens (E) in the female spurt is less certain. Adrenal androgens have been considered to be more important than ovarian E. To study the anabolic effects of E, there has been carried out a pilot study in 9 girls aged 11 to 15 years. Before and 6 days after the start of E treatment, urinary 15 N balance studies were performed, using 15 NH 4 Cl. (author)
Fluorescent glycosidase inhibiting 1,5-dideoxy-1,5-iminoalditols
DEFF Research Database (Denmark)
Greimel, Peter; Häusler, Herwig; Lundt, Inge
2006-01-01
1,5-Dideoxy-1,5-iminoalditols of various configurations as well as isofagomine were N-alkylated with non-polar straight chain spacer-arms by a set of simple standard procedures. The spacer-arms’ terminal functional groups, primary amines, were employed to introduce fluorescent tags such as dansyl...
Energy Technology Data Exchange (ETDEWEB)
Annable, W.K. [Department of Civil and Environmental Engineering, University of Waterloo, Waterloo, Ontario, N2L 3G1 (Canada)]. E-mail: wkannabl@uwaterloo.ca; Frape, S.K. [Department of Earth Sciences, University of Waterloo, Waterloo, Ontario, N2L 3G1 (Canada); Shouakar-Stash, O. [Department of Earth Sciences, University of Waterloo, Waterloo, Ontario, N2L 3G1 (Canada); Shanoff, T. [Department of Earth Sciences, University of Waterloo, Waterloo, Ontario, N2L 3G1 (Canada); Drimmie, R.J. [Department of Earth Sciences, University of Waterloo, Waterloo, Ontario, N2L 3G1 (Canada); Harvey, F.E. [School of Natural Resources, University of Nebraska, Lincoln, NE 68588-0517 (United States)
2007-07-15
The isotopic compositions of commercially available herbicides were analyzed to determine their respective {sup 15}N, {sup 13}C and {sup 37}Cl signatures for the purposes of developing a discrete tool for tracing and identifying non-point source contaminants in agricultural watersheds. Findings demonstrate that of the agrochemicals evaluated, chlorine stable isotopes signatures range between {delta}{sup 37}Cl = -4.55 per mille and +3.40 per mille , whereas most naturally occurring chlorine stable isotopes signatures, including those of road salt, sewage sludge and fertilizers, vary in a narrow range about the Standard Mean Ocean Chloride (SMOC) between -2.00 per mille and +1.00 per mille . Nitrogen stable isotope values varied widely from {delta}{sup 15}N = -10.86 per mille to +1.44 per mille and carbon stable isotope analysis gave an observed range between {delta}{sup 13}C = -37.13 per mille and -21.35 per mille for the entire suite of agro-chemicals analyzed. When nitrogen, carbon and chlorine stable isotope analyses were compared in a cross-correlation analysis, statistically independent isotopic signatures exist suggesting a new potential tracer tool for identifying herbicides in the environment.
Emission pathways to achieve 2.0°C and 1.5°C climate targets
Su, Xuanming; Takahashi, Kiyoshi; Fujimori, Shinichiro; Hasegawa, Tomoko; Tanaka, Katsumasa; Kato, Etsushi; Shiogama, Hideo; Masui, Toshihiko; Emori, Seita
2017-06-01
We investigated the feasibilities of 2.0°C and 1.5°C climate targets by considering the abatement potentials of a full suite of greenhouse gases, pollutants, and aerosols. We revised the inter-temporal dynamic optimization model DICE-2013R by introducing three features as follows. First, we applied a new marginal abatement cost curve derived under moderate assumptions regarding future socioeconomic development—the Shared Socioeconomic Pathways 2 (SSP2) scenario. Second, we addressed emission abatement for not only industrial CO2 but also land-use CO2, CH4, N2O, halogenated gases, CO, volatile organic compounds, SOx, NOx, black carbon and organic carbon. Third, we improved the treatment of the non-CO2 components in the climate module based on MAGICC 6.0. We obtained the following findings: (1) It is important to address the individual emissions in an analysis of low stabilization scenarios because abating land-use CO2, non-CO2 and aerosol emissions also contributes to maintaining a low level of radiative forcing and substantially affects the climate costs. (2) The 2.0°C target can be efficiently reached under the assumptions of the SSP2 scenario. (3) The 1.5°C target can be met with early deep cuts under the assumption of a temperature overshoot, and it will triple the carbon price and double the mitigation cost compared with the 2.0°C case.
Chen, Qian; Ding, Ning; Zhu, Zhan Ling; Peng, Ling; Ge, Shun Feng; Jiang, Yuan Mao
2017-07-18
Two-year-old potted Fuji 3 apple trees on different rootstocks [Fuji 3/M. micromalus Makin (joe), Fuji 3/M7 (semi-dwarf) and Fuji 3/M26/M. micromalus Makin (dwarf)] were used to study leaf morphology and photosynthesis and the characteristics of distribution and utilization of 13 C and 15 N at different nitrogen supply levels (0N, 25%N and 100%N, the N content in 100% N treatment was the same as that in Hoagland complete nutrient solution) under sand culture condition. The main results were as follows: At shoot growth cessation stage in autumn, the leaf chlorophyll content (SPAD), leaf nitrogen content and photosynthetic rate were found the highest in Fuji 3/M. micromalus Makin, followed by Fuji 3/M7, and the lowest was found in Fuji 3/M26/M. micromalus Makin under the same nitrogen stress treatments (0N and 25%N), however, under normal nitrogen treatment (100%N) Fuji 3/M26/M. micromalus Makin had the highest leaf SPAD value, photosynthetic rate and the nitrogen content, followed by Fuji 3/M7, and the lowest was found in Fuji 3/M. micromalus Makin. The leaf SOD and CAT activities showed Fuji 3/M. micromalus Makin > Fuji 3/M7 > Fuji 3/M26/M. micromalus Makin under the same nitrogen stress treatments, but showed Fuji 3/M26/M. micromalus Makin > Fuji 3/M7 > Fuji 3/M. micromalus Makin under the normal nitrogen treatment. There were significant differences in the distributions of 15 N and 13 C in root and leaf in the 3 scion-stock combinations, and the distribution rates of 15 N and 13 C in roots were the highest under nitrogen stress treatments and in the order of Fuji 3/M. micromalus Makin > Fuji 3/M7 > Fuji 3/M26/M. micromalus Makin. The distribution rates of 15 N and 13 C in leaves were the highest under the normal nitrogen treatment and in the order of Fuji 3/M26/M. micromalus Makin > Fuji 3/M7 > Fuji 3/M. micromalus Makin. The 15 N utilization ratio differed significantly among the 3 scion-stock combinations under different nitrogen application levels and was in
International Nuclear Information System (INIS)
Sardroodi, Jaber Jahanbin; Atabay, Maryam; Azamat, Jafar
2012-01-01
Highlights: ► The osmotic coefficients of the solutions of ionic liquid in ethanol have been measured. ► Measured osmotic coefficients were correlated using Pitzer, e-NRTL and NRF models and polynomial equation. ► Vapour pressures were evaluated from the correlated osmotic coefficients. - Abstract: Osmotic coefficients of the solutions of room temperature ionic liquid N-R-4-(N,N-dimethylamino)pyridinium tetrafluoroborate (R = C 4 H 9 , C 5 H 11 , C 6 H 13 ) in ethanol have been measured at T = 298.15 K by the isopiestic method. The experimental osmotic coefficients have been correlated using the ion interaction model of Pitzer, electrolyte non-random two liquid (e-NRTL) model of Chen, non-random factor (NRF) and a fourth-order polynomial in terms of molality. The vapour pressures of the solutions studied have been evaluated from the osmotic coefficients.
International Nuclear Information System (INIS)
Altabet, M.A.
1984-01-01
An extensive study of 15 N natural abundance in particulate organic nitrogen (PON) from warm-core rings of the Gulf Stream was carried out to test its use as an in situ tracer of the marine nitrogen cycle. Ring 82-B exhibited large temporal changes in the delta 15 N of PON. It was found that delta 15 N values for euphotic zone PON were low in April before stratification and higher in June after stratification had occurred. Below 400 meters, in the permanent thermocline, the change was opposite going from very high values to ones similar to those at the surface. Examination of vertical profiles for delta 15 N in the upper 200 meters demonstrated that in stratified waters a delta 15 N minimum for PON occurs with both the top of the nitracline and a maximum in PON concentration. Often a minimum in C/N ratio also occurs at the depth of the delta 15 N minimum. A mathematical model of nitrogen flux into and out of the euphotic zone and associated isotopic fractionation qualitatively reproduced the observed patterns for the delta 15 N of PON, PON concentration and NO 3 - concentration. Levels of PON increased as a result of either increasing NO 3 - flux into the euphotic zone or increasing the residence time of PON in the euphotic zone. These results lend general support to current views regarding the nature and significance of the vertical fluxes of nitrogen in the upper-ocean and the hypotheses presented concerning the factors which control the delta 15 N of PON
Determination of protein turnover parameters in athletes using 15N tracers
International Nuclear Information System (INIS)
Krumbiegel, P.; Kuehne, K.; Faust, H.; Bornhak, H.; Junghans, P.; Zerbes, H.
1985-01-01
In 2 adolescent female athletes engaged in technical-acrobatic sports the influence of a high protein diet on the protein turnover rate under training conditions was investigated by means of 15 N-glycine. Protein synthesis was significantly increased, whereas the utilization of nutritive nitrogen was decreased as expected. The 15 N tracer technique is well suited to determine the protein requirements under special training conditions
17 CFR 240.15c1-7 - Discretionary accounts.
2010-04-01
... transactions or purchase or sale which are excessive in size or frequency in view of the financial resources... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-7 Discretionary...
Directory of Open Access Journals (Sweden)
E. Capron
2013-05-01
Full Text Available Correct estimation of the firn lock-in depth is essential for correctly linking gas and ice chronologies in ice core studies. Here, two approaches to constrain the firn depth evolution in Antarctica are presented over the last deglaciation: outputs of a firn densification model, and measurements of δ15N of N2 in air trapped in ice core, assuming that δ15N is only affected by gravitational fractionation in the firn column. Since the firn densification process is largely governed by surface temperature and accumulation rate, we have investigated four ice cores drilled in coastal (Berkner Island, BI, and James Ross Island, JRI and semi-coastal (TALDICE and EPICA Dronning Maud Land, EDML Antarctic regions. Combined with available ice core air-δ15N measurements from the EPICA Dome C (EDC site, the studied regions encompass a large range of surface accumulation rates and temperature conditions. Our δ15N profiles reveal a heterogeneous response of the firn structure to glacial–interglacial climatic changes. While firn densification simulations correctly predict TALDICE δ15N variations, they systematically fail to capture the large millennial-scale δ15N variations measured at BI and the δ15N glacial levels measured at JRI and EDML – a mismatch previously reported for central East Antarctic ice cores. New constraints of the EDML gas–ice depth offset during the Laschamp event (~41 ka and the last deglaciation do not favour the hypothesis of a large convective zone within the firn as the explanation of the glacial firn model–δ15N data mismatch for this site. While we could not conduct an in-depth study of the influence of impurities in snow for firnification from the existing datasets, our detailed comparison between the δ15N profiles and firn model simulations under different temperature and accumulation rate scenarios suggests that the role of accumulation rate may have been underestimated in the current description of firnification
International Nuclear Information System (INIS)
Kchaou, R.; Khelil, M. N.; Rejeb, S.; Gharbi, F.; Henchi, B.; Hernandez, T.; Destain, J. P.
2010-01-01
Field experiments were conducted to evaluate the use of a novel 15N isotope technique for comparing the dynamics of N derived from sewage sludge applied to sorghum to the dynamics of N derived from the commercial fertilizer, urea. The treatments included a control, sludge applied at three rates (3, 6 and 9 t/ha, or 113, 226 and 338 kg N/ha) and N-urea applied at three rates (150, 250 and 350 kg N/ha). Recovery of 15N -labelled sludge was similar for the different nitrogen rates applied , with a mean value of 27%. However, the recovery of 15N -urea decreased as the rate of N application increased (from 38% to 27%). Approximately 22% and 19% of the 15N from sludge and urea, respectively, remained in the 0-60 cm layer of soil, most of which was present in the 0-20 cm layer. Furthermore, losses of 15N -labelled fertilizer were not affected by the N fertilization source, and the greatest losses, which were measured in response to the highest N application rate, were 59%. (authors)
Makarov, Mikhail; Malysheva, Tatiana; Tiunov, Alexei; Kadulin, Maxim; Maslov, Mikhail
2017-04-01
Nitrogen availability, net N mineralization, nitrification and 15N natural abundance of total soil N and small soil N pools (N-NH4+, N-NO3-, DON and microbial biomass N) were studied in a toposequence of alpine ecosystems in the Northern Caucasus. The toposequence was represented by (1) low productive alpine lichen heath (ALH) of the wind-exposed ridge and upper slope; (2) more productive Festuca varia grassland (FG) of the middle slope; (3) most productive Geranium gymnocaulon/Hedysarum caucasicum meadow (GHM) of the lower slope and (4) low productive snow bed community (SBC) of the slope bottom. Nitrogen transformation in the alpine soils produces distinct N pools with different 15N enrichment: DON/microbial biomass N > total N > N-NH4+ > N-NO3-. Grassland and meadow soils of the middle part of the toposequence are characterized by higher nitrogen transformation activities and higher δ15 values of total N and N-NH4+. Field incubation of alpine soils increased δ15N of N-NH4+ from -2.6 - +2.0‰ to +6.1 - +15.7‰. The N-NO3-produced in the incubation experiment had extremely low (negative) δ15N values (up to -14‰). We found a positive correlation between δ15N of different soil N pools (total N, N-NH4+ and N-NO3-) and net N mineralization and nitrification. Nitrification controls the formation of 15N enriched N-NH4+ pool while N mineralization probably had an important role in regulation of 15N enrichment of DON pool in alpine soils. Overall, our results support the hypothesis that 15N is more enriched in N-rich and more depleted in N-poor ecosystems. We conclude that δ15N values of different soil N pools could be a good indicator of microbial N transformation in alpine soils of the Northern Caucasus. Acknowledgement: This study was supported by Russian Science Foundation (16-14-10208).
International Nuclear Information System (INIS)
Nasrullah, Nizar; Wungkar, Marietje; Gunawan, Andi; Gandanegara, Soertini; Suharsono, Heny
2000-01-01
The objective of this study is to measure the NO 2 pollutant sorption of various trees, shrubs and ground cover plants. 32 species of trees, 64 speceis of shrubs and 13 species of ground cover plants were exposed to 3 ppm (v / v) N- 15 O 2 in a gas chamber for 60 minutes. Experiment consisted of 2 replicates. The environment conditions in the chamber were set at 30 o C, 1000 lux, and initial relative humidity 60 %. After gas treatment, plants parts were separated into leaves, stems and roots, than dried in 70 o C for 48 hours and then weighed. After weighing, those plants parts were ground to a pine powder. After kjendhal digestion, N total content of plants were analyzed by distillation method. 15 N content of plant samples were analyzed by emission spectrometer ( Yasco, N-151). The amount of N-15 absorbed by plant was the total content of 15 N in the whole plants ( leaves, stem and root ) per gram dry weight of leaves. The amount of 15 N absorbed by plants varied among investigated plants. 15 N sorption of trees are in the range 0.28 - 68.31μg/g. The sorption of shrubs and ground cover plants varied in 1.97 - 100.02 μg/g and 2.38 - 24.06μg/g, respectively. According to the amount of 15 N sorption , the plants were divided into 3 groups of sorption level, high ( > 30.0μg/g), moderate ( 15 - 30 μg/g ), and low sorption level ( 15 μg/g). Results showed that among of 32 investigated trees, 64 shrubs and 13 ground cover plant, 4 species of trees and 13 species of shrubs performed a high sorption level and no one of ground cover plants performed a high sorption level. The species of trees and 15 species of shrubs that mention above are recommended to use as an element of landscape which to be functioned to reduce NO 2 atmospheric pollutant
The role of 15N in elucidating processes governing integrated soil fertility management strategies
International Nuclear Information System (INIS)
Vanlauwe, B.; Sanginga, N.; Merckx, R.
2005-01-01
Full text: Nitrogen is the most limiting nutrient for crop production in most of sub-Saharan Africa and has negative impacts on the environment if inputs, both mineral and organic, are not properly managed. Integrated Soil Fertility Management (ISFM) aims at integrating organic and mineral inputs and at site-specific management of mineral inputs to maximize the N use efficiency of both inputs. A series of experiments with 15 N labelled urea and organic matter of varying biochemical quality was carried out to test the hypothesis that mixing urea with organic matter will lead to temporary immobilization of urea-derived N and subsequently to a better utilization of urea-N by the crop and reduced losses of urea-N. Another set of experiments addressed the issue whether organic matter status affects the recovery of applied N fertilizer. First of all, in a lysimeter experiment, mixing 15 N-labeled urea with various organic materials with varying quality was observed not to significantly affect the drainage of urea-derived mineral N. Outflow of water at the bottom of the lysimeters was affected by the type of residue and the way of application. Secondly, in a nanoplot experiment with square metal cubes, 0.43 by 0.43 m, the recovery of applied 15 N-labeled urea was not affected by applying the urea together with incorporated organic materials of varying quality and averaged 23%. Recovery of applied urea in the soil (0-90 cm), however, was significantly higher after mixing the urea with maize stover than in the treatment which received only 90 kg urea-N ha -1 . This is likely to be related to the rather large N-immobilization potential of maize stover in view of its low quality. Leucaena residues have also been shown to initially immobilize N and this was related to the rather high content of soluble polyphenols. Cowpea stover is likely to decompose very fast and may have little impact on the urea-N dynamics. Thirdly, the recovery of 15 N-labeled urea, as affected by the
Energy Technology Data Exchange (ETDEWEB)
Farmanzadeh, Davood, E-mail: d.farmanzad@umz.ac.ir; Abdollahi, Tahereh
2016-11-01
Highlights: • The most stable structures of Cu{sub n} (n = 10–15) were structures with C{sub S} symmetry. • It is expected that even clusters are better electron donors than the odd clusters. • Acetylene and ethylene adsorb molecularly on the Cu nanoclusters surface. • Acetylene never orient toward di-σ mode for Cu−Cu bond in odd copper nanoclusters. • For di- σ-Cu{sub n}C{sub 2}H{sub 4}, no stable structure is identified. - Abstract: In this work, we report the results of density functional theory calculations of ethylene and acetylene adsorption on the most stable Cu{sub n} (n = 10–15) nanoclusters, in two π and di- σ adsorption modes. Both the hydrocarbons molecularly adsorbed on the surface. Our results show that the quality of interaction of ethylene and acetylene with odd copper nanoclusters (n = 11, 13, 15) is different from what is found on even copper nanoclusters (n = 10, 12, 14). One of the interesting features of this adsorption is that acetylene never orient toward di-σ mode for Cu−Cu bond in odd copper nanoclusters. Also, for di- σ-Cu{sub n}C{sub 2}H{sub 4}, no stable structure is identified. The highest interaction and deformation energies are seen for the adsorption of acetylene and ethylene on Cu{sub 11} in π-mode.
Site occupancies in ternary C15 ordered Laves phases
International Nuclear Information System (INIS)
Kotula, P.G.; Chu, F.; Thoma, D.J.; Mitchell, T.E.; Anderson, I.M.; Bentley, J.
1996-01-01
Site occupancies in three C15-structured AB 2 (X) Laves phases have been determined by Atom Location by CHanneling Enhanced MIcroanalysis (ALCHEMI). In NbCr 2 (V), the results were consistent with exclusive site occupancies of Nb for the A sublattice and Cr and V for the B sublattice. The B-site occupancy of V is not expected from atom size effects alone. In NbCr 2 (Ti), the results were consistent with Ti partitioning mostly to the A sites with some anti-site defects likely. In HfV 2 (Nb), the results were consistent with Nb partitioning between the A and B sites. The results of the ALCHEMI analyses of these ternary C15 Laves phase materials will be discussed with respect to previously determined phase diagrams and first-principles total energy and electronic structure calculations
Quintana-Rizzo, Ester; Torres, Joseph J; Ross, Steve W; Romero, Isabel; Watson, Kathleen; Goddard, Ethan; Hollander, David
2015-05-15
The blowout of the Deepwater Horizon (DWH) drill-rig produced a surface oil layer, dispersed micro-droplets throughout the water column, and sub-surface plumes. We measured stable carbon and nitrogen isotopes in mesopelagic fishes and shrimps in the vicinity of DWH collected prior to, six weeks after, and one year after the oil spill (2007, 2010 and 2011). In 2010, the year of the oil spill, a small but significant depletion of δ(13)C was found in two mesopelagic fishes (Gonostoma elongatum and Chauliodus sloani) and one shrimp (Systellaspis debilis); a significant δ(15)N enrichment was identified in the same shrimp and in three fish species (G. elongatum, Ceratoscopelus warmingii, and Lepidophanes guentheri). The δ(15)N change did not suggest a change of trophic level, but did indicate a change in diet. The data suggest that carbon from the Deepwater Horizon oil spill was incorporated into the mesopelagic food web of the Gulf of Mexico. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Aelion, W.C.M.; Engle, M.R.; Aelion, W.C.M.; Ma, H.
2010-01-01
Natural abundance of N stable isotopes used in combination with concentrations may be useful indicators of N-cycling in wetlands. Concentrations and 15 N signatures of NO 3 -, NH 4 and sediment organic nitrogen (SON) were measured in two impacted coastal golf course retention ponds and two natural marshes. Limited NO 3 was detected in natural site surface water or pore water, but both isotopic signature and concentrations of NO 3 - in surface water of impacted sites indicated anthropogenic inputs. In natural sites, NH 4 concentrations were greatest in deeper pore water and least in surface water, suggesting diffusion predominates. The natural sites had greater % SON, and 15 N indicated that the natural sites also had greater NH 4 + released from SON mineralization than impacted sites. In NO 3 --limited systems, neither concentrations nor 15 N natural abundance was able to provide information on N-cycling, while processes associated with NH 4 + were better elucidated by using both concentrations and 15 N natural abundance
15N indicates an active N-cycling microbial community in low carbon, freshwater sediments.
Sheik, C.
2017-12-01
Earth's large lakes are unique aquatic ecosystems, but we know little of the microbial life driving sedimentary biogeochemical cycles and ultimately the isotopic record. In several of these large lakes, water column productivity is constrained by element limitation, such as phosphorus and iron, creating oligotrophic water column conditions that drive low organic matter content in sediments. Yet, these sediments are biogeochemically active and have been shown to have oxygen consumption rates akin to pelagic ocean sediments and complex sulfur cycling dynamics. Thus, large oligotrophic lakes provide unique and interesting biogeochemical contrast to highly productive freshwater and coastal marine systems. Using Lake Superior as our study site, we found microbial community structure followed patterns in bulk sediment carbon and nitrogen concentrations. These observed patterns were loosely driven by land proximity, as some stations are more coastal and have higher rates of sedimentation, allochthonous carbon inputs and productivity than pelagic sites. Interestingly, upper sediment carbon and nitrogen stable isotopes were quite different from water column. Sediment carbon and nitrogen isotopes correlated significantly with microbial community structure. However, 15N showed much stronger correlation than 13C, and became heavier with core depth. Coinciding with the increase in 15N values, we see evidence of both denitrification and anammox processes in 16S rRNA gene libraries and metagenome assembled genomes. Given that microorganisms prefer light isotopes and that these N-cycling processes both contribute to N2 production and efflux from the sediment, the increase in 15N with sediment depth suggests microbial turnover. Abundance of these genomes also varies with depth suggesting these novel microorganisms are partitioning into specific sediment geochemical zones. Additionally, several of these genomes contain genes involved in sulphur cycling, suggesting a dual
Estimation of the endogenous N proportions in ileal digesta and faeces in 15N-labelled pigs
International Nuclear Information System (INIS)
Simon, O.; Bergner, H.
1987-01-01
4 castrated male pigs 40 kg fitted with simple 'T' cannulas in the terminal ileum were given 15 N-labelled ammonium salts, added to a low protein diet, for 6 days. Excretion of 15 N in urine and feces was monitored daily throughout the labelling and subsequent experimental periods. During the experimental period the pigs were given a diet based on wheat and fish meal, supplemented with varying levels of partially hydrolyzed straw meal to give crude fiber contents ranging from 40 to 132 g/kg. After adaptation to the particular levels of straw meal, feces and ileal digesta were collected during successive 24 h periods. N digestibility values were determined by the chromium oxide ratio method. The retention of 15 N-labelled non-specific N was 0.46 of the dose given. The validity of using urine values as a measure of 15 N abundance in endogenous N was demonstrated by the similarity of 15 N abundance in urine immediately before slaughter at the end of the experiment and in the digestive secretory organs thereafter. The average amount of endogenous N passing the terminal ileum was 3.4 g/day or 0.30-0.50 of total ileal N flow. This was not affected by dietary fiber level. The proportion of fecal N which was of endogenous origin was similar to that in ileal digesta, suggesting similar utilization of endogenous and residual dietary N by hindgut bacteria. Half the endogenous N entering the large intestine was reabsorbed there. Increasing dietary crude fiber from 40 to 132 g/kg increased fecal endogenous N excretion from 1.3 to 2.0 g/animal and day. (author)
Contribution of diet to δ15N, δ13C, and Δ14C values in the Pacific rat (Rattus exulans)
International Nuclear Information System (INIS)
Beavan, N.R.
2001-01-01
This thesis is the outcome of a research project undertaken to determine how diet can affect the reliability of rat bone (especially that of Rattus exulans) for accurate radiocarbon analysis. It addresses questions about the reliability of R. exulans bone for radiocarbon dating with respect to the survival of bone in archaeological and natural burial sites, laboratory processing methods, and the extent to which diet influences radiocarbon ages of bone. I have shown that R. exulans bone can return reliable radiocarbon dates, based on bone survival and the efficacy of chemical treatment to remove burial contamination. In three dietary investigations, stable isotope (δ 13 C and δ 15 N) and radiocarbon ( 14 C) analyses of modern populations and archaeological specimens also indicated that Rattus exulans and other omnivorous species can have radiocarbon values influenced by a diet linked to 14 C - depleted reservoirs. Moreover, depleted carbon reservoir effects are localised and variable in their magnitude. Work on modern populations also provided an improved means of isotopic analysis in an ecological study, where bomb-generated radiocarbon (Δ 14 C) signatures in the natural environment were used as for other 'tracer' studies, in conjunction with stable isotopes (δ 13 C and δ 15 N). Results indicated that the changing atmospheric 14 C signal fixed into the biota in a given year by photosynthesis is transferred from plants through trophic levels to end-members, including rats. The additional isotopic 'clue' about diet given by radiocarbon analysis offered a better understanding of the variation in diets of R. exulans in different habitats. Variation in the isotopic signal among individuals supported other observations that diets of scavenging rats are opportunistic and associated with faunal availability in different habitats. To better understand diet-induced radiocarbon variations, I also examined the carbon contribution to bone protein from essential amino acids
Schmittner, A.; Somes, C. J.
2016-06-01
A three-dimensional, process-based model of the ocean's carbon and nitrogen cycles, including 13C and 15N isotopes, is used to explore effects of idealized changes in the soft-tissue biological pump. Results are presented from one preindustrial control run (piCtrl) and six simulations of the Last Glacial Maximum (LGM) with increasing values of the spatially constant maximum phytoplankton growth rate μmax, which accelerates biological nutrient utilization mimicking iron fertilization. The default LGM simulation, without increasing μmax and with a shallower and weaker Atlantic Meridional Overturning Circulation and increased sea ice cover, leads to 280 Pg more respired organic carbon (Corg) storage in the deep ocean with respect to piCtrl. Dissolved oxygen concentrations in the colder glacial thermocline increase, which reduces water column denitrification and, with delay, nitrogen fixation, thus increasing the ocean's fixed nitrogen inventory and decreasing δ15NNO3 almost everywhere. This simulation already fits sediment reconstructions of carbon and nitrogen isotopes relatively well, but it overestimates deep ocean δ13CDIC and underestimates δ15NNO3 at high latitudes. Increasing μmax enhances Corg and lowers deep ocean δ13CDIC, improving the agreement with sediment data. In the model's Antarctic and North Pacific Oceans modest increases in μmax result in higher δ15NNO3 due to enhanced local nutrient utilization, improving the agreement with reconstructions there. Models with moderately increased μmax fit both isotope data best, whereas large increases in nutrient utilization are inconsistent with nitrogen isotopes although they still fit the carbon isotopes reasonably well. The best fitting models reproduce major features of the glacial δ13CDIC, δ15N, and oxygen reconstructions while simulating increased Corg by 510-670 Pg compared with the preindustrial ocean. These results are consistent with the idea that the soft-tissue pump was more efficient
International Nuclear Information System (INIS)
Acquaye, Solomon; Inubushi, Kazuyuki
2004-01-01
Nitrogen fertilizer and soil types exert an impact on plant and soil microbial biomass (SMB). A 15 N tracer experiment was conducted to compare the effects of the application of controlled-release coated urea (CRCU) and urea on SMB in gley (clayey) and sandy paddy soils. The fertilizers were applied at the rate of 8 g N m -2 for CRCU as deep-side placement and 10 g N m -2 for urea mixed into soil or applied into floodwater. The soil type and soil layer (surface: few millimeter depth of surface soil to include benthic algae; subsurface: 1 to 20 cm depth), but not the fertilizer type, affected the amount of microbial biomass N (B N ). On an area basis, subsurface soil layers contained about 2-3 times the amount of B N in the surface layers. The seasonal average B N amount i.e. at 1 to 20 cm depth, in the gley soil was 1.67 g N m -2 , compared to 1.20 g N m -2 for the sandy soil. The proportion of B N in total soil N was significantly influenced by the soil type and soil layer, and was higher for the surface layers of both soils and subsurface layer of the sandy soil than for the subsurface layer of gley soil. Soil type, soil layer, and fertilizer type significantly influenced the amount of microbial biomass 15 N (B 15N ). Unlike B N , the amount of B 15N was significantly higher in the surface (11.9-177.3 mg N m -2 ) than in the subsurface soil layers (4.8-83.6 mg N m -2 ), especially with urea application between 60 and 120 DAT (days after transplanting). At 30 DAT, the subsurface layer of the sandy soil showed a higher B 15N (218 mg N m -2 ) amount than the surface layer (133.4 mg N m -2 ). Sandy soil (4.8-218 mg N m -2 ) and urea (6.2-218 mg N m -2 ) induced a larger increase of the amount of B 15 N than the gley soil (6.2-83.6 mg N m -2 ) and CRCU (4.8-40 mg Nm -2 ). Again, the sandy soil, surface soil layers, and urea induced a higher proportion (%) of B 15N in B N than the gley soil, subsurface soil layers, and CRCU, respectively. The soil type affected B N
Determination of the δ15N of nitrate in water; RSIL lab code 2899
Coplen, Tyler B.; Qi, Haiping; Revesz, Kinga; Casciotti, Karen; Hannon, Janet E.
2007-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 2899 is to determine the δ15N of nitrate (NO3-) in water. The δ15N of the dissolved NO3- is analyzed by conversion of the NO3- to nitrous oxide (N2O), which serves as the analyte for mass spectrometry. A culture of denitrifying bacteria is used in the enzymatic conversion of the NO3- to N2O, which follows the pathway shown in equation 1: NO3- → NO2- → NO → 1/2 N2O (1) Because the bacteria Pseudomonas aureofaciens lack N2O reductive activity, the reaction stops at N2O, unlike the typical denitrification reaction that goes to N2. After several hours, the conversion is complete, and the N2O is extracted from the vial, separated from volatile organic vapor and water vapor by an automated -65 °C isopropanol-slush trap, a Nafion drier, a CO2 and water removal unit (Costech #021020 carbon dioxide absorbent with Mg(ClO4)2), and trapped in a small-volume trap immersed in liquid nitrogen with a modified Finnigan MAT (now Thermo Scientific) GasBench 2 introduction system. After the N2O is released, it is further purified by gas chromatography before introduction to the isotope-ratio mass spectrometer (IRMS). The IRMS is a Thermo Scientific Delta V Plus continuous flow IRMS (CF-IRMS). It has a universal triple collector, consisting of two wide cups with a narrow cup in the middle; it is capable of simultaneously measuring mass/charge (m/z) of the N2O molecule 44, 45, and 46. The ion beams from these m/z values are as follows: m/z = 44 = N2O = 14N14N16O; m/z = 45 = N2O = 14N15N16O or 14N14N17O; m/z = 46 = N2O = 14N14N18O. The 17O contributions to the m/z 44 and m/z 45 ion beams are accounted for before δ15N values are reported.
Le Loc'h, F; Durand, J-D; Diop, K; Panfili, J
2015-04-01
Potential trophic competition between two sympatric mullet species, Mugil cephalus and Mugil curema, was explored in the hypersaline estuary of the Saloum Delta (Senegal) using δ(13) C and δ(15) N composition of muscle tissues. Between species, δ(15) N compositions were similar, suggesting a similar trophic level, while the difference in δ(13) C compositions indicated that these species did not feed from exactly the same basal production sources or at least not in the same proportions. This result provides the first evidence of isotopic niche segregation between two limno-benthophageous species belonging to the geographically widespread, and often locally abundant, Mugilidae family. © 2015 The Fisheries Society of the British Isles.
Effects of growth and change of food on the δ15N in marine fishes
International Nuclear Information System (INIS)
Kasamatsu, Fujio; Sato, Rie; Park, Kwang Lai
1998-01-01
Information is limited concerning variation of the δ 15 N with growth in marine organisms and consequently the effect of growth of marine biota on the δ 15 N is not yet well understood. The δ 15 N in 26 species of marine fishes taken from Japanese coastal waters together with 4664 stomach contents of these fishes were examined to investigate the effects of food habits and growth on the δ 15 N. The mean δ 15 N for two species that fed mainly on large-size fishes and six species that fed mainly on small-size fishes were 14.5±1.0per mille and 12.8±0.7per mille, respectively. For five species that fed mainly on decapod crustaceans, two species that fed mainly on zooplankton, and three species that fed mainly on benthos (mainly Polychaeta), the δ 15 N were 13.0±0.7, 9.7±0.9, and 12.2±1.2per mille, respectively. The mean δ 15 N in the species whose prey were mainly fish or decapod crustaceans was about 3-5per mille higher than the species whose prey was mainly zooplankton. Within the four species that shift their food habits with growth to higher trophic level, the δ 15 N significantly increased with growth in one species (Pacific cod), while not significant increase in the δ 15 N with growth in the remaining species. (author)
Directory of Open Access Journals (Sweden)
Elizabeth Yohannes
Full Text Available Stable isotope analysis of commercially and ecologically important fish can improve understanding of life-history and trophic ecology. However, accurate interpretation of stable isotope values requires knowledge of tissue-specific isotopic turnover that will help to describe differences in the isotopic composition of tissues and diet. We performed a diet-switch experiment using captive-reared parasite-free Eurasian perch (Perca fluviatilis and wild caught specimens of the same species, infected with the pike tapeworm Triaenophorus nodulosus living in host liver tissue. We hypothesize that metabolic processes related to infection status play a major role in isotopic turnover and examined the influence of parasite infection on isotopic turn-over rate of carbon (δ13C, nitrogen (δ15N and sulphur (δ34S in liver, blood and muscle. The δ15N and δ13C turnovers were fastest in liver tissues, followed by blood and muscle. In infected fish, liver and blood δ15N and δ13C turnover rates were similar. However, in infected fish, liver and blood δ13C turnover was faster than that of δ15N. Moreover, in infected subjects, liver δ15N and δ13C turnover rates were three to five times faster than in livers of uninfected subjects (isotopic half-life of ca.3-4 days compared to 16 and 10 days, respectively. Blood δ34S turnover rate were about twice faster in non-infected individuals implying that parasite infection could retard the turnover rate of δ34S and sulphur containing amino acids. Slower turnover rate of essential amino acid could probably decrease individual immune function. These indicate potential hidden costs of chronic and persistent infections that may have accumulated adverse effects and might eventually impair life-history fitness. For the first time, we were able to shift the isotope values of parasites encapsulated in the liver by changing the dietary source of the host. We also report variability in isotopic turnover rates between tissues
International Nuclear Information System (INIS)
Culbert, P.A.; Jianming Lu; Adam, M.J.
1997-01-01
The synthesis of methyl 15-(4-trimethylstannylphenyl)pentadecanoate (p-SnPPA), a precursor for the regiospecific production of 15-(4-[ 123 I]-iodophenyl)pentadecanoic acid, is described. The stannylated precursor is synthesized in six steps from 4-bromophenylacetylene in an overall yield of 16%. p-SnPPA reacts with N.C.A. [ 123 I]NaI in the presence of peracetic acid to yield IPPA in 62% radiochemical yield following hydrolysis. (author)
Energy Technology Data Exchange (ETDEWEB)
Aigner, Martina [Soil and Water Management and Crop Nutrition Laboratory, Joint FAO/IAEA Division for Nuclear Techniques in Food and Agriculture, Seibersdorf (Austria)
2014-07-15
Eight out of twelve laboratories (67%) participating in the nitrogen analysis reported {sup 15}N-data within the control limits for the enriched plant sample and eight out of nine (89%) participating laboratories for carbon analysis reported {sup 13}C isotopic abundance results within the control limits for this test sample. The reported analytical data and WEPAL evaluation of the {sup 15}N enriched plant material produced by SWMCNL is shown. All participants received a certificate of participation. Worldwide comparison of stable {sup 15}N and {sup 13}C isotope measurements will provide confidence in the laboratory's analytical performance and is hence an invaluable tool for external quality control. It is hoped that in the future more stable isotope laboratories will make use of this unique opportunity to assess their analytical performance and provide evidence of the high quality of their analytical data.
International Nuclear Information System (INIS)
Trivelin, P.C.O.; Matsui, E.; Saito, S.M.T.; Libardi, P.L.; Salati, E.
1984-01-01
A experimental work under field conditions to develop a method to measure atmospheric N 2 -fixation by leguminous plants, using a low enrichment 15 N 2 technique, is carried out. The experiment was developed using a N 2 -fixation measuring chamber on Terra Roxa Estruturada. The beam plants had their aereal part under normal conditions and the rooting system confined, through which a mixture of Ar, O 2 and N 2 labelled with 15 N (1.9% atom excess) was circulated from the 22nd to the 31st day from planting. Samples of the gaseous Ar, O 2 and N 2 mixture were analysed by mass spectrometry to determine 15 N concentrations and O 2 and CO 2 contents. The N 2 -fixed was measured by determination of total-N and isotopic concentration of nitrogen in the plants. (M.A.C.) [pt
Plot-size for 15N-fertilizer recovery studies by tanzania-grass
International Nuclear Information System (INIS)
Martha Junior, Geraldo Bueno; Trivelin, Paulo Cesar Ocheuze; Corsi, Moacyr
2009-01-01
The understanding of the N dynamics in pasture ecosystems can be improved by studies using the 15 N tracer technique. However, in these experiments it must be ensured that the lateral movement of the labeled fertilizer does not interfere with the results. In this study the plot-size requirements for 15 N-fertilizer recovery experiments with irrigated Panicum maximum cv. Tanzania was determined. Three grazing intensities (light, moderate and intensive grazing) in the winter, spring and summer seasons were considered. A 1 m 2 plot-size, with a grass tussock in the center, was adequate, irrespective of the grazing intensity or season of the year. Increasing the distance from the area fertilized with 15 N negatively affected the N derived from fertilizer (Npfm) recovered in herbage.The lowest decline in Npfm values were observed for moderate and light grazing intensities. This fact might be explained by the vigorous growth characteristics of these plants. Increasing the grazing intensity decreased the tussock mass and, the smaller the tussock mass, the greater was the dependence on fertilizer nitrogen. (author)
DEFF Research Database (Denmark)
Laberge, G.; Ambus, P.; Hauggaard-Nielsen, H.
2006-01-01
The decline of N from N-15-labelled mature pea residues was followed in unplanted soil over 16.5 yr. Eight years after residue incorporation, 24% of the residue N-15 input was still present in the soil and, after 16.5 yr, 16% of the residue N-15 input remained. A double exponential model......-amended soils were obtaining 1.7% of their N from residue N. This is, to our knowledge, the longest study on decay of N in soils from N-15-labelled crop residues. The current study thus provides a unique data set for our empirical understanding of N-dynamics in agricultural systems, which is a prerequisite...
Werth, Martin; Spiegel, Ann-Kathrin; Kazda, Marian
2013-01-01
The transformation from self-supporting lianas to host-supported climbing lianas is related to re-allocation of biomass and nutrients among plant organs. Therefore, first, variations in leaf mass per area (LMA), leaf carbon and nitrogen allocation and (13)C and (15)N natural abundances were analysed among three tropical Passiflora species (P. edulis, P. ligularis, and P. tripartita) in a greenhouse study. Second, the influence of a climbing support was considered for each species and parameter. P. ligularis leaves were most enriched in (13)C in both treatments when compared with the other two species. This enrichment was caused by a high LMA, which is related to a high internal resistance to CO(2) diffusion. For P. edulis and P. tripartita, δ(13)C was additionally increasing with nitrogen content per area. Generally, there were no differences when considering carbon and nitrogen allocation to leaves of host-supported and self-supporting lianas. The only hints towards increased investment into leaves after the transition from self-supporting to host-supported stages could be seen by a trend to increased leaf areas and masses. δ(13)C values of supported P. edulis or P. tripartita plants were significantly increasing faster than those of non-supported plants once the interactions of leaf mass or nitrogen content per area were accounted for. Hence, the offer of a climbing support had only a minor impact on δ(13)C or δ(15)N values in vitro, but this could be different with increasing age of lianas in vivo.
Utilization of {sup 15}N-Diammonium Phosphate by Ruminants to Produce Milk and Meat Proteins
Energy Technology Data Exchange (ETDEWEB)
Piva, G.; Silva, S. [Istituto di Zootecnicae di Chimica Agraria, Facolta di Agraria Univ. Cattolicas. Cuore, Piacenza (Italy)
1968-07-01
The authors investigated the alimentary role of diammonium phosphate (DAP) in ruminants. For this study DAP labelled with {sup 15}N was used; analysis of the {sup 15}N atomic per cent excess was made with an Italelettronica mass spectrophotometer (model SP 21 F) and the amino acid determination by a Beckman-Spinco amino acid analyser (model 120B) fitted with a preparative column. For the experiment 7 g of DAP at 15 and 20 at. % excess {sup 15}N were administered once to mature lactating and non-lactating sheep, respectively. The measurement of {sup 15}N in the protein and isolated amino acids of milk and meat showed: (1) The milk protein produced in the first 24 h contained the highest atomic per cent excess of {sup 15}SN, 0.093; (2) That the supplemental {sup 15}N was found in all the amino acids of milk proteins except tryptophane. The atomic per cent excess of {sup 15}N was observed to vary between the various amino acids. These results confirmed previous observations on bacterial protein synthesized from DAP. (3) Muscle protein {sup 15}N maximized on the third day after administration of the {sup 15}N-DAP, with an atomic per cent excess of 0.040; (4) The atomic per cent excess of {sup 15}N in the individual amino acids of muscle protein is significant in only two amino' acids, serine and cystine; and (5) That after 8 d of adaptation there are no traces of DAP in milk or meat proteins, urine or faeces. The authors conclude that the ruminant, after a period of adaptation and through the mediation of ruminant microorganisms, is able to use the nitrogen of diammonium phosphate for the synthesis of milk and meat proteins. (author)
Asian climate change under 1.5–4 °C warming targets
Directory of Open Access Journals (Sweden)
Ying Xu
2017-06-01
Full Text Available Based on simulations of 18 CMIP5 models under three RCP scenarios, this article investigates changes in mean temperature and precipitation and their extremes over Asia in the context of global warming targets of 1.5–4 °C, and further compares the differences between 1.5 °C and 2 °C targets. Results show that relative to the pre-industrial era, the mean temperature over Asia increases by 2.3 °C, 3.0 °C, 4.6 °C, and 6.0 °C at warming targets of 1.5 °C, 2 °C, 3 °C, and 4 °C, respectively, with stronger warming in high latitudes than in low latitudes. The corresponding enhancement in mean precipitation over the entire Asian region is 4.4%, 5.8%, 10.2%, and 13.0%, with significant regional differences. In addition, an increase in warm extremes, a decrease in cold extremes, and a strengthening in the variability of amounts of extreme precipitation are projected. Under the 1.5 °C target, compared with the climate under the 2 °C target, the mean temperature will be lower by 0.5–1 °C over Asia; the mean precipitation will be less by 5%–20% over most of Asia, but will be greater by about 10%–15% over West Asia and western South Asia; extreme high temperatures will be uniformly cooler throughout the Asian region, and the warming in extreme low temperatures will decrease significantly in high latitudes of Asia; extreme precipitation will be weaker over most of Asia but will be stronger over West Asia and western South Asia. Under the 1.5 °C and 2 °C warming targets, the probability of very hot weather (anomalies greater than 1σ, σ is standard deviation, extremely hot weather (anomalies greater than 3σ, and extremely heavy precipitation (anomalies greater than 3σ occurring will increase by at least once, 10%, and 10%, respectively, compared to the reference period (1861–1900.
Cardenas, Laura; Loick, Nadine; Dixon, Liz; Matthews, Peter; Gilsanz, Claudia; Bol, Roland; Lewicka-Szczebak, Dominika; Well, Reinhard
2016-04-01
N2O is considered to be an important GHG with soils representing its major source and accounting for approximately 6% of the current global warming and is also implicated in the depletion of stratospheric ozone. The atmospheric N2O concentration has been increasing since the Industrial Revolution making the understanding of its sources and removal processes very important for development of mitigation strategies. Bergstermann et al. (2011) found evidence of the existence of more than one pool of nitrate undergoing denitrification in a silty clay loam arable soil amended with glucose/nitrate solution. The Rayleigh type model was used to simulate d15N of N2O using process rates and associated fractionation factors, but assumptions for some of the model parameters had to be made due to lack of available data. In this study we carried out 2 incubation experiments in order to parameterise the model. To restrict the volume of soil reached by the amendment, we used blocks containing 3 soil cores that were incubated in one vessel to measure emissions of NO, N2O, N2 and CO2 from a clay grassland soil amended with KNO3 (N) and glucose (C) in three treatments: '1C' only 1 core received N and C (the other 2 received water), '3C' 3 cores received N and C, and 'Control' (received water only). The results showed changes in the d15Nbulk trends after day 6 post amendment application, coinciding with the decrease of N2O fluxes. We also report the results in the 15N site preference (SP) and d18O. We will show the results from the model validation based on this data.
Utilization of /sup 15/N in the sequence of mineral fertilizer - forage - animal - slurry - forage
Energy Technology Data Exchange (ETDEWEB)
Peschke, H [Humboldt-Universitaet, Berlin (German Democratic Republic). Sektion Pflanzenproduktion
1981-12-01
After systematic application of /sup 15/N-ammonium nitrate, the change of the dinuclidic composition and /sup 15/N quantity was studied by isotope analysis of several open systems in the sequence mineral fertilizer - (soil) - forage - (animal) - slurry - (soil) - forage. The relative /sup 15/N isotope frequency of 50 atom% in the mineral fertilizer declined to 12.2 to 21.4 atom% in the forage (beet, oats, hay) and went down to 3.15 atom% in the slurry of a dairy cow fed on this forage. Silage maize manured with the slurry of the dairy cow only showed 1.98 atom %, green oats grown after the silage maize on the same area was found to have 0.45 atom%. The /sup 15/N quantity of 104.5 g N in the fertilizer gradually decreased to 41.6 g N in the forage, 30.5 g N in the slurry and 22.6 g N in the silage maize. The causes discussed are /sup 15/N isotope dilution as qualitative factor and productive and unproductive N losses as quantitative factors.
International Nuclear Information System (INIS)
Shrestha, R.K.; Ladha, J.K.
1996-01-01
A pot experiment in the greenhouse was conducted to assess the usefulness of 15 N enrichment of soil NH 4 + -N as an alternative to a non-fixing reference plant to determine varietal differences in N 2 fixation among rice varieties. Diverse rice genotypes were grown in a 15 N stabilized soil obtained after 6 wk of application under flooded conditions. Atom % 15 N excess of soil NH 4 + -N was decreased exponentially with amount of N mineralized (r=99). Close agreement was observed between the 15 N enrichment of reference rice plant and 15 N enrichment of KCl extractable NH 4 + -N from unplanted pots maintained in the greenhouse. Whole plant atom % 15 N excess was inversely correlated within growth duration. Therefore, it was necessary to calculate Ndfa within growth duration. Ndfa estimated within the growth duration using 15 N enrichment of soil NH 4 + -N and reference rice genotype correlated almost perfectly (r=998). Thus the study demonstrated the potential of using 15 N enrichment of soil NH 4 + -N as a non-N 2 fixing reference for reliable estimate of biological nitrogen fixation by nonlegumes under flooded conditions. (author)
15N dilution technique of assessing the contribution of nitrogen fixation to rice plant
International Nuclear Information System (INIS)
Ventura, Wilbur; Watanabe, Iwao
1983-01-01
An attempt to correlate the positive nitrogen balance in rice-soil system with the 15 N dilution in rice plants was made to see if isotope dilution can be used to assess the contribution of nitrogen fixation to the nitrogen nutrition of rice. 15 N ammonium sulfate and sucrose were added to the moist soil in pots to label biomass nitrogen fraction. The rice-soil system with higher nitrogen gain had lower 15 N content in the rice plants. When the surface of pots was covered with black cloths to suppress photodependent N 2 fixation, no significant nitrogen gain was observed. Significant gain was found in the rice-flooded soil system exposed to light, and the 15 N content of plants decreased in allowing the photodependent N 2 fixation by blue-green algae symbiosis. The contribution of plant nitrogen derived from photodependent N 2 fixation was estimated to be 20-30 % of the positive nitrogen gain in the system by the 15 N dilution technique using the rice-covered soil as reference system. (Mori, K.)
Sawa, N; Okamura, K; Zendo, T; Himeno, K; Nakayama, J; Sonomoto, K
2010-07-01
To characterize novel multiple bacteriocins produced by Leuconostoc pseudomesenteroides QU 15. Leuconostoc pseudomesenteroides QU 15 isolated from Nukadoko (rice bran bed) produced novel bacteriocins. By using three purification steps, four antimicrobial peptides termed leucocin A (ΔC7), leucocin A-QU 15, leucocin Q and leucocin N were purified from the culture supernatant. The amino acid sequences of leucocin A (ΔC7) and leucocin A-QU 15 were identical to that of leucocin A-UAL 187 belonging to class IIa bacteriocins, but leucocin A (ΔC7) was deficient in seven C-terminal residues. Leucocin Q and leucocin N are novel class IId bacteriocins. Moreover, the DNA sequences encoding three bacteriocins, leucocin A-QU 15, leucocin Q and leucocin N were obtained. These bacteriocins including two novel bacteriocins were identified from Leuc. pseudomesenteroides QU 15. They showed similar antimicrobial spectra, but their intensities differed. The C-terminal region of leucocin A-QU 15 was important for its antimicrobial activity. Leucocins Q and N were encoded by adjacent open reading frames (ORFs) in the same operon, but leucocin A-QU 15 was not. These leucocins were produced concomitantly by the same strain. Although the two novel bacteriocins were encoded by adjacent ORFs, a characteristic of class IIb bacteriocins, they did not show synergistic activity. © 2010 The Authors. Journal compilation © 2010 The Society for Applied Microbiology.
Broek, Taylor A B; Walker, Brett D; Andreasen, Dyke H; McCarthy, Matthew D
2013-11-15
Compound-specific isotope analysis of individual amino acids (CSI-AA) is a powerful new tool for tracing nitrogen (N) source and transformation in biogeochemical cycles. Specifically, the δ(15)N value of phenylalanine (δ(15)N(Phe)) represents an increasingly used proxy for source δ(15)N signatures, with particular promise for paleoceanographic applications. However, current derivatization/gas chromatography methods require expensive and relatively uncommon instrumentation, and have relatively low precision, making many potential applications impractical. A new offline approach has been developed for high-precision δ(15)N measurements of amino acids (δ(15)N(AA)), optimized for δ(15)N(Phe) values. Amino acids (AAs) are first purified via high-pressure liquid chromatography (HPLC), using a mixed-phase column and automated fraction collection. The δ(15)N values are determined via offline elemental analyzer-isotope ratio mass spectrometry (EA-IRMS). The combined HPLC/EA-IRMS method separated most protein AAs with sufficient resolution to obtain accurate δ(15)N values, despite significant intra-peak isotopic fractionation. For δ(15)N(Phe) values, the precision was ±0.16‰ for standards, 4× better than gas chromatography/combustion/isotope ratio mass spectrometry (GC/C/IRMS; ±0.64‰). We also compared a δ(15)N(Phe) paleo-record from a deep-sea bamboo coral from Monterey Bay, CA, USA, using our method versus GC/C/IRMS. The two methods produced equivalent δ(15)N(Phe) values within error; however, the δ(15)N(Phe) values from HPLC/EA-IRMS had approximately twice the precision of GC/C/IRMS (average stdev of 0.27‰ ± 0.14‰ vs 0.60‰ ± 0.20‰, respectively). These results demonstrate that offline HPLC represents a viable alternative to traditional GC/C/IMRS for δ(15)N(AA) measurement. HPLC/EA-IRMS is more precise and widely available, and therefore useful in applications requiring increased precision for data interpretation (e.g. δ(15)N paleoproxies
Directory of Open Access Journals (Sweden)
Blair C R Dancy
Full Text Available Membranes define cellular and organelle boundaries, a function that is critical to all living systems. Like other biomolecules, membrane lipids are dynamically maintained, but current methods are extremely limited for monitoring lipid dynamics in living animals. We developed novel strategies in C. elegans combining 13C and 15N stable isotopes with mass spectrometry to directly quantify the replenishment rates of the individual fatty acids and intact phospholipids of the membrane. Using multiple measurements of phospholipid dynamics, we found that the phospholipid pools are replaced rapidly and at rates nearly double the turnover measured for neutral lipid populations. In fact, our analysis shows that the majority of membrane lipids are replaced each day. Furthermore, we found that stearoyl-CoA desaturases (SCDs, critical enzymes in polyunsaturated fatty acid production, play an unexpected role in influencing the overall rates of membrane maintenance as SCD depletion affected the turnover of nearly all membrane lipids. Additionally, the compromised membrane maintenance as defined by LC-MS/MS with SCD RNAi resulted in active phospholipid remodeling that we predict is critical to alleviate the impact of reduced membrane maintenance in these animals. Not only have these combined methodologies identified new facets of the impact of SCDs on the membrane, but they also have great potential to reveal many undiscovered regulators of phospholipid metabolism.
Rowe, E.C.; Cadisch, G.
2002-01-01
Nitrogen flows in agroforestry systems can be quantified by applying excess 15N to one pool or part of the system and subsequently measuring the quantity of 15N in other pools. Accurate quantifications depend on accurate determination of the mass, percentage N, and percentage 15N enrichment of each
Energy Technology Data Exchange (ETDEWEB)
Heine, W; Richter, I; Plath, C; Wutzke, K; Kupatz, P; Drescher, U [Rostock Univ. (German Democratic Republic)
1981-10-01
Investigation of protein metabolism in nutritional pediatric research by means of /sup 15/N tracer techniques has been relatively seldom used up to now. /sup 15/N labelled compounds for these purposes are not injurious to health. The technique is based on oral or intravenous application of the tracer substances and on /sup 15/N analysis of the urine fractions. The subsequent calculation of protein synthesis and breakdown rate, turnover and reutilisation of amino acids from protein breakdown as well as the size of the metabolic pool offers detailed information of protein metabolism. Determination of these parameters was performed in infants on mother's milk and formula feeding and on chemically defined diet. As an example of utilisation of D-amino acids for protein synthesis the /sup 15/N-D-phenylalanin retention on parenteral nutrition was found to be 33% of the applied dosis at an average. An oral /sup 15/N glycine loading test proved to be of value for the prediction of the therapeutic effect of human growth hormon in numerous types of dwarfism. Further application of /sup 15/N tracer technique dealt with utilisation of /sup 15/N urea for bacterial protein synthesis of the intestinal flora and with incorporation of /sup 15/N from /sup 15/N glycine and /sup 15/N lysine into the jejunal mucosa for measuring the enterocyte regeneration.
States of 15C via the (18O,16O) reaction
Cappuzzello, F; Cunsolo, A; Foti, A; Orrigo, S E A; Rodrigues, M R D; Borello-Lewin, T; Carbone, D; Schillaci, C
2010-01-01
A study of the 15C states was pursued in 2008 at the Catania INFN-LNS laboratory by the 13C(18O,16O)15C reaction at 84 MeV incident energy. The 16O ejectiles were detected at forward angles by the MAGNEX magnetic spectrometer. Thanks to an innovative technique the ejectiles were identified without the need of time of flight measurements. Exploiting the large momentum acceptance (25%) and solid angle (50 msr) of the spectrometer, the 15C energy spectra were obtained with a quite relevant yield up to about 20 MeV excitation energy. The application of the powerful technique of the trajectory reconstruction did allow to get an energy resolution of about 250 keV FWHM, limited mainly by straggling effects. The spectra show several known low lying states up to about 7 MeV excitation energy as well as two unknown resonant structures at about 11.4 and 13.5 MeV. The strong excitation of these latter together with the measured width of about 2 MeV FWHM could indicate the presence of collective modes of excitation connec...
Energy Technology Data Exchange (ETDEWEB)
Martha Junior, Geraldo Bueno [EMBRAPA Cerrados, Planaltina, DF (Brazil)], e-mail: gbmartha@cpac.embrapa.br; Trivelin, Paulo Cesar Ocheuze [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil). Lab. de Isotopos Estaveis], e-mail: pcotrive@cena.usp.br; Corsi, Moacyr [Escola Superior de Agricultura Luiz de Queiroz (ESALQ/USP), Piracicaba, SP (Brazil). Dept. de Zootecnia], e-mail: moa@esalq.usp.br
2009-07-01
The understanding of the N dynamics in pasture ecosystems can be improved by studies using the {sup 15}N tracer technique. However, in these experiments it must be ensured that the lateral movement of the labeled fertilizer does not interfere with the results. In this study the plot-size requirements for {sup 15}N-fertilizer recovery experiments with irrigated Panicum maximum cv. Tanzania was determined. Three grazing intensities (light, moderate and intensive grazing) in the winter, spring and summer seasons were considered. A 1 m{sup 2} plot-size, with a grass tussock in the center, was adequate, irrespective of the grazing intensity or season of the year. Increasing the distance from the area fertilized with {sup 15}N negatively affected the N derived from fertilizer (Npfm) recovered in herbage.The lowest decline in Npfm values were observed for moderate and light grazing intensities. This fact might be explained by the vigorous growth characteristics of these plants. Increasing the grazing intensity decreased the tussock mass and, the smaller the tussock mass, the greater was the dependence on fertilizer nitrogen. (author)
International Nuclear Information System (INIS)
Latkovics, Gy.-ne
1979-01-01
A composting experiment was set up on chernozem-type brown forest soil to investigate the transformation of nitrogen fertilizer and the mineralization of organic N. For the average soil sample from the ploughed layer the pH value was 7.1, the mineral N content 2.85 mg, the fixed ammonium content 15.98 mg and the total N 140.8 mg100/g soil. The humus content was 1.91%. In the experiment 15 N labelled ammonium nitrate was used, and, as 15 N labelled organic matter, ground, air-dried rye-grass and bean stalks and with approximately the same N content as the 0.4% of the soil quantity measured. The values obtained by chemical methods and isotope indication show that the N-loss during composting was negligible and that the methods tested are suitable for the investigation of the transformation processes of nitrogen. (author)
1H and 15N resonance assignments of oxidized flavodoxin from Anacystis nidulans with 3D NMR
International Nuclear Information System (INIS)
Clubb, R.T.; Thanabal, V.; Wagner, G.; Osborne, C.
1991-01-01
Proton and nitrogen-15 sequence-specific nuclear magnetic resonance assignments have been determined for recombinant oxidized flavodoxin from Anacystis nidulans. Assignments were obtained by using 15 N- 1 H heteronuclear three-dimensional (3D) NMR spectroscopy on a uniformly nitrogen-15 enriched sample of the protein, pH 6.6, at 30C. For 165 residues, the backbone and a large fraction of the side-chain proton resonances have been assigned. Medium- and long-range NOE's have been used to characterize the secondary structure. In solution, flavodoxin consists of a five-stranded parallel β sheet involving residues 3-9, 31-37, 49-56, 81-89, 114-117, and 141-144. Medium-range NOE's indicate that presence of several helices. Several 15 N and 1 H resonances of the flavin mononucleotide (FMN) prosthetic group have been assigned. The FMN-binding site has been investigated by using polypeptide-FMN NOE's
International Nuclear Information System (INIS)
Lara Cabejas, W.A.R.; Trivelin, P.C.O.
1990-01-01
Looking for stillage labeling with 15 N for further utilization in studies of mineral fertilization of sugar-cane, 15 N-(NH 4 ) 2 SO 4 (43.5ppm, 45.401 atoms% 15 N) was supplemented in a single fermentative cycle, in a laboratory scale. A nitrogen fractionation was made between insoluble-N and soluble-N in several componentes of the fermentative process (yeast, sugar-cane juice, centrifugate wine, centrifugate yeast and stillage) with the objective of studying the added nitrogen distribution and its isotopic abundance composition. The nitrogen fractionation, and the isotopic analysis by mass spectrometry of 15 N, in the fractions of the several components of the fermentative process, showed 81.1% of N recovery, being 3.2% in stillage and mainly in a soluble-N fraction (71.4%), and the rest found in centrifugate yeast (77.9%), distributed mainly in a insoluble-N fraction (92.0%). Desuniform isotopic label was found in stillage, between soluble-N (1.333 atoms% 15 N) and insoluble-N fractions (0.744 atoms% 15 N). Means to improve the isotopic uniformity in these fractions is discussed. (autor) [pt
15N-labeled nitrogen from green manure and ammonium sulfate utilization by the sugarcane ratoon
International Nuclear Information System (INIS)
Ambrosano, Edmilson Jose; Rossi, Fabricio; Trivelin, Paulo Cesar Ocheuze; Cantarella, Heitor; Ambrosano, Glaucia Maria Bovi; Schammass, Eliana Aparecida; Muraoka, Takashi
2011-01-01
Legumes as green manure are alternative sources of nitrogen (N) for crops and can supplement or even replace mineral nitrogen fertilization due to their potential for biological nitrogen fixation (BNF). The utilization of nitrogen by sugarcane (Saccharum spp.) fertilized with sunn hemp (Crotalaria juncea L.) and ammonium sulfate (AS) was evaluated using the 15 N tracer technique. N was added at the rate of 196 and 70 kg ha -1 as 15 N-labeled sunn hemp green manure (SH) and as ammonium sulfate (AS), respectively. Treatments were: (I) Control; (II) AS 15 N; (III) SH 15 N + AS; (IV) SH 15 N; and (V) AS 15 N + SH. Sugarcane was cultivated for five years and was harvested three times. 15 N recovery was evaluated in the two first harvests. In the sum of the three harvests, the highest stalk yields were obtained with a combination of green manure and inorganic N fertilizer; however, in the second cutting the yields were higher where SH was used than in plots with AS. The recovery of N by the first two consecutive harvests accounted for 19 to 21% of the N applied as leguminous green manure and 46 to 49% of the N applied as AS. The amounts of inorganic N, derived from both N sources, present in the 0-0.4 m layer of soil in the first season after N application and were below 1 kg ha -1 . (author)
International Nuclear Information System (INIS)
Axente, D.
2005-01-01
15 N utilization for nitride nuclear fuels production for nuclear power reactors and accelerator - driven systems is presented. Nitride nuclear fuel is the obvious choice for advanced nuclear reactors and ADS because of its favorable properties: a high melting point, excellent thermal conductivity, high fissile density, lower fission gas release and good radiation tolerance. The application of nitride fuels in nuclear reactors and ADS requires use of 15 N enriched nitrogen to suppress 14 C production due to (n,p) reaction on 14 N. Accelerator - driven system is a recent development merging of accelerator and fission reactor technologies to generate electricity and transmute long - lived radioactive wastes as minor actinides: Np, Am, Cm. A high-energy proton beam hitting a heavy metal target produces neutrons by spallation. The neutrons cause fission in the fuel, but unlike in conventional reactors, the fuel is sub-critical and fission ceases when the accelerator is turned off. Nitride fuel is a promising candidate for transmutation in ADS of minor actinides, which are converted into nitrides with 15 N for that purpose. Tacking into account that the world wide market is about 20 to 40 Kg 15 N annually, the supply of that isotope for nitride fuel production for nuclear power reactors and ADS would therefore demand an increase in production capacity by a factor of 1000. For an industrial plant producing 100 t/y 15 N, using present technology of isotopic exchange in NITROX system, the first separation stage of the cascade would be fed with 10M HNO 3 solution of 600 mc/h flow - rate. If conversion of HNO 3 into NO, NO 2 , at the enriching end of the columns, would be done with gaseous SO 2 , for a production plant of 100 t/y 15 N a consumption of 4 million t SO 2 /y and a production of 70 % H 2 SO 4 waste solution of 4.5 million mc/y are estimated. The reconversion of H 2 SO 4 into SO 2 in order to recycle of SO 2 is a problem to be solved to compensate the cost of SO 2
17 CFR 240.15c1-9 - Use of pro forma balance sheets.
2010-04-01
... pro forma balance sheets. The term manipulative, deceptive, or other fraudulent device or contrivance... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Use of pro forma balance sheets. 240.15c1-9 Section 240.15c1-9 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...
Directory of Open Access Journals (Sweden)
Eli eCarlisle
2014-07-01
Full Text Available Stable 15N isotopes have been used to examine movement of nitrogen (N through various pools of the global N cycle. A central reaction in the cycle involves nitrate (NO3– reduction to nitrite (NO2– catalyzed via nitrate reductase (NR. Discrimination against 15N by NR is a major determinant of isotopic differences among N pools. Here, we measured in vitro 15N discrimination by several NRs purified from plants, fungi, and a bacterium to determine the intrinsic 15N discrimination by the enzyme and to evaluate the validity of measurements made using 15N-enriched NO3–. Observed NR isotope discrimination ranged from 22‰ to 32‰ (kinetic isotope effects of 1.022 to 1.032 among the different isozymes at natural abundance 15N (0.37%. As the fractional 15N content of substrate NO3– increased from natural abundance, the product 15N fraction deviated significantly from that expected based on substrate enrichment and 15N discrimination measured at natural abundance. Additionally, isotopic discrimination by denitrifying bacteria used to reduce NO3– and NO2– in some protocols became a greater source of error as 15N enrichment increased. We briefly discuss potential causes of artifactual results with enriched 15N and recommend against the use of highly enriched 15N tracers to study N discrimination in plants or soils.
Schleussner, C. F.
2016-12-01
Robust appraisals of climate impacts at different levels of global-mean temperature increase are vital to guide assessments of dangerous anthropogenic interference with the climate system. By establishing 1.5°C as the long term temperature limit for global average temperature increase and inviting a special report of the IPCC on the impacts of 1.5°C, the Paris Agreement has put such assessments high on the post-Paris science agenda. Here I will present recent findings of climate impacts at 1.5°C, including extreme weather events, water availability, agricultural yields, sea-level rise and risk of coral reef loss. In particular, I will present findings from a recent study that attempts to differentiate between such impacts at warming levels of 1.5°¸C and 2°C above pre-industrial (Schleussner et al., 2016). By analyzing changes in indicators for 26 world regions as applicable, the study found regional dependent differences between a 1.5°C and 2°C warming. Regional hot-spots of change emerge with tropical regions bearing the brunt of the impacts of an additional 0.5°C warming. These findings highlight the importance of regional differentiation to assess both future climate risks and different vulnerabilities to incremental increases in global-mean temperature. Building on that analysis, I will discuss limitations of existing approaches to differentiate between warming levels and outline opportunities for future work on refining our understanding of the difference between impacts at 1.5°C and 2°C warming. ReferencesSchleussner, C.-F. et al. Differential climate impacts for policy relevant limits to global warming: the case of 1.5°C and 2°C. Earth Syst. Dyn. 7, 327-351 (2016).
International Nuclear Information System (INIS)
Yao Yunyin; Cheng Ming; Ma Changlin; Wang Zhidong; Hou Jinqin; Zhang Lihong; Luo Yongyun
1991-01-01
Natural 15 N abundance method was used to estimate contribution of symbiotic dinitrogen fixation by leguminous grasses. With the method the expensive 15 N fertilizer did not need to be applied to the soil and the normal ecosystem was not disturbed. Collecting samples of shoots of leguminous grasses and measuring the content of 15 N in them wee all to do for estimating potential of symbiotically fixed N 2 . Isotopic fractionation associated with N 2 fixation by legumes was studied. Values for 7 cultivars of alfalfa were ranged between 1.0000 ∼ 1.0015 (δ 15 N values were -0.05 ∼ 1.47 per mille); and the values for white clover, mung bean and whitepopinac lead tree were 0.0079, 0.9983 and 1.0018 (δ 15 N values: 2.15, 1.74 and -1.81 per mille) respectively. According to the δ 15 N values of grasses tested, the potential of N 2 fixation for 6 cultivars of alfalfa was estimated. Glory and rambler had higher potential of N 2 fixation; Baoding, Aigonquin and Minto had lower potential, and Peru was the lowest.N 2 fixing activity of alfalfa varied with different periods. The peak was found between June and July. Effects of non-N 2 -fixing references and different methods on estimates of %Ndfa of leguminous grasses were also discussed
Phenazine–naphthalene-1,5-diamine–water (1/1/2
Directory of Open Access Journals (Sweden)
Maria Gdaniec
2009-12-01
Full Text Available The asymmetric unit of the title compound, C12H8N2·C10H10N2·2H2O, contains one half-molecule of phenazine, one half-molecule of naphthalene-1,5-diamine and one water molecule. The phenazine and naphthalene-1,5-diamine molecules are located on inversion centers. The water molecules serve as bridges between the naphthalene-1,5-diamine molecules and also between the naphthalene-1,5-diamine and phenazine molecules. The naphthalene-1,5-diamine and water molecules are connected via N—H...O and O—H...N hydrogen bonds, forming a T4(2 motif. They are arranged into a two-dimensional polymeric structure parallel to (10overline{1} in which the water molecule is a single donor and a double acceptor, whereas the amino group is a double donor and a single acceptor in the hydrogen bonding. These two-dimensional assemblies alternate with the layers of phenazine molecules arranged into a herringbone motif. Each phenazine molecule is hydrogen bonded to two water molecules and thus a three-dimensional framework of hydrogen-bonded molecules is generated.
Conformational analysis of capsaicin using 13C, 15N MAS NMR, GIAO DFT and GA calculations
Siudem, Paweł; Paradowska, Katarzyna; Bukowicki, Jarosław
2017-10-01
Capsaicin produced by plants from genus Capsicum exerts multiple pharmacological effects and has found applications in food and pharmaceutical industry. The alkaloid was studied by a combined approach: solid-state NMR, GA conformational search and GIAO DFT methods. The 13C CPMAS NMR spectra were recorded using variable contact time and dipolar dephasing experiments. The results of cross-polarization (CP) kinetics, such as TCP values and long T1ρH (100-200 ms), indicated that the capsaicin molecule is fairly mobile, especially at the end of the aliphatic chain. The15N MAS NMR spectrum showed one narrow signal at -255 ppm. Genetic algorithm (GA) search with multi modal optimization was used to find low-energy conformations of capsaicin. Theoretical GIAO DFT calculations were performed using different basis sets to characterize five selected conformations. 13C CPMAS NMR was used as a validation method and the experimental chemical shifts were compared with those calculated for selected stable conformers. Conformational analysis suggests that the side chain can be bent or extended. A comparison of the experimental and the calculated chemical shifts indicates that solid capsaicin does not have the same structure as those established by PWXRD.
Reich, Kimberly J.; López-Castro, Melania C.; Shaver, Donna J.; Iseton, Claire; Hart, Kristen M.; Hooper, Michael J.; Schmitt, Christopher J.
2017-01-01
The Deepwater Horizon explosion in April 2010 and subsequent oil spill released 3.19 × 106 barrels (5.07 × 108 L) of MC252 crude oil into important foraging areas of the endangered Kemp’s ridley sea turtle Lepidochelys kempii (Lk) in the northern Gulf of Mexico (GoM). We measured δ13C and δ15N in scute biopsy samples from 33 Lk nesting in Texas during 2010–-12. Of these, 27 were equipped with satellite transmitters and were tracked to traditional foraging areas in the northern GoM after the spill. Differences in δ13C between the oldest and newest scute layers from 2010 nesters were not significantly different, but δ13C in the newest layers from 2011 and 2012 nesters was significantly lower compared to 2010. δ15N differences were not statistically significant. Collectively, the stable isotope and tracking data indicate that the lower δ13C values reflect the incorporation of oil rather than changes in diet or foraging area. Discriminant analysis indicated that 51.5% of the turtles sampled had isotope signatures indicating oil exposure. Growth of the Lk population slowed in the years following the spill. The involvement of oil exposure in recent population trends is unknown, but long-term effects may not be evident for many years. Our results indicate that C isotope signatures in scutes may be useful biomarkers of sea turtle exposure to oil.
International Nuclear Information System (INIS)
El-Kholi, A. F.; Galal, Y. G. M.
2004-01-01
Incubation experiment was conducted to study the effect of the nitrogenous fertilizer on the decomposition and mineralization of organic residues (soybean powdered forage) as well as the release of the soil inorganic nitrogen. This technique was carried out using two types of soils, one is alluvial and the other is saline sandy soil collected from Fayoum governorate. Soybean forage has an organic carbon 23.1%, total N 1.6% and C/N ratio 14.4. Regarding the effect of incubation period on the two soil samples, the evolved NH 4 -N was generally reached its highest peak after 30-45 days, in the presence of either the added 15 No3-fertilizer solely or in combination with soybean forage. Reversible trend was occurred with regard to the evolved No3-N. The highest peak of evolved No3-N recorded in unfertilized control, as compared to 15 No3-N treatment, at 30 day incubation period indicated that the addition of labeled mineral fertilizer had appreciably enhanced the immobilization process. Net nitrification revealed that it was the highest in unfertilized control soil where it was significantly decreased in the treated two soil samples. Gross mineralization as affected by the addition of soybean forage in combination with labeled mineral fertilizer had been promoted by 75% in the alluvial soil and by 18% in the sandy saline soil, as compared with the soil samples received 15 No3-fertilizer only. Gross immobilization, in soil samples received 15 No3-fertilizer plus soybean forage had surpassed those received 15 No3-fertilizer only by 16% in the alluvial soil and by 25% in the sandy saline soil. (Authors)
Energy Technology Data Exchange (ETDEWEB)
Mori, Satoshi [Tokyo Univ. (Japan). Faculty of Agriculture
1981-03-01
To clarify the mechanism of arginine utilization in barley roots, triply labeled (ureido-/sup 15/N, ureido-/sup 14/C and 5-/sup 3/H) arginine was applied to plants precultured with arginine (Arg-plants). (5-/sup 3/H) Arginine was incorporated mainly into ornithine, suggesting that arginase contributes in the first step of arginine metabolism. The arginase activity in the tissues was greatly enhanced by continuous supply of arginine, whereas urease activity was not by the same treatment. The amount of /sup 14/CO/sub 2/ evolved from (ureido-/sup 14/C) arginine in the Arg-plants was several times higher than that in plants treated with NO/sub 3//sup -/(NO/sub 3/-plants), and most /sup 14/C-urea exogenously supplied to detached roots of Arg-plants was immediately decomposed to /sup 14/CO/sub 2/. The urea released from arginine by arginase was cleaved to /sup 15/NH/sub 4//sup +/ + /sup 14/CO/sub 2/ by urease. Most of the /sup 14/CO/sub 2/ was then lost from the root system. On the other hand, the released /sup 15/NH/sub 4//sup +/ was reassimilated into amino acids probably through the pathway of ammonia assimilation. Released (5-/sup 3/H) ornithine was metabolized dominantly to proline.
Energy Technology Data Exchange (ETDEWEB)
Rossi, Paolo, E-mail: rossip@umn.edu; Xia, Youlin; Khanra, Nandish; Veglia, Gianluigi, E-mail: vegli001@umn.edu; Kalodimos, Charalampos G., E-mail: ckalodim@umn.edu [University of Minnesota, Department of Biochemistry, Molecular Biology and Biophysics (United States)
2016-12-15
The ongoing NMR method development effort strives for high quality multidimensional data with reduced collection time. Here, we apply ‘SOFAST-HMQC’ to frequency editing in 3D NOESY experiments and demonstrate the sensitivity benefits using highly deuterated and {sup 15}N, methyl labeled samples in H{sub 2}O. The experiments benefit from a combination of selective T{sub 1} relaxation (or L-optimized effect), from Ernst angle optimization and, in certain types of experiments, from using the mixing time for both NOE buildup and magnetization recovery. This effect enhances sensitivity by up to 2.4× at fast pulsing versus reference HMQC sequences of same overall length and water suppression characteristics. Representative experiments designed to address interesting protein NMR challenges are detailed. Editing capabilities are exploited with heteronuclear {sup 15}N,{sup 13}C-edited, or with diagonal-free {sup 13}C aromatic/methyl-resolved 3D-SOFAST-HMQC–NOESY–HMQC. The latter experiment is used here to elucidate the methyl-aromatic NOE network in the hydrophobic core of the 19 kDa FliT-FliJ flagellar protein complex. Incorporation of fast pulsing to reference experiments such as 3D-NOESY–HMQC boosts digital resolution, simplifies the process of NOE assignment and helps to automate protein structure determination.
International Nuclear Information System (INIS)
Heyser, J.W.; Chacon, M.J.
1989-01-01
Exogenous proline stimulated the growth of Petunia hybrida cells on 195 mM NaCl 10-fold as compared with cells grown on 195 mM CaCl medium minus proline. L-[ 15 N]-proline was fed to cells growing on 0 and 195 mM CaCl, and its metabolism was followed by 15 N NMR analysis of cell extracts. Total proline and amino acids were determined by ninhydrin assay. Proline and primary amino acids were easily resolved in NMR spectra and the amount of 15 N-label which remained in proline was determined. Reduced catabolism of proline in cells grown on NaCl was evident. The role of exogenous proline in conferring increased NaCl tolerance in this nonhalophyte will be discussed
Spangenberg, Jorge E; Vogiatzaki, Maria; Zufferey, Vivian
2017-09-29
This paper describes a novel approach to reassess the water status in vineyards based on compound-specific isotope analysis (CSIA) of wine volatile organic compounds (δ 13 C VOC/VPDB ) and bulk carbon and nitrogen isotopes, and the C/N molar ratios of the wine solid residues (δ 13 C SR/VPDB , δ 15 N SR/Air-N2 ). These analyses link gas chromatography/combustion and elemental analysis to isotope ratio mass spectrometry (GC/C/IRMS, EA/IRMS). Field-grown cultivars of Pinot Noir grapevines were exposed during six growing seasons (2009-2014) to controlled soil water availability, while maintaining identical the other environmental variables and agricultural techniques. Wines were produced from the grapes by the same oenological protocol. This permitted for the assessment of the effects in the biochemistry of wines solely induced by the changes in the plant-soil water status. This mimicked the more recurrent and prolonged periods of soil water deficiency due to climate changes. Water stress in grapevine was assessed by the measurement of the predawn leaf water potential (Ψ pd ) and the stable carbon isotope composition of the berry sugars during harvest (must sugars). For quantitation purposes and the normalization of the measured stable carbon isotope ratios of the VOCs, the wine samples were spiked with three standard compounds with known concentration and δ 13 C VPDB values. VOCs were extracted by liquid-liquid extraction and analyzed by gas chromatography/flame ionization detection (GC/FID), gas chromatography/mass spectrometry (GC/MS), and GC/C/IRMS. δ 13 C values were obtained for eighteen VOCs. The solid residues were obtained by freeze-drying wine aliquots and were analyzed for their C and N content and isotope composition by EA/IRMS. All the isotopic ratios (δ 13 C SR , δ 15 N SR , δ 13 C VOC ) are highly correlated with the Ψ pd values, indicating that the proposed gas chromatography and isotope ratio mass spectrometry approach is a useful tool to
Reaction π-p → π0n in the 15-40 GeV/c momentum range
International Nuclear Information System (INIS)
Apel, W.D.; Augenstein, K.H.; Krueger, M.; Mueller, H.; Schinzel, D.; Schneider, H.; Sigurdsson, G.; Bertolucci, E.; Mannelli, I.; Pierazzini, G.M.; Quaglia, M.; Scribano, A.; Sergiampietri, F.; Vincelli, M.L.; Donskov, S.V.; Inyakin, A.V.; Johnson, R.; Kachanov, V.A.; Krasnokutsky, R.N.; Lednev, A.A.; Mikhailov, Yu.V.; Prokoshkin, Yu. D.; Shuvalov, R.S.; Toropin, A.N.; Leder, G.; Steuer, M.
1979-01-01
A high statistics measurement of the reaction π - p → π 0 n has been performed at the Serpukhov accelerator for 15, 20, 25, 30 and 40 GeV/c incident pion momentum using the NICE set-up with its associated 648-channel hodoscope spectrometer for γ-ray detection. More than 3 million charge-exchange events have been recorded in total. It is found that the spin-flip and non-spin-flip amplitudes can be parametrized, for small mod(t) as exponentials with the same slopes to within a few per cent. Also the behaviour of the differential cross section for small and medium mod(t) agrees with the prediction of a geometrical s-channel model which describes binary reactions in terms of a complex pole b 0 (s). The imaginary part of this universal pole, Im b 0 (s), has been determined and found to be growing logarithmically with s. (Auth.)
Fate of free amino acids in paddy and upland soils by using 13C and 15N tracer techniques
International Nuclear Information System (INIS)
Yamamuro, Shigekazu; Ueno, Hideto; Takahashi, Shigeru
1999-01-01
Direct and indirect (=through decomposition) uptakes of free amino acids (FAA) by rice and tomato plants were investigated by using 13 C- and 15 N-labeled aspartic and glutamic acids, serine, leusine and ammonium as tracers. 1) One week after the surface application of amino acid-N or NH 4 -N to paddy soil, the amounts of ammonium remaining in the soil, assimilated ammonium, denitrificated ammonium and amounts taken up by plants were similar. 2) From 5.5 to 7.7% of the FAA applied was absorbed directly by rice plants, and from 42.5 to 47.2% of that was indirectly absorbed as ammonium after decomposition. It is suggested that the FAA degraded to ammonium around 2 or 3 d and the 1- 13 C absorption rates of the FAA (RCH(NH 2 ) 13 COOH) were high in proportion to the number of carbon atoms of the R side-chain. 3) The absorption rate of N derived from the FAA by tomato plants was lower than that by rice plants, namely, from 0.4 to 1.9% in direct-uptake and from 16.0 to 29.8% in indirect-uptake. Percentage of direct-uptake of the FAA in upland soil was much lower than that in the paddy field. (author)
International Nuclear Information System (INIS)
Hawke, D.J.
2000-01-01
This study investigated 15 N enrichment and nutrient cycling in hill country used for semi-extensive pastoral agriculture, at a site where pre-European seabird breeding occurred. Soil (>15 cm) and plant samples were taken from 18 ridgeline and sideslope transects. Three stock camps (locations which grazing animals frequent) were identified within the study area, two on the ridgeline and one on the sideslope. Soil 15 N enrichment was greatest at stock camps, and lowest where stock input was minimal. Soil natural abundance 15 N (815N) was therefore an index of stock nutrient inputs. Soil δ 15 N increased with decreasing C:N ratio, consistent with N loss through volatilisation and/or nitrate leaching from net mineralisation. Plant δ 15 N from stock camps was lower than its associated soil, implying that 15 N enrichment of plant-available N was lower than that of total soil N. However, the correlation between plant δ 15 N and soil δ 15 N varied between stock camps, indicating differences in N cycling. Olsen P was higher at stock camps, although again differences were found between stock camps. Total P and N were correlated neither with stock camps nor topography, but were higher than expected from parent material concentrations and literature results, respectively. It is postulated that significant contributions of both elements from former seabird breeding remain in the soil. Copyright (2000) CSIRO Publishing
17 CFR 239.15 - Form N-1 for open-end management investment companies registered on Form N-8A.
2010-04-01
... management investment companies registered on Form N-8A. 239.15 Section 239.15 Commodity and Securities... Registration Statements § 239.15 Form N-1 for open-end management investment companies registered on Form N-8A...-end management investment companies that are separate accounts of insurance companies as defined by...
Nitrogen cycling in a forest stream determined by a 15N tracer addition
Patrick J. Mullholland; Jennifer L. Tank; Diane M. Sanzone; Wilfred M. Wollheim; Bruce J. Peterson; Jackson R. Webster; Judy L. Meyer
2000-01-01
Nitrogen uptake and cycling was examined using a six-week tracer addition of 15N-labeled ammonium in early spring in Waer Branch, a first-order deciduous forest stream in eastern Tennessee. Prior to the 15N addition, standing stocks of N were determined for the major biomass compartments. During and after the addition,
Evaluation for dinitrogen fixation of alfalfa in field based on δ15N value
International Nuclear Information System (INIS)
Yao Yunyin; Chen Ming; Zhang Xizhong
1992-12-01
The dinitrogen fixation rate of alfalfa was estimated grown in pot and field experiments. β values (isotope fraction factor) of 7 cultivars of alfalfa (Medicago sativa L.) and white clover (Trifolium repens L.) grown in N-free liquid culture medium were examined. Variations in the δ 15 N values of varieties of alfalfa at growing seasons and forage grasses grown under various conditions were measured. %Ndfa of alfalfa was estimated using the natural 15 N abundance method, 15 N isotope dilution method and total N difference, and their accuracy was compared
International Nuclear Information System (INIS)
Bento, M.H.L.; Acamovic, T.; Makkar, H.P.S.
2005-01-01
The microbial attachment to and gas production from α-cellulose (Sigma; C-8002) without and with mimosa tannin (MT), pectin (P), polyethylene glycol (PEG), MT + P or MT + PEG, were investigated using the in vitro gas production system. Microbial attachment based on 15 N-labelled rumen microorganisms in the residual pellet after 24 h incubation was estimated, which varied from 113.7 to 161.3 μg 15 N per g residual pellet. C + MT had the lowest microbial attachment (P 2 = 0.84, P 15 N) in the residual pellet measured for C + MT (0.054) and C + MT + P (0.159), compared with the other treatments (0.32 for C; 0.34 for C + P; 0.33 for C + PEG; and 0.33 for C + MT + PEG). A MT concentration of 194 g/kg diet reduced microbial attachment and activity of rumen microorganisms in vitro. Polyethylene glycol counteracted the effect of MT on microbial attachment and activity. Pectin exerted a beneficial effect on attachment and fermentation in the initial hours of incubation. A ratio of pectin to MT of 1:1 improved microbial activity of C + MT but inhibition of microbial activity by MT remained at 24 h as indicated by the lower gas production of C + MT + P compared with the control. The results support the hypothesis that there is considerable interaction between tannins, microbes and non-starch-polysaccharides (NSP) in animal feeds and that these interactions may influence the functional ability of microbes in the gastrointestinal tract of animals. (author)
Projected drought risk in 1.5°C and 2°C warmer climates
Lehner, F.; Coats, S.; Stocker, T. F.; Pendergrass, A. G.; Sanderson, B. M.; Raible, C.; Smerdon, J. E.
2017-12-01
The large socioeconomic costs of droughts make them a crucial target for impact assessments of climate change scenarios. Using multiple drought metrics and a set of simulations with the Community Earth System Model (CESM) targeting 1.5°C and 2°C above preindustrial global mean temperatures, we investigate changes in aridity and the risk of consecutive drought years. The latter metric is motivated by recent droughts in California and the US Southwest in general, where consecutive years of moderate precipitation deficit can quickly lead to significant drought and elevated pressure on water resources. If warming is limited to 2°C, these simulations suggest little change in drought risk for the U.S. Southwest and Central Plains compared to present day, an interesting result that arises from a delicate balance between increases in evaporative demand and precipitation in CESM in that region. In the Mediterranean, central Europe, and a number of other regions across the globe, however, drought risk increases significantly for both 1.5°C and 2°C warming targets, and the additional 0.5°C of the 2°C climate leads to significantly higher drought risk. Our study suggests that limiting anthropogenic warming to 1.5°C rather than 2°C, as aspired to by the Paris Climate Agreement, may have benefits for future drought risk but that such benefits may be regional and in some cases highly uncertain. We will therefore also discuss the robustness of results across different drought metrics as well as the model uncertainties associated with drought projections for low warming targets.
Energy Technology Data Exchange (ETDEWEB)
Chiang, Hung-Lung, E-mail: hlchiang@mail.cmu.edu.tw [Department of Risk Management, China Medical University, Taichung 40402, Taiwan (China); Wu, Trong-Neng [Department of Public Health, China Medical University, Taichung 40402, Taiwan (China); Ho, Yung-Shou [Department of Applied Chemistry and Materials Science, Fooyin University, Kaohsiung 831, Taiwan (China); Zeng, Li-Xuan [Department of Risk Management, China Medical University, Taichung 40402, Taiwan (China)
2014-07-15
Highlights: • Acetylene was decomposed on SBA-15 and Ni-SBA-15 at 650–850 °C. • Carbon spheres and filaments were formed after acetylene decomposition. • PAHs were determined in tar and residues. • Exhaust constituents include CO{sub 2}, H{sub 2}, NO{sub x} and hydrocarbon species. - Abstract: Carbon materials including carbon spheres and nanotubes were formed from acetylene decomposition on hydrogen-reduced SBA-15 and Ni-SBA-15 at 650–850 °C. The physicochemical characteristics of SBA-15, Ni-SBA-15 and carbon materials were analyzed by field emission scanning electronic microscopy (FE-SEM), Raman spectrometry, and energy dispersive spectrometry (EDS). In addition, the contents of polyaromatic hydrocarbons (PAHs) in the tar and residue and volatile organic compounds (VOCs) in the exhaust were determined during acetylene decomposition on SBA-15 and Ni-SBA-15. Spherical carbon materials were observed on SBA-15 during acetylene decomposition at 750 and 850 °C. Carbon filaments and ball spheres were formed on Ni-SBA-15 at 650–850 °C. Raman spectroscopy revealed peaks at 1290 (D-band, disorder mode, amorphous carbon) and 1590 (G-band, graphite sp{sup 2} structure) cm{sup −1}. Naphthalene (2 rings), pyrene (4 rings), phenanthrene (3 rings), and fluoranthene (4 rings) were major PAHs in tar and residues. Exhaust constituents of hydrocarbon (as propane), H{sub 2}, and C{sub 2}H{sub 2} were 3.9–2.6/2.7–1.5, 1.4–2.8/2.6–4.3, 4.2–2.4/3.2–1.7% when acetylene was decomposed on SBA-15/Ni-SBA-15, respectively, corresponding to temperatures ranging from 650 to 850 °C. The concentrations of 52 VOCs ranged from 9359 to 5658 and 2488 to 1104 ppm for SBA-15 and Ni-SBA-15 respectively, at acetylene decomposition temperatures from 650 to 850 °C, and the aromatics contributed more than 87% fraction of VOC concentrations.
Cartigny, Pierre; Farquhar, James; Thomassot, Emilie; Harris, Jeffrey W.; Wing, Bozwell; Masterson, Andy; McKeegan, Kevin; Stachel, Thomas
2009-11-01
In order to address diamond formation and origin in the lithospheric mantle underlying the Central Slave Craton, we report N- and C-stable isotopic compositions and N-contents and aggregation states for 85 diamonds of known paragenesis (73 peridotitic, 8 eclogitic and 4 from lower mantle) from the Panda kimberlite (Ekati Mine, Lac de Gras Area, Canada). For 12 peridotitic and two eclogitic sulfide inclusion-bearing diamonds from this sample set, we also report multiple-sulfur isotope ratios. The 73 peridotitic diamonds have a mean δ13C-value of - 5.2‰ and range from - 6.9 to - 3.0‰, with one extreme value at - 14.1‰. The associated δ15N-values range from - 17.0 to + 8.5‰ with a mean value of - 4.0‰. N-contents range from 0 to 1280 ppm. The 8 eclogitic diamonds have δ13C-values ranging from - 11.2 to - 4.4‰ with one extreme value at - 19.4‰. Their δ15N ranges from - 2.1 to + 7.9‰ and N-contents fall between 0 and 3452 ppm. Four diamonds with an inferred lower mantle origin are all Type II (i.e. nitrogen-free) and have a narrow range of δ13C values, between - 4.5 and - 3.5‰. The δ34S of the 14 analyzed peridotitic and eclogitic sulfide inclusions ranges from - 3.5 to +5.7‰. None of them provide evidence for anomalous δ33S-values; observed variations in δ33S are from +0.19 to - 0.33‰, i.e. within the 2 sigma uncertainties of mantle sulfur ( δ33S = 0‰). At Panda, the N contents and the δ13C of sulfide-bearing peridotitic diamonds show narrower ranges than silicate-bearing peridotitic diamonds. This evidence supports the earlier suggestion established from eclogitic diamonds from the Kaapvaal that sulfide-(±silicate) bearing diamonds sample a more restricted portion of sublithospheric mantle than silicate-(no sulfide) bearing diamonds. Our findings at Panda suggest that sulfide-bearing diamonds should be considered as a specific diamond population on a global-scale. Based on our study of δ34S, Δ 33S, δ15N and δ13C, we find no
Behavior of /sup 15/N-labelled amino acids in germinated corn
Energy Technology Data Exchange (ETDEWEB)
Samukawa, K; Yamaguchi, M [Osaka Prefectural Univ., Sakai (Japan). Coll. of Agriculture
1979-06-01
By investigating the rise and fall of /sup 15/N-labelled amino acids in germinated corns, the behavior of amino radicals in free amino acids, the influence of the hydrolysis products of stored proteins on free amino acids and the change from heterotrophy to autotrophy of seeds were clarified. The amount of amino acid production depending on external nitrogen was very small in the early period of germination. /sup 15/N incorporation into proline was not observed in the early period of germination, which suggested that the proline may be nitrogen-storing source. Most of the amino-state nitrogen of asparagine accumulated at the time of germination was internal nitrogen, and this fact suggested that aspartic acid serve as the acceptor of ammonia produced in the early stage of germination. /sup 15/N content increased significantly on 9 th day after germination, and decreased on 12 th day. These facts prove that there are always active decomposition and production of protein in plant body.
A PPy-B15C5 modified lanthanum (III electrode in acetonitrile and its thermodynamic application
Directory of Open Access Journals (Sweden)
Mohammad Hossein Arbab Zavar
2017-02-01
Full Text Available Polypyrrole modified electrode prepared by electropolymerization of pyrrole in the presence of a complexing ligand, benzo-15-crown-5 (B15C5, was prepared and investigated as a La3+-selective electrode in acetonitrile. The potentiometric response of the electrode was linear within the La3+ concentration range 1 × 10−4 to 1 × 10−1 M with a Nernstian slope of 19.5 mV decade−1 in AN. The electrode was applied to study the complexation of the lanthanum (III ion in acetonitrile with other basic solvent molecules (D such as dimethyl sulfoxide, N,N-dimethylformamide, propylene carbonate, N,N,Diethylaniline and methanol. The successive complex formation constant (βi and Gibbs energies of transfer (ΔGtr of La3+ in AN in relation to such D were obtained.
Search for unbound 15Be states in the 3 n +12Be channel
Kuchera, A. N.; Spyrou, A.; Smith, J. K.; Baumann, T.; Christian, G.; DeYoung, P. A.; Finck, J. E.; Frank, N.; Jones, M. D.; Kohley, Z.; Mosby, S.; Peters, W. A.; Thoennessen, M.
2015-01-01
Background: 15Be is expected to have low-lying 3 /2+ and 5 /2+ states. A first search did not find the 3 /2+ [A. Spyrou et al., Phys. Rev. C 84, 044309 (2011), 10.1103/PhysRevC.84.044309]; however, a resonance in 15Be was populated in a second attempt and determined to be unbound with respect to 14Be by 1.8(1) MeV with a tentative spin-parity assignment of 5 /2+ [J. Snyder et al., Phys. Rev. C 88, 031303(R) (2013), 10.1103/PhysRevC.88.031303]. Purpose: Search for the predicted 15Be 3 /2+ state in the three-neutron decay channel. Method: A two-proton removal reaction from a 55 MeV/u 17C beam was used to populate neutron-unbound states in 15Be. The two-, three-, and four-body decay energies of the 12Be + neutron(s) detected in coincidence were reconstructed using invariant mass spectroscopy. Monte Carlo simulations were performed to extract the resonance and decay properties from the observed spectra. Results: The low-energy regions of the decay energy spectra can be described with the first excited unbound state of 14Be (Ex=1.54 MeV, Er=0.28 MeV). Including a state in 15Be that decays through the first excited 14Be state slightly improves the fit at higher energies though the cross section is small. Conclusions: A 15Be component is not needed to describe the data. If the 3 /2+ state in 15Be is populated, the decay by three-neutron emission through 14Be is weak, ≤11 % up to 4 MeV. In the best fit, 15Be is unbound with respect to 12Be by 1.4 MeV (unbound with respect to 14Be by 2.66 MeV) with a strength of 7 % .
Application of 15N amino acid absorption in chronic enteropathy and hepatic diseases in infants
International Nuclear Information System (INIS)
Culea, M.; Palibroda, N.; Chiriac, M.; Moldovan, Z.; Miu, N.
1993-01-01
The aim of this study was to estimate malabsorption status in humans using a 15 N stable isotope tracer technique. [ 15 N]-glycine, 98.98 atom %, was synthesized in our institute and was administered orally as a single bolus dose to twelve patients. Six of the 12 subjects studied were healthy and 6 were suspected of having malabsorption. Blood, urine and faecal samples were obtained, proteins in the samples were precipitated with sulphosalicylic acid (5%), the eluate was purified with Dowex 50W-X8 (40mm x 2mm column), and derivatised to form the trifluoroacetyl-butyl esters using standard techniques. Gas chromatographic separation was performed on a glass column 2m X 3mm i.d. packed with EGA 1% on Chromosorb W AW 80-100 mesh. An isotope dilution GC/MS method and Kjeldahl digestion followed by MS analysis of nitrogen gas was performed. 15 N isotopomer was used as internal standard. [ 15 N]-Gly elimination in faeces was compared with total 15 N elimination in faeces to distinguish artefacts caused by intestinal bacteria. Significant differences in the amount of [ 15 N]-Gly eliminated in urine and faeces between malabsorption and control patients were obtained. It was concluded that more emphasis should be given to the faeces data than to urine because 15 N elimination in urine is competitive with 15 N incorporation into protein. 12 refs, 4 figs, 4 tabs
15N abundance in Antarctica: origin of soil nitrogen and ecological implications
International Nuclear Information System (INIS)
Wada, E.; Shibata, R.; Torii, T
1981-01-01
The results of an investigation of the nitrogen cycle in Antartica are reported which show that nitrate in Antarctic soils is extremely depleted in 15 N compared with biogenic nitrogen and that algae collected from a nitrate-rich saline pond and from a penguin rookery exhibit, respectively, the lowest and the highest 15 N/ 14 N ratios among terrestrial biogenic nitrogen so far observed. The possible causes of these extreme nitrogen isotopic compositions are discussed. (U.K.)
Single Transition-to-single Transition Polarization Transfer (ST2-PT) in [15N,1H]-TROSY
International Nuclear Information System (INIS)
Pervushin, Konstantin V.; Wider, Gerhard; Wuethrich, Kurt
1998-01-01
This paper describes the use of single transition-to-single transition polarization transfer (ST2-PT) in transverse relaxation-optimized spectroscopy (TROSY), where it affords a √2 sensitivity enhancement for kinetically stable amide 15N-1H groups in proteins. Additional, conventional improvements of [15N,1H]-TROSY include that signal loss for kinetically labile 15N-1H groups due to saturation transfer from the solvent water is suppressed with the 'water flip back' technique and that the number of phase steps is reduced to two, which is attractive for the use of [15N,1H]-TROSY as an element in more complex NMR schemes. Finally, we show that the impact of the inclusion of the 15N steady-state magnetization (Pervushin et al., 1998) on the signal-to-noise ratio achieved with [15N,1H]-TROSY exceeds by up to two-fold the gain expected from the gyromagnetic ratios of 1H and 15N
DEFF Research Database (Denmark)
Sørensen, Pernille Lærkedal; Michelsen, Anders; Jonasson, Sven Evert
2008-01-01
of nitrogen (N). Here, we studied 15N label incorporation into microbes, plants and soil N pools after both long-term (12 years) climate manipulation and nutrient addition, plant clipping and a pulse-addition of labile C to the soil, in order to gain information on interactions among soil N and C pools...... addition. However, plants exerted control on the soil inorganic N concentrations and recovery of total dissolved 15N (TD15N), and likewise the microbes reduced these soil pools, but only when fed with labile C. Soil microbes in clipped plots were primarily C limited, and the findings of reduced N...... availability, both in the presence of plants and with the combined treatment of plant clipping and addition of sugar, suggest that the plant control of soil N pools was not solely due to plant uptake of soil N, but also partially caused by plants feeding labile C to the soil microbes, which enhanced...
Determination of the δ15N of nitrate in solids; RSIL lab code 2894
Coplen, Tyler B.; Qi, Haiping; Revesz, Kinga; Casciotti, Karen; Hannon, Janet E.
2007-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 2894 is to determine the δ15N of nitrate (NO3-) in solids. The nitrate fraction of the nitrogen species is dissolved by water (called leaching) and can be analyzed by the bacterial method covered in RSIL lab code 2899. After leaching, the δ15N of the dissolved NO3- is analyzed by conversion of the NO3- to nitrous oxide (N2O), which serves as the analyte for mass spectrometry. A culture of denitrifying bacteria is used in the enzymatic conversion of NO3- to N2O, which follows the pathway shown in equation 1: NO3- → NO2- → NO → 1/2 N2O (1) Because the bacteria Pseudomonas aureofaciens lack N2O reductive activity, the reaction stops at N2O, unlike the typical denitrification reaction that goes to N2. After several hours, the conversion is complete, and the N2O is extracted from the vial, separated from volatile organic vapor and water vapor by an automated -65 °C isopropanol-slush trap, a Nafion drier, a CO2 and water removal unit (Costech #021020 carbon dioxide absorbent with Mg(ClO4)2), and trapped in a small-volume trap immersed in liquid nitrogen with a modified Finnigan MAT (now Thermo Scientific) GasBench 2 introduction system. After the N2O is released, it is further purified by gas chromatography before introduction to the isotope-ratio mass spectrometer (IRMS). The IRMS is a Thermo Scientific Delta V Plus continuous flow IRMS (CF-IRMS). It has a universal triple collector, consisting of two wide cups with a narrow cup in the middle; it is capable of simultaneously measuring mass/charge (m/z) of the N2O molecule 44, 45, and 46. The ion beams from these m/z values are as follows: m/z = 44 = N2O = 14N14N16O; m/z = 45 = N2O = 14N15N16O or 14N14N17O; m/z = 46 = N2O = 14N14N18O. The 17O contributions to the m/z 44 and m/z 45 ion beams are accounted for before δ15N values are reported.
International Nuclear Information System (INIS)
Cole, H.B.R.; Sparks, S.W.; Torchia, D.A.
1988-01-01
The authors report high-resolution 13 C and 15 N NMR spectra of crystalline staphylococcal nuclease (Nase) complexed to thymidine 3',5'-diphosphate and Ca 2+ . High sensitivity and resolution are obtained by applying solid-state NMR techniques-high power proton decoupling and cross-polarization magic angle sample spinning (CPMASS)-to protein samples that have been efficiently synthesized and labeled by an overproducing strain of Escherichia coli. A comparison of CPMASS and solution spectra of Nase labeled with either [methyl- 13 C]methionine or [ 15 ]valine shows that the chemical shifts in the crystalline and solution states are virtually identical. This result is strong evidence that the protein conformations in the solution and crystalline states are nearly the same. Because of the close correspondence of the crystal and solution chemical shifts, sequential assignments obtained in solution apply to the crystal spectra. It should therefore be possible to study the molecular structure and dynamics of many sequentially assigned atomic sites in Nase crystals. Similar experiments are applicable to the growing number of proteins that can be obtained from efficient expression systems
The use of N-15 in the measurement of symbiotic nitrogen fixation by legumes under field condition
International Nuclear Information System (INIS)
Impithuksa, Viroj
1982-01-01
The amount of N fixation by legume crop in field condition by using 15 N can determine by the addition of labelled 15 N fertilizer into the soil and measuring the amount of labelled 15 N, soil N, and fixed N taken up by legume crop. This requires a standard crop (reference crop) as a control to determine labelled 15 N and soil N taken up by this crop. In case the same rate of labelled 15 N fertilizer is added to the legume crop and a standard crop
International Nuclear Information System (INIS)
Piltingsrud, H.V.
1983-01-01
The calculation of activity yields from practical photonuclear target systems designed to produce short-lived positron emitting radionuclides for nuclear medicine purposes requires certain basic information. These include a knowledge of the photon source (bremsstrahlung energy spectrum and intensity as a function of angle from the electron beam) and the #betta#, n activation cross section of the secondary target element. A lack of adequate information concerning these parameters motivated the present study in which activity yields for the reactions 12 C(#betta#, n) 11 C, 14 N(#betta#, n) 13 N, and 16 O(#betta#, n) 15 O were measured as a function of energy of and angle from the electron beam between 16 and 30 MeV and 0 0 and 30.5 0 , respectively. The data indicate highly complex relationships between the activity yield and the experimental variables. Also indicated are possible applications of the data to indicate the energy of an electron beam producing a given bremsstrahlung field in which activation measurements are made
Effect of estrogens on urinary /sup 15/N balance in girls
Energy Technology Data Exchange (ETDEWEB)
Zachmann, M.; Kempken, B.; Prader, A. (Zurich Univ. (Switzerland))
1984-08-01
While the anabolic and growth-promoting effects of testosterone are known to be important for pubertal growth in boys, the role of estrogens (E) in the female spurt is less certain. Adrenal androgens have been considered to be more important than ovarian E. To study the anabolic effects of E, there has been carried out a pilot study in 9 girls aged 11 to 15 years. Before and 6 days after the start of E treatment, urinary /sup 15/N balance studies were performed, using /sup 15/NH/sub 4/Cl.
Barley Benefits from Organic Nitrogen in Plant Residues Applied to Soil using 15N Isotope Dilution
International Nuclear Information System (INIS)
Gadalla, A.M.; Galal, Y.G.M.; Abdel Aziz, H.A.; El-Degwy, S.M.A.; Abd El-Haleem, M.
2008-01-01
The experiment was carried out in pots (sandy soil cultivated with Barley plant) under greenhouse conditions, at Inshas, Egypt. The aim was to evaluate the transformation of nitrogen applied either as mineral form ( 15 NH 4 ) 2 SO 4 , or as organic-material-N (plant residues) .Basal recommended doses of P and K were applied. Labeled 15 N as( 15 NH 4 ) 2 SO 4 (5 % a.e) or plant residues (ground leuceana forage, compost, and mixture of them) were applied at a rate of 20 kg N/ ha). 15 N technique was used to evaluate N-uptake and fertilizer use efficiency. The treatments were arranged in a completely randomized block design under greenhouse conditions. The obtained results showed that the dry weight of barley shoots was positively affected by reinforcement of mineral- N with organic-N. On the other hand, the highest dry weight was estimated with leuceana either applied alone or reinforced with mineral N. Similar trend was noticed with N uptake but only with organic N, while with treatment received 50% organic-N. plus 50% mineral- N. the best value of N uptake was recorded with mixture of leuceana and compost. The amount of Ndff was lowest where fertilizer 15 N was applied alone. Comparing Ndff for the three organic treatments which received a combination of fertilizer- 15 N+organic-material-N, results showed that the highest Ndff was occurred with mixture of leuceana and compost, whereas the lowest was induced with individual leuceana treatment. 15 N recovery in shoots of barley ranged between 22.14 % to 82.16 %. The lowest occurred with application of mineral 15 N alone and; the highest occurred where mineral 15 N was mixed with compost or leucaena-compost mixture
DEFF Research Database (Denmark)
De Brabandere, Loreto; Dehairs, F.; Van Damme, S.
2002-01-01
the growth season reflects the 15N enrichment of the ambient NH4 + pool induced by nitrification and NH4+ uptake. Zooplankton in the mesohaline section of the river was consistently enriched in 15N relative to suspended matter but followed its seasonal trend. During summer and autumn the isotopic offset...... matter in the oligohaline and mesohaline section increased compared to the 1970s, probably because today nitrification, which enriches the NH4+ pool in 15N, starts earlier in the season. For summer, the discrepancy between present-day suspended matter d15N values and those observed in the 1970s was even...
Use of low enriched /sup 15/N/sub 2/ for symbiotic fixation tests
Energy Technology Data Exchange (ETDEWEB)
Victoria, R L
1975-01-01
Gaseous atmospheres containing /sup 15/N/sub 2/ with low enrichment were used to test symbiotic nitrogen fixation in beans (Phaseolus vulgari, L.). The tests of fixation in nodulated roots and the tests of fixation in the whole plant, in which the plants were placed inside a specially constructed growth chamber, gave positive results and suggest that the methodology used can be very helpfull in more detailed studies on symbiotic fixation. Samples of atmospheric air were purified by absorption of O/sub 2/ and CO/sub 2/ by two methods. The purified N/sub 2/ obtained was analysed and the results were compared. Samples of bean plant material were collected in natural conditions and analysed for /sup 15/N natural variation. Several samples were prepared for /sup 15/N isotopic analysis by two methods. The results obtained were compared. All samples were analysed in an Atlas-Varian Ch-4 model mass spectrometer, and the results were given in delta /sup 15/N/sub 0///sup 00/ variation in relation to a standard gas.
Alexandropoulos, Ioannis I; Argyriou, Aikaterini I; Marousis, Kostas D; Topouzis, Stavros; Papapetropoulos, Andreas; Spyroulias, Georgios A
2016-10-01
The H-NOX (Heme-nitric oxide/oxygen binding) domain is conserved across eukaryotes and bacteria. In human soluble guanylyl cyclase (sGC) the H-NOX domain functions as a sensor for the gaseous signaling agent nitric oxide (NO). sGC contains the heme-binding H-NOX domain at its N-terminus, which regulates the catalytic site contained within the C-terminal end of the enzyme catalyzing the conversion of GTP (guanosine 5'-triphosphate) to GMP (guanylyl monophosphate). Here, we present the backbone and side-chain assignments of the (1)H, (13)C and (15)N resonances of the 183-residue H-NOX domain from Nostoc sp. through solution NMR.
Energy Technology Data Exchange (ETDEWEB)
Fontani, F. [INAF-Osservatorio Astrofisico di Arcetri, L.go E. Fermi 5, I-50125 Firenze (Italy); Caselli, P.; Bizzocchi, L. [Max Planck Institute for Extraterrestrial Physics, Giessenbachstrasse 1, D-85748 Garching (Germany); Palau, A. [Centro de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México, P.O. Box 3-72, 58090 Morelia, Michoacán, México (Mexico); Ceccarelli, C. [Univ. Grenoble Alpes, IPAG, F-38000 Grenoble (France)
2015-08-01
We report on the first measurements of the isotopic ratio {sup 14}N/{sup 15}N in N{sub 2}H{sup +} toward a statistically significant sample of high-mass star-forming cores. The sources belong to the three main evolutionary categories of the high-mass star formation process: high-mass starless cores, high-mass protostellar objects, and ultracompact H ii regions. Simultaneous measurements of the {sup 14}N/{sup 15}N ratio in CN have been made. The {sup 14}N/{sup 15}N ratios derived from N{sub 2}H{sup +} show a large spread (from ∼180 up to ∼1300), while those derived from CN are in between the value measured in the terrestrial atmosphere (∼270) and that of the proto-solar nebula (∼440) for the large majority of the sources within the errors. However, this different spread might be due to the fact that the sources detected in the N{sub 2}H{sup +} isotopologues are more than those detected in the CN ones. The {sup 14}N/{sup 15}N ratio does not change significantly with the source evolutionary stage, which indicates that time seems to be irrelevant for the fractionation of nitrogen. We also find a possible anticorrelation between the {sup 14}N/{sup 15}N (as derived from N{sub 2}H{sup +}) and the H/D isotopic ratios. This suggests that {sup 15}N enrichment could not be linked to the parameters that cause D enrichment, in agreement with the prediction by recent chemical models. These models, however, are not able to reproduce the observed large spread in {sup 14}N/{sup 15}N, pointing out that some important routes of nitrogen fractionation could be still missing in the models.
15N NMR studies of layered nitride superconductor LixZrNCl
International Nuclear Information System (INIS)
Tou, H.; Oshiro, S.; Kotegawa, H.; Taguchi, Y.; Kishiume, Y.; Kasahara, Y.; Iwasa, Y.
2010-01-01
NMR measurements were carried out on pristine ZrNCl and Li x ZrNCl. From the 15 N-Knight shift study, the isotropic Knight shift, the traceless chemical (orbital) shift tensor and the traceless Knight shift tensor were determined as K iso = -71 ppm, (σ 1 , σ 2 , σ 3 ) = (-55, -55, 110) ppm and (K 1 , K 2 , K 3 ) = (48, 48, -96) ppm, respectively. In the superconducting state, the fractional change of the 15 N NMR shift for H-parallel ab was observed, evidencing that the pairing symmetry is a spin-singlet state.
Origin and tracing techniques of high 15N nitrogen compounds in industrial environments
International Nuclear Information System (INIS)
Talma, A.S.; Meyer, R.
2002-01-01
Effluents and process waters from various industrial plants were investigated for the 15 N/ 14 N isotope ratio in nitrate and ammonia. It was found that large isotope fractionation occurs in cases where ammonia is involved in gas-liquid phase changes. This feature was found to occur in two coke oven plants where ammonia gas is removed from a gas stream by solution in water, in an ammonia sulphate plant where ammonia gas is absorbed in sulphuric acid and in a water treatment plant where ammonia is removed from (high pH) water by blowing air through the process water. In all these cases 15 N isotope enrichments (in the range of 10 to 30 per mille) occurred. These enrichments are in excess of those found naturally. Ammonia in such wastewaters essentially retains this high 15 N content when it is converted to nitrate underground: which occurs rapidly under well-oxidised conditions. Nitrate is a fairly conservative tracer and its contamination in water can be followed readily. In the low recharge environment in the central parts of South Africa evidence of waste management practices of 10-20 years earlier were still quite evident using this isotopic label. The high 15 N nitrate signal could be used to distinguish industrial nitrogen pollution from pollution by local sewage disposal systems. Vegetation that derives its nitrogen from such high 15 N sources retains the isotope signature of its source. Grass and other annual plants then exhibit the isotope signature of the water of a specific year. Trees exhibit the isotope signature of deeper water, which shows the effects of longer term pollution events. The use of high 15 N as tracer enables the source apportionment of nitrogen derived pollution in these specific circumstances. (author)
Aqua ammonia 15 N obtaining and application with vainness for sugar-cane fertilization
International Nuclear Information System (INIS)
Vitti, Andre Cesar; Trivellin, Paulo Cesar O.; Oliveira, Claudineia R. de; Bendassoli, Jose A.
2000-01-01
Nitrogen compounds marked with the isotope 15 N are continuously being used in agronomic studies and, when associated to the isotopic dilution technique, they constitute an important tool in clarifying the N cycle. At the Centro de Energia Nuclear na Agricultura (CENA/USP), it was obtained ( 15 NH 4 ) 2 SO 4 enhanced at 3,5% of 15 N atoms, by means of the ionic exchange chromatography technique, which made possible to produce aqua ammonia ( 15 NH 3 aq). Four repetitions were taken to the aqua ammonia production process to use the nitrogen compound in the field experiment. In each process 150g of ammonium sulfate enhanced at 3,5% of 15 N atoms was used, obtaining 31,0 ± 1,6 g of aqua ammonia on the average (80% yield), with the same enhancement. The incidence of isotopic dilution has not been observed during the procedure, what made the use of such methodology possible. After obtaining the aqua ammonia 15 N through this procedure, it was added to the vinasse (an equivalent to 50 m 3 ha -1 ) in doses that corresponded to 70 kg ha -1 of N-NH 3 aq. The mixture was applied to the sugar-cane straw on the soil's surface, aimed to the crop's fertilization. The compound's isotopic composition was analyzed by means of a spectrometer of masses ANCA-SL Europe Scientific, while the total-N volatilized, by the micro-Kjeldahl. Method. In accordance to the low NH 3 (6,4 ± 1,9 kg ha -1 ) volatilization results, it could be concluded that the application of vinasse and aqua ammonia mixture to the straw on the soil's surface was efficient, due to the vinasse's acid character, which allowed the NH 3 , in presence of the ion H + , to stay in the NH 4 + form in solution. (author)
Hot spots of crop production changes at 1.5°C and 2°C
Schleussner, C. F.; Deryng, D.; Mueller, C.; Elliott, J. W.; Saeed, F.; Folberth, C.; Liu, W.; Wang, X.; Pugh, T.
2017-12-01
Studying changes in global and regional crop production is central for assessing the benefits of limiting global average temperature below 1.5ºC versus 2ºC. Projections of future climatic impacts on crop production are commonly focussed on focussing on mean changes. However, substantial risks are posed by extreme weather events such as heat waves and droughts that are of great relevance for imminent policy relevant questions such as price shocks or food security. Preliminary research on the benefits of keeping global average temperature increase below 1.5ºC versus 2ºC above pre-industrial levels has indicated that changes in extreme weather event occurrences will be more pronounced than changes in the mean climate. Here we will present results of crop yield projections for a set of global gridded crop models (GGCMs) for four major staple crops at 1.5°C and 2°C warming above pre-industrial levels using climate forcing data from the Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) project. We will assess changes in crop production on the global and regional level, and identify hot spots of change. The unique multi-ensemble setup allows to identify changes in extreme yield losses with multi-year to multi-decadal return periods, and thus elucidate the consequences for global and regional food security.
Use of Bio-Organic Fertilizers to Develop N Uptake Using 15N Technique
International Nuclear Information System (INIS)
Galal, Y.G.M.
2008-01-01
Experimental work either in field scale or in green house conditions were conducted using 15 N technique to evaluate the role of different bio fertilizers and different plant residues as organic amendments on enhancement of plant N nutrition. Nitrogen fixation by a symbiotic bacteria has been observed in greenhouse and field experiments under dry land cropping systems. Biological N 2 fixation associated with crop residues (legumes or cereals) was investigated in pot experiments with wheat and chickpea cultivars. In these experiments, labelled wheat and rice straw were used as organic N sources in comparison with either 15 N-labelled ammonium sulfate or ammonium nitrate as chemical nitrogen fertilizers. Rhizobium inoculation extended to be used with wheat gave the best results of N uptake and N 2 fixation when combined with Azospirillum brasilense as heterotrophic diazotrophs. The nitrogen uptake by wheat plants was significantly increased by application of soybean residues and inoculation with Azospirillum brasilense. From the field trial we can conclude that soybean residue as enriched N material, and Azospirillum brasilense inoculation enhanced N yields of wheat cultivars grown in poor fertile sandy soil
Solvent-dependent deuterium isotope effects in the 15N NMR spectra of an ammonium ion
International Nuclear Information System (INIS)
Wielogorska, E.; Jackowski, K.
2000-01-01
Deuterium isotope effects on 15 N NMR chemical shifts and spin-spin coupling constants have been investigated for the 15 N enriched ammonium chloride (conc. 15 NH 4 + ion has been observed in water, methanol, ethanol and dimethylsulfoxide, while the 15 ND 4 + has been monitored in the analogous deuterated liquids. It is shown that the isotope effect in nitrogen chemical shifts ( 1 Δ 15 N( 2/1 H)), significantly different in various solvents, changes from -1.392 ppm in dimethylsulfoxide to -0.071 ppm in ethanol. The 1 J(N,H) and 1 J(N,D) coupling constants have been measured for acidic solutions under conditions of slow proton (or deuterium) exchange. The reduced coupling constants have been estimated to present isotope effects in the spin-spin coupling constants. The latter isotope effects are fairly small. (author)
Impacts on terrestrial biodiversity of moving from a 2°C to a 1.5°C target
Smith, Pete; Price, Jeff; Molotoks, Amy; Warren, Rachel; Malhi, Yadvinder
2018-05-01
We applied a recently developed tool to examine the reduction in climate risk to biodiversity in moving from a 2°C to a 1.5°C target. We then reviewed the recent literature examining the impact of (a) land-based mitigation options and (b) land-based greenhouse gas removal options on biodiversity. We show that holding warming to 1.5°C versus 2°C can significantly reduce the number of species facing a potential loss of 50% of their climatic range. Further, there would be an increase of 5.5-14% of the globe that could potentially act as climatic refugia for plants and animals, an area equivalent to the current global protected area network. Efforts to meet the 1.5°C target through mitigation could largely be consistent with biodiversity protection/enhancement. For impacts of land-based greenhouse gas removal technologies on biodiversity, some (e.g. soil carbon sequestration) could be neutral or positive, others (e.g. bioenergy with carbon capture and storage) are likely to lead to conflicts, while still others (e.g. afforestation/reforestation) are context-specific, when applied at scales necessary for meaningful greenhouse gas removal. Additional effort to meet the 1.5°C target presents some risks, particularly if inappropriately managed, but it also presents opportunities. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
Gerhart-Barley, L.; McLauchlan, K. K.; Battles, J. J.; Craine, J. M.; Higuera, P. E.; Mack, M. C.; McNeil, B. E.; Nelson, D. M.; Pederson, N.; Perakis, S. S.
2016-12-01
In recent decades, human perturbation of the global nitrogen (N) cycle has been immense with reactive nitrogen supply to ecosystems from anthropogenic sources now exceeding that of natural fixation. The impact of these perturbations on ecosystem nutrient cycling and plant communities is limited by the lack of long-term `baseline' assessments of N cycling prior to anthropogenic influences. Stable N isotope analysis (δ15N) of dendrochronological records have the potential to provide this baseline data, but to date have focused on short term, regional assessments. Here, we address this question with a data set incorporating 311 individual trees and 7,661 δ15N measurements from 50 sites throughout the contiguous United States. These sites represent the diversity of US forest types, climate conditions, N deposition, soil types, and disturbance histories. The chronologies span, on average, the last 162 calendar years, with the oldest chronology dating back to 1572 C.E. Consequently, this study is the first century- and continental-scale assessment of ecosystem N cycling using tree-ring chronologies. When aggregated, the chronologies show a consistent decline from 1825 C.E. to present, indicating declining N availability in US forests, despite global increases in N supply. Environmental factors such as mean annual precipitation (MAP), mean annual temperature (MAT), and mean annual nitrogen deposition (Ndep) did not contribute to average site δ15N values; however, MAP and MAT significantly affected temporal trajectories in tree-ring δ15N, with more negative slopes toward present occurring in regions with low MAT and high MAP. Quantity of atmospheric N deposition had no discernible impact on mean δ15N values or on the temporal slope. This lack of response is either because levels of N deposition are too low to produce a discernible response in any meaningful aspects of the N cycle, and/or the δ15N signature of depositional N is similar enough to ecosystem N pools that
Influence of nutrition on protein synthesis and 15N tracer data in man
International Nuclear Information System (INIS)
Faust, H.
1984-01-01
Quantitative studies and measurements of parameters of the protein metabolism in vivo require the isotope methodology. Different 15 N tracer methods with special modifications are available which can be used depending on clinical problems. The oral single pulse application of [ 15 N]glycine is equal to other isotope tracer techniques provided that the basic assumptions of the application are fullfilled. The protein metabolism is clearly influenced by the nutritional status whereby the protein synthesis is more sensitive than the breakdown to altered dietary intakes of protein and energy. The importance of standardized experimental conditions is emphasized for studies with 15 N and the interpretation of tracer data. (author)
International Nuclear Information System (INIS)
Asante, Kwadwo Ansong; Agusa, Tetsuro; Kubota, Reiji; Mochizuki, Hiroko; Ramu, Karri; Nishida, Shuhei; Ohta, Suguru; Yeh, Hsin-ming; Subramanian, Annamalai; Tanabe, Shinsuke
2010-01-01
Trace elements (TEs) and stable isotope ratios (δ 15 N and δ 13 C) were analyzed in fish from deep-water of the Sulu Sea, the Celebes Sea and the Philippine Sea. Concentrations of V and Pb in pelagic fish from the Sulu Sea were higher than those from the Celebes Sea, whereas the opposite trend was observed for δ 13 C. High concentrations of Zn, Cu and Ag were found in non-migrant fish in deep-water, while Rb level was high in fish which migrate up to the epipelagic zone, probably resulting from differences in background levels of these TEs in each water environment or function of adaptation to deep-water by migrant and non-migrant species. Arsenic level in the Sulu Sea fish was positively correlated with δ 15 N, indicating biomagnification of arsenic. To our knowledge, this is the first study on relationship between diel vertical migration and TE accumulation in deep-water fish.
Fujiyoshi, Lei; Sugimoto, Atsuko; Tsukuura, Akemi; Kitayama, Asami; Lopez Caceres, M Larry; Mijidsuren, Byambasuren; Saraadanbazar, Ariunaa; Tsujimura, Maki
2017-03-01
The spatial patterns of plant and soil δ 15 N and associated processes in the N cycle were investigated at a forest-grassland boundary in northern Mongolia. Needles of Larix sibirica Ledeb. and soils collected from two study areas were analysed to calculate the differences in δ 15 N between needle and soil (Δδ 15 N). Δδ 15 N showed a clear variation, ranging from -8 ‰ in the forest to -2 ‰ in the grassland boundary, and corresponded to the accumulation of organic layer. In the forest, the separation of available N produced in the soil with 15 N-depleted N uptake by larch and 15 N-enriched N immobilization by microorganisms was proposed to cause large Δδ 15 N, whereas in the grassland boundary, small Δδ 15 N was explained by the transport of the most available N into larch. The divergence of available N between larch and microorganisms in the soil, and the accumulation of diverged N in the organic layer control the variation in Δδ 15 N.
DEFF Research Database (Denmark)
Pirhofter-Walzl, Karin; Eriksen, Jørgen; Rasmussen, Jim
2013-01-01
access to greater amounts of soil 15N compared with a shallow-rooting binary mixture, and if leguminous plants affect herbage yield and soil 15N-access. Methods 15N-enriched ammonium-sulphate was placed at three different soil depths (0.4, 0.8 and 1.2 m) to determine the depth dependent soil 15N....... This positive plant diversity effect could not be explained by complementary soil 15N-access of the different plant species from 0.4, 0.8 and 1.2 m soil depths, even though deep-rooting chicory acquired relatively large amounts of deep soil 15N and shallow-rooting perennial ryegrass when grown in a mixture...
Measurement of denitrification on grassland using gas chromatography and 15N tracer technique
International Nuclear Information System (INIS)
Lippold, H.; Foerster, I.; Hagemann, O.; Matzel, W.
1981-01-01
Alternative covering of grassland micro-plots fertilized with 15 NH 4 15 NO 3 allowed on the basis on N 2 and N 2 O quantities released within several weeks to measure denitrification and to calculate it by means of methane as gas tracer. Thus the gas exchange was rendered visible and the N quantities measured could be corrected. In some variants, the acetylene blocking technique was successfully applied by adding acetylene to the soil air. The losses measured at 6 dates are discussed together with the 15 N balance and atmospherical conditions. The method is suited for recording the high losses occurring mainly in the second quarter of the year immediately after fertilization. Under the conditions mentioned soil N losses were small (3 kg N/ha). The immobilized fertilizer N quantities reached 20 to 30 kg/ha (fertilizer rate 100 kg N/ha) and were comparably independent of the date of fertilization. (author)
/sup 15/N dilution technique of assessing the contribution of nitrogen fixation to rice plant
Energy Technology Data Exchange (ETDEWEB)
Ventura, W; Watanabe, Iwao [International Rice Research Inst., College, Laguna (Phillippines)
1983-06-01
An attempt to correlate the positive nitrogen balance in rice-soil system with the /sup 15/N dilution in rice plants was made to see if isotope dilution can be used to assess the contribution of nitrogen fixation to the nitrogen nutrition of rice. /sup 15/N ammonium sulfate and sucrose were added to the moist soil in pots to label biomass nitrogen fraction. The rice-soil system with higher nitrogen gain had lower /sup 15/N content in the rice plants. When the surface of pots was covered with black cloths to suppress photodependent N/sub 2/ fixation, no significant nitrogen gain was observed. Significant gain was found in the rice-flooded soil system exposed to light, and the /sup 15/N content of plants decreased in allowing the photodependent N/sub 2/ fixation by blue-green algae symbiosis. The contribution of plant nitrogen derived from photodependent N/sub 2/ fixation was estimated to be 20-30 % of the positive nitrogen gain in the system by the /sup 15/N dilution technique using the rice-covered soil as reference system.
The potential contribution of disruptive low-carbon innovations to 1.5 °C climate mitigation
Wilson, C.; Pettifor, H.; Cassar, E.; Kerr, L.; Wilson, M.
2018-01-01
This paper investigates the potential for consumer-facing innovations to contribute emission reductions for limiting warming to 1.5 °C. First, we show that global integrated assessment models which characterise transformation pathways consistent with 1.5 °C mitigation are limited in their ability to analyse the emergence of novelty in energy end-use. Second, we introduce concepts of disruptive innovation which can be usefully applied to the challenge of 1.5 °C mitigation. Disruptive low-carbo...
Foliar fertilization of sugarcane (Saccharum spp): absorption and translocation of 15-N-labeled urea
International Nuclear Information System (INIS)
Trivelin, P.C.O.; Carvalho, J.G. de; Silva, A.Q. da; Primavesi, A.C.P.A.; Camacho, E.; Eimori, I.E.; Guilherme, M.R.
1988-01-01
The absorption and translocation of foliar applied nitrogen as urea solution to sugar cane plants was evaluated. An experiment using the isotope dilution technique with 15 N labeled urea was carried out in green house condition. Seedlings of sugarcane variety IAC 53-150 were planted in pots with 5KG of top soil''latossolo vermelho amarelo, fase arenosa'' (Haplustox). (M.A.C.) [pt
Synthesis of alkylated deoxyno irimycin and 1,5-dideoxy-1,5-iminoxylitol analogues:
DEFF Research Database (Denmark)
Szczepina, M.G.; Johnston, B.D; Yuan, Y.
2004-01-01
The syntheses of N-alkylated deoxynojirimycin and 1,5-dideoxy-1,5-iminoxylitol derivatives having either a D- or an L-erythritol-3-sulfate functionalized N-substituent are reported. The alkylating agent used was a cyclic sulfate derivative, whereby selective attack of the nitrogen atom at the least...
Halogenated Terpenes and a C15-Acetogenin from the Marine Red Alga Laurencia saitoi
Directory of Open Access Journals (Sweden)
Xiao-Ming Li
2008-11-01
Full Text Available Seven parguerane diterpenes: 15-bromo-2,7,19-triacetoxyparguer-9(11-en-16-ol (1, 15-bromo-2,7,16,19-tetraacetoxyparguer-9(11-ene (2, 15-bromo-2,19-diacetoxyparguer-9(11-en-7,16-diol (3, 15-bromo-2,16,19-triacetoxyparguer-9(11-en-7-ol (4, 15-bromo-2,16-diacetoxyparguer-9(11-en-7-ol (5, 15-bromoparguer-9(11-en-16-ol (6, 15-bromoparguer-7-en-16-ol (7, two polyether triterpenes: thyrsiferol (8 and thyrsiferyl 23-acetate (9, and one C15-acetogenin, neolaurallene (10, were isolated from a sample of marine red alga Laurencia saitoi collected off the coast of Yantai. Their structures were established by detailed NMR spectroscopic analysis and comparison with literature data.
Nitrate movement and plant uptake of N in a field soil receiving 15N-enriched fertilizer
International Nuclear Information System (INIS)
Broadbent, F.E.; Krauter, C.
1974-01-01
A plot of 13.9 m 2 on Yolo fine sandy loam was fertilized with (NH 4 ) 2 SO 4 containing 8.04 atom percent excess 15 N at the rate of 112 kg N/hectare and planted first to wheat and then to corn. The plot was surrounded by a buffer zone of 405 m 2 which was treated in identical fashion except that unlabeled fertilizer was used. Porous ceramic probes for measuring soil moisture tension and for extraction of soil solution were installed depths from 15 to 180 cm. Harvested crops were analyzed for 15 N as were soil cores taken after crop harvest. Nitrate-N concentrations in the soil solution at 15 cm ranged from a maximum in March of 70 ppM, of which 39 ppM was derived from fertilizer, to a minimum of 0.2 ppM in July. The largest amount of fertilizer-derived NO 3 -N at 180 cm was 0.28 percent of that applied, contributing 0.36 ppM to the concentration at that depth. The wheat crop removed 32.3 percent of the fertilizer N and the corn crop utilized 22.8 percent. Organic and inorganic N remaining in the soil after cropping represented 32.9 percent of the applied N, leaving 12.0 percent unaccounted for. The consistently low nitrate concentrations at 180 cm suggest that this deficit was not due to leaching, and should be attributed to denitrification. (U.S.)
Energy Technology Data Exchange (ETDEWEB)
Ambrosano, Edmilson Jose; Rossi, Fabricio, E-mail: ambrosano@apta.sp.gov.b [Agencia Paulista de Tecnologia dos Agronegocios (APTA), Piracicapa, SP (Brazil). Polo Rigional Centro Sul; Trivelin, Paulo Cesar Ocheuze [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil). Lab. de Isotopos Estaveis; Cantarella, Heitor [Agencia Paulista de Tecnologia dos Agronegocios (APTA/IAC), Campinas, SP (Brazil). Instituto Agronomico de Campinas. Centro de Solos e Recursos Agroambientais; Ambrosano, Glaucia Maria Bovi [Universidade de Campinas (UNICAMP/FOP), Piracicaba, SP (Brazil). Fac. de Odontologia de Piracicaba. Dept. de Odontologia Social, Bioestatistica; Schammass, Eliana Aparecida [Agencia Paulista de Tecnologia dos Agronegocios (APTA/IZ), Nova Odessa, SP (Brazil). Instituto de Zootecnia; Muraoka, Takashi [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil). Lab. de Fertilidade do solo
2011-05-15
Legumes as green manure are alternative sources of nitrogen (N) for crops and can supplement or even replace mineral nitrogen fertilization due to their potential for biological nitrogen fixation (BNF). The utilization of nitrogen by sugarcane (Saccharum spp.) fertilized with sunn hemp (Crotalaria juncea L.) and ammonium sulfate (AS) was evaluated using the {sup 15}N tracer technique. N was added at the rate of 196 and 70 kg ha{sup -1} as {sup 15}N-labeled sunn hemp green manure (SH) and as ammonium sulfate (AS), respectively. Treatments were: (I) Control; (II) AS{sup 15}N; (III) SH{sup 15}N + AS; (IV) SH{sup 15}N; and (V) AS{sup 15}N + SH. Sugarcane was cultivated for five years and was harvested three times. {sup 15}N recovery was evaluated in the two first harvests. In the sum of the three harvests, the highest stalk yields were obtained with a combination of green manure and inorganic N fertilizer; however, in the second cutting the yields were higher where SH was used than in plots with AS. The recovery of N by the first two consecutive harvests accounted for 19 to 21% of the N applied as leguminous green manure and 46 to 49% of the N applied as AS. The amounts of inorganic N, derived from both N sources, present in the 0-0.4 m layer of soil in the first season after N application and were below 1 kg ha{sup -1}. (author)
AgMIP Coordinated Global and Regional Assessments for 1.5°C and 2.0°C
Rosenzweig, C.
2017-12-01
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study performs a proof-of-concept of the CGRA to demonstrate advantages and challenges of the framework. This effort responds to the request by UNFCCC for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), HAPPI and CMIP5 ensemble scenarios, global gridded crop models, global agricultural economic models, site-based crop models, and within-country regional economic models. CGRA results show that at the global scale, mixed areas of positive and negative simulated yield changes, with declines in some breadbasket regions led to overall declines in productivity at both 1.5°C and 2.0°C. These projected global yield changes resulted in increases in prices of major commodities in a global economic model. Simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on region and crop, but with more negative effects on productivity at 2.0°C than at 1.5°C for the most part. In conjunction with price changes from the global economics models, these productivity declines resulted generally in small positive effects on regional farm livelihoods, showing that farming systems should continue to be viable under high mitigation scenarios. CGRA protocols focus on how mitigation actions and effects differ across scales, with main mechanisms studied in the integrated assessment models being policies and technologies that reduce direct non-CO2 emissions from agriculture, reduce CO2 emissions from land use change and forest sink enhancement
Regional patterns in foliar 15N across a gradient of nitrogen deposition in the northeastern US
Linda H. Pardo; Steven G. McNulty; Johnny L. Boggs; Sara Duke
2007-01-01
Recent studies have demonstrated that natural abundance 15N can be a useful tool for assessing nitrogen saturation, because as nitrification and nitrate loss increase, d15N of foliage and soil also increases. We measured foliar d15N at 11 high-elevation spruce-fir stands along an N deposition gradient...
International Nuclear Information System (INIS)
Nishio, T.; Oka, N.
2003-01-01
The effect of the application of organic matter on the fate of 15 N-labeled ammonium was investigated in a field. The organic materials incorporated into the experimental plots consisted of wheat straw, rape, pig compost, cow compost, plant manure. In May 2000, 10 g N m -2 of 15 N-labeled ammonium was applied to the field together with the organic materials, and maize and winter wheat were consecutively cultivated. The recovery of applied 15 N in soils and plants was determined after the harvest of each crop. Although only about 10% of the applied 15 N-labeled fertilizer remained in the 0-30 cm layer of the Control Plot and the Plant Manure Plot, more than 25% of the applied 15 N remained in the Pig Compost Plot. Amount and proportion of the immobilized 15 N to those of total N or microbial biomass N in soils were determined for the topsoil samples (0-10 cm layer). The amounts of both microbial biomass N and total immobilized 15 N in soil were highest in the Pig Compost Plot. Although the amount of microbial biomass N was comparable to the amount of immobilized 15 N-labeled fertilizer in soil, the amounts of 15 N-labeled fertilizer contained in the microbial biomass accounted for less than 10 % of the amount of total immobilized 15 N in soil. The ratio of the amount of 15 N-labeled fertilizer contained in biomass N to the total amount of biomass N was one order to magnitude higher than the ratio of the amount of immobilized 15 N-labeled fertilizer to the amount of total N in soil. No conspicuous changes in the amount of immobilized 15 N in soil were observed during the cultivation of winter wheat except for the Pig Compost Plot. No significant correlation was recognized between the amount of 15 N-labeled fertilizer contained in microbial biomass before wheat cultivation and that of 15 N-labeled fertilizer absorbed by wheat, indicating that microbial N immobilized during the growth period of the former crop (maize) was not a significant source of N for the latter