Food resources of stream macroinvertebrates determined by natural-abundance stable C and N isotopes and a 15N tracer addition

Science.gov (United States)

Patrick J. Mulholland; Jennifer L. Tank; Diane M. Sanzone; Wilfrid M. Wollheim; Bruce J. Peterson; Jackson R. Webster; Judy L. Meyer

2000-01-01

Trophic relationships were examined using natural-abundance 13C and 15N analyses and a 15N-tracer addition experiment in Walker Branch, a 1st-order forested stream in eastern Tennessee. In the 15N-tracer addition experiment, we added 15NH4...

15N-tomatine

International Nuclear Information System (INIS)

Elliger, C.A.

1988-01-01

A method for preparative isolation of 15 N-tomatine from foliage of tomato plants grown hydroponically with 15 N-containing nutrient salts is described. Extractive workup of plant material gave a crude product which was chromatographed on Sephadex LH-20 to yield pure tomatine. Assay of 15 N content by mass spectrometry showed that isotopic purity was ca. 95%. (author)

Large old trees influence patterns of delta13C and delta15N in forests.

Science.gov (United States)

Weber, Pascale; Bol, Roland; Dixon, Liz; Bardgett, Richard D

2008-06-01

Large old trees are the dominant primary producers of native pine forest, but their influence on spatial patterns of soil properties and potential feedback to tree regeneration in their neighbourhood is poorly understood. We measured stable isotopes of carbon (delta(13)C) and nitrogen (delta(15)N) in soil and litter taken from three zones of influence (inner, middle and outer zone) around the trunk of freestanding old Scots pine (Pinus sylvestris L.) trees, to determine the trees' influence on below-ground properties. We also measured delta(15)N and delta(13)C in wood cores extracted from the old trees and from regenerating trees growing within their three zones of influence. We found a significant and positive gradient in soil delta(15)N from the inner zone, nearest to the tree centre, to the outer zone beyond the tree crown. This was probably caused by the higher input of (15)N-depleted litter below the tree crown. In contrast, the soil delta(13)C did not change along the gradient of tree influence. Distance-related trends, although weak, were visible in the wood delta(15)N and delta(13)C of regenerating trees. Moreover, the wood delta(15)N of small trees showed a weak negative relationship with soil N content in the relevant zone of influence. Our results indicate that large old trees control below-ground conditions in their immediate surroundings, and that stable isotopes might act as markers for the spatial and temporal extent of these below-ground effects. John Wiley & Sons, Ltd

Indirect Measurement of 15N(p,α)12C and 18O(p,α)15N. Applications to the AGB Star Nucleosynthesis

International Nuclear Information System (INIS)

La Cognata, M.; Spitaleri, C.; Cherubini, S.; Crucilla, V.; Gulino, M.; Lamia, L.; Pizzone, R. G.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S.; Sergi, M. L.; Tumino, A.; Tribble, R.; Al-Abdullah, T.; Banu, A.; Fu, C.; Goldberg, V.; Mukhamedzhanov, A.; Tabacaru, G.; Trache, L.

2008-01-01

The Trojan Horse Method has been recently applied to the study of reactions involved in fluorine nucleosynthesis inside AGB stars. Fluorine abundance is important since it allows to constrain mixing models from the comparison of the observed fluorine abundances with the ones predicted by models. Anyway direct measurements of the cross section do not extend down to the Gamow peak, which is the astrophysically relevant energy region. In particular the study focuses on the 15 N(p,α) 12 C and the 18 O(p,α) 15 N reactions which can influence fluorine yield as they are part of 19 F production/destruction network

Synthesis of (+-)-(1,1'- sup 15 N sub 2 , 2'- sup 13 C)-trans-3'-methylnicotine

Energy Technology Data Exchange (ETDEWEB)

Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr. (Department of Health and Human Services, Atlanta, GA (United States))

1992-03-01

The synthesis of ({+-})- (1,1'-{sup 15}N{sub 2}, 2'-{sup 13}C)-trans-3'-methylnicotine is reported. {sup 15}N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/(carbonyl-{sup 13}C)-methyl formate. The resulting {sup 15}n-Pyridine-3-({sup 13}C-carbonyl)-carboxaldehyde was reacted with {sup 15}N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give ({+-})- (1,1'-{sup 15}N{sub 2}, 5'-{sup 13}C)-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave ({+-})-(1,1'-{sup 15}N{sub 2}, 2'-{sup 13}C)-trans-3'-methylnicotine. (Author).

Comparison of 15N- and 13C-determined parameters of mobility in melittin

International Nuclear Information System (INIS)

Zhu Lingyang; Prendergast, Franklyn G.; Kemple, Marvin D.

1998-01-01

Backbone and tryptophan side-chain mobilities in the 26-residue, cytolytic peptide melittin (MLT) were investigated by 15 N and 13 C NMR. Specifically, inverse-detected 15 N T 1 and steady-state NOE measurements were made at 30 and 51 MHz on MLT at 22 deg. C enriched with 15 N at six amide positions and in the Trp 19 side chain. Both the disordered MLT monomer (1.2 mM peptide at pH 3.6 in neat water) and α-helical MLT tetramer (4.0 mM peptide at pH 5.2 in 150 mM phosphate buffer) were examined. The relaxation data were analyzed in terms of the Lipari and Szabo model-free formalism with three parameters: τ m , the correlation time for the overall rotation; S 2 , a site-specific order parameter which is a measure of the amplitude of the internal motion; and τ e , a local, effective correlation time of the internal motion. A comparison was made of motional parameters from the 15 N measurements and from 13 C measurements on MLT, the latter having been made here and previously [Kemple et al. (1997) Biochemistry, 36, 1678-1688]. τ m and τ e values were consistent from data on the two nuclei. In the MLT monomer, S 2 values for the backbone N-H and Cα-H vectors in the same residue were similar in value but in the tetramer the N-H order parameters were about 0.2 units larger than the Cα-H order parameters. The Trp side-chain N-H and C-H order parameters, and τ e values were generally similar in both the monomer and tetramer. Implications of these results regarding the dynamics of MLT are examined

Experiments and strategies for the assignment of fully13 C/15N-labelled polypeptides by solid state NMR

International Nuclear Information System (INIS)

Straus, Suzana K.; Bremi, Tobias; Ernst, Richard R.

1998-01-01

High-resolution heteronuclear NMR correlation experiments and strategies are proposed for the assignment of fully 13 C/ 15 N-labelled polypeptides in the solid state. By the combination of intra-residue and inter-residue 13 C- 15 N correlation experiments with 13 C- 13 C spin-diffusion studies, it becomes feasible to partially assign backbone and side-chain resonances in solid proteins. The performance of sequences using 15 N instead of 13 C detection is evaluated regarding sensitivity and resolution for a labelled dipeptide (L-Val-L-Phe). The techniques are used for a partial assignment of the 15 N and 13 C resonances in human ubiquitin

Application of 15N labeling to topics in molecular hematology

International Nuclear Information System (INIS)

Lapidot, A.; Irving, C.S.

1975-01-01

The amount of information which can be obtained from many types of spectrometric analysis of compounds of hematological interest can be greatly enhanced when measurements are made on a series of isotopically labeled compounds. A murine Friend virus-induced erythroleukemic cell (FLC) culture was found to be a superior biosynthetic system for the preparation of highly and selectively 15 N and 13 C enriched hemoglobins. A mutant of Rhodopseudomonas spheroides was found suitable for the preparation of larger quantities of >90 percent enriched protoporphyrin-IX- 15 N and coproporphyrin-III-- 15 N. A comparison of the 15 N and 13 C NMR spectra of FLC carbomonoxy-[Gly- 15 N]-hemoglobin, carbomonoxy-[Gly- 13 C/sub alpha/]-hemoglobin, α and β globin-[Gly- 15 N] and globin-[Gly- 13 C/sub alpha/] demonstrated 1) 15 N peptide chemical shifts are sensitive to polypeptide sequence, whereas 13 C α-carbon chemical shifts are not, (2) variations in the solvation of the peptide N-H group can be detected in the 15 N spectra but not the 13 C spectra, (3) 15 N heme resonances could not be detected, whereas 13 C resonances could. These studies indicated that in hemoglobin the glycyl N-H resonances are either solvated by H 2 O or hydrogen bonded to peptide C=0 groups. In denatured globin, the majority of the glycyl residues are rapidly exchanging between these two states

Ultra-violet absorption cross sections of isotopically substituted nitrous oxide species: 14N14NO, 15N14NO, 14N15NO and 15N15NO

Directory of Open Access Journals (Sweden)

P. von Hessberg

2004-01-01

Full Text Available The isotopically substituted nitrous oxide species 14N14NO, 15N14NO, 14N15NO and 15N15NO were investigated by ultra-violet (UV absorption spectroscopy. High precision cross sections were obtained for the wavelength range 181 to 218nm at temperatures of 233 and 283K. These data are used to calculate photolytic isotopic fractionation constants as a function of wavelength. The fractionation constants were used in a three-dimensional chemical transport model in order to simulate the actual fractionation of N2O in the stratosphere, and the results were found to be in good agreement with field studies.

Synthesis of hydroxylamine-15 N.HCl

International Nuclear Information System (INIS)

Baldea, Aurel

2001-01-01

15 N labelled hydroxylamine is one of the starting substance for synthesis of labelled oximes. Industrial procedure was chosen to prepare hydroxylamine- 15 N. Sodium nitrite reduced by sodium bisulfite and sulfur dioxide, at temperature of 0-2 deg. C, produces sodium hydroxylamine disulfonate. The reaction mixture is treated with acetone and the resulting acetoxime is distilled. In order to obtain crystalline hydroxylamine hydrochloride, hydrochloric acid is added to the distillate and the solution is evaporated to dryness. The crude product was purified by recristallization, yielding 62-65% of theoretical amount. Labelled ammonium chloride formed as byproduct can be recovered improving 15 N balance. IR spectra is used for chemical analysis and mass spectrometry for isotopic analysis. For this purpose hydroxylamine- 15 N is converted into molecular nitrogen. (author)

[Studies with 15N-labeled lysine in colostomized hens. 2. 15N excretion in feces].

Science.gov (United States)

Gruhn, K; Wiefel, P

1983-05-01

Over a period of four days colostomised hens were given 15N-lysine, and the development of 15N-excretion both in the TCA-soluble and the TCA-precipitable fraction of the faeces was measured over eight days. In both fractions the total, lysine, histidine and arginine N and 15N-excess (15N') was determined. The average apparent digestibility of 14N was 81.2% +/- 1.1% and of 15N' 93.2% +/- 0.7%. Labelled N is already excreted in faeces 3 hours after its application. The TCA-precipitable N is less strongly labelled than the TCA-soluble N. During the application of 15N' the labelling in faecal lysine is nearly one power of ten higher than in total N. The atom-% 15N' of the lysine could also be distinctly detected in arginine and histidine. The quotas of the total 15N' in faeces were 3.5% for arginine-15N' and 0.8% for histidine 15N'; 15N' can mainly be detected in the soluble fraction.

Stellar Origin of 15N-rich Presolar SiC Grains of Type AB: Supernovae with Explosive Hydrogen Burning

International Nuclear Information System (INIS)

Liu, Nan; Nittler, Larry R.; Alexander, Conel M. O’D.; Wang, Jianhua; Pignatari, Marco

2017-01-01

We report C, N, and Si isotopic data for 59 highly 13 C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 15 N-rich ( 14 N/ 15 N ≤ solar) AB grains, and their Mg–Al, S, and Ca–Ti isotope data when available. These 37 grains are enriched in 13 C, 15 N, and 26 Al with the PNGs showing more extreme enhancements. The 15 N-rich AB grains show systematically higher 26 Al and 30 Si excesses than the 14 N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 ( 14 N/ 15 N < solar) and 2 ( 14 N/ 15 N ≥ solar). For the first time, we have obtained both S and Ti isotopic data for five AB1 grains and one PNG and found 32 S and/or 50 Ti enhancements. Interestingly, one AB1 grain had the largest 32 S and 50 Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the 32 S excess and thus the initial presence of radiogenic 32 Si ( t 1/2 = 153 years). More importantly, we found that the 15 N and 26 Al excesses of AB1 grains form a trend that extends to the region in the N–Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.

Stellar Origin of 15N-rich Presolar SiC Grains of Type AB: Supernovae with Explosive Hydrogen Burning

Science.gov (United States)

Liu, Nan; Nittler, Larry R.; Pignatari, Marco; O'D. Alexander, Conel M.; Wang, Jianhua

2017-06-01

We report C, N, and Si isotopic data for 59 highly 13C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 15N-rich (14N/15N ≤ solar) AB grains, and their Mg-Al, S, and Ca-Ti isotope data when available. These 37 grains are enriched in 13C, 15N, and 26Al with the PNGs showing more extreme enhancements. The 15N-rich AB grains show systematically higher 26Al and 30Si excesses than the 14N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 (14N/15N PNG and found 32S and/or 50Ti enhancements. Interestingly, one AB1 grain had the largest 32S and 50Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the 32S excess and thus the initial presence of radiogenic 32Si (t 1/2 = 153 years). More importantly, we found that the 15N and 26Al excesses of AB1 grains form a trend that extends to the region in the N-Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.

Synthesis of 15N-enriched urea (CO(15NH22 from 15NH3, CO, and S in a discontinuous process

Directory of Open Access Journals (Sweden)

C. R. Sant Ana Filho

2012-12-01

Full Text Available CO(15NH22 enriched with the stable isotope 15N was synthesized based on a reaction involving CO, 15NH3, and S in the presence of CH3OH. The method differs from the industrial method; a stainless steel reactor internally lined with polytetrafluoroethylene (PTFE was used in a discontinuous process under low pressure and temperature. The yield of the synthesis was evaluated as a function of the parameters: the amount of reagents, reaction time, addition of H2S, liquid solution and reaction temperature. The results showed that under optimum conditions (1.36, 4.01, and 4.48 g of 15NH3, CO, and S, respectively, 40 ml CH3OH, 40 mg H2S, 100 ºC and 120 min of reaction 1.82 g (yield 76.5% of the compound was obtained per batch. The synthesized CO(15NH22 contained 46.2% N, 0.55% biuret, melting point of 132.55 ºC and did not exhibit isotopic fractionation. The production cost of CO(15NH22 with 90.0 at. % 15N was US$ 238.60 per gram.

15N fractionation in infrared-dark cloud cores

Science.gov (United States)

Zeng, S.; Jiménez-Serra, I.; Cosentino, G.; Viti, S.; Barnes, A. T.; Henshaw, J. D.; Caselli, P.; Fontani, F.; Hily-Blant, P.

2017-07-01

Context. Nitrogen is one of the most abundant elements in the Universe and its 14N/15N isotopic ratio has the potential to provide information about the initial environment in which our Sun formed. Recent findings suggest that the solar system may have formed in a massive cluster since the presence of short-lived radioisotopes in meteorites can only be explained by the influence of a supernova. Aims: We seek to determine the 14N/15N ratio towards a sample of cold and dense cores at the initial stages in their evolution. Methods: We observed the J = 1 → 0 transitions of HCN, H13CN, HC15N, HN13C, and H15NC towards a sample of 22 cores in four infrared-dark clouds (IRDCs) which are believed to be the precursors of high-mass stars and star clusters. Assuming LTE and a temperature of 15 K, the column densities of HCN, H13CN, HC15N, HN13C, and H15NC are calculated and their 14N/15N ratio is determined for each core. Results: The 14N/15N ratios measured in our sample of IRDC cores range between 70 and ≥763 in HCN and between 161 and 541 in HNC. These ratios are consistent with the terrestrial atmosphere (TA) and protosolar nebula (PSN) values, and with the ratios measured in low-mass prestellar cores. However, the 14N/15N ratios measured in cores C1, C3, F1, F2, and G2 do not agree with the results from similar studies towards the same cores using nitrogen bearing molecules with nitrile functional group (-CN) and nitrogen hydrides (-NH) although the ratio spread covers a similar range. Conclusions: Relatively low 14N/15N ratios amongst the four-IRDCs were measured in IRDC G which are comparable to those measured in small cosmomaterials and protoplanetary disks. The low average gas density of this cloud suggests that the gas density, rather than the gas temperature, may be the dominant parameter influencing the initial nitrogen isotopic composition in young PSN. The reduced spectra (FITS files) are only available at the CDS via anonymous ftp to http

Redox-controlled backbone dynamics of human cytochrome c revealed by 15N NMR relaxation measurements

International Nuclear Information System (INIS)

Sakamoto, Koichi; Kamiya, Masakatsu; Uchida, Takeshi; Kawano, Keiichi; Ishimori, Koichiro

2010-01-01

Research highlights: → The dynamic parameters for the backbone dynamics in Cyt c were determined. → The backbone mobility of Cyt c is highly restricted due to the covalently bound heme. → The backbone mobility of Cyt c is more restricted upon the oxidation of the heme. → The redox-dependent dynamics are shown in the backbone of Cyt c. → The backbone dynamics of Cyt c would regulate the electron transfer from Cyt c. -- Abstract: Redox-controlled backbone dynamics in cytochrome c (Cyt c) were revealed by 2D 15 N NMR relaxation experiments. 15 N T 1 and T 2 values and 1 H- 15 N NOEs of uniformly 15 N-labeled reduced and oxidized Cyt c were measured, and the generalized order parameters (S 2 ), the effective correlation time for internal motion (τ e ), the 15 N exchange broadening contributions (R ex ) for each residue, and the overall correlation time (τ m ) were estimated by model-free dynamics formalism. These dynamic parameters clearly showed that the backbone dynamics of Cyt c are highly restricted due to the covalently bound heme that functions as the stable hydrophobic core. Upon oxidation of the heme iron in Cyt c, the average S 2 value was increased from 0.88 ± 0.01 to 0.92 ± 0.01, demonstrating that the mobility of the backbone is further restricted in the oxidized form. Such increases in the S 2 values were more prominent in the loop regions, including amino acid residues near the thioether bonds to the heme moiety and positively charged region around Lys87. Both of the regions are supposed to form the interaction site for cytochrome c oxidase (CcO) and the electron pathway from Cyt c to CcO. The redox-dependent mobility of the backbone in the interaction site for the electron transfer to CcO suggests an electron transfer mechanism regulated by the backbone dynamics in the Cyt c-CcO system.

15N and 13C abundances in marine environments with emphasis on biogeochemical structure of food networks

International Nuclear Information System (INIS)

Wada, E.

1987-01-01

Distributions of δ 15 N and δ 13 C for biogenic substances in the Antarctic Ocean and in the Otsuchi River estuary in Japan were investigated to construct isotope biogeochemical framework for assessing marine ecosystems. The isotopic compositions of phytoplankton were particularly low in the Antarctic Ocean. High nitrate and CO 2 concentrations in the surface sea waters, and the low light intensity seem to enhance the kinetic isotope fractionations that preferred the depletion of 15 N and 13 C in the algal body. A clear-cut linear relationship between animal δ 15 N and its trophic level was obtained in the Antarctic system. In the estuary, the variation of isotope ratios were principally governed by the mixing of land-derived organic matter, marine phytoplankton, and seagrasses. A food-chain effect of 15 N enrichment was also confirmed. An isotopically ordered structure was presented for a marine estuarine ecosystem. The isotopic abundances in a food network vary mainly because of the variation in 15 N and 13 C contents of primary producers grown under different environmental conditions and because of the enrichment of 15 N along food chains. (author)

Indirect measurement of the 15N(p,α)12C reaction cross section through the THM

International Nuclear Information System (INIS)

Romano, S.; La Cognata, M.; Spitaleri, C.; Cherubini, S.; Gulino, M.; Lamia, L.; Musumarra, A.; Tribble, R.; Trache, C.L.; Fu, C.

2005-01-01

Among the reactions of the stellar CNO cycle, the 15 N(p,α) 12 C plays a crucial role. In particular its reaction rate is important for understanding the CNOI escape towards CNOII. Thus it is important to study its bare nucleus cross section at the energies typical of such astrophysical environments, i.e. few tens of keV. At these energies such a measurement is hard to perform in a direct way because of the electron screening effect as pointed out for several cases. A possibility is then given by indirect methods and in particular the Trojan Horse Method (THM) has been applied in this case. The preliminary validity test for the study of 15 N(p,α) 12 C via the 15 N(d,α 12 C)n three body reaction is reported in this work. A 15 N beam was provided by the cyclotron at Texas A and M University with energy 60 MeV/c and delivered onto a CD 2 target. A ΔE/E telescope (PSD + ionization chamber) and a pair of PSD's were mounted in a coplanar geometry. Coincidences between the detectors were considered and the 15 N-p quasi-free contribution to the overall three-body cross-section was selected. Data analysis and preliminary results will be discussed and compared with direct data. (author)

Species specific and environment induced variation of δ13C and δ15N in alpine plants

Directory of Open Access Journals (Sweden)

Yang eYang

2015-06-01

Full Text Available Stable carbon and nitrogen isotope signals in plant tissues integrate plant-environment interactions over long periods. In this study, we hypothesized that humid alpine life conditions are narrowing the scope for significant deviations from common carbon, water and nitrogen relations as captured by stable isotope signals. We explored the variation in δ13C and δ15N in 32 plant species from tissue type to ecosystem scale across a suite of locations at c. 2500 m elevation in the Swiss Alps. Foliar δ13C and δ15N varied among species by about 3-4 ‰ and 7-8 ‰ respectively. However, there was no overall difference in means of δ13C and δ15N for species sampled in different plant communities or when bulk plant dry matter harvests of different plant communities were compared. δ13C was found to be highly species specific, so that the ranking among species was mostly maintained across 11 habitats. However, δ15N varied significantly from place to place in all species (a range of 2.7 ‰ except in Fabaceae (Trifolium alpinum and Juncaceae (Luzula lutea. There was also a substantial variation among individuals of the same species collected next to each other. No difference was found in foliar δ15N of non-legumes, which were either collected next to or away from the most common legume, T. alpinum. δ15N data place Cyperaceae and Juncaceae, just like Fabaceae, in a low discrimination category, well separated from other families. Soil δ15N was higher than in plants and increased with soil depth. The results indicate a high functional diversity in alpine plants that is similar to that reported for low elevation plants. We conclude that the surprisingly high variation in δ13C and δ15N signals in the studied high elevation plants is largely species specific (genetic and insensitive to obvious environmental cues.

Determination of the asymptotic normalization coefficients for ¹⁴C + n <--> ¹⁵C, the ¹⁴C(n, gamma)¹⁵C reaction rate, and evaluation of a new method to determine spectroscopic factors

Energy Technology Data Exchange (ETDEWEB)

McCleskey, M; Mukhamedzhanov, A M; Trache, L; Tribble, R E; Banu, A; Eremenko, V; Goldberg, V Z; Lui, Y W; McCleskey, E; Roeder, B T; Spiridon, A; Carstoiu, F; Burjan, V; Hons, Z; Thompson, I J

2014-04-17

The ¹⁴C + n <--> ¹⁵C system has been used as a test case in the evaluation of a new method to determine spectroscopic factors that uses the asymptotic normalization coefficient (ANC). The method proved to be unsuccessful for this case. As part of this experimental program, the ANCs for the ¹⁵C ground state and first excited state were determined using a heavy-ion neutron transfer reaction as well as the inverse kinematics (d,p) reaction, measured at the Texas A&M Cyclotron Institute. The ANCs were used to evaluate the astrophysical direct neutron capture rate on ¹⁴C, which was then compared with the most recent direct measurement and found to be in good agreement. A study of the ¹⁵C SF via its mirror nucleus ¹⁵F and a new insight into deuteron stripping theory are also presented.

Biosynthesis of quinolizidine alkaloids. Incorporation of [1-amino-15N, 1-13C] cadaverine into lupanine, 13-hydroxylupanine, and angustifoline

International Nuclear Information System (INIS)

Rana, J.; Robins, D.J.

1985-01-01

The labelling patterns in (+)-lupanine, (+)-13-hydroxylupanine, and (+)-angustifoline derived biosynthetically from [1-amino- 15 N,1- 13 C]-1,5-diaminopentane (cadaverine) have been established by 13 C n.m.r. spectroscopy. Three cadaverine units are incorporated to about the same extent into each of these three alkaloids. The presence of two doublets due to 13 C- 15 N coupling in the 13 C brace 1 H brace n.m.r. spectra associated with C-2 and C-15 of lupanine and 13-hydroxylupanine, and one 13 C- 15 N doublet at C-2 of angustifoline, indicate that two of the cadaverine units are converted into the outer rings of the tetracyclic quinolizidine alkaloids in a specific fashion. (author)

Applications of stable isotopes of 2H, 13C and 15N to clinical problems

International Nuclear Information System (INIS)

Klein, P.D.; Szczepanik, P.A.; Hachey, D.L.

1974-01-01

The function of the Argonne Program is to provide synthetic, analytical instrumental capability in a core facility for the clinical investigator who needs to use 2 H, 13 C, or 15 N labelled compounds for metabolic or clinical research on pregnant women, newborn infants, young children, or for mass screening. To carry out such application development, there were six stages which were recurrent steps in every application. Five fundamental strategies should be adopted to establish the use of stable isotopes in clinical work. The instrument required for measurements was a combined gas chromatograph-mass spectrometer, and its use was schematically illustrated. Some of the successful experiences with compounds labelled by stable isotopes, such as deuterium labelled chenodeoxycholic acid, and respective 13 C and 15 N-labelled glycine were described. Deutrium labelled bile acid enabled easy and safe determination of the size of the bile acid pool and the replacement rate, providing clearer diagnoses for cholestatic liver disease and gallstones. 13 C and 15 N labelled compounds were used in clinical studies, of children with genetic disorders of amino acid metabolism, i.e., non ketotic hyperflycinemia, B 12 -responsive methyl malonic acidemia, and Lesch-Nyhan syndrome. 15 N-labelled glycine was also studied in a child with Lesch-Nyhan syndrome. (Mukohata, S.)

Stellar Origin of {sup 15}N-rich Presolar SiC Grains of Type AB: Supernovae with Explosive Hydrogen Burning

Energy Technology Data Exchange (ETDEWEB)

Liu, Nan; Nittler, Larry R.; Alexander, Conel M. O’D.; Wang, Jianhua [Department of Terrestrial Magnetism, Carnegie Institution for Science, Washington, DC 20015 (United States); Pignatari, Marco [E. A. Milne Centre for Astrophysics, Department of Physics and Mathematics, University of Hull, Hull HU6 7RX (United Kingdom)

2017-06-10

We report C, N, and Si isotopic data for 59 highly {sup 13}C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 {sup 15}N-rich ({sup 14}N/{sup 15}N ≤ solar) AB grains, and their Mg–Al, S, and Ca–Ti isotope data when available. These 37 grains are enriched in {sup 13}C, {sup 15}N, and {sup 26}Al with the PNGs showing more extreme enhancements. The {sup 15}N-rich AB grains show systematically higher {sup 26}Al and {sup 30}Si excesses than the {sup 14}N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 ({sup 14}N/{sup 15}N < solar) and 2 ({sup 14}N/{sup 15}N ≥ solar). For the first time, we have obtained both S and Ti isotopic data for five AB1 grains and one PNG and found {sup 32}S and/or {sup 50}Ti enhancements. Interestingly, one AB1 grain had the largest {sup 32}S and {sup 50}Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the {sup 32}S excess and thus the initial presence of radiogenic {sup 32}Si ( t {sub 1/2} = 153 years). More importantly, we found that the {sup 15}N and {sup 26}Al excesses of AB1 grains form a trend that extends to the region in the N–Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.

Nitrogen dynamics in stream wood samples incubated with [14C]lignocellulose and potassium[15N]nitrate

International Nuclear Information System (INIS)

Aumen, N.G.; Bottomley, P.J.; Gregory, S.V.

1985-01-01

Surface wood samples obtained from a Douglas fir log incubated in vitro with [ 14 C]lignocellulose in a defined mineral salts medium supplemented with 10 mg of N liter -1 of 15 N-labeled NO 3 - (50 atom % 15 N). Evolution of 14 CO 2 , distribution and isotopic dilution of 15 N, filtrate N concentrations, and the rates of denitrification, N 2 fixation, and respiration were measured at 6, 12, and 18 days of incubation. The organic N content of the lignocellulose-wood sample mixture had increased from 132 μg of N to a maximum of 231 μg of N per treatment after 6 days of incubation. Rates of [ 14 C]lignocellulose decomposition were greatest during the first 6 days and then began to decline over the remaining 12 days. Total CO 2 evolution was also highest at day 6 and declined steadily over the remaining duration of the incubation. Filtrate NH 4 + -N increased from background levels to a final value of 57 μg of N per treatment. Filtrate NO 3 - N completely disappeared by day 6, and organic N showed a slight decline between days 12 and 18. The majority of the 15 N that could be recovered appeared in the particulate organic fraction by day 6 (41 μg of N), and the filtrate NH 4 + N fraction contained 11 μg of 15 N by day 18. The 15 N enrichment values of the filtrate NH 4 + and the inorganic N associated with the particulate fraction had increased to approximately 20 atom % 15 N by 18 days of incubation, whereas the particulate organic fraction reached its highest enrichment by day 6. Measurements of N 2 fixation and denitrification indicated an insignificant gain or loss of N from the experimental system by these processes. The data show that woody debris in stream ecosystems might function as a rapid and efficient sink for exogenous N, resulting in stimulation of wood decomposition and subsequent activation of other N cycling processes

Synthesis and biosynthesis of 13C, 15N labeled deoxynucleosides useful for biomolecular structural determinations

International Nuclear Information System (INIS)

Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J.

1994-01-01

Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study utilizes nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy (more than 10,000 mw) in this arena requires stable isotope enrichment. Herein, the authors present strategies for the site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of [U- 13 C, 15 N] DNA from methylotrophic bacteria. With commercially available 6-chloropurine, an effective 2-step route leads to [6- 15 N]-2'-deoxadenosine (dA). The resulting [6- 15 N]-dA is used in a series of reactions to synthesize [2- 13 C, 1,2'- 15 N 2 ]-2'-deoxyguanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4g of methanol to yield 1 gram of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. The authors are currently developing large scale isolation protocols. General synthetic pathways to oligomeric DNA are presented

Synthesis and biosynthesis of 13C-, 15N-labeled deoxynucleosides useful for biomolecular structural determinations

International Nuclear Information System (INIS)

Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J.

1994-01-01

Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study uses nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy for DNA molecules with mw > 10,000 requires stable isotope enrichment. We present strategies for site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of (U- 13 C, 15 N) DNA from methylotropic bacteria. With commercially available 6-chloropurine, an effective two-step route leads to 2'-deoxy-(amino- 15 N)adenosine (dA). The resulting d(amino- 15 N)A is used in a series of reactions to synthesize 2'-deoxy-(2- 13 C,1,amino- 15 N 2 )guanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4 g of methanol to yield 1 g of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. We are currently developing large-scale isolation protocols. General synthetic pathways to oligomeric DNA will be presented

Effect of body size and body mass on δ 13 C and δ 15 N in coastal fishes and cephalopods

Science.gov (United States)

Vinagre, C.; Máguas, C.; Cabral, H. N.; Costa, M. J.

2011-11-01

Carbon and nitrogen isotopes have been widely used in the investigation of trophic relations, energy pathways, trophic levels and migrations, under the assumption that δ 13C is independent of body size and that variation in δ 15N occurs exclusively due to ontogenetic changes in diet and not body size increase per se. However, several studies have shown that these assumptions are uncertain. Data from food-webs containing an important number of species lack theoretical support on these assumptions because very few species have been tested for δ 13C and δ 15N variation in captivity. However, if sampling comprises a wide range of body sizes from various species, the variation of δ 13C and δ 15N with body size can be investigated. While correlation between body size and δ 13C and δ 15N can be due to ontogenetic diet shifts, stability in such values throughout the size spectrum can be considered an indication that δ 13C and δ 15N in muscle tissues of such species is independent of body size within that size range, and thus the basic assumptions can be applied in the interpretation of such food webs. The present study investigated the variation in muscle δ 13C and δ 15N with body size and body mass of coastal fishes and cephalopods. It was concluded that muscle δ 13C and δ 15N did not vary with body size or mass for all bony fishes with only one exception, the dragonet Callionymus lyra. Muscle δ 13C and δ 15N also did not vary with body size or mass in cartilaginous fishes and cephalopods, meaning that body size/mass per se have no effect on δ 13C or δ 15N, for most species analysed and within the size ranges sampled. The assumption that δ 13C is independent of body size and that variation in δ 15N is not affected by body size increase per se was upheld for most organisms and can be applied to the coastal food web studied taking into account that C. lyra is an exception.

Correlation between the synthetic origin of methamphetamine samples and their 15N and 13C stable isotope ratios

International Nuclear Information System (INIS)

Billault, Isabelle; Courant, Frederique; Pasquereau, Leo; Derrien, Solene; Robins, Richard J.; Naulet, Norbert

2007-01-01

The active ingredient of ecstasy, N-methyl-3,4-methyldioxyphenylisopropylamine (MDMA) can be manufactured by a number of easy routes from simple precursors. We have synthesised 45 samples of MDMA following the five most common routes using N-precursors from 12 different origins and three different precursors for the aromatic moiety. The 13 C and 15 N contents of both the precursors and the MDMA samples derived therefrom were measured by isotope ratio mass spectrometry coupled to an elemental analyser (EA-IRMS). We show that within-pathway correlation between the 15 N content of the precursor and that of the derived MDMA can be strong but that no general pattern of correlation can be defined. Rather, it is evident that the δ 15 N values of MDMA are strongly influenced by a combination of the δ 15 N values of the source of nitrogen used, the route by which the MDMA is synthesised, and the experimental conditions employed. Multivariate analysis (PCA) based on the δ 15 N values of the synthetic MDMA and of the δ 15 N and δ 13 C values of the N-precursors leads to good discrimination between the majority of the reaction conditions tested

N-Mesityl-C-acylketenimines: 1,5-Sigmatropic Shifts and Electrocyclization to Quinolines.

Science.gov (United States)

Rao, V. V. Ramana; Fulloon, Belinda E.; Bernhardt, Paul V.; Koch, Rainer; Wentrup, Curt

1998-08-21

Flash vacuum thermolysis (FVT) of triazoles 6a-c generates alpha-oxoketenimines 10, the ester 10a being isolable. FVT of pyrroledione 8 generates the isomeric imidoylketene 9a. Ketenes 9 and ketenimines 10 undergo thermal interconversion by 1,3-shifts of methoxy and dimethylamino groups under mild FVT conditions (ca. 350-400 degrees C). Both 9 and 10 are directly observable by IR spectroscopy at either 77 K or on Ar matrix isolation at 12 K. On FVT at temperatures above ca. 400 degrees C, the ketenimines 10 undergo a 1,5-H shift to o-quinoid imines 12/13, followed by electrocyclization to dihydroquinolines 14 (unobserved) and 15 (observed by NMR). The latter are easily oxidized to alkylquinoline-3-carboxylates or quinoline-3-carboxamides 16 by atmospheric oxygen. Ab initio calculations on model compounds 18-23 predict an energy barrier of ca. 38 kcal mol(-)(1) (161 kJ mol(-)(1)) for the 1,5-H shift in N-(o-methylphenyl)ketenimines via the transition state TS19 followed by an electrocyclization barrier to dihydroquinoline 23a via TS22a of ca. 16 kcal mol(-)(1).

The effect of organic matter and nitrification inhibitor on 15 N H4 and 15 N O3 absorption by the maize

International Nuclear Information System (INIS)

Saito, S.M.T.

1974-01-01

The effect of the forms 15 N H 4 and 15 N O 3 in presence or absence of organic matter and of the nitrification inhibitor AM (2-amino-4-chloro-6-methyl-pyrimidine) in dry matter weight and nitrogen content of the plant derived from soil and form fertilizer is studied. The experiment was carried out in greenhouse and the test plant was the hybrid Maize Centralmex . The fertilizers ( 15 N H 4 ) 2 S O 4 and Na 15 N O 3 , were added in two levels: 40 and 120 Kg N/ha, with 1,02% of N and 1,4% of 15 N in excess, respectively. Three soils of different physical and chemical characteristics were used; Regosol intergrade, Latosol Roxo and Podzolized de Lins e Marilia var. Marilia. (M.A.C.)

Nitrogen-15-labeled deoxynucleosides. 3. Synthesis of [3-15N]-2'-deoxyadenosine

International Nuclear Information System (INIS)

Rhee, Young-Sook; Jones, R.A.

1990-01-01

The synthesis of [3- 15 N]-labeled adenine has been reported by several groups. Each of these syntheses followed essentially the same route, in which the 15 N is introduced by nitration of 4-bromoimidazole under forcing conditions using [ 15 N]-HNO 3 . The authors have devised an alternate route which uses an azo coupling reaction for introduction of the 15 N and proceeds through the intermediacy of [5- 15 N]-labeled 5-aminoimidazole-4-carboxamide (AICA). An unrelated route to the [5- 15 N]-labeled 5-amino-imidazole ribonucleoside (AIRs) was recently reported. AICA is a versatile precursor, which is most commonly used for entry into the guanine or isoguanine families, although it is usually used as the AICA-riboside rather than the heterocycle itself. The authors have found that AICA also can be used for the adenine family by cyclization to hypoxanthine using diethoxymethyl acetate in DMF at reflux. Although these conditions are more vigorous than those required for cyclization of 4,5-diaminopyrimidines using this reagent, the reaction works well. In addition, they report high-yield enzymatic conversion of [3- 15 N]-adenine to [3- 15 N]-2'-deoxyadenosine

Afforestation impacts microbial biomass and its natural {sup 13}C and {sup 15}N abundance in soil aggregates in central China

Energy Technology Data Exchange (ETDEWEB)

Wu, Junjun; Zhang, Qian; Yang, Fan; Lei, Yao; Zhang, Quanfa; Cheng, Xiaoli, E-mail: xlcheng@fudan.edu.cn

2016-10-15

We investigated soil microbial biomass and its natural abundance of δ{sup 13}C and δ{sup 15}N in aggregates (> 2000 μm, 250–2000 μm, 53–250 μm and < 53 μm) of afforested (implementing woodland and shrubland plantations) soils, adjacent croplands and open area (i.e., control) in the Danjiangkou Reservoir area of central China. The afforested soils averaged higher microbial biomass carbon (MBC) and nitrogen (MBN) levels in all aggregates than in open area and cropland, with higher microbial biomass in micro-aggregates (< 250 μm) than in macro-aggregates (> 2000 μm). The δ{sup 13}C of soil microbial biomass was more enriched in woodland soils than in other land use types, while δ{sup 15}N of soil microbial biomass was more enriched compared with that of organic soil in all land use types. The δ{sup 13}C and δ{sup 15}N of microbial biomass were positively correlated with the δ{sup 13}C and δ{sup 15}N of organic soil across aggregates and land use types, whereas the {sup 13}C and {sup 15}N enrichment of microbial biomass exhibited linear decreases with the corresponding C:N ratio of organic soil. Our results suggest that shifts in the natural {sup 13}C and {sup 15}N abundance of microbial biomass reflect changes in the stabilization and turnover of soil organic matter (SOM) and thereby imply that afforestation can greatly impact SOM accumulation over the long-term. - Highlights: • Afforested soils averaged higher microbial biomass in all aggregates than cropland. • Microbial biomass was higher in micro-aggregates than in macro-aggregates. • δ{sup 13}C and δ{sup 15}N of microbe positively correlated with δ{sup 13}C and δ{sup 15}N of organic soil. • {sup 13}C and {sup 15}N enrichment of microbe was negatively related to with soil C:N ratio.

Stable isotope analysis (δ (13)C and δ (15)N) of soil nematodes from four feeding groups.

Science.gov (United States)

Melody, Carol; Griffiths, Bryan; Dyckmans, Jens; Schmidt, Olaf

2016-01-01

Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis ((13)C/(12)C and (15)N/(14)N, expressed as δ (13)C and δ (15)N) has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000) to achieve required minimum sample weights (typically >100 µg C and N). Here, micro-sample near-conventional elemental analysis-isotopic ratio mass spectrometry (μEA-IRMS) of C and N using microgram samples (typically 20 µg dry weight), was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus), bacterial feeders (Plectus and Rhabditis), omnivores (Aporcelaimidae and Qudsianematidae) and plant feeder (Rotylenchus). Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ (15)N (p = 0.290) or δ (13)C (p = 0.706) between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ (15)N = 1.08 to 3.22 mUr‰, δ (13)C = -29.58 to -27.87 mUr) and all other groups. There was an average difference of 9.62 mUr in δ (15)N between the plant feeder and the predator group (δ (15)N = 9.89 to 12.79 mUr, δ (13)C = -27.04 to -25.51 mUr). Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr(2)) and the predators (1.73 mUr(2)), but largest for

Stable isotope analysis (δ13C and δ15N of soil nematodes from four feeding groups

Directory of Open Access Journals (Sweden)

Carol Melody

2016-09-01

Full Text Available Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis (13C/12C and 15N/14N, expressed as δ13C and δ15N has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000 to achieve required minimum sample weights (typically >100 µg C and N. Here, micro-sample near-conventional elemental analysis–isotopic ratio mass spectrometry (μEA–IRMS of C and N using microgram samples (typically 20 µg dry weight, was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus, bacterial feeders (Plectus and Rhabditis, omnivores (Aporcelaimidae and Qudsianematidae and plant feeder (Rotylenchus. Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ15N (p = 0.290 or δ13C (p = 0.706 between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ15N = 1.08 to 3.22 mUr‰, δ13C = –29.58 to –27.87 mUr and all other groups. There was an average difference of 9.62 mUr in δ15N between the plant feeder and the predator group (δ15N = 9.89 to 12.79 mUr, δ13C = –27.04 to –25.51 mUr. Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr2 and the predators (1.73 mUr2, but largest for omnivores (3.83 mUr2

Investigation into endogenous N metabolism in /sup 15/N-labelled pigs. 1. /sup 15/N labelling and /sup 15/N excretion in urine and feces after feeding 4 different diets

Energy Technology Data Exchange (ETDEWEB)

Bergner, H; Bergner, U; Adam, K [Humboldt-Universitaet, Berlin (German Democratic Republic). Sektion Tierproduktion und Veterinaermedizin

1984-07-01

4 male castrated pigs (55-65 kg) either received a wheat-fish meal diet (1 and 2) or a wheat-horse bean diet (3 and 4) without straw meal supplement (1 and 3) or with a supplement of 20% dry matter (2 and 4). In order to investigate whether a /sup 15/N labelling of the pigs is also possible with a protein excess in the ration, the animals received 24.8 g (1 and 2) and 11.6 g crude protein/kg/sup 0.75/ live weight (3 and 4). During a 10-day /sup 15/N-labelling 385 mg /sup 15/N excess (/sup 15/N') per kg/sup 0.75/ were applied with /sup 15/N labelling the following quotas of the applied /sup 15/N amount were incorporated: 1 = 10.2%, 2 = 7.2%, 3 = 18.7%, 4 = 14.4%. /sup 15/N excretion in both TCA fractions of feces showed a highly significant positive correlation to the increasing content of crude fibre in the 4 diets. The immediate /sup 15/N incorporation into the TCA-precipitable fraction of feces proves that /sup 15/N enters the large intestine endogenously and serves bacterial protein synthesis. 3 days after the last /sup 15/N application the pigs were killed. The values of atom-% /sup 15/N' were determined in the TCA-precipitable blood plasma and in the TCA-precipitable fraction of the liver. The other examined organs and tissues showed smaller differences between the test animals. The results show that the /sup 15/N labelling of tissues and organs of pigs is also possible at a high level of protein supply by means of an oral application of (/sup 15/N) ammonia salts.

Isotopic signatures (13C/12C; 15N/14N) of blue penguin burrow soil invertebrates : carbon sources and trophic relationships

International Nuclear Information System (INIS)

Hawke, D.J.; Clark, J.M.

2010-01-01

Seabird burrows provide a soil environment for processing discards such as feathers and guano, hence constituting a primary interface between the sea and the land. This study involved collection and culturing of soil invertebrates from three blue penguin (Eudyptula minor) burrows, and examined their 13 C/ 12 C and 15 N/ 14 N isotopic composition in relation to potential burrow resources (terrestrial plant litter, burrow soil, guano, blue penguin feathers). Two taxa (cerylonid beetles and small tineid moth larvae) had a depleted 13 C/ 12 C indicative of a level of dependence on C from terrestrial soil. Tineid moth larvae (Monopis crocicapitella and (or) M. ethelella) substantially increased their 13 C/ 12 C enrichment during development, implying increasing dependence on marine C. Remaining taxa, both decomposers and predators, had 13 C/ 12 C intermediate between guano and feathers. Larval and emergent fleas had the most enriched 13 C/ 12 C , indicative of a greater dependence on feather C and the likelihood of co-processing with guano. Pseudoscorpions and histerid beetles had overlapping isotopic enrichments implying competition for prey, but were spatially separated in burrow soil. With their highly enriched 15 N/ 14 N and marine 13 C/ 12 C, larvae and protonymphs of the histiostomatid mite Myianoetus antipodus stood alone. Blue penguin burrows therefore support a diverse invertebrate fauna that incorporates terrestrial soil as well as varying proportions of the various blue penguin discards. (author). 45 refs., 1 fig., 1 tab.

HN-NCA heteronuclear TOCSY-NH experiment for {sup 1}H{sup N} and {sup 15}N sequential correlations in ({sup 13}C, {sup 15}N) labelled intrinsically disordered proteins

Energy Technology Data Exchange (ETDEWEB)

Wiedemann, Christoph; Goradia, Nishit; Häfner, Sabine [Leibniz Institute for Age Research, Fritz Lipmann Institute, Research Group Biomolecular NMR Spectroscopy (Germany); Herbst, Christian [Ubon Ratchathani University, Department of Physics, Faculty of Science (Thailand); Görlach, Matthias; Ohlenschläger, Oliver; Ramachandran, Ramadurai, E-mail: raman@fli-leibniz.de [Leibniz Institute for Age Research, Fritz Lipmann Institute, Research Group Biomolecular NMR Spectroscopy (Germany)

2015-10-15

A simple triple resonance NMR experiment that leads to the correlation of the backbone amide resonances of each amino acid residue ‘i’ with that of residues ‘i−1’ and ‘i+1’ in ({sup 13}C, {sup 15}N) labelled intrinsically disordered proteins (IDPs) is presented. The experimental scheme, {HN-NCA heteronuclear TOCSY-NH}, exploits the favourable relaxation properties of IDPs and the presence of {sup 1}J{sub CαN} and {sup 2}J{sub CαN} couplings to transfer the {sup 15}N{sub x} magnetisation from amino acid residue ‘i’ to adjacent residues via the application of a band-selective {sup 15}N–{sup 13}C{sup α} heteronuclear cross-polarisation sequence of ∼100 ms duration. Employing non-uniform sampling in the indirect dimensions, the efficacy of the approach has been demonstrated by the acquisition of 3D HNN chemical shift correlation spectra of α-synuclein. The experimental performance of the RF pulse sequence has been compared with that of the conventional INEPT-based HN(CA)NH pulse scheme. As the availability of data from both the HCCNH and HNN experiments will make it possible to use the information extracted from one experiment to simplify the analysis of the data of the other and lead to a robust approach for unambiguous backbone and side-chain resonance assignments, a time-saving strategy for the simultaneous collection of HCCNH and HNN data is also described.

Fate of 15N-urea and 15N-ammonium sulphate applied in different periods to cica-8 rice culture in greenhouse conditions

International Nuclear Information System (INIS)

Bastidas, O.G.; Alvarez, A.; Victoria, R.L.; Urquiaga C, S.; Muraoka, T.

1984-01-01

The fate of nitrogen fertilizers in rice cultivars (Cica-8) is studied. Urea (1.973% at of 15 N) and ammonium sulfate (1.826% at of 15 N) are used. The fertilizers are applied in four levels (0,100,200 and 300 Kg N/ha) in shadow coditions and after 30 days of germination. (M.A.C.) [pt

Variation in hair δ13C and δ15N values in long-tailed macaques (Macaca fascicularis) from Singapore

Science.gov (United States)

Schillaci, Michael A.; Castellini, J. Margaret; Stricker, Craig A.; Jones-Engel, Lisa; Lee, Benjamin P.Y.-H.

2014-01-01

Much of the primatology literature on stable isotope ratios of carbon (δ13C) and nitrogen (δ15N) has focused on African and New World species, with comparatively little research published on Asian primates. Here we present hair δ13C and δ15N isotope values for a sample of 33 long-tailed macaques from Singapore. We evaluate the suggestion by a previous researcher that forest degradation and biodiversity loss in Singapore have led to a decline in macaque trophic level. The results of our analysis indicated significant spatial variability in δ13C but not δ15N. The range of variation in δ13C was consistent with a diet based on C3 resources, with one group exhibiting low values consistent with a closed canopy environment. Relative to other macaque species from Europe and Asia, the macaques from Singapore exhibited a low mean δ13C value but mid-range mean δ15N value. Previous research suggesting a decline in macaque trophic level is not supported by the results of our study.

Nitrogen Fertilizer and Straw Applications Affect Uptake of 13C,15N-Glycine by Soil Microorganisms in Wheat Growth Stages.

Directory of Open Access Journals (Sweden)

Lijie Yang

Full Text Available This study investigated the influence of nitrogen (N fertilizer and straw on intact amino acid N uptake by soil microorganisms and the relationship between amino acid turnover and soil properties during the wheat growing season. A wheat pot experiment was carried out with three treatments: control (CK, N fertilizer (NF and N fertilizer plus rice straw (NS. We used stable isotope compound-specific analysis to determine the uptake of 13C,15N-glycine by soil microorganisms. In the NF treatment, microbial 13C,15N-glycine uptake was lower compared with CK, suggesting that inorganic N was the preferred N source for soil microorganisms. However, The application of straw with N fertilizer (in NS treatment increased microbial 13C,15N-glycine uptake even with the same amount of N fertilizer application. In this treatment, enzyme activities, soil microbial biomass C and microbial biomass N increased simultaneously because more C was available. Soil mineral N and plant N contents all decreased substantially. The increased uptake of intact 13C,15N-glycine in the NS treatment can be attributed to direct assimilation by soil microorganisms to satisfy the demand for N when inorganic N was consumed.

Affordable uniform isotope labeling with 2H, 13C and 15N in insect cells

International Nuclear Information System (INIS)

Sitarska, Agnieszka; Skora, Lukasz; Klopp, Julia; Roest, Susan; Fernández, César; Shrestha, Binesh; Gossert, Alvar D.

2015-01-01

For a wide range of proteins of high interest, the major obstacle for NMR studies is the lack of an affordable eukaryotic expression system for isotope labeling. Here, a simple and affordable protocol is presented to produce uniform labeled proteins in the most prevalent eukaryotic expression system for structural biology, namely Spodoptera frugiperda insect cells. Incorporation levels of 80 % can be achieved for 15 N and 13 C with yields comparable to expression in full media. For 2 H, 15 N and 2 H, 13 C, 15 N labeling, incorporation is only slightly lower with 75 and 73 %, respectively, and yields are typically twofold reduced. The media were optimized for isotope incorporation, reproducibility, simplicity and cost. High isotope incorporation levels for all labeling patterns are achieved by using labeled algal amino acid extracts and exploiting well-known biochemical pathways. The final formulation consists of just five commercially available components, at costs 12-fold lower than labeling media from vendors. The approach was applied to several cytosolic and secreted target proteins

Dynamic of N fertilizers: urea (15 N) and aqua ammonia (15 N) incorporated to the sugar cane soil. Final report

International Nuclear Information System (INIS)

Trivelin, P.C.O.

1988-05-01

The dynamic of N fertilizers, urea and aqua ammonia, in the soil of sugar cane crops are studied with an emphasis on the horizontal and vertical moving. The nitrogen routing from urea and aqua ammonia sources, by isotopic technique with 15 N in relation to the leaching, volatilization and extraction by the cultivation and residue of N immobilized manure in the soil with sugar cane plantation is also analysed. (C.G.C.)

15N Hyperpolarization of Imidazole-15N2 for Magnetic Resonance pH Sensing via SABRE-SHEATH.

Science.gov (United States)

Shchepin, Roman V; Barskiy, Danila A; Coffey, Aaron M; Theis, Thomas; Shi, Fan; Warren, Warren S; Goodson, Boyd M; Chekmenev, Eduard Y

2016-06-24

15 N nuclear spins of imidazole- 15 N 2 were hyperpolarized using NMR signal amplification by reversible exchange in shield enables alignment transfer to heteronuclei (SABRE-SHEATH). A 15 N NMR signal enhancement of ∼2000-fold at 9.4 T is reported using parahydrogen gas (∼50% para-) and ∼0.1 M imidazole- 15 N 2 in methanol:aqueous buffer (∼1:1). Proton binding to a 15 N site of imidazole occurs at physiological pH (p K a ∼ 7.0), and the binding event changes the 15 N isotropic chemical shift by ∼30 ppm. These properties are ideal for in vivo pH sensing. Additionally, imidazoles have low toxicity and are readily incorporated into a wide range of biomolecules. 15 N-Imidazole SABRE-SHEATH hyperpolarization potentially enables pH sensing on scales ranging from peptide and protein molecules to living organisms.

Diet-tissue stable isotope (Δ(13)C and Δ(15)N) discrimination factors for multiple tissues from terrestrial reptiles.

Science.gov (United States)

Steinitz, Ronnie; Lemm, Jeffrey M; Pasachnik, Stesha A; Kurle, Carolyn M

2016-01-15

Stable isotope analysis is a powerful tool for reconstructing trophic interactions to better understand drivers of community ecology. Taxon-specific stable isotope discrimination factors contribute to the best use of this tool. We determined the first Δ(13)C and Δ(15)N values for Rock Iguanas (Cyclura spp.) to better understand isotopic fractionation and estimate wild reptile foraging ecology. The Δ(13)C and Δ(15)N values between diet and skin, blood, and scat were determined from juvenile and adult iguanas held for 1 year on a known diet. We measured relationships between iguana discrimination factors and size/age and quantified effects of lipid extraction and acid treatment on stable isotope values from iguana tissues. Isotopic and elemental compositions were determined by Dumas combustion using an elemental analyzer coupled to an isotope ratio mass spectrometer using standards of known composition. The Δ(13)C and Δ(15)N values ranged from -2.5 to +6.5‰ and +2.2 to +7.5‰, respectively, with some differences among tissues and between juveniles and adults. The Δ(13)C values from blood and skin differed among species, but not the Δ(15)N values. The Δ(13)C values from blood and skin and Δ(15)N values from blood were positively correlated with size/age. The Δ(13)C values from scat were negatively correlated with size (not age). Treatment with HCl (scat) and lipid extraction (skin) did not affect the isotope values. These results should aid in the understanding of processes driving stable carbon and nitrogen isotope discrimination factors in reptiles. We provide estimates of Δ(13)C and Δ(15)N values and linear relationships between iguana size/age and discrimination factors for the best interpretation of wild reptile foraging ecology. Copyright © 2015 John Wiley & Sons, Ltd.

Bicarbonate as tracer for plant assimilated C and homogeneity of 14C and 15N distribution in ryegrass and white clover tissue by alternative labeling approaches

DEFF Research Database (Denmark)

Rasmussen, Jim; Kusliene, Gedrime; Jacobsen, Ole Stig

2013-01-01

that 15N also had a heterogeneous distribution (up to two orders of magnitude). Conclusion Bicarbonate can efficiently be used to introduce 14C or 13C into plant via the leaf-labeling method. Both 14C and 15N showed heterogeneous distribution in the plant, although the distribution of 15N was more even......Aims: Application of carbon (C) and nitrogen (N) isotopes is an essential tool to study C and N flows in plant-soil-microorganisms systems. When targeting single plants in a community the tracers need to be added via e.g., leaf-labeling or stem-feeding approaches. In this study we: (i) investigated...... if bicarbonate can be used to introduce 14C (or 13C) into white clover and ryegrass, and (ii) compared the patterns of 14C and 15N allocation in white clover and ryegrass to evaluate the homogeneity of tracer distribution after two alternative labeling approaches. Methods Perennial ryegrass and white clover were...

Dynamics of nitrogen in an oxic paleudalf soil with the incorporation of 15N-tagged organic nitrogen (maize straw) and 15N-tagged mineral nitrogen (ammonium sulphate)

International Nuclear Information System (INIS)

Freitas, J.R. de.

1984-12-01

An experiment, carried out under field conditions in 12 lysimeters, each containing 3.0 ton of Oxic Paleudalf soil with four replicates, is described. This objective is labelling soil organic N. Nitrogen was incorporated into soil as maize straw, non-labelled and labelled with 15 N and ammonium sulphate - 15 N. The soil was sampled every 15 days in three different depths. N as NH + 4 , NO - 3 , total-N and (%)C and (%) moisture was analysed. (M.A.C.) [pt

Reaction π-p→ωn in the (15/40) GeV/c momentum range

International Nuclear Information System (INIS)

Apel, W.D.; Augenstein, K.H.; Krueger, M.; Mueller, H.; Schneider, H.; Sigurdsson, G.; Donskov, S.V.; Inyakin, A.V.; Kachanov, V.A.; Krasnokutsky, R.N.; Lednev, A.A.; Mikhailov, Yu.V.; Prokoshkin, Yu.D.; Shuvalov, R.S.; Leder, G.

1979-01-01

A high statistics measurement of the reaction π - p→ωn with ω→π 0 γ has been performed at the 70 GeV Serpukhov accelerator for 15, 20.2, 25, 30 and 40 GeV/c incident pion momentum, using the NICE set-up with its associated 648-channel γ-ray spectrometer. Values of the density matrix elements, differential and integral cross sections are reported. Already at 15 GeV/c, the unnatural parity exchange contribution to ω production in helicity 1 state is negligible. After a maximum around /t/ approximately equal to 0.12 (GeV/c) 2 , the differential cross section decreases exponentially up to /t/ approximately equal to 0.7 (GeV/c) 2 , where a break is seen in its slope. (author)

The effect of noncollinearity of 15N-1H dipolar and 15N CSA tensors and rotational anisotropy on 15N relaxation, CSA/dipolar cross correlation, and TROSY

International Nuclear Information System (INIS)

Fushman, David; Cowburn, David

1999-01-01

Current approaches to 15N relaxation in proteins assume that the 15N-1H dipolar and 15N CSA tensors are collinear. We show theoretically that, when there is significant anisotropy of molecular rotation, different orientations of the two tensors, experimentally observed in proteins, nucleic acids, and small peptides, will result in differences in site- specific correlation functions and spectral densities. The standard treatments of the rates of longitudinal and transverse relaxation of amide 15N nuclei, of the 15N CSA/15N-1H dipolar cross correlation, and of the TROSY experiment are extended to account for the effect of noncollinearity of the 15N-1H dipolar and 15N CSA (chemical shift anisotropy) tensors. This effect, proportional to the degree of anisotropy of the overall motion, (D-parallel /D-perpendicular -1), is sensitive to the relative orientation of the two tensors and to the orientation of the peptide plane with respect to the diffusion coordinate frame. The effect is negligible at small degrees of anisotropy, but is predicted to become significant for D-parallel /D-perpendicular ≥1.5, and at high magnetic fields. The effect of noncollinearity of 15N CSA and 15N-1H dipolar interaction is sensitive to both gross (hydrodynamic) properties and atomic-level details of protein structure. Incorporation of this effect into relaxation data analysis is likely to improve both precision and accuracy of the derived characteristics of protein dynamics, especially at high magnetic fields and for molecules with a high degree of anisotropy of the overall motion. The effect will also make TROSY efficiency dependent on local orientation in moderately anisotropic systems

Dynamic of N fertilizers: urea ({sup 15} N) and aqua ammonia ({sup 15} N) incorporated to the sugar cane soil. Final report; Dinamica do N dos fertilizantes: ureia ({sup 15} N) e aquamonia ({sup 15} N) incorporados ao solo na cultura da cana-de-acucar. Relatorio final

Energy Technology Data Exchange (ETDEWEB)

Trivelin, P C.O. [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil)

1988-05-01

The dynamic of N fertilizers, urea and aqua ammonia, in the soil of sugar cane crops are studied with an emphasis on the horizontal and vertical moving. The nitrogen routing from urea and aqua ammonia sources, by isotopic technique with {sup 15} N in relation to the leaching, volatilization and extraction by the cultivation and residue of N immobilized manure in the soil with sugar cane plantation is also analysed. (C.G.C.).

Capture cross-section and rate of the 14 C (n, γ) 15 C reaction from ...

Indian Academy of Sciences (India)

We calculate the Coulomb dissociation of 15C on a Pb target at 68 MeV/u incident beam energy within the fully quantum mechanical distorted wave Born approximation formalism of breakup reactions. The capture cross-section and the subsequent rate of the 14C(, )15C reaction are calculated from the ...

Synthesis and biosynthesis of {sup 13}C-, {sup 15}N-labeled deoxynucleosides useful for biomolecular structural determinations

Energy Technology Data Exchange (ETDEWEB)

Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J. [Los Alamos National Laboratory, NM (United States)

1994-12-01

Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study uses nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy for DNA molecules with mw > 10,000 requires stable isotope enrichment. We present strategies for site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of (U-{sup 13}C, {sup 15}N) DNA from methylotropic bacteria. With commercially available 6-chloropurine, an effective two-step route leads to 2{prime}-deoxy-(amino-{sup 15}N)adenosine (dA). The resulting d(amino-{sup 15}N)A is used in a series of reactions to synthesize 2{prime}-deoxy-(2-{sup 13}C,1,amino-{sup 15}N{sub 2})guanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4 g of methanol to yield 1 g of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. We are currently developing large-scale isolation protocols. General synthetic pathways to oligomeric DNA will be presented.

Synthesis of organic compounds 15 N enriched

International Nuclear Information System (INIS)

Oliveira, Claudineia Raquel de; Bendassolli, Jose Albertino; Prestes, Clelber Vieira; Tavares, Glauco Arnold

2002-01-01

The aim of this work was to develop urea- 15 N and glycine- 15 N synthesis for agronomic and biological studies. The production of these compounds was evaluated due to the fact of increasing use of urea, comparing to others solid fertilizers and the importance of glycine in the studies of protein metabolism. A non-conventional method was carried out to synthesize urea. The process involved reaction among Co, NH 3 anidrid and S at low temperature (100 deg C) and of pressure (0,81 mPa) compared to the conventional method. Monolise halets reaction was carried out for glycine synthesis with chloroacetic and ammonia 2 deg C. Both compounds are economic viable, they can be produced at a lower price than the trade market one. (author)

Ner protein of phage Mu: Assignments using {sup 13}C/{sup 15}N-labeled protein

Energy Technology Data Exchange (ETDEWEB)

Strzelecka, T.; Gronenborn, A.M.; Clore, G.M. [National Institutes of Health, Bethesda, MD (United States)

1994-12-01

The Ner protein is a small (74-amino acid) DNA-binding protein that regulates a switch between the lysogenic and lytic stages of phage Mu. It inhibits expression of the C repressor gene and down-regulates its own expression. Two-dimensional NMR experiments on uniformly {sup 15}N-labeled protein provided most of the backbone and some of the sidechain proton assignments. The secondary structure determination using two-dimensional NOESY experiments showed that Ner consists of five {alpha}-helices. However, because most of the sidechain protons could not be assigned, the full structure was not determined. Using uniformly {sup 13}C/{sup 15}N-labeled Ner and a set of three-dimensional experiments, we were able to assign all of the backbone and 98% of the sidechain protons. In particular, the CBCANH and CBCA(CO)NH experiments were used to sequentially assign the C{alpha} and C{beta} resonances; the HCCH-CTOCSY and HCCH-COSY were used to assign sidechain carbon and proton resonances.

Natural isotopes abundance of 15N and 13C in leaves of some N2-fixing and non N2-fixing trees and shrubs in Syria

International Nuclear Information System (INIS)

Kurdali, F.; Al-Shamma'a, M.

2007-12-01

Variability in the natural abundance isotopes of 15 N and 13 C in leaves of several legume and non-legume plant species grown at different sites of two areas in semi-arid regions of Syria was determined. In the first area (non-saline soil), the 15 N values of a number of fixing and non-fixing reference plants ranged from -2.09 to +9.46, depending on plant species and studied site. 15 N in a number of legume species including Acacia cyanopylla (-1.73), Acacia farnesiana (-0.55), Prosopis juliflora (-1.64) and Medicago arborea (+1.6) were close to the atmospheric value pointing to a major contribution of N 2 fixing in these species; whereas, those of reference plants were highly positive (between +3.6 and +9.46%). In the actinorhizal tree, Elaeagnus angustifolia, the 15 N abundance was far lower (-0.46 to -2.1%) strongly suggesting that the plant obtained large proportional contribution from BNF. In contrast, δ 15 N values in some other legumes and actinorhizal plants were relatively similar to those of reference plants, suggesting that the contribution of fixed N 2 is negligible. On the other hand, δ 13 C% values in leaves of C3 plants were affected by plant species, ranging from a minimum of -28.67% to a maximum of -23%. However, they were the same within each plant species although they were grown at different sites. Moreover, dual stable isotope analysis in leaves of Prosopis juliflora and other non- legumes grown on a salt affected soil (second area) was also conducted. Results showed that salinity did not affect C assimilation in this woody legume since a higher carbon discrimination was obtained indicating that this plant is a salt tolerant species; whereas, N2-fixation was drastically affected (δ 15 N= +7.03). (Author)

Correlation between the synthetic origin of methamphetamine samples and their {sup 15}N and {sup 13}C stable isotope ratios

Energy Technology Data Exchange (ETDEWEB)

Billault, Isabelle [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France)]. E-mail: Isabelle.Billault@univ-nantes.fr; Courant, Frederique [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France); Pasquereau, Leo [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France); Derrien, Solene [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France); Robins, Richard J. [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France); Naulet, Norbert [Laboratoire d' Analyse Isotopique et Electrochimique de Metabolismes, CNRS UMR6006, University of Nantes, BP 92208, 44322 Nantes (France)

2007-06-12

The active ingredient of ecstasy, N-methyl-3,4-methyldioxyphenylisopropylamine (MDMA) can be manufactured by a number of easy routes from simple precursors. We have synthesised 45 samples of MDMA following the five most common routes using N-precursors from 12 different origins and three different precursors for the aromatic moiety. The {sup 13}C and {sup 15}N contents of both the precursors and the MDMA samples derived therefrom were measured by isotope ratio mass spectrometry coupled to an elemental analyser (EA-IRMS). We show that within-pathway correlation between the {sup 15}N content of the precursor and that of the derived MDMA can be strong but that no general pattern of correlation can be defined. Rather, it is evident that the {delta} {sup 15}N values of MDMA are strongly influenced by a combination of the {delta} {sup 15}N values of the source of nitrogen used, the route by which the MDMA is synthesised, and the experimental conditions employed. Multivariate analysis (PCA) based on the {delta} {sup 15}N values of the synthetic MDMA and of the {delta} {sup 15}N and {delta} {sup 13}C values of the N-precursors leads to good discrimination between the majority of the reaction conditions tested.

Changes in mineral 15 N from soils treated with 15 N-urea and 15 N-vinasse incorporated or not to sugar cane straw

International Nuclear Information System (INIS)

Silva, Vilma M.; Colaco, Waldeciro; Encarnacao, Fernando A.F.

1999-01-01

Changes in N derived from 15 N sources (urea and vinasse), applied to two soils differing in texture (PV sandy, LR clayey), incorporated or not to sugar cane straw (dry leaves and sheathes) and incubated in an open system for 35 days, were evaluated through an isotope technique. Soil samples were collected 7, 14, 21, 28 and 35 days after applications to determine nitrogen fractions (total-N, N H 4 + - N and NO 3 - - N) derived from the labelled sources. Mineral N was taken as the sum of N H 4 + - N and N H 3 - -N. 15 N-abundances were determined in the concentrated extracts of these fractions. The mineral N net transformation rates were found from the mineral N obtained by taking the difference between the values of two subsequent incubation times. The results showed that mineral N transformation rates were initially positives in the treatments of 15 N-urea, and significantly higher (10,30 mg kg -1 d -1 , PV and 8,08 mg kg -1 d -1 , LR) than those obtained in the treatments with 15 N vinasse (1,11 mg kg -1 dia -1 , PV and 0,55 mg kg -1 dia -1 , LR). In general terms, mineral-N net transformation rates were negative (0,06 and 0,26 mg.kg -1 d -1 , PV; -1,44 and 0,07 mg.kg -1 .d -1 , LR, respective;y for urea and vinasse) indicating prevalence of immobilization. The results also showed small fluctuations among treatments at some of the incubation periods, which reflects the influence of characteristics and properties of both soils. (author)

The contamination of commercial 15N2 gas stocks with 15N-labeled nitrate and ammonium and consequences for nitrogen fixation measurements.

Science.gov (United States)

Dabundo, Richard; Lehmann, Moritz F; Treibergs, Lija; Tobias, Craig R; Altabet, Mark A; Moisander, Pia H; Granger, Julie

2014-01-01

We report on the contamination of commercial 15-nitrogen (15N) N2 gas stocks with 15N-enriched ammonium, nitrate and/or nitrite, and nitrous oxide. 15N2 gas is used to estimate N2 fixation rates from incubations of environmental samples by monitoring the incorporation of isotopically labeled 15N2 into organic matter. However, the microbial assimilation of bioavailable 15N-labeled N2 gas contaminants, nitrate, nitrite, and ammonium, is liable to lead to the inflation or false detection of N2 fixation rates. 15N2 gas procured from three major suppliers was analyzed for the presence of these 15N-contaminants. Substantial concentrations of 15N-contaminants were detected in four Sigma-Aldrich 15N2 lecture bottles from two discrete batch syntheses. Per mole of 15N2 gas, 34 to 1900 µmoles of 15N-ammonium, 1.8 to 420 µmoles of 15N-nitrate/nitrite, and ≥21 µmoles of 15N-nitrous oxide were detected. One 15N2 lecture bottle from Campro Scientific contained ≥11 µmoles of 15N-nitrous oxide per mole of 15N2 gas, and no detected 15N-nitrate/nitrite at the given experimental 15N2 tracer dilutions. Two Cambridge Isotopes lecture bottles from discrete batch syntheses contained ≥0.81 µmoles 15N-nitrous oxide per mole 15N2, and trace concentrations of 15N-ammonium and 15N-nitrate/nitrite. 15N2 gas equilibrated cultures of the green algae Dunaliella tertiolecta confirmed that the 15N-contaminants are assimilable. A finite-differencing model parameterized using oceanic field conditions typical of N2 fixation assays suggests that the degree of detected 15N-ammonium contamination could yield inferred N2 fixation rates ranging from undetectable, detected in field assays. These results indicate that past reports of N2 fixation should be interpreted with caution, and demonstrate that the purity of commercial 15N2 gas must be ensured prior to use in future N2 fixation rate determinations.

Tracking spatial distribution of human-derived wastewater from Davis Station, East Antarctica, using δ15N and δ13C stable isotopes

International Nuclear Information System (INIS)

Corbett, Patricia A.; King, Catherine K.; Mondon, Julie A.

2015-01-01

Highlights: • Elevated δ15N and δ13C observed in fish tissue up to 4 km from the Davis Station wastewater outfall. • δ15N decreased stepwise with concentrations decreasing with distance from the discharge point. • The trend observed for δ13C almost mirrored δ15N. • Current wastewater treatment practices are insufficient to avoid uptake of contaminants in fish. - Abstract: Stable isotope ratios, δ15N and δ13C were effectively used to determine the geographical dispersion of human derived sewage from Davis Station, East Antarctica, using Antarctic rock cod (Trematomus bernacchii). Fish within 0–4 km downstream of the outfall exhibited higher δ15N and δ13C values relative to reference sites. Nitrogen in particular showed a stepped decrease in δ15N with increasing distance from the discharge point by 1–2‰. Stable isotopes were better able to detect the extent of wastewater contamination than other techniques including faecal coliform and sterol measures. Uptake and assimilation of δ15N and δ13C up to 4 km from the outfall adds to growing evidence indicating the current level of wastewater treatment at Davis Station is not sufficient to avoid impact to the surrounding environment. Isotopic assimilation in T. bernacchii is a viable biomarker for investigation of initial sewage exposure and longer term monitoring in the future

Chemienzymatic synthesis of Uridine. Nucleotides labeled with [15N] and [13C

DEFF Research Database (Denmark)

Gilles, Anne-Marie; Cristea, Ioan; Palibroda, Nicolae

1995-01-01

+necessary for the oxidation of glucose 6-phosphate and 6-phosphogluconate was recycled by glutamate dehydrogenase and excess of ammonia and a-oxoglutarate. Despite the number and complexity of the enzymatic steps, the synthesis of [15N,13C]UTP is straightforward with an overall yield exceeding 60%. This method, extended...... and diversified to the synthesis of all natural ribonucleotides, is a more economical alternative for obtaining nucleic acids for structural analysis by heteronuclear NMR spectroscopy....

Auto-inducing media for uniform isotope labeling of proteins with 15N, 13C and 2H

International Nuclear Information System (INIS)

Guthertz, Nicolas; Klopp, Julia; Winterhalter, Aurélie; Fernández, César; Gossert, Alvar D.

2015-01-01

Auto-inducing media for protein expression offer many advantages like robust reproducibility, high yields of soluble protein and much reduced workload. Here, an auto-inducing medium for uniform isotope labelling of proteins with 15 N, 13 C and/or 2 H in E. coli is presented. So far, auto-inducing media have not found widespread application in the NMR field, because of the prohibitively high cost of labeled lactose, which is an essential ingredient of such media. Here, we propose using lactose that is only selectively labeled on the glucose moiety. It can be synthesized from inexpensive and readily available substrates: labeled glucose and unlabeled activated galactose. With this approach, uniformly isotope labeled proteins were expressed in unattended auto-inducing cultures with incorporation of 13 C, 15 N of 96.6 % and 2 H, 15 N of 98.8 %. With the present protocol, the NMR community could profit from the many advantages that auto-inducing media offer

15 N separation in the Nitrox system under pressure

International Nuclear Information System (INIS)

Axente, D.; Baldea, A.; Teaca, C.; Horga, R.; Abrudean, M.

1999-01-01

The basic isotope exchange reaction responsible for the separation of 15 N in Nitrox system is that between gaseous nitrogen oxides and aqueous nitric acid with single stage separation factor α = 1.055 for M.l -1 nitric acid, at 25 deg. C and atmospheric pressure. The rate of nitrogen isotope exchange between NO and HNO 3 has been measured as a function of nitric oxide pressure 0.1 - 0.4 MPa for 1 and 2 M.l -1 . It is concluded that 15 N/ 14 N exchange rate in NO-HNO 3 system has a linear dependence on NO pressure as indicated by rate measurements at different NO partial pressure and constant overall pressure, by adding helium in reactor. Using the rate law: R = [HNO 3 ] 2 [N 2 O 3 ] the 15 N/ 14 N exchange rates for nitric acid concentrations 1.5 - 10 M.l -1 were calculated. In order to know what happens in 15 N separation at higher pressure, when the isotopic transport between two phases is improved, a stainless steel laboratory experimental setup with 1000 mm long x 18 mm i,d. column, packed with triangular wire springs 1.8 x 1.8 x 0.2 mm was utilised. At 0.15 MPA and 2.36 ml.cm -2 . min -1 flow rate HETP was 7% smaller than at atmospheric pressure and 1.5 times smaller flow rate. HETP at 3.14 ml . cm -2 . min -1 flow rate and 0.18 MPa is practically equal with that obtained at atmospheric pressure and 2 times smaller flow rate. The operation of the 15 N separation setup at 0.18 MPa, instead of atmospheric pressure, will permit to double the 10 M.l -1 nitric acid flow rate and of 15 N production of the given column. (authors)

sup 15 N-ammonium test in clinical research. Der ( sup 15 N)-Ammoniumtest in der klinischen Forschung

Energy Technology Data Exchange (ETDEWEB)

Jung, K; Metzner, C; Teichmann, B [Akademie der Wissenschaften der DDR, Leipzig (German Democratic Republic). Zentralinstitut fuer Isotopen- und Strahlenforschung Leipzig Univ. (German Democratic Republic). Bereich Medizin

1989-01-01

By use of the {sup 15}N-ammonium test the liver function is investigated under influence of hormonal contraceptives in women and in liver diseases in children. With the described noninvasive nonradioactive isotope test the ammonia detoxification capability and the urea synthesis capacity of the liver is determined by measuring of the {sup 15}N excretion in ammonia and urea in urine after oral administering of {sup 15}N-ammonium chloride. The {sup 15}N-ammonium test shows a significant influence of the hormonal contraceptives on the liver function and gives diagnostic evidence for liver diseases in children. (author).

π-p→ωn reaction at momenta from 15 to 40 GeV/c

International Nuclear Information System (INIS)

Apel, W.D.; Augenstein, K.H.; Bertolucci, E.; Vincelli, M.L.; Donskov, S.V.; Inyakin, A.; Kachanov, V.A.; Quaglia, M.; Krasnokutsky, R.N.; Krueger, M.; Leder, G.; Lednev, A.A.; Mannelli, I.; Mikhailov, Y.V.; Mueller, H.; Prokoshkin, Y.D.; Pierazzini, G.M.; Sergiampietri, F.; Sigurdsson, G.; Scribano, A.; Schneider, H.; Shuvalov, R.S.

1980-01-01

Cross sections for the reaction π - p→ωn, ω→π 0 γ have been measured with good statistics at incident-pion momenta of 15, 20, 25, 30, and 40 GeV/c. The experiments were performed at the 70-GeV IHEP accelerator, using the NICE 648-channel hodoscopic spectrometer. The density matrix elements and the differential and integrated cross sections for the reaction have been determined. The unnatural-parity exchange contribution to the production of ω mesons in the state with helicity 1 is already insignificant at 15 GeV/c. With increasing Vertical BartVertical Bar the differential cross sections pass through a maximum at Vertical BartVertical Barapprox. =0.12 (GeV/c) 2 and then fall exponentially until Vertical BartVertical Barapprox. =0.7 (GeV/c) 2 ; at that point the curve bends sharply, the cross section falling off much less rapidly for larger values of Vertical BartVertical Bar

Two new organic reference materials for δ13C and δ15N measurements and a new value for the δ13C of NBS 22 oil

Science.gov (United States)

Qi, Haiping; Coplen, Tyler B.; Geilmann, Heike; Brand, Willi A.; Böhlke, J.K.

2003-01-01

Analytical grade L-glutamic acid is chemically stable and has a C/N mole ratio of 5, which is close to that of many of natural biological materials, such as blood and animal tissue. Two L-glutamic acid reference materials with substantially different 13C and 15N abundances have been prepared for use as organic reference materials for C and N isotopic measurements. USGS40 is analytical grade L-glutamic acid and has a δ13C value of −26.24‰ relative to VPDB and a δ15N value of −4.52‰ relative to N2 in air. USGS41 was prepared by dissolving analytical grade L-glutamic acid with L-glutamic acid enriched in 13C and 15N. USGS41 has a δ13C value of +37.76‰ and a δ15N value of +47.57‰. The δ13C and δ15N values of both materials were measured against the international reference materials NBS 19 calcium carbonate (δ13C = +1.95‰), L-SVEC lithium carbonate (δ13C = −46.48‰), IAEA-N-1 ammonium sulfate (δ15N = 0.43‰), and USGS32 potassium nitrate (δ15N = 180‰) by on-line combustion continuous-flow and off-line dual-inlet isotope-ratio mass spectrometry. Both USGS40 and USGS41 are isotopically homogeneous; reproducibility of δ13C is better than 0.13‰, and that of δ15N is better than 0.13‰ in 100-μg amounts. These two isotopic reference materials can be used for (i) calibrating local laboratory reference materials, and (ii) quantifying drift with time, mass-dependent fractionations, and isotope-ratio-scale contraction in the isotopic analysis of various biological materials. Isotopic results presented in this paper yield a δ13C value for NBS 22 oil of −29.91‰, in contrast to the commonly accepted value of −29.78‰ for which off-line blank corrections probably have not been quantified satisfactorily.

Application of 13C and 15N stable isotope probing to characterize RDX degrading microbial communities under different electron-accepting conditions

International Nuclear Information System (INIS)

Cho, Kun-Ching; Lee, Do Gyun; Fuller, Mark E.; Hatzinger, Paul B.; Condee, Charles W.; Chu, Kung-Hui

2015-01-01

Highlights: • SIP characterized RDX-degrading communities under different e-accepting conditions. • Dominant RDX degradation pathways differed under different e-accepting conditions. • More complete detoxification of RDX occurred under methanogenic and sulfate-reducing conditions than under manganese(IV) and iron(III)-reducing conditions. - Abstract: This study identified microorganisms capable of using the explosive hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) or its metabolites as carbon and/or nitrogen sources under different electron-accepting conditions using 13 C and 15 N stable isotope probing (SIP). Mesocosms were constructed using groundwater and aquifer solids from an RDX-contaminated aquifer. The mesocosms received succinate as a carbon source and one of four electron acceptors (nitrate, manganese(IV), iron(III), or sulfate) or no additional electron acceptor (to stimulate methanogenesis). When RDX degradation was observed, subsamples from each mesocosm were removed and amended with 13 C 3 - or ring- 15 N 3 -, nitro- 15 N 3 -, or fully-labeled 15 N 6 -RDX, followed by additional incubation and isolation of labeled nucleic acids. A total of fifteen 16S rRNA sequences, clustering in α- and γ-Proteobacteria, Clostridia, and Actinobacteria, were detected in the 13 C-DNA fractions. A total of twenty seven sequences were derived from different 15 N-DNA fractions, with the sequences clustered in α- and γ-Proteobacteria, and Clostridia. Interestingly, sequences identified as Desulfosporosinus sp. (in the Clostridia) were not only observed to incorporate the labeled 13 C or 15 N from labeled RDX, but also were detected under each of the different electron-accepting conditions. The data suggest that 13 C- and 15 N-SIP can be used to characterize microbial communities involved in RDX biodegradation, and that the dominant pathway of RDX biodegradation may differ under different electron-accepting conditions

Production of 15N for nitride type nuclear fuel

International Nuclear Information System (INIS)

Axente, Damian

2005-01-01

Full text: Nitride nuclear fuel is the choice for advanced nuclear reactors and ADS, considering its favorable properties as: melting point, excellent thermal conductivity, high fissile density, lower fission gas release and good radiation tolerance. The application of nitride fuels in different nuclear reactors requires use of 15 N enriched nitrogen to suppress 14 C production due to (n,p) reaction on 14 N. Nitride fuel is a promising candidate for transmutation in ADSs of radioactive minor actinides, which are converted into nitrides with 15 N for that purpose. Taking into account that at present the world wide 15 N market is about 20 - 40 Kg 15 N/y, the supply of that isotope for nitride type nuclear fuel, would demand an increase in production capacity by a factor of 1000. For an industrial plant producing 100 t/y 15 N at 99 at. % 15 N concentration, using present technology of 15 N/ 14 N isotopic exchange in Nitrox system, the first separation stage of the cascade would be fed with 10M HNO 3 solution at a 600 m 3 /h flow-rate. If conversion of HNO 3 into NO, NO 2 , at the enriching end of the columns, would be done with gaseous SO 2 , for an industrial plant of 100 t/y 15 N a consumption of 4 million t SO 2 /y and a production of 70 % H 2 SO 4 waste solution of 4.5 million m 3 /y are estimated. The reconversion of H 2 SO 4 into SO 2 in order to recycle SO 2 is a problem to be solved to compensate the cost of sulfur dioxide and to diminish the amount of sulfuric acid waste solution. It should be taken into consideration an important price reduction of 15 N in order to make possible its utilization for industrial production of nitride type nuclear fuel. (authors)

Studies of the intermediary metabolism in cultured cells of the insect Spodoptera frugiperda using 13C- or 15N-labelled tracers

Directory of Open Access Journals (Sweden)

Bacher Adelbert

2005-11-01

Full Text Available Abstract Background Insect cells can serve as host systems for the recombinant expression of eukaryotic proteins. Using this platform, the controlled expression of 15N/13C labelled proteins requires the analysis of incorporation paths and rates of isotope-labelled precursors present in the medium into amino acids. For this purpose, Spodoptera frugiperda cells were grown in a complex medium containing [U-13C6]glucose. In a second experiment, cultures of S. frugiperda were grown in the presence of 15N-phenylalanine. Results Quantitative NMR analysis showed incorporation of the proffered [U-13C6]glucose into the ribose moiety of ribonucleosides (40 – 45% and into the amino acids, alanine (41%, glutamic acid/glutamine (C-4 and C-5, 30% and aspartate/asparagine (15%. Other amino acids and the purine ring of nucleosides were not formed from exogenous glucose in significant amounts (> 5%. Prior to the incorporation into protein the proffered 15N-phenylalanine lost about 70% of its label by transamination and the labelled compound was not converted into tyrosine to a significant extent. Conclusion Growth of S. frugiperda cells in the presence of [U-13C6]glucose is conducive to the fractional labelling of ribonucleosides, alanine, glutamic acid/glutamine and aspartic acid/asparagine. The isotopolog compositions of the ribonucleosides and of alanine indicate considerable recycling of carbohydrate intermediates in the reductive branch of the pentose phosphate pathway. The incorporation of 15N-labelled amino acids may be hampered by loss of the 15N-label by transamination.

Biosynthetic preparation of L-[13C]- and [15N]glutamate by Brevibacterium flavum

International Nuclear Information System (INIS)

Walker, T.E.; London, R.E.

1987-01-01

The biosynthesis of isotopically labeled L-glutamic acid by the microorganism Brevibacterium flavum was studied with a variety of carbon-13-enriched precursors. The purpose of this study was twofold: (i) to develop techniques for the efficient preparation of labeled L-glutamate with a variety of useful labeling patterns which can be used for other metabolic studies, and (ii) to better understand the metabolic events leading to label scrambling in these strains. B. flavum, which is used commercially for the production of monosodium glutamate, has the capability of utilizing glucose or acetate as a sole carbon source, and important criterion from the standpoint of developing labeling strategies. Unfortunately, singly labeled glucose precursors lead to excessive isotopic dilution which reduces their usefulness. Studies with [3- 13 C]pyruvate indicate that this problem can in principle be overcome by using labeled three-carbon precursors; however, conditions could not be found which would lead to an acceptable yield of isotopically labeled L-glutamate. In contrast, [1- 13 C]- or [2- 13 C]acetate provides relatively inexpensive, readily available precursors for the production of selectively labeled, high enriched L-glutamate. The preparation of L-[ 15 N]glutamate from [ 15 N]ammonium sulfate was carried out and is a very effective labeling strategy. Analysis of the isotopic distribution in labeled glutamate provides details about the metabolic pathways in these interesting organisms

Transformation of /sup 14/C labelled plant components in soil in relation to immobilization and remineralization of /sup 15/N fertilizer

Energy Technology Data Exchange (ETDEWEB)

Azam, F.; Haider, K.; Malik, K.A.

1985-01-01

Uniformly /sup 14/C labeled glucose, cellulose and wheat straw and specifically /sup 14/C labeled lignin component in corn stalks were aerobically incubated for 12 weeks in a chernozem soil along with /sup 15/N labeled ammonium sulfate. Glucose was most readily decomposed, followed in order by cellulose, wheat straw and corn stalk lignins labeled at methoxyl-, side chain 2- and ring-C. More than 50% of /sup 14/C applied as glucose, cellulose and wheat straw evolved as CO/sub 2/ during the first week. Lignin however, decomposed relatively slowly. A higher proportion of /sup 14/C was transformed into microbial biomass whereas lignins contributed a little to this fraction. After 12 weeks of incubation nearly 60% of the lignin /sup 14/C was found in humic compounds of which more than 70% was resistant to hydrolysis with 6N HCl. Maximum incorporation of /sup 15/N in humic compounds was observed in cellulose amended soil. However, in this case more than 80% of the /sup 15/N was in hydrolysable forms. Immobilization-remineralization of applied /sup 15/N was most rapid in glucose treated soil and a complete immobilization followed by remineralization was observed after 3 days. The process was much slow in soil treated with cellulose, wheat straw or corn stalks. More than 70% of the newly immobilized N was in hydrolysable forms mainly representing the microbial component. Serial hydrolysis of soil at different incubation intervals showed a greater proportion of 6N HCl hydrolysable /sup 14/C and /sup 15/N in fractions representing microbial material. /sup 14/C from lignin carbons was relatively more uniformly distributed in different fractions as compared to glucose, cellulose and wheat straw where a major portion of /sup 14/C was in easily hydrolysable fractions. 25 refs., 3 figs., 4 tabs.

ORTHO-TO-PARA ABUNDANCE RATIO (OPR) OF AMMONIA IN 15 COMETS: OPRs OF AMMONIA VERSUS 14N/15N RATIOS IN CN

International Nuclear Information System (INIS)

Shinnaka, Yoshiharu; Kawakita, Hideyo; Kobayashi, Hitomi; Jehin, Emmanuel; Manfroid, Jean; Hutsemekers, Damien; Arpigny, Claude

2011-01-01

The ortho-to-para abundance ratio (OPR) of cometary molecules is considered to be one of the primordial characteristics of cometary ices. We present OPRs of ammonia (NH 3 ) in 15 comets based on optical high-dispersion spectroscopic observations of NH 2 , which is a photodissociation product of ammonia in the gaseous coma. The observations were mainly carried out with the VLT/UVES. The OPR of ammonia is estimated from the OPR of NH 2 based on the observations of the NH 2 (0, 9, 0) vibronic band. The absorption lines by the telluric atmosphere are corrected and the cometary C 2 emission lines blended with NH 2 lines are removed in our analysis. The ammonia OPRs show a cluster between 1.1 and 1.2 (this corresponds to a nuclear spin temperature of ∼30 K) for all comets in our sample except for 73P/Schwassmann-Wachmann 3 (73P/SW3). Comet 73P/SW3 (both B- and C-fragments) shows the OPR of ammonia consistent with nuclear spin statistical weight ratio (1.0) that indicates a high-temperature limit as nuclear spin temperature. We compared the ammonia OPRs with other properties ( 14 N/ 15 N ratios in CN, D/H ratios of water, and mixing ratios of volatiles). Comet 73P/SW3 is clearly different from the other comets in the plot of ammonia OPRs versus 14 N/ 15 N ratios in CN. The ammonia OPRs of 1.0 and lower 15 N-fractionation of CN in comet 73P/SW3 imply that icy materials in this comet formed under warmer conditions than other comets. Comets may be classified into two groups in the plot of ammonia OPRs against 14 N/ 15 N ratios in CN.

Emission spectroscopic 15N analysis 1985

International Nuclear Information System (INIS)

Meier, G.

1986-01-01

The state of the art of emission spectroscopic 15 N analysis is demonstrated taking the NOI-6e 15 N analyzer as an example. The analyzer is equipped with a microcomputer to ensure a high operational comfort, computer control, and both data acquisition and data processing. In small amounts of nitrogen-containing substances (10 to 50 μg N 2 ) the 15 N abundance can be very quickly determined in standard discharge tubes or in aqueous ammonium salt solutions with a standard deviation less than 0.6 percent

Organic vs. conventional grassland management: do (15)N and (13)C isotopic signatures of hay and soil samples differ?

Science.gov (United States)

Klaus, Valentin H; Hölzel, Norbert; Prati, Daniel; Schmitt, Barbara; Schöning, Ingo; Schrumpf, Marion; Fischer, Markus; Kleinebecker, Till

2013-01-01

Distinguishing organic and conventional products is a major issue of food security and authenticity. Previous studies successfully used stable isotopes to separate organic and conventional products, but up to now, this approach was not tested for organic grassland hay and soil. Moreover, isotopic abundances could be a powerful tool to elucidate differences in ecosystem functioning and driving mechanisms of element cycling in organic and conventional management systems. Here, we studied the δ(15)N and δ(13)C isotopic composition of soil and hay samples of 21 organic and 34 conventional grasslands in two German regions. We also used Δδ(15)N (δ(15)N plant - δ(15)N soil) to characterize nitrogen dynamics. In order to detect temporal trends, isotopic abundances in organic grasslands were related to the time since certification. Furthermore, discriminant analysis was used to test whether the respective management type can be deduced from observed isotopic abundances. Isotopic analyses revealed no significant differences in δ(13)C in hay and δ(15)N in both soil and hay between management types, but showed that δ(13)C abundances were significantly lower in soil of organic compared to conventional grasslands. Δδ(15)N values implied that management types did not substantially differ in nitrogen cycling. Only δ(13)C in soil and hay showed significant negative relationships with the time since certification. Thus, our result suggest that organic grasslands suffered less from drought stress compared to conventional grasslands most likely due to a benefit of higher plant species richness, as previously shown by manipulative biodiversity experiments. Finally, it was possible to correctly classify about two third of the samples according to their management using isotopic abundances in soil and hay. However, as more than half of the organic samples were incorrectly classified, we infer that more research is needed to improve this approach before it can be efficiently

Organic vs. Conventional Grassland Management: Do 15N and 13C Isotopic Signatures of Hay and Soil Samples Differ?

Science.gov (United States)

Klaus, Valentin H.; Hölzel, Norbert; Prati, Daniel; Schmitt, Barbara; Schöning, Ingo; Schrumpf, Marion; Fischer, Markus; Kleinebecker, Till

2013-01-01

Distinguishing organic and conventional products is a major issue of food security and authenticity. Previous studies successfully used stable isotopes to separate organic and conventional products, but up to now, this approach was not tested for organic grassland hay and soil. Moreover, isotopic abundances could be a powerful tool to elucidate differences in ecosystem functioning and driving mechanisms of element cycling in organic and conventional management systems. Here, we studied the δ15N and δ13C isotopic composition of soil and hay samples of 21 organic and 34 conventional grasslands in two German regions. We also used Δδ15N (δ15N plant - δ15N soil) to characterize nitrogen dynamics. In order to detect temporal trends, isotopic abundances in organic grasslands were related to the time since certification. Furthermore, discriminant analysis was used to test whether the respective management type can be deduced from observed isotopic abundances. Isotopic analyses revealed no significant differences in δ13C in hay and δ15N in both soil and hay between management types, but showed that δ13C abundances were significantly lower in soil of organic compared to conventional grasslands. Δδ15N values implied that management types did not substantially differ in nitrogen cycling. Only δ13C in soil and hay showed significant negative relationships with the time since certification. Thus, our result suggest that organic grasslands suffered less from drought stress compared to conventional grasslands most likely due to a benefit of higher plant species richness, as previously shown by manipulative biodiversity experiments. Finally, it was possible to correctly classify about two third of the samples according to their management using isotopic abundances in soil and hay. However, as more than half of the organic samples were incorrectly classified, we infer that more research is needed to improve this approach before it can be efficiently used in practice

Retrospective characterization of ontogenetic shifts in killer whale diets via δ13C and δ15N analysis of teeth

Science.gov (United States)

Newsome, Seth D.; Etnier, Michael A.; Monson, Daniel H.; Fogel, Marilyn L.

2009-01-01

Metabolically inert, accretionary structures such as the dentin growth layers in teeth provide a life history record of individual diet with near-annual resolution. We constructed ontogenetic δ13C and δ15N profiles by analyzing tooth dentin growth layers from 13 individual killer whales Orcinus orca collected in the eastern northeast Pacific Ocean between 1961 and 2003. The individuals sampled were 6 to 52 yr old, representing 2 ecotypes—resident and transient—collected across ~25° of latitude. The average isotopic values of transient individuals (n = 10) are consistent with a reliance on mammalian prey, while the average isotopic values of residents (n = 3) are consistent with piscivory. Regardless of ecotype, most individuals show a decrease in δ15N values of ~2.5‰ through the first 3 yr of life, roughly equivalent to a decrease of one trophic level. We interpret this as evidence of gradual weaning, after which, ontogenetic shifts in isotopic values are highly variable. A few individuals (n = 2) maintained relatively stable δ15N and δ13C values throughout the remainder of their lives, whereas δ15N values of most (n = 11) increased by ~1.5‰, suggestive of an ontogenetic increase in trophic level. Significant differences in mean δ13C and δ15N values among transients collected off California suggest that individuality in prey preferences may be prevalent within this ecotype. Our approach provides retrospective individual life history and dietary information that cannot be obtained through traditional field observations of free-ranging and elusive species such as killer whales, including unique historic ecological information that pre-dates modern studies. By providing insights into individual diet composition, stable isotope analysis of teeth and/or bones may be the only means of evaluating a number of hypothesized historical dietary shifts in killer whales of the northeast Pacific Ocean

Resolution of the 15N balance enigma?

International Nuclear Information System (INIS)

Clough, T.J.; Sherlock, R.R.; Cameron, K.C.; Stevens, R.J.; Laughlin, R.J.; Mueller, C.

2001-01-01

The enigma of soil nitrogen balance sheets has been discussed for over 40 years. Many reasons have been considered for the incomplete recovery of 15 N applied to soils, including sampling uncertainty, gaseous N losses from plants, and entrapment of soil gases. The entrapment of soil gases has been well documented for rice paddy and marshy soils but little or no work appears to have been done to determine entrapment in drained pasture soils. In this study 15 N-labelled nitrate was applied to a soil core in a gas-tight glovebox. Water was applied, inducing drainage, which was immediately collected. Dinitrogen and N -2 were determined in the flux through the soil surface, and in the gases released into the glovebox as a result of irrigation or physical destruction of the core. Other components of the N balance were also measured, including soil inorganic-N and organic-N. Quantitative recovery of the applied 15 N was achieved when the experiment was terminated 484 h after the 15 N-labelled material was applied. Nearly 23% of the 15 N was recovered in the glovebox atmosphere as N 2 and N 2 O due to diffusion from the base of the soil core, convective flow after irrigation, and destructive soil sampling. This 15 N would normally be unaccounted for using the sampling methodology typically employed in 15 N recovery experiments. Copyright (2001) CSIRO Publishing

Natural abundances of 15N and 13C in leaves of some N2-fixing and non-N2-fixing trees and shrubs in Syria.

Science.gov (United States)

Kurdali, F; Al-Shamma'a, M

2009-09-01

A survey study was conducted on man-made plantations located at two different areas in the arid region of Syria to determine the variations in natural abundances of the (15)N and (13)C isotopes in leaves of several woody legume and non-legume species, and to better understand the consequence of such variations on nitrogen fixation and carbon assimilation. In the first study area (non-saline soil), the delta(15)N values in four legume species (Acacia cyanophylla,-1.73 per thousand Acacia farnesiana,-0.55 per thousand Prosopis juliflora,-1.64 per thousand; and Medicago arborea,+1.6 \\textperthousand) and one actinorhizal plant (Elaeagnus angustifolia,-0.46 to-2.1 per thousand) were found to be close to that of the atmospheric value pointing to a major contribution of N(2) fixing in these species; whereas, delta(15)N values of the non-fixing plant species were highly positive. delta(13)C per thousand; in leaves of the C3 plants were found to be affected by plant species, ranging from a minimum of-28.67 per thousand; to a maximum of-23 per thousand. However, they were relatively similar within each plant species although they were grown at different sites. In the second study area (salt affected soil), a higher carbon discrimination value (Delta(13)C per thousand) was exhibited by P. juliflora, indicating that the latter is a salt tolerant species; however, its delta(15)N was highly positive (+7.03 per thousand) suggesting a negligible contribution of the fixed N(2). Hence, it was concluded that the enhancement of N(2) fixation might be achieved by selection of salt-tolerant Rhizobium strains.

15N-labelled glycine synthesis

International Nuclear Information System (INIS)

Tavares, Claudineia R.O.; Bendassolli, Jose A.; Sant'Ana Filho, Carlos R.; Prestes, Clelber V.; Coelho, Fernando

2006-01-01

This work describes a method for 15 N-isotope-labeled glycine synthesis, as well as details about a recovery line for nitrogen residues. To that effect, amination of α-haloacids was performed, using carboxylic chloroacetic acid and labeled aqueous ammonia ( 15 NH 3 ). Special care was taken to avoid possible 15 NH 3 losses, since its production cost is high. In that respect, although the purchase cost of the 13 N-labeled compound (radioactive) is lower, the stable tracer produced constitutes an important tool for N cycling studies in living organisms, also minimizing labor and environmental hazards, as well as time limitation problems in field studies. The tests were carried out with three replications, and variable 15 NH 3(aq) volumes in the reaction were used (50, 100, and 150 mL), in order to calibrate the best operational condition; glycine masses obtained were 1.7, 2, and 3.2 g, respectively. With the development of a system for 15 NH 3 recovery, it was possible to recover 71, 83, and 87% of the ammonia initially used in the synthesis. With the required adaptations, the same system was used to recover methanol, and 75% of the methanol initially used in the amino acid purification process were recovered. (author)

New structures in the continuum of 15C populated by two-neutron transfer

International Nuclear Information System (INIS)

Cappuzzello, F.; Rea, C.; Bonaccorso, A.; Bondì, M.; Carbone, D.; Cavallaro, M.; Cunsolo, A.; Foti, A.; Orrigo, S.E.A.; Rodrigues, M.R.D.; Taranto, G.

2012-01-01

The 13 C( 18 O,  16 O) 15 C reaction has been studied at 84 MeV incident energy. The ejectiles have been detected at forward angles and 15 C excitation energy spectra have been obtained up to about 20 MeV. Several known bound and resonant states of 15 C have been identified together with two unknown structures at 10.5 MeV (FWHM=2.5 MeV) and 13.6 MeV (FWHM=2.5 MeV). Calculations based on the removal of two uncorrelated neutrons from the projectile describe a significant part of the continuum observed in the energy spectra. In particular the structure at 10.5 MeV is dominated by a resonance of 15 C near the 13 C+n+n threshold. Similar structures are found in nearby nuclei such as 14 C and 11 Be.

N-15 analysis by emission spectroscopy

Energy Technology Data Exchange (ETDEWEB)

NONE

1983-12-31

The stable isotope of nitrogen, N-15, has become widely used as tracer in agriculture, medicine and biology research. The film gives an overview of the sample preparation and analytical procedures followed in the analysis of the nitrogen isotopic composition (14N/15N ratio) by optical emission spectrometry at the Seibersdorf Laboratory. The subsampling of plant material and the several steps of chemical pretreatment such as Kjeldahl digestion, distillation, titration and adjustment of the proper N concentration in the extract are demonstrated. The preparation of the discharge tubes is shown in detail. Final measurement of the 14N/15N ratio is carried out with the NOI-5 and JASCO emission spectrometers

The influence of fish cage culture on δ{sup 13}C and δ{sup 15}N of filter-feeding Bivalvia (Mollusca)

Energy Technology Data Exchange (ETDEWEB)

Benedito, E.; Takeda, A.M., E-mail: eva@nupelia.uem.br [Universidade Estadual de Maringa (UEM), PR (Brazil). Nucleo de Pesquisas em Limnologia, Ictiologia e Aquicultura; Figueroa, L. [Universidade Estadual de Maringa (UEM), PR (Brazil). Pos-Graduacao em Ecologia de Ambientes Aquaticos Continentais; Manetta, GI. [Universidade Estadual de Maringa (UEM), PR (Brazil). Pos-Graduacao em Biologia Comparada

2013-11-15

The objective of this study was to evaluate the effect of Oreochromis niloticus cage culture promoted variations in the δ{sup 13}C and δ{sup 15}N in Corbicula fluminea (Mollusca; Bivalvia) and in the sediment of an aquatic food web. Samples were taken before and after net cage installation in the Rosana Reservoir (Paranapanema River, PR-SP). Samples of specimens of the bivalve filter C. fluminea and samples of sediment were collected using a modified Petersen grab. All samples were dried in an oven (60 °C) for 72 hours, macerated to obtain homogenous fine powders and sent for carbon (δ{sup 13}C) and nitrogen (δ{sup 15}N) isotopic value analysis in a mass spectrometer. There were significant differences in the δ{sup 13}C and δ{sup 15}N values of the invertebrate C. fluminea between the beginning and the end of the experiment. There were no differences between the δ{sup 13}C and δ{sup 15}N values of sediment. These results indicate that the installation of fish cage culture promoted impacts in the isotopic composition of the aquatic food web organisms, which could exert influence over the native species and the ecosystem. (author)

15N-ammonium test in clinical research

International Nuclear Information System (INIS)

Jung, K.; Metzner, C.; Teichmann, B.; Leipzig Univ.

1989-01-01

By use of the 15 N-ammonium test the liver function is investigated under influence of hormonal contraceptives in women and in liver diseases in children. With the described noninvasive nonradioactive isotope test the ammonia detoxification capability and the urea synthesis capacity of the liver is determined by measuring of the 15 N excretion in ammonia and urea in urine after oral administering of 15 N-ammonium chloride. The 15 N-ammonium test shows a significant influence of the hormonal contraceptives on the liver function and gives diagnostic evidence for liver diseases in children. (author)

Creating 13C- and 15N-enriched tree leaf litter for decomposition experiments

Science.gov (United States)

Szlavecz, K. A.; Pitz, S.; Chang, C.; Bernard, M.

2013-12-01

Labeling plant material with heavy isotopes of carbon and nitrogen can produce a traceable nutrient signal that can be followed into the different trophic levels and decomposer food web. We treated 60 tree saplings with 13C-enriched CO2 gas and 15N-enriched ammonium nitrate over a three-month period to create dually-labeled plant material for future decomposition experiments. The trees included both early (Red maple, Sweetgum, Tulip poplar) and late (American beech, White oak) successional deciduous tree species, and a conifer, White pine. We constructed a 2.4 m × 2.4 m × 2.4 m environmental chamber that was climate-controlled using an air conditioning system. An Arduino microcontroller interfaced with a Vaisala GMP343 CO2 probe maintained a CO2 concentration between 500-520 ppm by controlling a solenoid valve on the CO2 tank regulator. The trees were placed into the chamber in August 2012 and remained until senescence unless they were lost to death or disease. Ammonium nitrate was added twice, in September and October. Leaf samples were collected prior to the start of the experiment and after senescence, whereas root samples were collected only in December. Samples were dried, ground and analyzed using an isotope ratio mass spectrometer. American beech and White oak had 40% mortality, and 34% of tulip poplar trees were removed because of powdery mildew overgrowth or death. Most tulip poplar trees exhibited a second leaf out following senescence in late September. Nearly 1 kg of litter was produced with tulip poplar representing over half of the total mass. Levels of enrichment varied greatly by species. Beech (-14.2‰) and White oak (-4.8‰) had low levels of enrichment in comparison to early successional species such as Sweetgum (41.7‰) and Tulip poplar (30.7‰ [first leaf fall] and 238.0‰ [second leaf fall]). Leaf enrichment with 15N followed a similar pattern, though it was achieved at a higher level with δ15N values varying from 271.6‰ to 1354.2�

Cyclotron production of molecules labelled with short-lived radioisotopes β+ emitters (15O, 13N, 11C) and their clinical uses

International Nuclear Information System (INIS)

Bougharouat, B.

1981-01-01

Clinical use of three short-lived radioisotopes: 15 O, 13 N and 11 C is studied on two complementary aspects. A production and purification system is realized; detection instruments in medical use are studied. The production of labelled molecules with the three radiotracers 15 O, 13 N, 11 C from the target bombardment with charged and accelerated particles was studied [fr

Absorption of ammonium sulphate 15N by coffee plants

International Nuclear Information System (INIS)

Fenilli, Tatiele Anete Bergamo; Reichardt, Klaus; Bacchi, Osny Oliveira Santos; Trivelin, Paulo Cesar Ocheuze; Dourado Neto, Durval

2005-01-01

The objective of this study was to quantify the absorption of ammonium sulphate 15 N by coffee plants. Treatments consisted of five sub-plots of 9 plants, of which the three central ones received 280 kg ha -1 of 15 N, applied at four times: 1/4 on 01 Set 03; 1/4 on 03 Nov 03; 1/4 on 15 Dec 03 and 1/4 on 30 Jan 04. The isotopic enrichment was 2,072 ± 0,001 atom % 15 N. The dry matter of the shoot was evaluated every 60 days, using one plant per replicate, collected outside the sub-plot. They were as similar as possible to the labeled plants, which were used only for isotopic and Total N analysis, after being dried at 65 deg C until constant weight. At harvest, plants had absorbed 42,88% of the fertilizer N. Leaves accumulated the largest amount of fertilizer N, and were also the compartments that received most N from other parts of the plant. The following partition of the fertilizer N was found at harvest: 23.01% in young leaves, 6.23% in old leaves, 4,46% in stem, 3.46% in fruits, 3.10% in young branches and 2.63% in old branches. (author)

Growth and N2-fixation of Dhaincha C-3/Sorghum C-4 and Dhaincha C-3/Sunflower C-3 intercropping systems using the 15N and 13C natural abundance method technique

International Nuclear Information System (INIS)

Kurdali, F.

2007-06-01

A field experiment on dhaincha C 3 (Sesbania aculeata Pers), sunflower C 3 (Helianthus annuus L.) and sorghum C 4 (Sorghum bicolor L.) plants grown in monocropping and intercropping systems was conducted to evaluate seed yield, dry matter production, total N yield, land equivalent ratio (LER), intraspecific competition for soil N uptake, water use efficiency (WUE) and N 2 -fixation using the 15 N natural abundance technique (δ 15 N ). Moreover, carbon isotope discrimination (Δ13 C ) was determined to assess factors responsible for crop performance variability in the different cropping systems. Intercropping of sesbania/sorghum showed greater efficiency over monocropping in producing dry matter, during the entire growth period, as indicated by the LERs (>1); whereas, the efficiency of producing dry matter in the sesbania /sunflower intercropping was similar to that in the monocropping system (LER=1). Moreover, sorghum plants (C 4 ) was more competitive than sesbania (C 3 ) for soil N uptake; whereas, sesbania seemed to be more competitive than its associated sunflower (C 3 ). N uptake in the mixed stand of sesbania/sorghum was improved due to the increase in soil N uptake by the component sorghum and the higher root nodule activity of component sesbania without affecting the amount of N 2 fixed. In both cropping systems, sesbania plants fixed almost the same amount of N 2 (an average of 105 kg N/ha) although the number of rows in the mixed stand was 2/3 of that in the pure stand. This gives an advantage of the intercropping over sole cropping system with regards to N 2 -fixation. 13 C discrimination in plant materials was found to be affected by plant species and the cropping system. Factors affected Δ13 C in plants grown in the mixed stand relative to solely grown crops are discussed.(author)

Determination of δ13C, δ15N, or δ34S by isotope-ratio-monitoring mass spectrometry using an elemental analyzer

Science.gov (United States)

Johnson, Craig A.; Stricker, Craig A.; Gulbransen, Cayce A.; Emmons, Matthew P.

2018-02-14

This report describes procedures used in the Geology, Geophysics, and Geochemistry Science Center of the U.S. Geological Survey in Denver, Colorado, to determine the stable-isotope ratios 13C/12C, 15N/14N, and 34S/32S in solid materials. The procedures use elemental analyzers connected directly to gas-source isotope-ratio mass spectrometers. A different elemental–analyzer–mass-spectrometer system is used for 13C/12C and 15N/14N than is used for 34S/32S to accommodate differences in reagents, catalysts, and instrument settings.

Absorption of ammonium sulphate {sup 15}N by coffee plants; Recuperacao do {sup 15}N do sulfato de amonio por plantas de cafe

Energy Technology Data Exchange (ETDEWEB)

Fenilli, Tatiele Anete Bergamo; Reichardt, Klaus; Bacchi, Osny Oliveira Santos [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Fisica do Solo]. E-mail: tatiele@cena.usp.br; Trivelin, Paulo Cesar Ocheuze [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Isotopos Estaveis; Dourado Neto, Durval [Sao Paulo Univ., Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz. Dept. de Producao Vegetal

2005-07-01

The objective of this study was to quantify the absorption of ammonium sulphate {sup 15}N by coffee plants. Treatments consisted of five sub-plots of 9 plants, of which the three central ones received 280 kg ha{sup -1} of {sup 15}N, applied at four times: 1/4 on 01 Set 03; 1/4 on 03 Nov 03; 1/4 on 15 Dec 03 and 1/4 on 30 Jan 04. The isotopic enrichment was 2,072 {+-} 0,001 atom % {sup 15}N. The dry matter of the shoot was evaluated every 60 days, using one plant per replicate, collected outside the sub-plot. They were as similar as possible to the labeled plants, which were used only for isotopic and Total N analysis, after being dried at 65 deg C until constant weight. At harvest, plants had absorbed 42,88% of the fertilizer N. Leaves accumulated the largest amount of fertilizer N, and were also the compartments that received most N from other parts of the plant. The following partition of the fertilizer N was found at harvest: 23.01% in young leaves, 6.23% in old leaves, 4,46% in stem, 3.46% in fruits, 3.10% in young branches and 2.63% in old branches. (author)

Investigation into endogenous N metabolism in 15N-labelled pigs. 1

International Nuclear Information System (INIS)

Bergner, H.; Bergner, U.; Adam, K.

1984-01-01

4 male castrated pigs (55-65 kg) either received a wheat-fish meal diet (1 and 2) or a wheat-horse bean diet (3 and 4) without straw meal supplement (1 and 3) or with a supplement of 20% dry matter (2 and 4). In order to investigate whether a 15 N labelling of the pigs is also possible with a protein excess in the ration, the animals received 24.8 g (1 and 2) and 11.6 g crude protein/kg/sup 0.75/ live weight (3 and 4). During a 10-day 15 N-labelling 385 mg 15 N excess ( 15 N') per kg/sup 0.75/ were applied with 15 N labelling the following quotas of the applied 15 N amount were incorporated: 1 = 10.2%, 2 = 7.2%, 3 = 18.7%, 4 = 14.4%. 15 N excretion in both TCA fractions of feces showed a highly significant positive correlation to the increasing content of crude fibre in the 4 diets. The immediate 15 N incorporation into the TCA-precipitable fraction of feces proves that 15 N enters the large intestine endogenously and serves bacterial protein synthesis. 3 days after the last 15 application the pigs were killed. The values of atom-% 15 N' were determined in the TCA-precipitable blood plasma and in the TCA-precipitable fraction of the liver. The other examined organs and tissues showed smaller differences between the test animals. The results show that the 15 N labelling of tissues and organs of pigs is also possible at a high level of protein supply by means of an oral application of [ 15 N] ammonia salts. (author)

Affordable uniform isotope labeling with {sup 2}H, {sup 13}C and {sup 15}N in insect cells

Energy Technology Data Exchange (ETDEWEB)

Sitarska, Agnieszka; Skora, Lukasz; Klopp, Julia; Roest, Susan; Fernández, César; Shrestha, Binesh; Gossert, Alvar D., E-mail: alvar.gossert@novartis.com [Novartis Institutes for BioMedical Research (Switzerland)

2015-06-15

For a wide range of proteins of high interest, the major obstacle for NMR studies is the lack of an affordable eukaryotic expression system for isotope labeling. Here, a simple and affordable protocol is presented to produce uniform labeled proteins in the most prevalent eukaryotic expression system for structural biology, namely Spodoptera frugiperda insect cells. Incorporation levels of 80 % can be achieved for {sup 15}N and {sup 13}C with yields comparable to expression in full media. For {sup 2}H,{sup 15}N and {sup 2}H,{sup 13}C,{sup 15}N labeling, incorporation is only slightly lower with 75 and 73 %, respectively, and yields are typically twofold reduced. The media were optimized for isotope incorporation, reproducibility, simplicity and cost. High isotope incorporation levels for all labeling patterns are achieved by using labeled algal amino acid extracts and exploiting well-known biochemical pathways. The final formulation consists of just five commercially available components, at costs 12-fold lower than labeling media from vendors. The approach was applied to several cytosolic and secreted target proteins.

Seasonal variation in nitrogen pools and 15N/13C natural abundances in different tissues of grassland plants

Directory of Open Access Journals (Sweden)

J. K. Schjoerring

2012-05-01

Full Text Available Seasonal changes in nitrogen (N pools, carbon (C content and natural abundance of 13C and 15N in different tissues of ryegrass plants were investigated in two intensively managed grassland fields in order to address their ammonia (NH3 exchange potential. Green leaves generally had the largest total N concentration followed by stems and inflorescences. Senescent leaves had the lowest N concentration, indicating N re-allocation. The seasonal pattern of the Γ value, i.e. the ratio between NH4+ and H+ concentrations, was similar for the various tissues of the ryegrass plants but the magnitude of Γ differed considerably among the different tissues. Green leaves and stems generally had substantially lower Γ values than senescent leaves and litter. Substantial peaks in Γ were observed during spring and summer in response to fertilization and grazing. These peaks were associated with high NH4+ rather than with low H+ concentrations. Peaks in Γ also appeared during the winter, coinciding with increasing δ15N values, indicating absorption of N derived from mineralization of soil organic matter. At the same time, δ13C values were declining, suggesting reduced photosynthesis and capacity for N assimilation. δ15N and δ13C values were more influenced by mean monthly temperature than by the accumulated monthly precipitation. In conclusion, ryegrass plants showed a clear seasonal pattern in N pools. Green leaves and stems of ryegrass plants generally seem to constitute a sink for NH3, while senescent leaves have a large potential for NH3 emission. However, management events such as fertilisation and grazing may create a high NH3 emission potential even in green plant parts. The obtained results provide input for future modelling of plant-atmosphere NH3 exchange.

δ15N value does not reflect fasting in mysticetes.

Science.gov (United States)

Aguilar, Alex; Giménez, Joan; Gómez-Campos, Encarna; Cardona, Luís; Borrell, Asunción

2014-01-01

The finding that tissue δ(15)N values increase with protein catabolism has led researchers to apply this value to gauge nutritive condition in vertebrates. However, its application to marine mammals has in most occasions failed. We investigated the relationship between δ(15)N values and the fattening/fasting cycle in a model species, the fin whale, a migratory capital breeder that experiences severe seasonal variation in body condition. We analyzed two tissues providing complementary insights: one with isotopic turnover (muscle) and one that keeps a permanent record of variations in isotopic values (baleen plates). In both tissues δ(15)N values increased with intensive feeding but decreased with fasting, thus contradicting the pattern previously anticipated. The apparent inconsistency during fasting is explained by the fact that a) individuals migrate between different isotopic isoscapes, b) starvation may not trigger significant negative nitrogen balance, and c) excretion drops and elimination of 15N-depleted urine is minimized. Conversely, when intensive feeding is resumed in the northern grounds, protein anabolism and excretion start again, triggering 15N enrichment. It can be concluded that in whales and other mammals that accrue massive depots of lipids as energetic reserves and which have limited access to drinking water, the δ15N value is not affected by fasting and therefore cannot be used as an indication of nutritive condition.

Synthesis of [1,3 - 15 N2] uracil

International Nuclear Information System (INIS)

Chiriac, M.; Axente, D.

2001-01-01

The synthesis of 15 N labelled uracil, using CO( 15 NH 2 ) 2 as starting material, is presented. The experimental procedure is an adaptation of the synthesis methods for the corresponding unlabelled compounds. Urea- 15 N 2 used as starting material was obtained from H 15 NO 3 (99 at.% 15 N) produced at National Institute for Research and Development of Isotopic and Molecular Technologies, Cluj-Napoca.The uracil structure was determined using the mass spectrometry method and the isotopic labelling was determined by the same method on the molecular compound. The synthesis scheme of (1,3- 15 N 2 ) uracil is presented. (authors)

15N tracer techniques in pediatric research

International Nuclear Information System (INIS)

Heine, W.; Richter, I.; Plath, C.; Wutzke, K.; Stolpe, H.J.; Tiess, M.; Toewe, J.

1983-01-01

The main topics of the review comprise mathematical fundamentals of the determination of N metabolism parameters using the 3-pool method, the value of different 15 N tracer substances for the determination of whole-body protein parameters, the utilization of parenterally applied D-amino acids, studies on the influence of different diets on the N metabolism of premature infants with the 15 N tracer technique, the application of the 15 N-glycine-STH-test for the evaluation of the therapeutic effect of STH in children suffering from hypothalamico-hypophyseal dwarfism, in vivo studies on urea utilization by the infant intestinal flora under various dietary regimens as well as in vitro investigations on the utilization of 15 N-labelled urea and NH 4 Cl, resp., by the intestinal flora

Partial Molar Volumes of 15-Crown-5 Ether in Mixtures of N,N-Dimethylformamide with Water.

Science.gov (United States)

Tyczyńska, Magdalena; Jóźwiak, Małgorzata

2014-01-01

The density of 15-crown-5 ether (15C5) solutions in the mixtures of N,N -dimethylformamide (DMF) and water (H 2 O) was measured within the temperature range 293.15-308.15 K using an Anton Paar oscillatory U-tube densimeter. The results were used to calculate the apparent molar volumes ( V Φ ) of 15C5 in the mixtures of DMF + H 2 O over the whole concentration range. Using the apparent molar volumes and Redlich and Mayer equation, the standard partial molar volumes of 15-crown-5 were calculated at infinite dilution ([Formula: see text]). The limiting apparent molar expansibilities ( α ) were also calculated. The data are discussed from the point of view of the effect of concentration changes on interactions in solution.

On-line measurement of 13C/12C and 15N/14N ratios by E/A-diluter-IRMS

International Nuclear Information System (INIS)

Foerstel, H.; Boner, M.; Prast, H.

2001-01-01

Efficient food control requires rapid procedures for testing source authenticity. Food is produced inside a closed 'isotopic environment' from where it inherits a specific isotopic composition or fingerprint. Isotope ratio mass spectrometry (IRMS) measures isotopic compositions using simple gases like CO 2 or N 2 exclusively. From food samples these gases may be produced by combustion in a commercial CHN analyser (Elemental Analyser, EA). Following GC separation of the combustion gases the elemental content is determined using a thermal conductivity detector (TCD) . The effluent of the EA is coupled to the mass spectrometer via an open split. Because the relative amounts of the bio-elements vary significantly, (often C/N is 25/1 or larger), the amount of analyte gas produced from a single sample must be adjusted e.g. using a diluter. Our diluter configuration can be adjusted to measure repeatedly the 13 C/ 12 C ratio of carbon dioxide in mineral waters, as well as to measure 15 N/ 14 N and 13 C/ 12 C ratios from biological or soil samples simultaneously. In the first application different types of carbon dioxide, produced naturally (well) or technically (process), can be distinguished. The second application offers the possibility to trace the fate of a fertilizer in vineyards by determining the isotopic variation of nitrogen and carbon in soil and vines. (author)

Mangrove isotopic (δ15N and δ13C) fractionation across a nitrogen vs. phosphorus limitation gradient

Science.gov (United States)

Mckee, Karen L.; Feller, Ilka C.; Popp, Marianne; Wanek, Wolfgang

2002-01-01

Mangrove islands in Belize are characterized by a unique switching from nitrogen (N) to phosphorus (P) limitation to tree growth from shoreline to interior. Fertilization has previously shown that Rhizophora mangle (red mangrove) fringe trees (5–6 m tall) growing along the shoreline are N limited; dwarf trees (!1.5 m tall) in the forestinterior are P limited; and transition trees (2–4 m tall) are co-limited by both N and P.  Growth patterns paralleled a landward decrease in soil flushing by tides and an increase in bioavailable N, but P availability remained consistently low across the gradient. Stable isotopic composition was measured in R. mangle leaves to aid in explaining this nutrient switching pattern and growth variation. Along control transects, leaf !15N decreased from "0.10‰ (fringe) to #5.38‰ (dwarf). The !15N of N-fertilized trees also varied spatially, but the values were consistently more negative (by $3‰) compared to control trees. Spatial variation in !15N values disappeared when the trees were fertilized with P, and values averaged "0.12‰, similar to that in control fringe trees. Neither variation in source inputs nor microbial fractionation could fully account for the observed patterns in !15N. The results instead suggest that the lower !15N values in transition and dwarf control trees were due to plant fractionation as a consequence of slower growth and lower N demand. P fertilization increased N demand and decreased fractionation. Although leaf !13C was unaffected by fertilization, values increased from fringe (#28.6‰) to transition (#27.9‰) to dwarf (#26.4‰) zones, indicating spatial variation in environmental stresses affecting stomatal conductance or carboxylation. The results thus suggest an interaction of external supply, internal demand, and plant ability to acquire nutrients under different hydro-edaphic conditions that vary across this tree-height gradient. The findings not only aid in understanding

Human baby hair amino acid natural abundance 15N-isotope values are not related to the 15N-isotope values of amino acids in mother's breast milk protein.

Science.gov (United States)

Romek, Katarzyna M; Julien, Maxime; Frasquet-Darrieux, Marine; Tea, Illa; Antheaume, Ingrid; Hankard, Régis; Robins, Richard J

2013-12-01

Since exclusively breast-suckled infants obtain their nutrient only from their mother's milk, it might be anticipated that a correlation will exist between the (15)N/(14)N isotope ratios of amino acids of protein of young infants and those supplied by their mother. The work presented here aimed to determine whether amino nitrogen transfer from human milk to infant hair protein synthesized within the first month of life conserves the maternal isotopic signature or whether post-ingestion fractionation dominates the nitrogen isotope spectrum. The study was conducted at 1 month post-birth on 100 mother-infant pairs. Isotope ratios (15)N/(14)N and (13)C/(12)C were measured using isotope ratio measurement by Mass Spectrometry (irm-MS) for whole maternal milk, and infant hair and (15)N/(14)N ratios were also measured by GC-irm-MS for the N-pivaloyl-O-isopropyl esters of amino acids obtained from the hydrolysis of milk and hair proteins. The δ(15)N and δ(13)C (‰) were found to be significantly higher in infant hair than in breast milk (δ(15)N, P amino acids in infant hair was also significantly higher than that in maternal milk (P < 0.001). By calculation, the observed shift in isotope ratio was shown not to be accounted for by the amino acid composition of hair and milk proteins, indicating that it is not simply due to differences in the composition in the proteins present. Rather, it would appear that each pool-mother and infant-turns over independently, and that fractionation in infant N-metabolism even in the first month of life dominates over the nutrient N-content.

Activity coefficients at infinite dilution of organic solutes in the ionic liquid trihexyl(tetradecyl)phosphonium tetrafluoroborate using gas-liquid chromatography at T = (313.15, 333.15, 353.15, and 373.15) K

International Nuclear Information System (INIS)

Tumba, Kaniki; Reddy, Prashant; Naidoo, Paramespri; Ramjugernath, Deresh

2011-01-01

Research highlights: → Activity coefficients at infinite dilution in the ionic liquid [3C 6 C 14 P][BF 4 ]. → Twenty-seven solutes investigated at T = (313.15, 333.15, 353.15, and 373.15) K. → [3C 6 C 14 P][BF 4 ] shows promise for the separation of aromatic and alcohol mixtures. - Abstract: Activity coefficients at infinite dilution have been measured by gas-liquid chromatography for 27 organic solutes (n-alkanes, 1-alkenes, 1-alkynes, cycloalkanes, aromatics, alcohols, and ketones) in the ionic liquid trihexyl(tetradecyl)phosphonium tetrafluoroborate [3C 6 C 14 P][BF 4 ]. The measurements were carried out at four different temperatures viz.T = (313.15, 333.15, 353.15, and 373.15) K. From the experimental data, partial molar excess enthalpy values at infinite dilution were calculated for the experimental temperature range. The selectivity values for the separation of n-hexane/benzene, cyclohexane/benzene, and methanol/benzene mixtures were determined from the experimental infinite dilution activity coefficient values. These values were compared to those available in the literature for other ionic liquids and commercial solvents, so as to assess the feasibility of employing [3C 6 C 14 P][BF 4 ] in solvent-enhanced industrial separations.

Natural abundances of 15N and 13C in leaves of some N2- fixing and non N2- fixing trees and shrubs in Syria

International Nuclear Information System (INIS)

Kurdali, F.; Al-Shamma'a, M.

2010-01-01

A survey study was conducted on man-made plantations located at two different areas in the arid region of Syria to determine the variations in natural abundances of the 12 N and 13 C isotopes in leaves of several woody legume and non-legume species, and to better understand the consequence of such variations on nitrogen fixation and carbon assimilation. In the first study area (non-saline soil), the δ 15 N values in four legume species (Acacia cyanopylla, -1.73 %; Acacia farnesiana, -0.55%; Prosopis juliflora, -1.64%, and Medicago arborea, +1.6%) and one actinorhizal plant (Elaeagnus angustifolia, -0.46 to -2.1%) were found to be close to that of the atmospheric value pointing to a major contribution of N 2 fixing in these species; whereas, δ 15 N values of the non-fixing plant species were highly positive.δ 13 C% in leaves of the C 3 plants were found to be affected by plant species, ranging from a minimum of -28.67% to a maximum of -23%. However, they were relatively similar within each plant species although they were grown at different sites. In the second study area (salt affected soil) a higher carbon discrimination value (Δ 3 C%) was exhibited by Prosopis juliflora indicating that the latter is a salt tolerant species; however, its δ 15 N was highly positive (+7.03%) suggesting a negligible contribution of the fixed N 2 . Hence, it was concluded that the enhancement of N 2 fixation might be achieved by selection of salt-tolerant rhizobium strains. (author)

Methodological investigation on the use of 14C-leucine and 15N-leucine for studying the absorption of amino acids in the experimental rat

International Nuclear Information System (INIS)

Bergner, H.; Bergner, U.; Adam, K.

1980-01-01

After nine days of adaptation to a whole-egg diet, albino rats were given 14 C-U-L-leucine and 15 N-L-leucine in addition by the oral route. Each rat received the labelled leucine via a pellet made from the whole-egg diet after food deprivation for 15 h. Thereafter, the experimental animals consumed the unlabelled experimental diet ad libitum. Four times, 30 min, and 1, 2, 4 and 8 h after ingestion of the labelled food, four experimental rats were sacrificed. The contents of the digestive tract and tissue samples were examined for 14 C and 15 N. The halftime of disappearance of the 14 C activity and of the 15 N excess from the TCA-soluble fraction of the gastric contents lay between 1.9 and 2.2 h. Up to the fourth hour of experiment, the 15 N level of the TCA-soluble fraction of the gastric contents was high. The free leucine is obviously absorbed in the stomach and is used for the synthesis of enzyme protein and mucoproteides. In the TCA-soluble fraction of the total contents of the small intestine, the following values (expressed as percentages of the total amounts ingested at the times of measurement) were found: 14 C = 2.0; 6.5; 9.6; 7.4 and 1.5; 15 N excess = 0.8; 1.2; 1.6; 1.6 and 1.2 Were these values regarded as non-absorbed leucine, the 14 C values obtained during the one-to-four hour period of experiment would unequivocally be too high. Presumably, they are simulated by other 14 C-metabolites which originate from the leucine catabolism and reach the intestinal lumen through the intestinal wall. Amino acids labelled with 15 N should be preferred in studies on the absorption of amino acids because, in case of catabolization, the 15 N-amino group is excreted mainly in the form of urea. 14 C-amino acids can be recommended for such studies only if the specific 14 C activity of the amino acid used is also measured. (author)

Benchmark fragment-based 1H, 13C, 15N and 17O chemical shift predictions in molecular crystals†

Science.gov (United States)

Hartman, Joshua D.; Kudla, Ryan A.; Day, Graeme M.; Mueller, Leonard J.; Beran, Gregory J. O.

2016-01-01

The performance of fragment-based ab initio 1H, 13C, 15N and 17O chemical shift predictions is assessed against experimental NMR chemical shift data in four benchmark sets of molecular crystals. Employing a variety of commonly used density functionals (PBE0, B3LYP, TPSSh, OPBE, PBE, TPSS), we explore the relative performance of cluster, two-body fragment, and combined cluster/fragment models. The hybrid density functionals (PBE0, B3LYP and TPSSh) generally out-perform their generalized gradient approximation (GGA)-based counterparts. 1H, 13C, 15N, and 17O isotropic chemical shifts can be predicted with root-mean-square errors of 0.3, 1.5, 4.2, and 9.8 ppm, respectively, using a computationally inexpensive electrostatically embedded two-body PBE0 fragment model. Oxygen chemical shieldings prove particularly sensitive to local many-body effects, and using a combined cluster/fragment model instead of the simple two-body fragment model decreases the root-mean-square errors to 7.6 ppm. These fragment-based model errors compare favorably with GIPAW PBE ones of 0.4, 2.2, 5.4, and 7.2 ppm for the same 1H, 13C, 15N, and 17O test sets. Using these benchmark calculations, a set of recommended linear regression parameters for mapping between calculated chemical shieldings and observed chemical shifts are provided and their robustness assessed using statistical cross-validation. We demonstrate the utility of these approaches and the reported scaling parameters on applications to 9-tertbutyl anthracene, several histidine co-crystals, benzoic acid and the C-nitrosoarene SnCl2(CH3)2(NODMA)2. PMID:27431490

Benchmark fragment-based (1)H, (13)C, (15)N and (17)O chemical shift predictions in molecular crystals.

Science.gov (United States)

Hartman, Joshua D; Kudla, Ryan A; Day, Graeme M; Mueller, Leonard J; Beran, Gregory J O

2016-08-21

The performance of fragment-based ab initio(1)H, (13)C, (15)N and (17)O chemical shift predictions is assessed against experimental NMR chemical shift data in four benchmark sets of molecular crystals. Employing a variety of commonly used density functionals (PBE0, B3LYP, TPSSh, OPBE, PBE, TPSS), we explore the relative performance of cluster, two-body fragment, and combined cluster/fragment models. The hybrid density functionals (PBE0, B3LYP and TPSSh) generally out-perform their generalized gradient approximation (GGA)-based counterparts. (1)H, (13)C, (15)N, and (17)O isotropic chemical shifts can be predicted with root-mean-square errors of 0.3, 1.5, 4.2, and 9.8 ppm, respectively, using a computationally inexpensive electrostatically embedded two-body PBE0 fragment model. Oxygen chemical shieldings prove particularly sensitive to local many-body effects, and using a combined cluster/fragment model instead of the simple two-body fragment model decreases the root-mean-square errors to 7.6 ppm. These fragment-based model errors compare favorably with GIPAW PBE ones of 0.4, 2.2, 5.4, and 7.2 ppm for the same (1)H, (13)C, (15)N, and (17)O test sets. Using these benchmark calculations, a set of recommended linear regression parameters for mapping between calculated chemical shieldings and observed chemical shifts are provided and their robustness assessed using statistical cross-validation. We demonstrate the utility of these approaches and the reported scaling parameters on applications to 9-tert-butyl anthracene, several histidine co-crystals, benzoic acid and the C-nitrosoarene SnCl2(CH3)2(NODMA)2.

Dual element ((15)N/(14)N, (13)C/(12)C) isotope analysis of glyphosate and AMPA by derivatization-gas chromatography isotope ratio mass spectrometry (GC/IRMS) combined with LC/IRMS.

Science.gov (United States)

Mogusu, Emmanuel O; Wolbert, J Benjamin; Kujawinski, Dorothea M; Jochmann, Maik A; Elsner, Martin

2015-07-01

To assess sources and degradation of the herbicide glyphosate [N-(phosphonomethyl) glycine] and its metabolite AMPA (aminomethylphosphonic acid), concentration measurements are often inconclusive and even (13)C/(12)C analysis alone may give limited information. To advance isotope ratio analysis of an additional element, we present compound-specific (15)N/(14)N analysis of glyphosate and AMPA by a two step derivatization in combination with gas chromatography/isotope ratio mass spectrometry (GC/IRMS). The N-H group was derivatized with isopropyl chloroformate (iso-PCF), and remaining acidic groups were subsequently methylated with trimethylsilyldiazomethane (TMSD). Iso-PCF treatment at pH 10 indicated decomposition of the derivative. At pH 10, and with an excess of iso-PCF by 10-24, greatest yields and accurate (15)N/(14)N ratios were obtained (deviation from elemental analyzer-IRMS: -0.2 ± 0.9% for glyphosate; -0.4 ± 0.7% for AMPA). Limits for accurate δ(15)N analysis of glyphosate and AMPA were 150 and 250 ng injected, respectively. A combination of δ(15)N and δ(13)C analysis by liquid chromatography/isotope ratio mass spectrometry (LC/IRMS) (1) enabled an improved distinction of commercial glyphosate products and (2) showed that glyphosate isotope values during degradation by MnO2 clearly fell outside the commercial product range. This highlights the potential of combined carbon and nitrogen isotopes analysis to trace sources and degradation of glyphosate.

Simple approach for the preparation of 15-15N2-enriched water for nitrogen fixation assessments: Evaluation, application and recommendations

Directory of Open Access Journals (Sweden)

Isabell eKlawonn

2015-08-01

Full Text Available Recent findings revealed that the commonly used 15N2 tracer assay for the determination of dinitrogen (N2 fixation can underestimate the activity of aquatic N2-fixing organisms. Therefore, a modification to the method using pre-prepared 15-15N2-enriched water was proposed. Here, we present a rigorous assessment and outline a simple procedure for the preparation of 15-15N2-enriched water. We recommend to fill sterile-filtered water into serum bottles and to add 15-15N2 gas to the water in amounts exceeding the standard N2 solubility, followed by vigorous agitation (vortex mixing ≥5 min. Optionally, water can be degassed at low-pressure (≥950 mbar for ten minutes prior to the 15-15N2 gas addition to indirectly facilitate the 15-15N2 dissolution. This preparation of 15-15N2-enriched water can be done within one hour using standard laboratory equipment. The final 15N-atom% excess was 5% after replacing 2–5% of the incubation volume with 15-15N2-enriched water. Notably, the addition of 15-15N2-enriched water can alter levels of trace elements in the incubation water due to the contact of 15-15N2-enriched water with glass, plastic and rubber ware during its preparation. In our tests, levels of trace elements (Fe, P, Mn, Mo, Cu, Zn increased by up to 0.1 nmol L-1 in the final incubation volume, which may bias rate measurements in regions where N2 fixation is limited by trace elements. For these regions, we tested an alternative way to enrich water with 15-15N2. The 15-15N2 was injected as a bubble directly to the incubation water, followed by gentle shaking. Immediately thereafter, the bubble was replaced with water to stop the 15-15N2 equilibration. This method achieved a 15N-atom excess of 6.6±1.7% when adding 2 mL 15-15N2 per liter of incubation water. The herein presented methodological tests offer guidelines for the 15N2 tracer assay and thus, are crucial to circumvent methodological draw-backs for future N2 fixation assessments.

Uniform 15N- and 15N/13C-labeling of proteins in mammalian cells and solution structure of the amino terminal fragment of u-PA

International Nuclear Information System (INIS)

Hansen, A.P.; Petros, A.M.; Meadows, R.P.; Mazar, A.P.; Nettesheim, D.G.; Pederson, T.M.; Fesik, S.W.

1994-01-01

Urokinase-type plasminogen activator (u-PA) is a 54-kDa glycoprotein that catalyzes the conversion of plasminogen to plasmin, a broad-specificity protease responsible for the degradation of fibrin clots and extracellular matrix components. The u-PA protein consists of three individual modules: a growth factor domain (GFD), a kringle, and a serine protease domain. The amino terminal fragment (ATF) includes the GFD-responsible for u-PA binding to its receptor-and the kringle domains. This protein was expressed and uniformly 15 N-and 15 N/ 13 C-labeled in mammalian cells by methods that will be described. In addition, we present the three-dimensional structure of ATF that was derived from 1299 NOE-derived distance restraints along with the φ angle and hydrogen bonding restraints. Although the individual domains in the structures were highly converged, the two domains are structurally independent. The overall structures of the individual domains are very similar to the structures of homologous proteins. However, important structural differences between the growth factor domain of u-PA and other homologous proteins were observed in the region that has been implicated in binding the urokinase receptor. These results may explain, in part, why other growth factors show no appreciable affinity for the urokinase receptor

15N liver function tests - concept, validity, clinical use

International Nuclear Information System (INIS)

Faust, H.; Jung, K.; Krumbiegel, P.; Hirschberg, K.; Reinhardt, R.; Junghans, P.

1987-01-01

Several liver function tests using the oral application of a nitrogen compound labelled with 15 N and the subsequent determination of 15 N in a certain fraction of urine by emission spectrometry are described. Because of the key position of the liver in the metabolism of nitrogen compounds the results of these tests allow conclusions concerning disturbances of special liver functions. Instructions for the clinical use of the '[ 15 N]Ammonium Test', '[ 15 N]Hippurate Test' the '[ 15 N]Methacetin Test', and the '[ 15 N]Glycine Test' are given. (author)

Alteration of /sup 15/N//sup 14/N and /sup 13/C//sup 12/C ratios of plant matter during the initial stages of diagenesis: studies utilizing archaeological specimens from Peru

Energy Technology Data Exchange (ETDEWEB)

DeNiro, M J [California Univ., Los Angeles (USA). Dept. of Earth and Space Sciences; Hastorf, C A [California Univ., Los Angeles (USA). Dept. of Anthropology

1985-01-01

The stable carbon and nitrogen isotope ratios of plants extracted from Peruvian archaeological sites, ranging in age from 400 to 4000 years B.P., have been measured. The delta/sup 13/C and delta/sup 15/N values of prehistoric plants that were carbonized prior to deposition are similar to those of modern plants which have the same carbon dioxide fixation or nitrogen assimilation mechanisms. In contrast, the delta/sup 15/N values of prehistoric plants that were not carbonized are generally 10 to 20 per mille and as much as 35 per mille more positive than those of their modern counterparts. The delta/sup 13/C and delta/sup 15/N values of different parts of prehistoric uncarbonized plants differ by as much as 8 per mille and 21 per mille respectively, whereas the same parts of modern plants have delta/sup 13/C or delta/sup 15/N values that lie within 2 per mille of one another. SEM analysis eliminated the possibility that diagenetic alteration of the isotope ratios of the prehistoric uncarbonized plants was caused by the adsorption of particulate soil matter. The results are discussed.

Sub-cellular localisation of a 15N-labelled peptide vector using NanoSIMS imaging

Science.gov (United States)

Römer, Winfried; Wu, Ting-Di; Duchambon, Patricia; Amessou, Mohamed; Carrez, Danièle; Johannes, Ludger; Guerquin-Kern, Jean-Luc

2006-07-01

Dynamic SIMS imaging is proposed to map sub-cellular distributions of isotopically labelled, exogenous compounds. NanoSIMS imaging allows the characterisation of the intracellular transport pathways of exogenous molecules, including peptide vectors employed in innovative therapies, using stable isotopes as molecular markers to detect the compound of interest. Shiga toxin B-subunit (STxB) was chosen as a representative peptide vector. The recombinant protein ( 15N-STxB) was synthesised in Escherichia coli using 15NH 4Cl as sole nitrogen source resulting in 15N enrichment in the molecule. Using the NanoSIMS 50 ion microprobe (Cameca), different ion species ( 12C 14N -, 12C 15N -, 31P -) originating from the same sputtered micro volume were simultaneously detected. High mass resolving power enabled the discrimination of 12C 15N - from its polyatomic isobars of mass 27. We imaged the membrane binding and internalisation of 15N-STxB in HeLa cells at spatial resolutions of less than 100 nm. Thus, the use of rare stable isotopes like 15N with dynamic SIMS imaging permits sub-cellular detection of isotopically labelled, exogenous molecules and imaging of their transport pathways at high mass and spatial resolution. Application of stable isotopes as markers can replace the large and chemically complex tags used for fluorescence microscopy, without altering the chemical and physical properties of the molecule.

Nitrogen turnover of three different agricultural soils determined by 15N triple labelling

Science.gov (United States)

Fiedler, Sebastian R.; Kleineidam, Kristina; Strasilla, Nicol; Schlüter, Steffen; Reent Köster, Jan; Well, Reinhard; Müller, Christoph; Wrage-Mönnig, Nicole

2017-04-01

To meet the demand for data to improve existing N turnover models and to evaluate the effect of different soil physical properties on gross nitrogen (N) transformation rates, we investigated two arable soils and a grassland soil after addition of ammonium nitrate (NH4NO3), where either ammonium (NH4+), or nitrate (NO3-), or both pools have been labelled with 15N at 60 atom% excess (triple 15N tracing method). Besides NH4+, NO3- and nitrite (NO2-) contents with their respective 15N enrichment, nitrous oxide (N2O) and dinitrogen (N2) fluxes have been determined. Each soil was adjusted to 60 % of maximum water holding capacity and pre-incubated at 20˚ C for two weeks. After application of the differently labelled N fertilizer, the soils were further incubated at 20˚ C under aerobic conditions in a He-N2-O2 atmosphere (21 % O2, 76 He, 2% N2) to increase the sensitivity of N2 rates via the 15N gas flux method. Over a 2 week period soil N pools were quantified by 2 M KCl extraction (adjusted to pH 7 to prevent nitrite losses) (Stevens and Laughlin, 1995) and N gas fluxes were measured by gas chromatography in combination with IRMS. Here, we present the pool sizes and fluxes as well as the 15N enrichments during the study. Results are discussed in light of the soil differences that were responsible for the difference in gross N dynamics quantified by the 15N tracing model Ntrace (Müller et al., 2007). References Müller, C., T. Rütting, J. Kattge, R.J. Laughlin, and R.J. Stevens, (2007) Estimation of parameters in complex 15N tracing models by Monte Carlo sampling. Soil Biology & Biochemistry. 39(3): p. 715-726. Stevens, R.J. and R.J. Laughlin, (1995) Nitrite transformations during soil extraction with potassium chloride. Soil Science Society of America Journal. 59(3): p. 933-938.

15N-Labelling and structure determination of adamantylated azolo-azines in solution

Directory of Open Access Journals (Sweden)

Sergey L. Deev

2017-11-01

Full Text Available Determining the accurate chemical structures of synthesized compounds is essential for biomedical studies and computer-assisted drug design. The unequivocal determination of N-adamantylation or N-arylation site(s in nitrogen-rich heterocycles, characterized by a low density of hydrogen atoms, using NMR methods at natural isotopic abundance is difficult. In these compounds, the heterocyclic moiety is covalently attached to the carbon atom of the substituent group that has no bound hydrogen atoms, and the connection between the two moieties of the compound cannot always be established via conventional 1H-1H and 1H-13C NMR correlation experiments (COSY and HMBC, respectively or nuclear Overhauser effect spectroscopy (NOESY or ROESY. The selective incorporation of 15N-labelled atoms in different positions of the heterocyclic core allowed for the use of 1H-15N (JHN and 13C-15N (JCN coupling constants for the structure determinations of N-alkylated nitrogen-containing heterocycles in solution. This method was tested on the N-adamantylated products in a series of azolo-1,2,4-triazines and 1,2,4-triazolo[1,5-a]pyrimidine. The syntheses of adamantylated azolo-azines were based on the interactions of azolo-azines and 1-adamatanol in TFA solution. For azolo-1,2,4-triazinones, the formation of mixtures of N-adamantyl derivatives was observed. The JHN and JCN values were measured using amplitude-modulated 1D 1H spin-echo experiments with the selective inversion of the 15N nuclei and line-shape analysis in the 1D 13С spectra acquired with selective 15N decoupling, respectively. Additional spin–spin interactions were detected in the 15N-HMBC spectra. NMR data and DFT (density functional theory calculations permitted to suggest a possible mechanism of isomerization for the adamantylated products of the azolo-1,2,4-triazines. The combined analysis of the JHN and JCN couplings in 15N-labelled compounds provides an efficient method for the structure

40 CFR 721.6505 - Polymers of C13C15 oxoalcohol ethoxolates.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymers of C13C15 oxoalcohol... Specific Chemical Substances § 721.6505 Polymers of C13C15 oxoalcohol ethoxolates. (a) Chemical substance... polymers of C13C15 oxoalcohol ethoxolates (PMNs P-96-950/951) are subject to reporting under this section...

Effects of arbuscular mycorrhizal fungi on gas exchange and stable isotope ratio of δ13C, δ15N of leymus chinensis plant

International Nuclear Information System (INIS)

Shi Weiqi; Wang Guoan; Li Xiaolin

2008-01-01

Leymus chinensis, one of dominant species in Inner Mongolia grassland, was selected to evaluate the effects of arbuscular mycorrhizal fungi (AMF) on plant gas change parameters and stable isotope ratio in pot culture. The plant was inoculated with two mycorrhizal fungi, Glomus intraradices and Glomus claroidum, and the uninoculated plant was used as the control check. On the 45th , 60th , 75th days after sowing, gas exchange parameters and stable isotope ratio were measured. The results showed that AM infection promoted phosphoms content, stomatal conductance and photosynthetic rate of Leymus chinensis, reduced host δ 15 N, however, it did not influence host intrinsic water using efficiency and δ 13 C. It was the growth time that significantly affected the gas exchange and stable isotope ratio of δ 13 C and δ 15 N. And the interaction of inoculation and growth time also influenced on the net photosynthetic rate, δ 13 C and δ 15 N of the host. Stomatal conductance and photosynthetic rate were always changed the same direction by arbuscular mycorrhizal fungi causing no significant difference between mycorrhizal and non-mycorrhizal plant. AMF absorbed nitrogen and accumulated δ 15 N, thus, it transformed less 15 N into the host, and as a result, the mycorrhizal plant had lower δ 15 N. Therefore, the results gave a new way and reference to know of the grass balance of carbon gain and water cost and the nitrogen cycle in grassland. (authors)

Sequence-specific {sup 1}H, {sup 13}C, and {sup 15}N resonance assignments for intestinal fatty-acid-binding protein complexed with palmitate (15.4 kDA)

Energy Technology Data Exchange (ETDEWEB)

Hodsdon, M.E.; Toner, J.J.; Cistola, D.P. [Washington Univ. School of Medicine, St. Louis, MO (United States)

1994-12-01

Intestinal fatty-acid-binding protein (I-FABP) belongs to a family of soluble, cytoplasmic proteins that are thought to function in the intracellular transport and trafficking of polar lipids. Individual members of this protein family have distinct specificities and affinities for fatty acids, cholesterol, bile salts, and retinoids. We are comparing several retinol- and fatty-acid-binding proteins from intestine in order to define the factors that control molecular recognition in this family of proteins. We have established sequential resonance assignments for uniformly {sup 13}C/{sup 15}N-enriched I-FABP complexed with perdeuterated palmitate at pH7.2 and 37{degrees}C. The assignment strategy was similar to that introduced for calmodulin. We employed seven three-dimensional NMR experiments to establish scalar couplings between backbone and sidechain atoms. Backbone atoms were correlated using triple-resonance HNCO, HNCA, TOCSY-HMQC, HCACO, and HCA(CO)N experiments. Sidechain atoms were correlated using CC-TOCSY, HCCH-TOCSY, and TOCSY-HMQC. The correlations of peaks between three-dimensional spectra were established in a computer-assisted manner using NMR COMPASS (Molecular Simulations, Inc.) Using this approach, {sup 1}H, {sup 13}C, and {sup 15}N resonance assignments have been established for 120 of the 131 residues of I-FABP. For 18 residues, amide {sup 1}H and {sup 15}N resonances were unobservable, apparently because of the rapid exchange of amide protons with bulk water at pH 7.2. The missing amide protons correspond to distinct amino acid patterns in the protein sequence, which will be discussed. During the assignment process, several sources of ambiguity in spin correlations were observed. To overcome this ambiguity, the additional inter-residue correlations often observed in the HNCA experiment were used as cross-checks for the sequential backbone assignments.

Changes in leaf δ13C and δ15N for three Mediterranean tree species in relation to soil water availability

Science.gov (United States)

Ogaya, Romà; Peñuelas, Josep

2008-11-01

A rain exclusion experiment simulating drought conditions expected in Mediterranean areas for the following decades (15% decrease in soil moisture) was conducted in a Mediterranean holm oak forest to study the response of leaf δ13C, δ15N, and N concentrations to the predicted climatic changes for the coming decades. Plant material was sampled in 2000, 2003, 2004, and 2005 in eight plots: four of them were control plots and the other four plots received the rain exclusion treatment. Although there was a negative relationship between δ13C and soil moisture, for each species and year, the rain exclusion treatment did not have any significant effect on δ13C, and therefore on the intrinsic water use efficiency (iWUE) of the three dominant species: Phillyrea latifolia, Arbutus unedo, and Quercus ilex. On the other hand, rain exclusion clearly increased the δ15N values in the three species studied, probably indicating higher N losses at the soil level leading to a 15N enrichment of the available N. It suggested that rain exclusion exerted a greater effect on the nitrogen biogeochemical cycle than on the carbon assimilation process. δ15N values were inversely correlated with summer soil moisture in Q. ilex and A. unedo, but no relationship was observed in P. latifolia. This latter species showed the lowest iWUE values, but it was the only species with no decrease in annual basal increment in response to the rain exclusion treatment, and it also had the highest resistance to the hot and dry conditions projected for the Mediterranean basin in the coming decades. The different strategies to resist rain exclusion conditions of these species could induce changes in their competitive ability and future distribution. The losses of N from the ecosystem may further limit plant growth and ecosystem functioning.

Auto-inducing media for uniform isotope labeling of proteins with {sup 15}N, {sup 13}C and {sup 2}H

Energy Technology Data Exchange (ETDEWEB)

Guthertz, Nicolas [Institute of Cancer Research, Division of Structural Biology (United Kingdom); Klopp, Julia; Winterhalter, Aurélie; Fernández, César; Gossert, Alvar D., E-mail: alvar.gossert@novartis.com [Novartis Institutes for BioMedical Research (Switzerland)

2015-06-15

Auto-inducing media for protein expression offer many advantages like robust reproducibility, high yields of soluble protein and much reduced workload. Here, an auto-inducing medium for uniform isotope labelling of proteins with {sup 15}N, {sup 13}C and/or {sup 2}H in E. coli is presented. So far, auto-inducing media have not found widespread application in the NMR field, because of the prohibitively high cost of labeled lactose, which is an essential ingredient of such media. Here, we propose using lactose that is only selectively labeled on the glucose moiety. It can be synthesized from inexpensive and readily available substrates: labeled glucose and unlabeled activated galactose. With this approach, uniformly isotope labeled proteins were expressed in unattended auto-inducing cultures with incorporation of {sup 13}C, {sup 15}N of 96.6 % and {sup 2}H, {sup 15}N of 98.8 %. With the present protocol, the NMR community could profit from the many advantages that auto-inducing media offer.

Study of the reaction π-p→ωn in the 15-40 GeV/c momentum range

International Nuclear Information System (INIS)

Saleem, M.; Shaukat, M.A.

1981-08-01

Recent measurements of differential cross sections and density matrix elements for the reaction π - p→ωn in the 15-40 GeV/c momentum range and for 0 2 have been fitted by using a simple Regge pole model with phenomenological residue functions. (author)

Patterns of δ13C and δ15N in wolverine Gulo gulo tissues from the Brooks Range, Alaska

Directory of Open Access Journals (Sweden)

Fredrik DALERUM

2009-06-01

Full Text Available Knowledge of carnivore diets is essential to understand how carnivore populations respond demographically to variations in prey abundance. Analysis of stable isotopes is a useful complement to traditional methods of analyzing carnivore diets. We used data on d13C and d15N in wolverine tissues to investigate patterns of seasonal and annual diet variation in a wolverine Gulo gulo population in the western Brooks Range, Alaska, USA. The stable isotope ratios in wolverine tissues generally reflected that of terrestrial carnivores, corroborating previous diet studies on wolverines. We also found variation in d13C and d15N both between muscle samples collected over several years and between tissues with different assimilation rates, even after correcting for isotopic fractionation. This suggests both annual and seasonal diet variation. Our results indicate that data on d13C and d15N holds promise for qualitative assessments of wolverine diet changes over time. Such temporal variation may be important indicators of ecological responses to environmental perturbations, and we suggest that more refined studies of stable isotopes may be an important tool when studying temporal change in diets of wolverines and similar carnivores [Current Zoology 55(3: 188–192, 2009].

Prototropic tautomerism of 5-nitrobenzimidazole derivatives in {sup 1}H, {sup 13}C and {sup 15}N NMR spectra; Tautomeria prototropowa pochodnych 5-nitrobenzimidazolu w widmach {sup 1}H, {sup 13}C, {sup 15}N NMR

Energy Technology Data Exchange (ETDEWEB)

Wiench, J W; Bocian, W; Stefaniak, L [Inst. Chemii Organicznej, Polska Akademia Nauk, Warsaw (Poland)

1994-12-31

NMR spectra of 5-nitrobenzimidazole derivatives in DMSO solution show the fast exchange of protons. The line broadening in {sup 1}H,{sup 13}C and {sup 15}N spectra have been observed. The interpretation of the spectra has been done basing on chemical shifts values and couplings between nuclei in the investigated derivatives. 3 refs, 2 figs, 3 tabs.

Methods of 15N tracer research in biological systems

International Nuclear Information System (INIS)

Hirschberg, K.; Faust, H.

1985-01-01

The application of the stable isotope 15 N is of increasing importance in different scientific disciplines, especially in medicine, agriculture, and the biosciences. The close correlation between the growing interest and improvements of analytical procedures resulted in remarkable advances in the 15 N tracer technique. On the basis of the latest results of 15 N tracer research in life sciences and agriculture methods of 15 N tracer research in biological systems are compiled. The 15 N methodology is considered under three headings: Chemical analysis with a description of methods of sample preparation (including different separation and isolation methods for N-containing substances of biological and agricultural origin) and special procedures converting ammonia to molecular nitrogen. Isotopic analysis with a review on the most important methods of isotopic analysis of nitrogen: mass spectrometry (including the GC-MS technique), emission spectrometry, NMR spectroscopy, and other analytical procedures. 15 N-tracer techniques with a consideration of the role of the isotope dilution analysis as well as different labelling techniques and the mathematical interpretation of tracer data (modelling, N turnover experiments). In these chapters also sources of errors in chemical and isotopic analysis, the accuracy of the different methods and its importance on tracer experiments are discussed. Procedures for micro scale 15 N analysis and aspects of 15 N analysis on the level of natural abundance are considered. Furthermore some remarks on isotope effects in 15 N tracer experiments are made. (author)

Clinical-scale investigation of stable isotopes in human blood: delta13C and delta15N from 406 patients at the Johns Hopkins Medical Institutions.

Science.gov (United States)

Kraft, Rebecca A; Jahren, A Hope; Saudek, Christopher D

2008-11-01

Objective chemical biomarkers are needed in clinical studies of diet-related diseases to supplement subjective self-reporting methods. We report on several critical experiments for the development of clinically legitimate dietary stable isotope biomarkers within human blood. Our examination of human blood revealed the following: (1) Within blood clot and serum from anonymous individuals (201 males, 205 females) we observed: mean serum delta13C = -19.1 +/- 0.8 per thousand (standard deviation, SD); clot, -19.3 +/- 0.8 per thousand (SD); range = -15.8 per thousand to -23.4 per thousand. Highly statistically significant differences are observed between clot and serum, males and females for both clot and serum. For 15N (n = 206), mean serum = +8.8 +/- 0.5 per thousand (SD); clot +7.4 +/- 0.4 per thousand (SD); range = +6.3 per thousand to +10.5 per thousand. Blood serum is enriched in 15N relative to blood clot by +1.4 per thousand on average, which may reflect differing protein amino acid content. Serum nitrogen is statistically significantly different for males and females, however, clot shows no statistical difference. (2) Relative to clot, capillary blood is marginally different for 13C, but not 15N. Clot 13C is not significantly different from serum; however, it is depleted in 15N by 1.5 per thousand relative to serum. (3) We assessed the effect of blood additives (sodium fluoride and polymerized acrylamide resin) and laboratory process (autoclaving, freeze drying) commonly used to preserve or prepare venous blood. On average, no alteration in delta13C or delta15N is detected compared with unadulterated blood from the same individual. (4) Storage of blood with and without the additives described above for a period of up to 115 days exhibits statistically significant differences for 13C and 15N for sodium fluoride. However, storage for unadulterated blood and blood preserved with polymerized acrylamide resin does not change the delta13C or delta15N isotopic

Studies of liver-specific metabolic reactions with /sup 15/N. 1. Metabolism of /sup 15/N-ammonium chloride in pigs

Energy Technology Data Exchange (ETDEWEB)

Hirschberg, K; Jung, K; Faust, H; Matkowitz, R

1987-07-01

The /sup 15/N tracer technique was used to investigate liver-specific reactions (urea and hippurate synthesis) for studying the metabolism in the healthy and damaged pig liver. After (/sup 15/N)ammonium chloride administration the tracer distribution on non-protein compounds of serum and urine was followed. Blood samplings before and after liver passage rendered possible a direct analysis of the (/sup 15/N)ammonium metabolism. The thioacetamide-induced liver damage was used as model for an acute liver intoxication. The capacity for urea synthesis was not influenced by means of this noxious substance, but the metabolism of amino acids and hippuric acid. The considerably depressed excretion of (/sup 15/N)hippurate seems to be a suitable indicator of liver disfunction.

The Contamination of Commercial 15N2 Gas Stocks with 15N–Labeled Nitrate and Ammonium and Consequences for Nitrogen Fixation Measurements

Science.gov (United States)

Dabundo, Richard; Lehmann, Moritz F.; Treibergs, Lija; Tobias, Craig R.; Altabet, Mark A.; Moisander, Pia H.; Granger, Julie

2014-01-01

We report on the contamination of commercial 15-nitrogen (15N) N2 gas stocks with 15N-enriched ammonium, nitrate and/or nitrite, and nitrous oxide. 15N2 gas is used to estimate N2 fixation rates from incubations of environmental samples by monitoring the incorporation of isotopically labeled 15N2 into organic matter. However, the microbial assimilation of bioavailable 15N-labeled N2 gas contaminants, nitrate, nitrite, and ammonium, is liable to lead to the inflation or false detection of N2 fixation rates. 15N2 gas procured from three major suppliers was analyzed for the presence of these 15N-contaminants. Substantial concentrations of 15N-contaminants were detected in four Sigma-Aldrich 15N2 lecture bottles from two discrete batch syntheses. Per mole of 15N2 gas, 34 to 1900 µmoles of 15N-ammonium, 1.8 to 420 µmoles of 15N-nitrate/nitrite, and ≥21 µmoles of 15N-nitrous oxide were detected. One 15N2 lecture bottle from Campro Scientific contained ≥11 µmoles of 15N-nitrous oxide per mole of 15N2 gas, and no detected 15N-nitrate/nitrite at the given experimental 15N2 tracer dilutions. Two Cambridge Isotopes lecture bottles from discrete batch syntheses contained ≥0.81 µmoles 15N-nitrous oxide per mole 15N2, and trace concentrations of 15N-ammonium and 15N-nitrate/nitrite. 15N2 gas equilibrated cultures of the green algae Dunaliella tertiolecta confirmed that the 15N-contaminants are assimilable. A finite-differencing model parameterized using oceanic field conditions typical of N2 fixation assays suggests that the degree of detected 15N-ammonium contamination could yield inferred N2 fixation rates ranging from undetectable, detected in field assays. These results indicate that past reports of N2 fixation should be interpreted with caution, and demonstrate that the purity of commercial 15N2 gas must be ensured prior to use in future N2 fixation rate determinations. PMID:25329300

Utilization of 15N-labelled urea in laying hens. 4

International Nuclear Information System (INIS)

Gruhn, K.; Hennig, A.

1986-01-01

In order to study the utilization of urea in poultry, 3 colostomized laying hybrids were orally supplied with a traditional ration supplemented with 1% 15 N'-labelled urea with a 15 N excess ( 15 N') of 96.06 atom-% over a period of 6 days. After another 2 days on which the hens received the same ration with unlabelled urea, they were killed. The atom-% 15 N' of the blood on an average of the 3 hens was 0.64, of the plasma 1.40 and of the corpuscles 0.47. The TCA-soluble fraction of the blood had an average 15 N' of 1.14 atom-%; the 15 N amount was 9.7% of the total amount of 15 N in the blood. The amount of 15 N' in the urea in the blood was 6.8 atom-%. This shows that the absorbed urea is decomposed very slowly. The quota of 15 N' in the basic amino acids from the total 15 N' of the blood plasma was only 0.3% and that of the corpuscles 2.2%. The average 15 N' of the mature follicles was 2.39 atom-% whereas the smallest and the remaining ovary contain 1.12 atom-%. The labelling level of lysine in mature egg cells was, in contrast to this, only 0.08 atom-% 15 N' and in infantile follicles 0.04 atom-% 15 N'. 1% of the 15 N' quota was in the follicles and the remaining ovary. Of the basic amino acids, histidine is most strongly labelled. The lower incorporation of the 15 N' from urea into the basic amino acids shows that the nitrogen of this compound can be used for the synthesis of the essential amino acids to a low degree only. (author)

Utilization of 15N-labelled urea in laying hens. 7

International Nuclear Information System (INIS)

Gruhn, K.

1987-01-01

3 colostomized laying hybrids received 1% 15 N-labelled urea with 96.06 atom-% 15 N excess ( 15 N') with a commercial ration over a period of 6 days. After the application of the same ration with unlabelled urea on the following 2 days the animals were butchered. In the muscles of breast, legs and heart, the labelling of total nitrogen and the incorporation of urea 15 N' into 15 amino acids of the 3 different kinds of muscles were ascertained. On average, significant differences could be ascertained between the atom-% 15 N of the muscles was 0.25 and 0.34 atom-%, resp.; that of the cardial proteins 0.71 atom-% 15 N'. The incorporation of urea 15 N into the basic amino acids is low and varies both between the kinds of muscles and between the amino acids. On average the highest level of labelling was found among the essential amino acids valine, isoleucine and leucine; the average atom-% 15 N' for the muscles of the breast is 0.13, of the leg 0.17, and of the heart 0.27; the 15 N' quota of branched Chain amino acids in the total 15 N' of the respective muscle is accordingly 6.0%, 5.0% and 4.5%. The non-essential amino acids, particularly glutamic acid, are more highly labelled in the muscles than the essential ones. A 15 N' for glutamic acid of 0.24 atom-% in the breast muscles, of 0.27 atom-% in those of the legs and of 0.64 atom-% in the heart muscle could be detected. The average quota of the 15 N' of these acid amino acids in the 15 N' for breast, leg and heart muscles is 7.4, 6.2 and 6.7, resp. The quota of the 15 N' in the 6 non-essential amino acids in the total 15 N' in all 3 kinds of muscles is approximately two thirds and in the 9 essential ones one third of the total 15 N'. Although the results show that there is a certain incorporation of 15 N' from urea into the amino acids of the muscle proteins, their contribution to meeting the demands is irrelevant. (author)

Seasonal changes in nitrogen availability, and root and microbial uptake of ¹⁵N¹³C₉-phenylalanine and ¹⁵N-ammonium in situ at a temperate heath

DEFF Research Database (Denmark)

Andresen, Louise C.; Michelsen, Anders; Jonasson, Sven Evert

2011-01-01

In the plant biosynthesis of secondary compounds, phenylalanine is a precursor of condensed tannins. Tannins are deposited into the soil in plant root exudates and dead plant material and have been suggested to precipitate some soil nutrients and hence reduce nutrient availability for plants. Free...... amino acid,inorganic and microbial N concentration during the growing season was investigated in an ecosystem with a natural tannin chemosphere. The influence of tannins on the uptake of nitrogen in plants and microbes was followed by injecting tannic acid (TA), ammonium-15N and phenylalanine-15N/13C9...

Mechanism of the reactions 14N(d,p)15N and 14N(d,n)15O by Doppler shift line shape method

International Nuclear Information System (INIS)

Abdel-Moneim, A.M.

1976-06-01

In this investigation the total and the differential absolute cross sections of the 14 N(d,p) 15 N reaction leading to excited states at 7.3, 8.3 and 9.05 MeV levels in 15 N and the 14 N(d,n) 15 O reaction leading to the 6.79 MeV level in 15 O, have been studied over the energy range from 0.5 MeV to 3 MeV. Doppler shift line shape method as well as γ-ray yield measurements have been used. The absolute cross sections are determined relative to the known 14 N(p,p) elastic differential cross sections. A comparison with previously determined values for the same reactions at selected energies shows good agreement in angular distribution as well as in absolute values. The total cross section for the d,p reaction shows a general energy dependence which is typical for direct reactions, but with minor contribution from compound nucleus formation at certain energy ranges. For the 14 N(d,n) 15 N reaction, the method applied is unique, since it allows the differential cross section to be studied all the way down to the threshold energy of deuterons at 2 MeV, with a detectorsystem efficiency which is constant over the entire range of neutron energies. The larger part of the energy range that has been investigated is dominated by a resonance at 2.55 π+ 0.05 MeV deuteron energy and a halfwidth depending on the amount of contribution from the direct reaction of the order of 200-400 keV. (JIW)

Stable isotope 15N-urea and clinical research in nephrology

International Nuclear Information System (INIS)

Sugino, Nobuhiro; Arai, Junko; Akimoto, Mitsuko; Miwa, Toichiro; Takuma, Takehide

1990-01-01

Stable isotope 15 N-compound, 15 N-urea, is useful marker to investigate nitrogen metabolism in clinical nephrology, particularly in chronic renal failure or dialysis. 15 N-urea incorporation into plasma albumin in addition to plasma 15 N disappearance was studied in 6 patients with endstage chronic renal failure. As a result, only minor fraction of administered 15 N-urea was incorporated into albumin in this study. In addition, it was also confirmed that high energy diet may promote protein synthesis through 15 N incorporation to plasma amino acids, such as alanine, in these patients with low protein meal. Therefore, administration of 15 N-compound to human subjects may contribute to provide us the important informations on nitrogen metabolism. For instance, urea kinetics are described in the endstage chronic renal failure in this review. However, less expensive 15 N-compounds should be provided and more simple but accurate measurement of 15 N activity should be developed for the further clinical application of the stable isotope. (author)

Determination of endogenous nitrogen in feces using 15N tracers

International Nuclear Information System (INIS)

Herrmann, U.; Krawielitzki, K.; Schadereit, R.; Smulikowska, S.

1986-01-01

A ration consisting of wheat gluten and N-free components was supplemented with L-lysine and L-leucine and fed to two groups of growing Wistar rats. Group 1 received 15 N Lys and unlabelled Leu, group 2 received unlabelled Lys and 15 N Leu in order to study the influence of the utilization of the 15 N marker on the labelling quota of feces and urine as well as various fractions of the body. The good utilization of Lys in group 1 results in a higher 15 N excess in feces and a reduced 15 N abundance in urine in comparison to group 2 with a lower utilization of 15 N Leu. The results show that the 15 N abundance in urine is unsuitable as an indicator of the 15 N labelling quota of endogenous metabolic fecal nitrogen. (author)

Constraints on oceanic N balance/imbalance from sedimentary 15N records

Directory of Open Access Journals (Sweden)

M. A. Altabet

2007-01-01

Full Text Available According to current best estimates, the modern ocean's N cycle is in severe deficit. N isotope budgeting provides an independent geochemical constraint in this regard as well as the only means for past reconstruction. Overall, it is the relative proportion of N2 fixation consumed by water column denitrification that sets average oceanic δ15N under steady-state conditions. Several factors (conversion of organic N to N2, Rayleigh closed and open system effects likely reduce the effective fractionation factor (ε for water column denitrification to about half the inherent microbial value for εden. If so, the average oceanic δ15N of ~5‰ is consistent with a canonical contribution from water column denitrification of 50% of the source flux from N2 fixation. If an imbalance in oceanic N sources and sinks changes this proportion then a transient in average oceanic δ15N would occur. Using a simple model, changing water column denitrification by ±30% or N2 fixation by ±15% produces detectable (>1‰ changes in average oceanic δ15N over one residence time period or more with corresponding changes in oceanic N inventory. Changing sedimentary denitrification produces no change in δ15N but does change N inventory. Sediment δ15N records from sites thought to be sensitive to oceanic average δ15N all show no detectible change over the last 3 kyr or so implying a balanced marine N budget over the latest Holocene. A mismatch in time scales is the most likely meaningful interpretation of the apparent conflict with modern flux estimates. Decadal to centennial scale oscillations between net N deficit and net surplus may occur but on the N residence timescale of several thousand years, net balance is achieved in sum. However, sediment δ15N records from the literature covering the period since the last glacial maximum show excursions of up to several ‰ that are consistent with sustained N deficit during the deglaciation followed by readjustment

Nicotine, acetanilide and urea multi-level 2H-, 13C- and 15N-abundance reference materials for continuous-flow isotope ratio mass spectrometry.

Science.gov (United States)

Schimmelmann, Arndt; Albertino, Andrea; Sauer, Peter E; Qi, Haiping; Molinie, Roland; Mesnard, François

2009-11-01

Accurate determinations of stable isotope ratios require a calibration using at least two reference materials with different isotopic compositions to anchor the isotopic scale and compensate for differences in machine slope. Ideally, the delta values of these reference materials should bracket the isotopic range of samples with unknown delta values. While the practice of analyzing two isotopically distinct reference materials is common for water (VSMOW-SLAP) and carbonates (NBS 19 and L-SVEC), the lack of widely available organic reference materials with distinct isotopic composition has hindered the practice when analyzing organic materials by elemental analysis/isotope ratio mass spectrometry (EA-IRMS). At present only L-glutamic acids USGS40 and USGS41 satisfy these requirements for delta13C and delta15N, with the limitation that L-glutamic acid is not suitable for analysis by gas chromatography (GC). We describe the development and quality testing of (i) four nicotine laboratory reference materials for on-line (i.e. continuous flow) hydrogen reductive gas chromatography-isotope ratio mass-spectrometry (GC-IRMS), (ii) five nicotines for oxidative C, N gas chromatography-combustion-isotope ratio mass-spectrometry (GC-C-IRMS, or GC-IRMS), and (iii) also three acetanilide and three urea reference materials for on-line oxidative EA-IRMS for C and N. Isotopic off-line calibration against international stable isotope measurement standards at Indiana University adhered to the 'principle of identical treatment'. The new reference materials cover the following isotopic ranges: delta2H(nicotine) -162 to -45 per thousand, delta13C(nicotine) -30.05 to +7.72 per thousand, delta15N(nicotine) -6.03 to +33.62 per thousand; delta15N(acetanilide) +1.18 to +40.57 per thousand; delta13C(urea) -34.13 to +11.71 per thousand, delta15N(urea) +0.26 to +40.61 per thousand (recommended delta values refer to calibration with NBS 19, L-SVEC, IAEA-N-1, and IAEA-N-2). Nicotines fill a gap as

The relative isotopic abundance (δ13C, δ15N) during composting of agricultural wastes in relation to compost quality and feedstock.

Science.gov (United States)

Inácio, Caio T; Magalhães, Alberto M T; Souza, Paulo O; Chalk, Phillip M; Urquiaga, Segundo

2018-05-01

Variations in the relative isotopic abundance of C and N (δ 13 C and δ 15 N) were measured during the composting of different agricultural wastes using bench-scale bioreactors. Different mixtures of agricultural wastes (horse bedding manure + legume residues; dairy manure + jatropha mill cake; dairy manure + sugarcane residues; dairy manure alone) were used for aerobic-thermophilic composting. No significant differences were found between the δ 13 C values of the feedstock and the final compost, except for dairy manure + sugarcane residues (from initial ratio of -13.6 ± 0.2 ‰ to final ratio of -14.4 ± 0.2 ‰). δ 15 N values increased significantly in composts of horse bedding manure + legumes residues (from initial ratio of +5.9 ± 0.1 ‰ to final ratio of +8.2 ± 0.5 ‰) and dairy manure + jatropha mill cake (from initial ratio of +9.5 ± 0.2 ‰ to final ratio of +12.8 ± 0.7 ‰) and was related to the total N loss (mass balance). δ 13 C can be used to differentiate composts from different feedstock (e.g. C 3 or C 4 sources). The quantitative relationship between N loss and δ 15 N variation should be determined.

Enrichment of 15N by ion exchange chromatography

International Nuclear Information System (INIS)

Ohwaki, Masao; Ohtsuka, Haruhisa; Nomura, Masao; Okamoto, Makoto; Fujii, Yasuhiko

1996-01-01

15 N isotope separation was studied using cation exchange resins which consist of functional groups: sulfonic acid, carboxylic acid and phenol at various concentration of the eluent LiOH. The isotope separation coefficients for these ion exchange resins were observed to be nearly equal, in spite of the large difference in ion exchange characteristics. The effect of flow rate on 15 N isotope separation was also studied, and the results indicate that the operation at high flow rate would be preferable for the industrial process of 15 N enrichment. Based on the preliminary investigations, a continuous operation using a series of ion exchange columns has been carried out in order to achieve high enrichment of 15 N. (author)

13C, 15N Resonance Assignment of Parts of the HET-s Prion Protein in its Amyloid Form

International Nuclear Information System (INIS)

Siemer, Ansgar B.; Ritter, Christiane; Steinmetz, Michel O.; Ernst, Matthias; Riek, Roland; Meier, Beat H.

2006-01-01

The partial 15 N and 13 C solid-state NMR resonance assignment of the HET-s prion protein fragment 218-289 in its amyloid form is presented. It is based on experiments measured at MAS frequencies in the range of 20-40 kHz using exclusively adiabatic polarization-transfer schemes. The resonance assignment within each residue is based on two-dimensional 13 C-- 13 C correlation spectra utilizing the DREAM mixing scheme. The sequential linking of the assigned residues used a set of two- and three-dimensional 15 N-- 13 C correlation experiments. Almost all cross peaks visible in the spectra are assigned, but only resonances from 43 of the 78 amino-acid residues could be detected. The missing residues are thought to be highly disordered and/or highly dynamic giving rise to broad resonance lines that escaped detection in the experiments applied. The line widths of the observed resonances are narrow and comparable to line widths observed in micro-crystalline samples. The 43 assigned residues are located in two fragments of about 20 residues

Variations in natural abundances of 15N and 13C in potassium fed lentil plants grown under water stress

International Nuclear Information System (INIS)

Kurdali, F.; Al-Shammaa, M.

2009-01-01

The impact of two K-fertilizer treatments [K0 (0) and K1 (150 kg K 2 O/ha)] on dry matter production and N 2 fixation (Ndfa) by Lentil (Lens culinaris.) was evaluated in a pot experiment. The plants were also subjected to three soil moisture regimes starting from bud flower initiation stage to pod formation (low, 45-50%. Moderate, 55-60% and high 75-80% of field capacity, abbreviated as FC1, FC2 and FC3, respectively). The 15 N natural abundance technique (%δ 15 N) was employed to evaluate N 2 fixation using barley as a reference crop. Moreover, the carbon isotope discrimination (%Δ 13 C) was determined to assess factors responsible for crop performance variability in the different treatments. Water restriction occurring during the post-flowering period considerably affects growth and N 2 -fixation. However, K-fertilizer enhanced plant performance by overcoming water shortage influences. The delta 15 N values in lentils ranged from +0.67 to +1.36% depending on soil moisture and K-fertilizer treatments. Whereas, those of N 2 fixation and the reference plant were -0.45 and +2.94%, respectively. Consequently, Ndfa% ranged from 45 and 65%. Water stress reduced Δ 13 C values in the FC1K0 And FC1K1 treatments. However, K fertilizer enhanced the whole plants Δ 13 C along with dry matter yield and N 2 fixation. The water stressed plants amended with K (FC1K1) seemed to be the best treatment because of its highest pod yield, high N balance and N 2 -fixation with low consumption of irrigation water. This illustrates the ecological and economical importance of K-fertilizer in alleviating water stress occurring during the post-flowering period of lentil.(Authors)

The measurement of muscle protein synthesis in broilers with a flooding dose technique: use of 15N-labelled phenylalanine, GC-MS and GC-C-IRMS.

Science.gov (United States)

Dänicke, S; Böttcher, W; Simon, O; Jeroch, H

2001-01-01

An experiment was carried out to measure fractional muscle protein synthesis rates (k(s)) in broilers with injection of a flooding dose of phenylalanine (1 ml/100 g body weight of 150 mM phenylalanine; 38 atom percent excess (APE) [15N]phenylalanine). K(s) was calculated from the [15N] enrichment in phenylalanine of tissue-free and protein-bound phenylalanine using both gas chromatography mass spectrometry (GC-MS) and gas chromatography combustion isotope ratio mass spectrometry (GC-C-IRMS) for measurements after a 10 min isotope incorporation period. The tertiary-butyldimethylsilyl (t-BDMS) derivatives of phenylalanine were used for gas chromatographic separation in both systems. GC-MS and GC-C-IRMS were calibrated for a range of 7 to 37 [15N]APE and 0 to 0.62 [15N]APE, respectively, and for sample sizes of 0.45 to 4.5 nmol phenylalanine and 7 to 40 nmol phenylalanine, respectively. Reproducibility of standards as a measure of precision varied from 0.06 to 0.29 [15N]APE and from 0.0004 to 0.0018 [15N]APE in GC-MS and GC-C-IRMS, respectively. K(s) was measured in the m. pectoralis major of broilers fed rye based diets (56%) which were provided either unsupplemented (-) or supplemented (+) with an enzyme preparation containing xylanase. K(s) in breast muscles was significantly increased from 21.8%/d to 23.9%/d due to enzyme supplementation. It can be concluded from the study that the measurement of protein synthesis in broilers with the flooding dose technique can be carried out by using [15N]phenylalanine, GC-MS and GC-C-IRMS.

Incorporation of 15N-inorganic nitrogen into free-amino acids in germinating corn

International Nuclear Information System (INIS)

Samukawa, Kisaburo; Yamaguchi, Masuro

1979-01-01

Incorporation of 15 N-labeled compounds, (K 15 NO 3 ) and ( 15 NH 4 ) 2 SO 4 , into free-amino acids was measured in germinating corn. Sterilized seeds of sweet corn (Choko No. 865) were sown on the filter papers soaked in 10 ml of the solution containing one of the labeled compounds (40 ppm N, 99 atom % excess) in petri dishes and germinated at 30 deg C. After 48 hours and 72 hours, 15 N-incorporation was measured in 5 seedlings selected owing to uniform growth. A GC-MS was used for measuring the ratio of 15 N isotopes present in free-amino acids. 15 N incorporation into free-amino acids hardly occurred when corn was germinated in the solution containing K 15 NO 3 , which suggested that endogenous nitrogen was used during the early germination stage of corn when nitrate is present. Incorporation into amino acids was greater when corn was germinated in the medium containing ( 15 NH 4 ) 2 SO 4 , than the case of the solution containing K 15 NO 3 . When corn was germinated in the solution containing ( 15 NH 4 ) 2 SO 4 , assimilation of 15 N into asparagine or aspartic acid was comparatively higher than that into the other amino acids, though the incorporation rate was low. Thus, in intact germinating corn, the hydrolyzed product of protein was utilized for germination with priority, and dependence on exogenous nitrogen was low. (Kaihara, S.)

Design of a 15N Molecular Unit to Achieve Long Retention of Hyperpolarized Spin State

Science.gov (United States)

Nonaka, Hiroshi; Hirano, Masashi; Imakura, Yuki; Takakusagi, Yoichi; Ichikawa, Kazuhiro; Sando, Shinsuke

2017-01-01

Nuclear hyperpolarization is a phenomenon that can be used to improve the sensitivity of magnetic resonance molecular sensors. However, such sensors typically suffer from short hyperpolarization lifetime. Herein we report that [15N, D14]trimethylphenylammonium (TMPA) has a remarkably long spin-lattice relaxation time (1128 s, 14.1 T, 30 °C, D2O) on its 15N nuclei and achieves a long retention of the hyperpolarized state. [15N, D14]TMPA-based hyperpolarized sensor for carboxylesterase allowed the highly sensitive analysis of enzymatic reaction by 15N NMR for over 40 min in phophate-buffered saline (H2O, pH 7.4, 37 °C).

Synthesis of {sup 15}N isotope labeled alanine; Sintese da alanina enriquecida com {sup 15}N

Energy Technology Data Exchange (ETDEWEB)

Oliveira, Claudineia R. de; Bendassolli, Jose Albertino; Sant' Ana, Carlos Roberto; Tagliassachi, Romulo Barbieri; Maximo, Everaldo; Prestes, Clelber Vieira [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Dept. de Isotopos Estaveis]. E-mail: crolivei@cena.usp.br

2005-07-01

The application of light chemical elements and their stable isotopes in biological studies have been increased over the last years. The use of {sup 15}N labeled amino acids is an important tool for elucidation of peptides structures. This paper describe a method for the synthesis of {sup 15}N isotope labeled alanine at lower costs than international ones, as well as the details of the recovery system of the nitrogen residues. In the present work an amination of {alpha}-haloacids, with the bromopropionic carboxylic acid and labeled aqua ammonia ({sup 15}NH{sub 3} aq) was carried out. In order to avoid eventually losses of {sup 15}NH{sub 3}, special cares were adopted, since the production cost is high. Although the acquisition cost of the {sup 13}N (radioactive) labeled compounds is lower, the obtained stable tracer will allow the accomplishment of important studies of the nitrogen cycling in living things, less occupational and environment hazards, and the time limitation problems in field studies. The tests took place in triplicates with NH{sub 3} (aq) being employed. With the establishment of the system for {sup 15}NH{sub 3} recovery, an average of 94 % of the ammonia employed in the synthesis process was recovered. The purity of the amino acid was state determined by TLC (Thin Layer Chromatography) and HPLC (High-Performance Liquid Chromatography) with a fluorescence detector. The Rf and the retention time of the synthesized sample were similar the sigma standard. Finally, regarding the established conditions, it was possible to obtain the alanine with a production cost about 40 % lower than the international price. (author)

The fate of 13C15N labelled glycine in permafrost and surface soil at simulated thaw in mesocosms from high arctic and subarctic ecosystems

DEFF Research Database (Denmark)

Ravn, Nynne Marie Rand; Elberling, Bo; Michelsen, Anders

2017-01-01

Background and aim: Nutrient distribution and carbon fluxes upon spring thaw are compared in mesocosms from high arctic and subarctic ecosystems dominated by Cassiope tetragona or Salix hastata/Salix arctica, in order to evaluate the possibility of plant and microbial utilization of an organic...... compound in thawing permafrost and surface soil. Methods: Double labeled glycine (13C15N) was added to soil columns with vegetation and to permafrost. During thaw conditions ecosystem respiration 13C was measured and 13C and 15N distribution in the ecosystem pools was quantified one day and one month after...... glycine addition. Results: Near-surface soil microbes were more efficient in the uptake of intact glycine immediately upon thaw than plants. After one month plants had gained more 15N whereas microbes seemed to lose 15N originating from glycine. We observed a time lag in glycine degradation upon...

Methods for sequential resonance assignment in solid, uniformly 13C, 15N labelled peptides: Quantification and application to antamanide

International Nuclear Information System (INIS)

Detken, Andreas; Hardy, Edme H.; Ernst, Matthias; Kainosho, Masatsune; Kawakami, Toru; Aimoto, Saburo; Meier, Beat H.

2001-01-01

The application of adiabatic polarization-transfer experiments to resonance assignment in solid, uniformly 13 C- 15 N-labelled polypeptides is demonstrated for the cyclic decapeptide antamanide. A homonuclear correlation experiment employing the DREAM sequence for adiabatic dipolar transfer yields a complete assignment of the C α and aliphatic side-chain 13 C resonances to amino acid types. The same information can be obtained from a TOBSY experiment using the recently introduced P9 1 12 TOBSY sequence, which employs the J couplings as a transfer mechanism. A comparison of the two methods is presented. Except for some aromatic phenylalanine resonances, a complete sequence-specific assignment of the 13 C and 15 N resonances in antamanide is achieved by a series of selective or broadband adiabatic triple-resonance experiments. Heteronuclear transfer by adiabatic-passage Hartmann-Hahn cross polarization is combined with adiabatic homonuclear transfer by the DREAM and rotational-resonance tickling sequences into two- and three-dimensional experiments. The performance of these experiments is evaluated quantitatively

Coupling fallout 210Pb and stables isotopes (δ13C, δ15N) for catchment urbanization reconstruction in southeastern coastal zone of Brazil

International Nuclear Information System (INIS)

Cerda, Mauricio; Macario, Kita Damasio; Roberto Meigikos dos Anjos; Universidade Federal Fluminense; Lamego, Fernando; Universidade Federal Fluminense

2016-01-01

Eutrophication history was reconstructed by bulk organic and inorganic proxies (C, N, P) and isotope (δ 13 C and δ 15 N) analysis constrained by geochronological model derived from fallout 210 Pb in Brazilian coastal lagoon. The sedimentary record spanning the last four decades showed impact of urbanization starting from 1970s. These changes were marked by increase of TN, TP, IP fluxes that were significantly correlated with population growth. Significant covariation of C:N, MDP and δ 15 N along age-depth profiles provided linkage with sedimentation rates, serving as an independent time marker for geochronology and validating use of 210 Pb dating model based on constant initial concentration. (author)

Does fertilizer (N15P15K15) amendment enhance phytoremediation of petroleum-polluted aquatic ecosystem in the presence of water hyacinth (Eichhornia crassipes [Mart.] Solms)?

Science.gov (United States)

Ndimele, Prince Emeka; Jenyo-Oni, Adetola; Chukwuka, Kanayo S; Ndimele, Chinatu Charity; Ayodele, Ibukunoluwa Augustine

2015-01-01

This study investigated the effects of inorganic fertilizer (N15P15K15) amendments on crude oil uptake by water hyacinth. Experimental units (water hyacinth grown in fresh water) were spiked with 0, 20, 40 and 60 mg/L crude oil. After 24 h, they were randomly assigned fertilizer (N15P15K15) at three different concentrations; 0, 6 and 10 mg/L. Crude oil degradation and absorption were determined by measuring total petroleum hydrocarbon (TPH) in the water column and water hyacinth, respectively. The measurements were taken monthly for six months (February-August 2010). The results showed that TPH concentration in the water column in the treatment amended at 6 mg/L (0.30 ± 0.01 mg/L) was significantly lower (p phytoremediation) absorbed significantly higher (p phytoremediation of crude oil by water hyacinth and biostimulation with fertilizer (N15P15K15) is possible.

Traceability of animal meals in Japanese quail eggs using the technique of 13C e 15N* stable isotopes

Directory of Open Access Journals (Sweden)

C Mori

2013-03-01

Full Text Available The objective of this study was to trace the inclusion of bovine meat and bone meal (BMBM in the diet of Japanese quails by analyzing eggs and egg fractions (yolk and albumen by the technique of carbon-13 (13C and nitrogen-15 (15N stable isotopes. In the trial, 120 Japanese quails were distributed in six treatments with four replicates of five birds each. The following treatments were applied: feed based on corn and soybean meal, containing graded BMBM inclusions (0, 1, 2, 3, 4 or 5%. After 42 days, 20 eggs per treatment were randomly collected for three consecutive days. Ten eggs were used for yolk and albumen sample collection, and ten for total egg sample collection. It was possible to detect the dietary inclusion of 1% BMBM in the egg and its fractions. Therefore, the technique of isotopes 13C and 15N is able of tracing since 1% inclusion level of BMBM in the diet of Japanese quails in eggs and their fractions.

Synthesis of {sup 15}N labeled glyphosate; Sintese do glifosato enriquecido com {sup 15}N

Energy Technology Data Exchange (ETDEWEB)

Oliveira, Claudineia R. de; Bendassolli, Jose Albertino; Tavares, Glauco Arnold; Rossete, Alexssandra L.R.M.; Tagliassachi, Romulo Barbieri; Prestes, Cleuber Vieira [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Dept. de Isotopos Estaveis]. E-mail: crolivei@cena.usp.br

2005-07-01

Amongst the actually commercialized herbicides the Glyphosate is the most used in Brazil. Its efficiency as well as the others herbicides against undesirable weeds is harmed by its final composts left at the environment. Although studies has being carried out to improve the knowledge about the herbicides behavior at the environment its complexity has led them towards innumerous to new significant research work where the use of radiolabeled composts (radiative tracers) are recommended to evaluate their bio-availability in the soil. However is the use, the manipulation and the storage of radiolabeled composts is requires an extra care under chemical safety point of view. The use of non radiolabeled composts is a world tendency especially for field researches. Under this context the presented work describes a method for the synthesis of {sup 15}N labeled glyphosate. The {sup 15}N-herbicide was undertaken by phosphometilation with the phosphit dialquil and {sup 15}N-glycine. The tests where carried out through a micro scale production plant and of equimolars amounts. At these conditions it's was possible to reach approximately a 20% of yield. At the conclusion of a best operational condition its expected to offer another important toll that shall be used in glyphosate behavior at the environment and undesirably weeds. (author)

Utilization of 15N-labelled urea in laying hens. 8

International Nuclear Information System (INIS)

Gruhn, K.; Graf, H.

1987-01-01

3 colostomized laying hybrids received orally with a conventional ration 1% urea with 96.06 atom-% 15 N excess ( 15 N') over a period of 6 days. In the period of the experiment every hen consumed 2.87 g 15 N'. After another 2 days, on which they received conventional feed urea, the animals were butchered. 15 N' was determined in the total N and in 15 amino acids of the oviduct. Of the 15 amino acids the labelling of glutamic acid, glycine and serine was highest and on average amounted to 0.80, 0.66 and 0.67 atom-% 15 N', resp. In lysine and arginine only 0.10 and 0.11 atom-% 15 N' could be detected. The amino acid N with natural isotopic frequency amounted to a quarter for the basic amino acids, a tenth for the branched chain ones and for the non-essential ones (glutamic acid, aspartic acid, serine, glycine, alanine, proline) a third of the total oviduct 14 N. The average quota of 15 N' is only 3.6%, that of the branched chain amino acids 4.5 and that of the non-essential ones 21.1%. Consequently, the 15 N' of the urea is mainly used for the synthesis of the non-essential amino acids of the oviduct. (author)

Combined solid state and solution NMR studies of α,ε-15N labeled bovine rhodopsin

International Nuclear Information System (INIS)

Werner, Karla; Lehner, Ines; Dhiman, Harpreet Kaur; Richter, Christian; Glaubitz, Clemens; Schwalbe, Harald; Klein-Seetharaman, Judith; Khorana, H. Gobind

2007-01-01

Rhodopsin is the visual pigment of the vertebrate rod photoreceptor cell and is the only member of the G protein coupled receptor family for which a crystal structure is available. Towards the study of dynamics in rhodopsin, we report NMR-spectroscopic investigations of α,ε- 15 N-tryptophan labeled rhodopsin in detergent micelles and reconstituted in phospholipids. Using a combination of solid state 13 C, 15 N-REDOR and HETCOR experiments of all possible 13 C' i-1 carbonyl/ 15 N i -tryptophan isotope labeled amide pairs, and H/D exchange 1 H, 15 N-HSQC experiments conducted in solution, we assigned chemical shifts to all five rhodopsin tryptophan backbone 15 N nuclei and partially to their bound protons. 1 H, 15 N chemical shift assignment was achieved for indole side chains of Trp35 1.30 and Trp175 4.65 . 15 N chemical shifts were found to be similar when comparing those obtained in the native like reconstituted lipid environment and those obtained in detergent micelles for all tryptophans except Trp175 4.65 at the membrane interface. The results suggest that the integrated solution and solid state NMR approach presented provides highly complementary information in the study of structure and dynamics of large membrane proteins like rhodopsin

1H, 13C and 15N chemical shift assignments of the thioredoxin from the obligate anaerobe Desulfovibrio vulgaris Hildenborough.

Science.gov (United States)

Garcin, Edwige B; Bornet, Olivier; Pieulle, Laetitia; Guerlesquin, Françoise; Sebban-Kreuzer, Corinne

2011-10-01

Thioredoxins are ubiquitous key antioxidant enzymes which play an essential role in cell defense against oxidative stress. They maintain the redox homeostasis owing to the regulation of thiol-disulfide exchange. In the present paper, we report the full resonance assignments of (1)H, (13)C and (15)N atoms for the reduced and oxidized forms of Desulfovibrio vulgaris Hildenborough thioredoxin 1 (Trx1). 2D and 3D heteronuclear NMR experiments were performed using uniformly (15)N-, (13)C-labelled Trx1. Chemical shifts of 97% of the backbone and 90% of the side chain atoms were obtained for the oxidized and reduced form (BMRB deposits with accession number 17299 and 17300, respectively).

A new organic reference material, l-glutamic acid, USGS41a, for δ(13) C and δ(15) N measurements - a replacement for USGS41.

Science.gov (United States)

Qi, Haiping; Coplen, Tyler B; Mroczkowski, Stanley J; Brand, Willi A; Brandes, Lauren; Geilmann, Heike; Schimmelmann, Arndt

2016-04-15

The widely used l-glutamic acid isotopic reference material USGS41, enriched in both (13) C and (15) N, is nearly exhausted. A new material, USGS41a, has been prepared as a replacement for USGS41. USGS41a was prepared by dissolving analytical grade l-glutamic acid enriched in (13) C and (15) N together with l-glutamic acid of normal isotopic composition. The δ(13) C and δ(15) N values of USGS41a were directly or indirectly normalized with the international reference materials NBS 19 calcium carbonate (δ(13) CVPDB = +1.95 mUr, where milliurey = 0.001 = 1 ‰), LSVEC lithium carbonate (δ(13) CVPDB = -46.6 mUr), and IAEA-N-1 ammonium sulfate (δ(15) NAir = +0.43 mUr) and USGS32 potassium nitrate (δ(15) N = +180 mUr exactly) by on-line combustion, continuous-flow isotope-ratio mass spectrometry, and off-line dual-inlet isotope-ratio mass spectrometry. USGS41a is isotopically homogeneous; the reproducibility of δ(13) C and δ(15) N is better than 0.07 mUr and 0.09 mUr, respectively, in 200-μg amounts. It has a δ(13) C value of +36.55 mUr relative to VPDB and a δ(15) N value of +47.55 mUr relative to N2 in air. USGS41 was found to be hydroscopic, probably due to the presence of pyroglutamic acid. Experimental results indicate that the chemical purity of USGS41a is substantially better than that of USGS41. The new isotopic reference material USGS41a can be used with USGS40 (having a δ(13) CVPDB value of -26.39 mUr and a δ(15) NAir value of -4.52 mUr) for (i) analyzing local laboratory isotopic reference materials, and (ii) quantifying drift with time, mass-dependent isotopic fractionation, and isotope-ratio-scale contraction for isotopic analysis of biological and organic materials. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.

15 CFR 8c.40 - Employment.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Employment. 8c.40 Section 8c.40... BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF COMMERCE § 8c.40 Employment... discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...

17 CFR 240.15c3-1d - Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1).

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Satisfactory Subordination...-Counter Markets § 240.15c3-1d Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1). (a) Introduction. (1) This Appendix sets forth minimum and non-exclusive requirements for satisfactory...

Study of the GDR in 15N using fast neutron capture

International Nuclear Information System (INIS)

Wender, S.A.; Jensen, M.; Potokar, M.; Roberson, N.R.; Tilley, D.R.; Weller, H.R.

1978-01-01

The excitation function for 15 N(γ,n) from 16 to 23 MeV was obtained by use of the detailed balance priinciple from neutron capture. As coefficients from the 14 N(n,γ) data are also shown. Similar data are shown for 14 C(p,γ) and 14 N(p,γ) studies. 2 figures

Novel DNA packaging recognition in the unusual bacteriophage N15

Energy Technology Data Exchange (ETDEWEB)

Feiss, Michael [Department of Microbiology, Roy J. and Lucille A. Carver College of Medicine, University of Iowa, Iowa City, IA 52242 (United States); Geyer, Henriette, E-mail: henriettegeyer@gmail.com [Division of Viral Infections, Robert Koch Institute, Berlin (Germany); Division of Viral Infections, Robert Koch Institute, Berlin (Germany); Klingberg, Franco, E-mail: franco.klingberg@thermofisher.com [Flow Cytometry, Imaging & Microscopy, Thermo Fisher Scientific, Frankfurter Strasse 129B 64293 Darmstadt (Germany); Flow Cytometry, Imaging & Microscopy, Thermo Fisher Scientific, Frankfurter Strasse 129B 64293 Darmstadt (Germany); Moreno, Norma, E-mail: nmoreno@islander.tamucc.edu [Texas A& M University – Corpus Christi, 6300 Ocean Drive, Corpus Christi, TX 78412, United States. (United States); Texas A& M University – Corpus Christi, 6300 Ocean Drive, Corpus Christi, TX 78412, United States. (United States); Forystek, Amanda, E-mail: eamanda-forystek@uiowa.edu [Flow Cytometry, Imaging & Microscopy, Thermo Fisher Scientific, Frankfurter Strasse 129B 64293 Darmstadt (Germany); Room # 2911 JPP, Dept. of Psychiatry, The University of Iowa, 200 Hawkins Drive, Iowa City, Iowa, 52242 (United States); Maluf, Nasib Karl, E-mail: fKarl.Maluf@ap-lab.com [Flow Cytometry, Imaging & Microscopy, Thermo Fisher Scientific, Frankfurter Strasse 129B 64293 Darmstadt (Germany); Alliance Protein Laboratories, Inc. 6042 Cornerstone Court West, Suite ASan Diego, CA 92121, USA. (United States); Sippy, Jean [Department of Microbiology, Roy J. and Lucille A. Carver College of Medicine, University of Iowa, Iowa City, IA 52242 (United States)

2015-08-15

Phage lambda's cosB packaging recognition site is tripartite, consisting of 3 TerS binding sites, called R sequences. TerS binding to the critical R3 site positions the TerL endonuclease for nicking cosN to generate cohesive ends. The N15 cos (cos{sup N15}) is closely related to cos{sup λ}, but whereas the cosB{sup N15} subsite has R3, it lacks the R2 and R1 sites and the IHF binding site of cosB{sup λ}. A bioinformatic study of N15-like phages indicates that cosB{sup N15} also has an accessory, remote rR2 site, which is proposed to increase packaging efficiency, like R2 and R1 of lambda. N15 plus five prophages all have the rR2 sequence, which is located in the TerS-encoding 1 gene, approximately 200 bp distal to R3. An additional set of four highly related prophages, exemplified by Monarch, has R3 sequence, but also has R2 and R1 sequences characteristic of cosB–λ. The DNA binding domain of TerS-N15 is a dimer. - Highlights: • There are two classes of DNA packaging signals in N15-related phages. • Phage N15's TerS binding site: a critical site and a possible remote accessory site. • Viral DNA recognition signals by the λ-like bacteriophages: the odd case of N15.

Investigation on the absorption of 14C-leucine and 15N-leucine in rats after feeding a fish meal diet in comparison with a gelatine diet

International Nuclear Information System (INIS)

Bergner, U.; Adam, K.; Bergner, H.

1981-01-01

Albino rats received after nine days of adaptation to a fish meal diet in comparison with a gelatine diet 14 C-U-L-leucine and 15 N-L-leucine via a pellet made from the specific diet after food deprivation for 15 h. Thereafter, the animals consumed the non-labelled experimental diet ad libitum. 30 min, and 1, 2, 4 and 8 h, resp., after intake of the labelled food, four rats at a time were sacrificed. The contents of the digestive tract and tissue samples were examined for 14 C and 15 N and their percentages in the TCA-soluble fraction determined. If these values are regarded as non-absorbed leucine, the 14 C values obtained up to the four hour period of the experiment would be too high. Presumably, they are in the case of both diets simulated by other 14 C metabolites which originate from the leucine catabolism and reach the intestinal lumen. Amino acids labelled with 15 N should be preferred in studies on the absorption of amino acids because, in case of catabolization, the 15 N aminogroup is excreted mainly as urea via urine. (author)

Flotsam samples can help explain the δ13C and δ15N values of invertebrate resting stages in lake sediment

Science.gov (United States)

van Hardenbroek, Maarten; Rinta, Päivi; Wooller, Matthew J.; Schilder, Jos; Stötter, Tabea; Heiri, Oliver

2018-06-01

The stable isotopic composition of chitinous remains of Cladocera (water fleas) and freshwater Bryozoa (moss animals) preserved in lake sediment records can provide supporting insights into past environmental and ecosystem changes in lakes. Here we explore whether analyses of these remains isolated from lake flotsam can provide information on the driving variables affecting the isotopic composition of these remains. We collected flotsam in 53 lakes and found enough material in 33 lakes to measure the stable carbon and nitrogen isotope ratios (expressed as δ13C and δ15N values, respectively) of resting stages. These values were compared with lake characteristics, water chemistry measurements, and the isotopic composition of sedimentary organic matter (SOM) in the lakes. Mean δ13C values of cladoceran ephippia and SOM were correlated and both were also negatively correlated with deep water methane concentrations and indicators of lake stratification. This supports the findings of previous studies that methane-derived carbon can provide a significant proportion of carbon entering planktonic food webs. Mean δ15N values of bryozoan statoblasts and SOM were correlated, suggesting that both reflect the δ15N values of phytoplankton. Our results provide information on how environmental variables in lakes can influence the δ13C and δ15N values in resting stages, but flotsam samples can also potentially be used to assess seasonal stable isotope variability of resting stages. Both types of information are important to improve palaeoenvironmental interpretations of stable isotope records based on these remains in lake sediments.

Urinary excretion of 15N during intraportal infusion of 15N-ammonia in chickens fed low or high protein diet

International Nuclear Information System (INIS)

Karasawa, Yutaka; Koh, Katsuki; Takahashi, Akira; Sumiya, Ryuta

1985-01-01

The purpose of this study is to examine time courses of 15 N in urinary ammonia and total N when 15 N-labeled ammonium acetate was continuously infused for 1 hour into chickens fed a 5 or 20 % protein diet. 15 N-enrichment of urinary nitrogen in the two dietary groups increased sharply in ammonia for the first 20 minutes and to a less extent linearly in total N for the first 30 minutes, and then gradually in both ammonia and total N. Through the ammonia infusion, the 15 N-enrichment of urinary ammonia was higher in the chickens fed the low protein diet than in those fed the high protein diet; both of them were higher than 15 N-enrichments of urinary N, which were almost the same in the two dietary groups. The urinary total N from the infused ammonia rose linearly for the first 40 minutes but thereafter did not rise further in the two dietary groups, whereas the endogenous urinary total N tended to decrease a little in the chichens fed the high protein diet but unchanged in those fed the low protein diet. The urinary ammonia from the infused ammonia increased sharply for the first 20 minutes, then linearly but at a lower rate in the chickens fed the high protein diet, whereas that in the chickens fed the low protein diet rose linearly throughout ammonia infusion. In contrast, the endogenous urinary ammonia showed no change in the chickens fed the high protein diet while it showed a tendency to increase a little in these fed the low protein diet. These results indicate that the increased urinary ammonia and total N during ammonia infusion are derived mostly from the infused ammonia in chickens fed 5 and 20% protein diets. (author)

North Atlantic ecosystem shifts revealed by cod otolith δ¹⁵N and δ¹³C chronologies

DEFF Research Database (Denmark)

Pedersen, Jens Brøgger; Nielsen, Jens Munk; Steingrund, Petur

. To study the link between environmental changes and ecosystem trophic structure we developed δ15N and δ13C chronologies by analyzing the organic matrix of cod otoliths from the Faroe Shelf cod population (1950-2010) and the Nuuk Fjord cod population (1927-2009). Significant correlations between δ15N & δ13C...... of organic matrix of otolith core material (Nuuk Fjord) and annual growth increments in Ocean Quahog (A. Islandica) shells will be included.......Changes in climate and exploitation have caused large fluctuations in the productivity of many North Atlantic cod populations and the collapse of many cod fisheries. These fluctuations are most likely due to a combined effect of physical processes and changes in ecosystem trophic structure...

Diet-tissue stable isotope (Δ¹³C and Δ¹⁵N) discrimination factors for multiple tissues from terrestrial reptiles

OpenAIRE

Steinitz, R; Lemm, JM; Pasachnik, SA; Kurle, CM

2016-01-01

Copyright © 2015 John Wiley & Sons, Ltd. Rationale Stable isotope analysis is a powerful tool for reconstructing trophic interactions to better understand drivers of community ecology. Taxon-specific stable isotope discrimination factors contribute to the best use of this tool. We determined the first Δ 13 C and Δ 15 N values for Rock Iguanas (Cyclura spp.) to better understand isotopic fractionation and estimate wild reptile foraging ecology. Methods The Δ 13 C and Δ 15 N values between di...

Asymptotic normalization coefficients for 14N+p→15O and the astrophysical S factor for 14N(p,γ)15O

International Nuclear Information System (INIS)

Mukhamedzhanov, A.M.; Gagliardi, C.A.; Pirlepesov, F.; Tribble, R.E.; Bem, P.; Burjan, V.; Kroha, V.; Novak, J.; Piskor, S.; Simeckova, E.; Vincour, J.; Brown, B.A.; Nunes, F.M.

2003-01-01

The 14 N(p,γ) 15 O reaction, which controls energy production in the CNO cycle, has contributions from both resonance and direct captures to the ground and excited states. The overall normalization of the direct captures is defined by the corresponding asymptotic normalization coefficients (ANCs). Especially important is the ANC for the subthreshold state in 15 O at -0.504 keV since direct capture through this state dominates the reaction rate at stellar energies. In order to determine the ANCs for 14 N+p→ 15 O, the 14 N( 3 He,d) 15 O proton transfer reaction has been measured at an incident energy of 26.3 MeV. Angular distributions for proton transfer to the ground and five excited states were obtained. ANCs were then extracted from comparison to both distorted-wave Born approximation and coupled-channels Born approximation calculations. Using these ANCs, we calculated the astrophysical factor and reaction rates for 14 N(p,γ) 15 O. Our analysis favors a low value for the astrophysical factor

Utilization of 15N-labelled urea in laying hens. 2

International Nuclear Information System (INIS)

Gruhn, K.; Zander, R.

1985-01-01

In an N metabolism experiment 3 colostomized laying hybrids received 2870 mg 15 N excess ( 15 N') per animal in 6 days in the form of urea with their conventional feed rations. During the 8-day experiment the 21 eggs laid were separated into egg-shell, white of egg and yolk. Weight, N content and 15 N' of the individual fractions of the eggs were determined. On an average 4.6% of the heavy nitrogen was in the egg-shells, 50% in the white of egg and 45.5% in the yolk. 2.8%, 4.5% and 5.5% (hens 1 - 3) of the 15 N' consumed were detected in the eggs. The maximum 15 N' output in the white of egg was reached on the 6th day, whereas 15 N' output in the yolk showed a nearly linear increase in the time of the experiment. The results show that labelled nitrogen from urea is incorporated into the egg to a lower degree than after the feeding of 15 N-labelled proteins and that the development of its incorporation into the white of egg and the yolk differ from that after the feeding of 15 N-labelled native proteins. (author)

Sedimentary records of δ{sup 13}C, δ{sup 15}N and organic matter accumulation in lakes receiving nutrient-rich mine waters

Energy Technology Data Exchange (ETDEWEB)

Widerlund, Anders, E-mail: Anders.Widerlund@ltu.se; Chlot, Sara; Öhlander, Björn

2014-07-01

Organic C and total N concentrations, C/N ratios, δ{sup 15}N and δ{sup 13}C values in {sup 210}Pb-dated sediment cores were used to reconstruct historical changes in organic matter (OM) accumulation in three Swedish lakes receiving nutrient-rich mine waters. Ammonium-nitrate-based explosives and sodium cyanide (NaCN) used in gold extraction were the major N sources, while lesser amounts of P originated from apatite and flotation chemicals. The software IsoSource was used to model the relative contribution of soil, terrestrial and littoral vegetation, and phytoplankton detritus in the lake sediments. In one lake the IsoSource modelling failed, suggesting the presence of additional, unknown OM sources. In two of the lakes sedimentary detritus of littoral vegetation and phytoplankton had increased by 15–20% and 20–35%, respectively, since ∼ 1950, when N- and P-rich mine waters began to reach the lakes. Today, phytoplankton is the dominating OM component in these lake sediments, which appears to be a eutrophication effect related to mining operations. Changes in the N isotopic composition of biota, lake water, and sediments related to the use of ammonium-nitrate-based explosives and NaCN were evident in the two studied systems. However, N isotope signals in the receiving waters (δ{sup 15}N ∼ + 9‰ to + 19‰) were clearly shifted from the primary signal in explosives (δ{sup 15}N–NO{sub 3} = + 3.4 ± 0.3‰; δ{sup 15}N–NH{sub 4} = − 8.0 ± 0.3‰) and NaCN (δ{sup 15}N = + 1.1 ± 0.5‰), and direct tracing of the primary N isotope signals in mining chemicals was not possible in the receiving waters. Systems where mine waters with a well known discharge history are a major point source of N with well-defined isotopic composition should, however, be suitable for further studies of processes controlling N isotope signatures and their transformation in aquatic systems receiving mine waters. - Highlights: • Historical mining-related changes in organic

Coral skeletal δ15N reveals isotopic traces of an agricultural revolution

International Nuclear Information System (INIS)

Marion, Guy S.; Dunbar, Robert B.; Mucciarone, David A.; Kremer, James N.; Lansing, J. Stephen; Arthawiguna, Alit

2005-01-01

This study introduces a new method of tracing the history of nutrient loading in coastal oceans via δ 15 N analysis of organic nitrogen preserved in the skeleton of the massive Porites coral. Four coral cores were collected in Bali, Indonesia, from reefs exposed to high levels of fertilizers in agricultural run-off, from lagoonal corals impacted by sewage, and from a reef located 30 km offshore. Skeletal δ 15 N in the agriculturally exposed coral declined from 10.7 ± 0.4 per mille in 1970-1971, when synthetic fertilizers (-0.8 per mille ± 0.2 per mille ) were introduced to Bali, to a depleted 'anthropogenic' baseline of 3.5 per mille ± 0.4% in the mid-1990s. δ 15 N values were negatively correlated with rainfall, suggesting that marine δ 15 N lowers during flood-born influxes of waste fertilizers. Reef cores exposed to untreated sewage in terrestrial discharge were enriched (7.8 and 7.3 ± 0.4 per mille ), while the offshore core reflected background oceanic signals (6.2 ± 0.4 per mille). δ 15 N, N concentration, and C:N systematics indicate that the N isotopic composition of skeletal organic matter was generally well preserved over 30 years. We suggest that skeletal organic δ 15 N can serve as a recorder of past nitrogen sources. In Bali, this tracer suggests that the intensification of Western style agricultural practices since 1970 are contributing to the degradation of coastal coral reefs

Uniform {sup 15}N- and {sup 15}N/{sup 13}C-labeling of proteins in mammalian cells and solution structure of the amino terminal fragment of u-PA

Energy Technology Data Exchange (ETDEWEB)

Hansen, A.P.; Petros, A.M.; Meadows, R.P.; Mazar, A.P.; Nettesheim, D.G.; Pederson, T.M.; Fesik, S.W. [Abbott Laboratories, Abbott Park, IL (United States)

1994-12-01

Urokinase-type plasminogen activator (u-PA) is a 54-kDa glycoprotein that catalyzes the conversion of plasminogen to plasmin, a broad-specificity protease responsible for the degradation of fibrin clots and extracellular matrix components. The u-PA protein consists of three individual modules: a growth factor domain (GFD), a kringle, and a serine protease domain. The amino terminal fragment (ATF) includes the GFD-responsible for u-PA binding to its receptor-and the kringle domains. This protein was expressed and uniformly {sup 15}N-and {sup 15}N/{sup 13}C-labeled in mammalian cells by methods that will be described. In addition, we present the three-dimensional structure of ATF that was derived from 1299 NOE-derived distance restraints along with the {phi} angle and hydrogen bonding restraints. Although the individual domains in the structures were highly converged, the two domains are structurally independent. The overall structures of the individual domains are very similar to the structures of homologous proteins. However, important structural differences between the growth factor domain of u-PA and other homologous proteins were observed in the region that has been implicated in binding the urokinase receptor. These results may explain, in part, why other growth factors show no appreciable affinity for the urokinase receptor.

15N sample preparation for mass spectroscopy analysis

International Nuclear Information System (INIS)

Trivelin, P.C.O.; Salati, E.; Matsui, E.

1973-01-01

Technics for preparing 15 N samples to be analised is presented. Dumas method and oxidation by sodium hypobromite method are described in order to get the appropriate sample. Method to calculate 15 N ratio from mass spectrometry dates is also discussed [pt

Density of states and T/sub c/ of disordered A15 compounds

International Nuclear Information System (INIS)

Ghosh, A.K.; Strongin, M.

1979-01-01

In this paper various data for the depression of T/sub c/ and N(O) are presented for a wide class of A15 materials. The question of disorder and the limits on T/sub c/ in these materials are discussed

Measurement of {sup 1}H-{sup 15}N and {sup 1}H-{sup 13}C residual dipolar couplings in nucleic acids from TROSY intensities

Energy Technology Data Exchange (ETDEWEB)

Ying Jinfa [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States); Wang Jinbu [National Cancer Institute, National Institutes of Health, Structural Biophysics Laboratory (United States); Grishaev, Alex [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States); Yu Ping; Wang Yunxing [National Cancer Institute, National Institutes of Health, Structural Biophysics Laboratory (United States); Bax, Ad, E-mail: bax@nih.gov [National Institutes of Health, Laboratory of Chemical Physics, National Institute of Diabetes and Digestive and Kidney Diseases (United States)

2011-09-15

Analogous to the recently introduced ARTSY method for measurement of one-bond {sup 1}H-{sup 15}N residual dipolar couplings (RDCs) in large perdeuterated proteins, we introduce methods for measurement of base {sup 13}C-{sup 1}H and {sup 15}N-{sup 1}H RDCs in protonated nucleic acids. Measurements are based on quantitative analysis of intensities in {sup 1}H-{sup 15}N and {sup 13}C-{sup 1}H TROSY-HSQC spectra, and are illustrated for a 71-nucleotide adenine riboswitch. Results compare favorably with those of conventional frequency-based measurements in terms of completeness and convenience of use. The ARTSY method derives the size of the coupling from the ratio of intensities observed in two TROSY-HSQC spectra recorded with different dephasing delays, thereby minimizing potential resonance overlap problems. Precision of the RDC measurements is limited by the signal-to-noise ratio, S/N, achievable in the 2D TROSY-HSQC reference spectrum, and is approximately given by 30/(S/N) Hz for {sup 15}N-{sup 1}H and 65/(S/N) Hz for {sup 13}C-{sup 1}H. The signal-to-noise ratio of both {sup 1}H-{sup 15}N and {sup 1}H-{sup 13}C spectra greatly benefits when water magnetization during the experiments is not perturbed, such that rapid magnetization transfer from bulk water to the nucleic acid, mediated by rapid amino and hydroxyl hydrogen exchange coupled with {sup 1}H-{sup 1}H NOE transfer, allows for fast repetition of the experiment. RDCs in the mutated helix 1 of the riboswitch are compatible with nucleotide-specifically modeled, idealized A-form geometry and a static orientation relative to the helix 2/3 pair, which differs by ca 6 Degree-Sign relative to the X-ray structure of the native riboswitch.

Decomposition of 14C-15N straw incorporated at three depths in a red-yellow latosol at Pernambuco State, Brazil

International Nuclear Information System (INIS)

Sampaio, E.V.S.; Salcedo, I.H.; Bettany, J.

1990-01-01

The decomposition of 14 C- 15 N labelled straw, incorporated at three depths in a Red-yellow Latosol from the humid, coastal zone of Pernambuco State, Brazil, was measured during two years. The straw was ground, mixed with soil portions and placed in 400-mesh bags and replaced into the original field sites at 10, 30 and 60cm depth. The decomposition was also followed in the laboratory using soil from the superficial layer. Straw carbon losses in the field reached 52% during the first month and about 80% after two years. In the first 4 months mineralization was faster in the superficial layer, with no differences thereafter. In the laboratory, mineralization was slower than in the field, reaching 34 and 50% after one month and two years, respectively. During the first month, most of the soil microbial biomass was apparently formed from straw derived material but the contribution from the straw decrease to 15-30% after two months and to less than 1% after two years. Straw N losses reached 25% in the first month and 40-50% after two years, with significant differences among soil depths in the first six months when losses were higher in the deeper layers. There were no plants to absorb the mineral N which accumulated in the soil to a concentration of up to 32μg/g soil. The contribution of straw N to this mineral N decreased with incubation period but was always less than 12%. The C:N ratio of straw derived material ( 14 C- 15 N) decreased from 22:1 to 8-10:1, at all depths. (author)

Competition for tracer 15N in tussock tundra ecosystems

International Nuclear Information System (INIS)

Marion, G.M.; Miller, P.C.; Black, C.H.

1987-01-01

The objectives of this study were to assess the roles of plant species, time, and site on competition for tracer 15 N (without carrier) in tussock tundra ecosystems. Six experimental sites were located in northern Alaska. After one year across the experimental sites, the recovery of 15 N by litter (11.3-16.3%) and mosses (5.4-16.4%) was significantly greater than for aboveground vascular plants (2.6-5.0%). 15 N recoveries by tundra vascular plants (2.6-5.0%) were low when compared to forest trees (9-25%) which suggst that competition for nitrogen is particularly severe in these colddominated tundra ecosystems. There were no significant differences among sites in 15 N recoveries by vascular plants, by mosses, or by litter. There was a statistically significant decline in 15 N recovery with time for Vaccinium vitis-idaea and Eriophoum vaginatum between the second and third year. The shallow rooted Vaccinium vitis-ideae was more highly labeled than the deep rooted Eriophorum vaginatum. Nearness to the source of the applied 15 N played a critical role in competition for surface applied nitrogen. (author)

First Measurement of the 14N/15N Ratio in the Analog of the Sun Progenitor OMC-2 FIR4

Science.gov (United States)

Kahane, Claudine; Jaber Al-Edhari, Ali; Ceccarelli, Cecilia; López-Sepulcre, Ana; Fontani, Francesco; Kama, Mihkel

2018-01-01

We present a complete census of the 14N/15N isotopic ratio in the most abundant N-bearing molecules toward the cold envelope of the protocluster OMC-2 FIR4, the best known Sun progenitor. To this scope, we analyzed the unbiased spectral survey obtained with the IRAM 30 m telescope at 3, 2, and 1 mm. We detected several lines of CN, HCN, HNC, HC3N, N2H+, and their respective 13C and 15N isotopologues. The lines’ relative fluxes are compatible with LTE conditions, and moderate line opacities have been corrected via a population diagram method or theoretical relative intensity ratios of the hyperfine structures. The five species lead to very similar 14N/15N isotopic ratios, without any systematic difference between amine- and nitrile-bearing species as previously found in other protostellar sources. The weighted average of the 14N/15N isotopic ratio is 270 ± 30. This 14N/15N value is remarkably consistent with the [250–350] range measured for the local galactic ratio but significantly differs from the ratio measured in comets (around 140). High-angular resolution observations are needed to examine whether this discrepancy is maintained at smaller scales. In addition, using the CN, HCN, and HC3N lines, we derived a 12C/13C isotopic ratio of 50 ± 5.

Benchmarking theoretical formalisms for (p ,p n ) reactions: The 15C(p ,p n )14C case

Science.gov (United States)

Yoshida, K.; Gómez-Ramos, M.; Ogata, K.; Moro, A. M.

2018-02-01

Background: Proton-induced knockout reactions of the form (p ,p N ) have experienced a renewed interest in recent years due to the possibility of performing these measurements with rare isotopes, using inverse kinematics. Several theoretical models are being used for the interpretation of these new data, such as the distorted-wave impulse approximation (DWIA), the transition amplitude formulation of the Faddeev equations due to Alt, Grassberger, and Sandhas (FAGS) and, more recently, a coupled-channels method here referred to as transfer-to-the- continuum (TC). Purpose: Our goal is to compare the momentum distributions calculated with the DWIA and TC models for the same reactions, using whenever possible the same inputs (e.g., distorting potential). A comparison with already published results for the FAGS formalism is performed as well. Method: We choose the 15C(p ,p n )14C reaction at an incident energy of 420 MeV/u, which has been previously studied with the FAGS formalism. The knocked-out neutron is assumed to be in a 2 s single-particle orbital. Longitudinal and transverse momentum distributions are calculated for different assumed separation energies. Results: For all cases considered, we find a very good agreement between DWIA and TC results. The energy dependence of the distorting optical potentials is found to affect in a modest way the shape and magnitude of the momentum distributions. Moreover, when relativistic kinematics corrections are omitted, our calculations reproduce remarkably well the FAGS result. Conclusions: The results found in this work provide confidence on the consistency and accuracy of the DWIA and TC models for analyzing momentum distributions for (p ,p n ) reactions at intermediate energies.

Highly 15N-Enriched Chondritic Clasts in the Isheyevo Meteorite

Energy Technology Data Exchange (ETDEWEB)

Bonal, L; Huss, G R; Krot, A N; Nagashima, K; Ishii, H A; Bradley, J P; Hutcheon, I D

2009-01-14

The metal-rich carbonaceous chondrites (CB and CH) have the highest whole-rock {sup 15}N enrichment ({delta}{sup 15}N up to +1500{per_thousand}), similar to {delta}{sup 15}N values reported in micron-sized regions (hotspots) of Interplanetary Dust Particles (IDPs) of possibly cometary origin and fine-grained matrices of unmetamorphosed chondrites. These {sup 15}N-rich hotspots are commonly attributed to low-temperature ion-molecule reactions in the protosolar molecular cloud or in the outer part of the protoplanetary disk. The nature of the whole-rock {sup 15}N enrichment of the metal-rich chondrites is not understood. We report a discovery of a unique type of primitive chondritic clasts in the CH/CB-like meteorite Isheyevo, which provides important constraints on the origin of {sup 15}N anomaly in metal-rich chondrites and nitrogen-isotope fractionation in the Solar System. These clasts contain tiny chondrules and refractory inclusions (5-15 {micro}m in size), and abundant ferromagnesian chondrule fragments (1-50 {micro}m in size) embedded in the partly hydrated, fine-grained matrix material composed of olivines, pyroxenes, poorly-organized aromatic organics, phyllosilicates and other hydrous phases. The mineralogy and oxygen isotope compositions of chondrules and refractory inclusions in the clasts are similar to those in the Isheyevo host, suggesting formation at similar heliocentric distances. In contrast to the previously known extraterrestrial samples, the fine-grained material in the clasts is highly and rather uniformly enriched in {sup 15}N, with bulk {delta}{sup 15}N values ranging between +1000 and +1300{per_thousand}; the {delta}{sup 15}N values in rare hotspots range from +1400 to +4000{per_thousand}. Since fine-grained matrices in the lithic clasts are the only component containing thermally unprocessed (during CAI and chondrule formation or during impact melting) materials that accreted into the metal rich chondrite parent body(ies), the {sup 15}N

17 CFR 240.15c1-2 - Fraud and misrepresentation.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...

Complete Measurement of Stable Isotopes in N2O (δ15N, δ15Nα, δ15Nβ, δ18O, δ17O) Using Off-Axis Integrated Cavity Output Spectroscopy (OA-ICOS)

Science.gov (United States)

Leen, J. B.; Gupta, M.

2014-12-01

Nitrate contamination in water is a worldwide environmental problem and source apportionment is critical to managing nitrate pollution. Fractionation caused by physical, chemical and biological processes alters the isotope ratios of nitrates (15N/14N, 18O/16O and 17O/16O) and biochemical nitrification and denitrification impart different intramolecular site preference (15N14NO vs. 14N15NO). Additionally, atmospheric nitrate is anomalously enriched in 17O compared to other nitrate sources. The anomaly (Δ17O) is conserved during fractionation processes, providing a tracer of atmospheric nitrate. All of these effects can be used to apportion nitrate in soil. Current technology for measuring nitrate isotopes is complicated and costly - it involves conversion of nitrate to nitrous oxide (N2O), purification, preconcentration and measurement by isotope ratio mass spectrometer (IRMS). Site specific measurements require a custom IRMS. There is a pressing need to make this measurement simpler and more accessible. Los Gatos Research has developed a next generation mid-infrared Off-Axis Integrated Cavity Output Spectroscopy (OA-ICOS) analyzer to quantify all stable isotope ratios of N2O (δ15N, δ15Nα, δ15Nβ, δ18O, δ17O). We present the latest performance data demonstrating the precision and accuracy of the OA-ICOS based measurement. At an N2O concentration of 322 ppb, the analyzer quantifies [N2O], δ15N, δ15Na, δ15Nb, and δ18O with a precision of ±0.05 ppb, ±0.4 ‰, ±0.45 ‰, and ±0.6 ‰, and ±0.8 ‰ respectively (1σ, 100s; 1σ, 1000s for δ18O). Measurements of gas standards demonstrate accuracy better than ±1 ‰ for isotope ratios over a wide dynamic range (200 - 100,000 ppb). The measurement of δ17O requires a higher concentration (1 - 50 ppm), easily obtainable through conversion of nitrates in water. For 10 ppm of N2O, the instrument achieves a δ17O precision of ±0.05 ‰ (1σ, 1000s). This performance is sufficient to quantify atmospheric

Synthesis of 15N-labelled urea and methylenediurea

International Nuclear Information System (INIS)

Murray, T.P.; Jones, G.T.

1985-01-01

A new technique was developed for the large-scale synthesis of 15 N-labelled urea at low enrichment levels. The synthesis is based on nucleophilic displacement of the phenoxide ion from phenyl carbonate and uses anhydrous ammonia as the nucleophile. In previous reports a copper catalyst was used; however, in this study it was found that the copper resulted in product decomposition and tar formation, which makes product purification difficult. A novel set of reaction conditions was developed: no catalyst was used, and no product decomposition or tar formation occurred. The reaction product was easily purified, and consistently high yields of 15 N-labelled urea were obtained. 15 N-labelled methylenediurea was prepared by the dilute solution reaction of formalin with 15 N-labelled urea. The methodology developed for the reclamation of unreacted urea resulted in minimum loss of labelled urea. High performance liquid chromatography has been used to determine the chemical purity of both urea and methylenediurea. (author)

Carbono, Nitrogênio, Abundância Natural de Δ13C e Δ15N do Solo sob Sistemas Agroflorestais

Directory of Open Access Journals (Sweden)

Wanderson Henrique Couto

2017-08-01

Full Text Available RESUMO O objetivo deste trabalho foi avaliar alterações nos teores de C e N e abundância natural de δ13C e δ15N de um Cambissolo Háplico Tb distrófico em uma área com sistema agroflorestal (SAF. Em cada área de estudo foram coletadas amostras de solo, em 8 profundidades de 0,0–1,0 m. O delineamento experimental utilizado foi o inteiramente casualizado, em esquema de parcelas subdivididas 2 × 8 (2 áreas florestais e 8 profundidades, com três repetições. Com exceção da camada superficial do solo (0,0-0,10, a área de SAF está preservando os teores de C e aumentando os teores de N (0,2-1,0 em relação à mata nativa. Ambas as áreas avaliadas apresentaram sinais de abundância natural de δ13C referente a plantas do ciclo fotossintético C3, e a área de mata nativa apresentou nas camadas superficiais (0,0-0,20 maiores valores de δ15N, demonstrando maior decomposição da matéria orgânica.

A new organic reference material, L-glutamic acid, USGS41a, for δ13C and δ15N measurements − a replacement for USGS41

Science.gov (United States)

Qi, Haiping; Coplen, Tyler B.; Mroczkowski, Stanley J.; Brand, Willi A.; Brandes, Lauren; Geilmann, Heike; Schimmelmann, Arndt

2016-01-01

RationaleThe widely used l-glutamic acid isotopic reference material USGS41, enriched in both 13C and 15N, is nearly exhausted. A new material, USGS41a, has been prepared as a replacement for USGS41.MethodsUSGS41a was prepared by dissolving analytical grade l-glutamic acid enriched in 13C and 15N together with l-glutamic acid of normal isotopic composition. The δ13C and δ15N values of USGS41a were directly or indirectly normalized with the international reference materials NBS 19 calcium carbonate (δ13CVPDB = +1.95 mUr, where milliurey = 0.001 = 1 ‰), LSVEC lithium carbonate (δ13CVPDB = −46.6 mUr), and IAEA-N-1 ammonium sulfate (δ15NAir = +0.43 mUr) and USGS32 potassium nitrate (δ15N = +180 mUr exactly) by on-line combustion, continuous-flow isotope-ratio mass spectrometry, and off-line dual-inlet isotope-ratio mass spectrometry.ResultsUSGS41a is isotopically homogeneous; the reproducibility of δ13C and δ15N is better than 0.07 mUr and 0.09 mUr, respectively, in 200-μg amounts. It has a δ13C value of +36.55 mUr relative to VPDB and a δ15N value of +47.55 mUr relative to N2 in air. USGS41 was found to be hydroscopic, probably due to the presence of pyroglutamic acid. Experimental results indicate that the chemical purity of USGS41a is substantially better than that of USGS41.ConclusionsThe new isotopic reference material USGS41a can be used with USGS40 (having a δ13CVPDB value of −26.39 mUr and a δ15NAir value of −4.52 mUr) for (i) analyzing local laboratory isotopic reference materials, and (ii) quantifying drift with time, mass-dependent isotopic fractionation, and isotope-ratio-scale contraction for isotopic analysis of biological and organic materials. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.

1H-15N correlation spectroscopy of nanocrystalline proteins

International Nuclear Information System (INIS)

Morcombe, Corey R.; Paulson, Eric K.; Gaponenko, Vadim; Byrd, R. Andrew; Zilm, Kurt W.

2005-01-01

The limits of resolution that can be obtained in 1 H- 15 N 2D NMR spectroscopy of isotopically enriched nanocrystalline proteins are explored. Combinations of frequency switched Lee-Goldburg (FSLG) decoupling, fast magic angle sample spinning (MAS), and isotopic dilution via deuteration are investigated as methods for narrowing the amide 1 H resonances. Heteronuclear decoupling of 15 N from the 1 H resonances is also studied. Using human ubiquitin as a model system, the best resolution is most easily obtained with uniformly 2 H and 15 N enriched protein where the amides have been exchanged in normal water, MAS at ∼20 kHz, and WALTZ-16 decoupling of the 15 N nuclei. The combination of these techniques results in average 1 H lines of only ∼0.26 ppm full width at half maximum. Techniques for optimizing instrument stability and 15 N decoupling are described for achieving the best possible performance in these experiments

13C- and 15N-labelled non-biogenic compounds used as stable isotope drugs for human liver function tests

International Nuclear Information System (INIS)

Krumbiegel, P.

1989-01-01

As a result of liver diseases, the elimination of certain drugs is retarded. After labelling a suitable drug with 13 C, the 13 CO 2 elimination rate serves as a liver function parameter. Current contributions to the 13 CO 2 breath test method are reviewed and related to the 14 CO 2 breath test proposals. In spite of several advantages of 13 C-labelled agents, some dissatisfaction has remained with the tests, especially at using them with infants. It is the necessity of face masks and the uncertainty to consider endogeneous CO 2 contributions diluting the exhaled 13 CO 2 . The problems are avoided if the other molecule site of the drug is labelled which is known to be eliminated via urine. With 15 N as a tracer, a suitable urine test using [ 15 N]-methacetin as agent has been proposed and put into practice. (author)

Stable isotope sup 15 N-urea and clinical research in nephrology

Energy Technology Data Exchange (ETDEWEB)

Sugino, Nobuhiro; Arai, Junko; Akimoto, Mitsuko; Miwa, Toichiro; Takuma, Takehide (Tokyo Women' s Medical Coll. (Japan))

1990-08-01

Stable isotope {sup 15}N-compound, {sup 15}N-urea, is useful marker to investigate nitrogen metabolism in clinical nephrology, particularly in chronic renal failure or dialysis. {sup 15}N-urea incorporation into plasma albumin in addition to plasma {sup 15}N disappearance was studied in 6 patients with endstage chronic renal failure. As a result, only minor fraction of administered {sup 15}N-urea was incorporated into albumin in this study. In addition, it was also confirmed that high energy diet may promote protein synthesis through {sup 15}N incorporation to plasma amino acids, such as alanine, in these patients with low protein meal. Therefore, administration of {sup 15}N-compound to human subjects may contribute to provide us the important informations on nitrogen metabolism. For instance, urea kinetics are described in the endstage chronic renal failure in this review. However, less expensive {sup 15}N-compounds should be provided and more simple but accurate measurement of {sup 15}N activity should be developed for the further clinical application of the stable isotope. (author).

Estimate of production of gaseous nitrogen in the human body based on (15)N analysis of breath N2 after administration of [(15)N2]urea.

Science.gov (United States)

Junghans, Peter

2013-01-01

After oral administration of [(15)N2]urea (1.5 mmol, 95 atom% (15)N), we found that breath N2 was significantly (15)N-labelled. The result suggests that molecular nitrogen in breath must be partly produced endogenously. Based on a metabolic model, the endogenous N2 production was estimated to be 0.40±0.25 mmol kg(-1) d(-1) or 2.9±1.8 % of the total (urinary and faecal) N excretion in fasted healthy subjects (n=4). In patients infected with Helicobacter pylori (n=5), the endogenous N2 production was increased to 1.24±0.59 mmol kg(-1) d(-1) or 9.0±4.3 % of the total N excretion compared to the healthy controls (pexchange measurements may be affected by endogenously produced nitrogen, especially in metabolic situations with elevated nitrosation, for instance in oxidative and nitrosative stress-related diseases such as H. pylori infections.

Dicty_cDB: FC-AJ15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT

Soil fertility, humic fractions and natural abundance of "1"3C and "1"5N in soil under different land use in Parana State, Southern Brazil

International Nuclear Information System (INIS)

Loss, Arcangelo; Pereia, Marcos Gervasio; Costa, Elias Mendes; Beutler, Sidinei Julio; Piccolo, Marisa de Cassia

2016-01-01

Humic fractions of soil organic matter (SOM) and measurements of "1"3C and "1"5N isotope can be used to highlight differences between management systems with different intensities of land use. This study characterized soil fertility, quantified carbon levels in the humic fractions and evaluated the natural abundance of "1"3C and "1"5N in systems cultivated under no-tillage system (NTS) and conventional tillage system (CTS) or used with secondary forest or perennial pasture in Marmeleiro, Parana State, Southern Brazil. NTS was more efficient than the conventional tillage system (CTS) in increasing pH (0.0-0.10 m layer), Ca (0.0-0.05 m layer), P (except 0.05-0.10 m layer) and N (0.0-0.10 m) levels, total organic carbon (TOC) stocks (0.0-0.20 and 0.0-0.40 m layers); carbon of the humin fraction (C-HUM) in 0.0-0.40 m; the fulvic acid fraction (C-FAF) and humic acid (C-HAF) in 0.0-0.05 m. The use of grasses, in NTS and pasture, increased TOC stocks compared to the other soil use or management systems evaluated in the 0.0-0.40 m layer. In the topsoil layer, the anthropogenic influence of plowing and harrowing in CTS promoted greater loss of carbon in C-HUM, C-FAF and C-HAF than NTS, forest and pasture. In CTS, growing corn for 42 years after the removal of forest cover did not alter the "1"3C at 0.0-0.40 m. In pasture, the absence of legumes, constant deposition of cattle manure and a more stable organic matter favored high "1"5N levels (except at 0.0-0.05 m in CTS). The decrease in "1"5N values from the 0.0-0.10 to 0.10-0.20 m layer in CTS indicates that soil turnover (by plowing and harrowing) has the potential to disturb the depth-related variation in soil "1"5N, accelerating decomposition and compromising N transformations. Among the variables analyzed, the determination of carbon in humic fractions and "1"5N values were efficient in identifying soil changes produced by land use or management systems

N-15-labelled pyrazines of triterpenic acids

Czech Academy of Sciences Publication Activity Database

Vlk, M.; Mičolová, P.; Urban, M.; Kvasnica, Miroslav; Šaman, David; Šarek, J.

2016-01-01

Roč. 308, č. 2 (2016), s. 733-739 ISSN 0236-5731 R&D Projects: GA ČR GJ15-08202Y; GA MŠk(CZ) LO1304; GA MŠk(CZ) LO1204 Grant - others:GA MŠk(CZ) LK21310; GA TA ČR(CZ) TA03010027; CTU(CZ) SGS15/094/OHK4/1T/14 Institutional support: RVO:61389030 ; RVO:61388963 Keywords : N-15 * Triterpenic acid * Isotopic labelling Subject RIV: CC - Organic Chemistry Impact factor: 1.282, year: 2016

Fertilizer-n uptake and distribution in rice plants using 15N tracer technique

International Nuclear Information System (INIS)

Yan Juan; Shen Qirong; Yin Bin; Wan Xinjun

2009-01-01

Fertilizer-nitrogen (N) uptake and distribution in rice were studied using 15 N tracer technique. The results obtained were as follows. At the tillering, jointing and booting, and anthesis stages, 23.1%, 8.3% and 19.9% of N were taken from fertilizer applied in base (N1), tillering (N2) and jointing and booting (N3), respectively. The 15 N translocation from anthesis to maturity was in the order of N3>N1>N2, but the 15 N translocation efficiency was higher in N1 (base fertilizer treatment) than in the other two treatments. At maturity, the 15 N distribution in straw in the treatments of N1, N2 and N3 was only 24.3%, 26.7% and 30.4%, respectively. No matter what time the N fertilizer was applied, the 15 N uptake was mostly distributed in leaves, then in the sheath, the least in stem, and 15 N distribution in spike increased with the increased 15 N translocation from nutritional organs to spike after anthesis. The study also showed that the 15 N uptake at maturity in N1, N2 and N3 treatments was 10.3%, 5.9% and 12.4%, respectively. The results indicated that (1) when soil N content was not high, the base fertilizer application was important to rice growth, and optimal increment might help increase tillering, and improve rice quality; (2) the initiation fertilizer significantly promoted quantities during grain filling, and thus application of N fertilizer in initiation was of considerable advance in increasing N harvest index (NHI); (3) the rice plants absorbed less N applied in tillering stage due to a big N loss in that period. Therefore a little bit increase of base N fertilizer with no or very small amount of tillering fertilizer, together with some topdressing of N fertilizer during initiation could improve N uptake by rice. (authors)

15 CFR 15.23 - Definitions.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 15.23 Section 15.23 Commerce and Foreign Trade Office of the Secretary of Commerce LEGAL PROCEEDINGS Involuntary Child and... approved under part D of title IV of the Social Security Act (42 U.S.C. 651-664), who has the duty or...

15N tracer kinetic studies on the validity of various 15N tracer substances for determining whole-body protein parameters in very small preterm infants

International Nuclear Information System (INIS)

Plath, C.; Heine, W.; Wutzke, K.D.; Krienke, L.; Toewe, J.M.; Massute, G.; Windischmann, C.

1987-01-01

Reliable 15 N tracer substances for tracer kinetic determination of whole-body protein parameters in very small preterm infants are still a matter of intensive research, especially after some doubts have been raised about the validity of [ 15 N]glycine, a commonly used 15 N tracer. Protein turnover, synthesis, breakdown, and further protein metabolism data were determined by a paired comparison in four preterm infants. Their post-conceptual age was 32.2 +/- 0.8 weeks, and their body weight was 1670 +/- 181 g. Tracer substances applied in this study were a [ 15 N]amino acid mixture (Ia) and [ 15 N]glycine (Ib). In a second group of three infants with a post conceptual age of 15 N-labeled 32.0 +/- 1.0 weeks and a body weight of 1,907 +/- 137 g, yeast protein hydrolysate (II) was used as a tracer substance. A three-pool model was employed for the analysis of the data. This model takes into account renal and fecal 15 N losses after a single 15 N pulse. Protein turnovers were as follows: 11.9 +/- 3.1 g kg-1 d-1 (Ia), 16.2 +/- 2.5 g kg-1 d-1 (Ib), and 10.8 +/- 3.0 g kg-1 d-1 (II). We were able to demonstrate an overestimation of the protein turnover when Ib was used. There was an expected correspondence in the results obtained from Ia and II. The 15 N-labeled yeast protein hydrolysate is a relatively cheap tracer that allows reliable determination of whole-body protein parameters in very small preterm infants

Accredited Standards Committee N15 Developments And Future Directions

International Nuclear Information System (INIS)

Mathews, Caroline E.; May, Melanie; Preston, Lynne

2009-01-01

Accredited Standards Committee (ASC) N15, Methods of Nuclear Material Control, is sponsored by the Institute of Nuclear Materials Management (INMM) to develop standards for protection, control and accounting of special nuclear materials in all phases of the nuclear fuel cycle, including analytical procedures where necessary and special to this purpose, except that physical protection of special nuclear material within a nuclear power plant is not included. Voluntary consensus standards complement federal regulations and technical standards and fulfill an important role for the nuclear regulatory agencies. This paper describes the N15 standards development process, with INMM as the Standards Developing Organization (SDO) and the N15 Committee responsible for implementation. Key components of the N15 standards development process include ANSI accreditation; compliance with the ANSI Essential Requirements (ER), coordination with other SDOs, communication with stakeholders, maintenance of balance between interest categories, and ANSI periodic audits. Recent and future ASC N15 activities are discussed, with a particular focus on new directions in anticipation of renewed growth in nuclear power.

/sup 15/N analysis in nutritional and metabolic research of infancy

Energy Technology Data Exchange (ETDEWEB)

Heine, W; Richter, I; Plath, C; Wutzke, K; Drescher, U [Rostock Univ. (German Democratic Republic). Bereich Medizin

1982-01-01

Investigation of protein metabolism in nutritional pediatric research by means of /sup 15/N tracer techniques has been relatively seldom used up to now. /sup 15/N-labelled compounds for these purposes are not injurious to health. The technique is based on oral or intravenous application of the tracer substances and on /sup 15/N analysis of the urine fractions. The subsequent calculation of protein synthesis and breakdown rate, turnover, and the reutilisation of amino acids from protein breakdown as well as the size of the metabolic pool offers detailed information of protein metabolism. Determination of these parameters were performed in infants on breast milk, formula feeding and on chemically defined diet. As an example of utilisation of D-amino acids for protein synthesis the /sup 15/N-D-phenylalanine retention of parenteral nutrition was found to be 33% of the applied doses at an average. An oral /sup 15/N-glycine loading test proved to be of value for the prediction of the therapeutic effect of human growth hormone. /sup 15/N tracer technique was also tested in utilizing /sup 15/N-urea for bacterial protein synthesis of the intestinal flora and by incorporation of /sup 15/N from /sup 15/N-glycine and /sup 15/N-lysine into the jejunal mucosa for measuring the enterocyte regeneration.

Simultaneous determination of 14N and 15N isotopes in opium by proton induced γ-ray emission technique

International Nuclear Information System (INIS)

Pritty Rao; Reddy, G.L.N.; Vikram Kumar, S.; Ramana, J.V.; Raju, V.S.; Sanjiv Kumar

2012-01-01

The paper describes the simultaneous determination of 14 N and 15 N isotopes in opium by proton induced γ-ray emission (PIGE) technique. The isotopic ratio of 14 N and 15 N is a useful parameter for assigning provenance of (seized) illicit drugs. The measurement, non-destructive in nature, is performed on pellets made up of opium powders and is based on the prompt detection of 2.313 and 4.4 MeV γ-rays emanating from 14 N(p,p'γ) 14 N and 15 N(p,αγ) 12 C nuclear reactions respectively, induced simultaneously by 3.6-3.8 MeV proton beam. Positive as well as negative deviations from the natural isotopic abundance (99.63:0.37) were observed in the samples. The precision of the measurements is about 4%. The methodology provides an easy and rapid approach to determine the isotopic ratio of 14 N and 15 N and has been used for the first time in the analysis of opium. (author)

Biosynthesis of agmatine in isolated mitochondria and perfused rat liver: studies with 15N-labelled arginine

Science.gov (United States)

2005-01-01

An important but unresolved question is whether mammalian mitochondria metabolize arginine to agmatine by the ADC (arginine decarboxylase) reaction. 15N-labelled arginine was used as a precursor to address this question and to determine the flux through the ADC reaction in isolated mitochondria obtained from rat liver. In addition, liver perfusion system was used to examine a possible action of insulin, glucagon or cAMP on a flux through the ADC reaction. In mitochondria and liver perfusion, 15N-labelled agmatine was generated from external 15N-labelled arginine. The production of 15N-labelled agmatine was time- and dose-dependent. The time-course of [U-15N4]agmatine formation from 2 mM [U-15N4]arginine was best fitted to a one-phase exponential curve with a production rate of approx. 29 pmol·min−1·(mg of protein)−1. Experiments with an increasing concentration (0– 40 mM) of [guanidino-15N2]arginine showed a Michaelis constant Km for arginine of 46 mM and a Vmax of 3.7 nmol·min−1·(mg of protein)−1 for flux through the ADC reaction. Experiments with broken mitochondria showed little changes in Vmax or Km values, suggesting that mitochondrial arginine uptake had little effect on the observed Vmax or Km values. Experiments with liver perfusion demonstrated that over 95% of the effluent agmatine was derived from perfusate [guanidino-15N2]arginine regardless of the experimental condition. However, the output of 15N-labelled agmatine (nmol·min−1·g−1) increased by approx. 2-fold (P<0.05) in perfusions with cAMP. The findings of the present study provide compelling evidence that mitochondrial ADC is present in the rat liver, and suggest that cAMP may stimulate flux through this pathway. PMID:15656789

Mercury and stable isotopes (δ15N and δ13C as tracers during the ontogeny of Trichiurus lepturus

Directory of Open Access Journals (Sweden)

Ana Paula Madeira Di Beneditto

Full Text Available This study applies total mercury (THg concentration and stable isotope signature (δ15N and δ13C to evaluate the trophic status and feeding ground of Trichiurus lepturus during its ontogeny in northern Rio de Janeiro, south-eastern Brazil. The trophic position of T. lepturus is detected well by THg and δ15N as the sub-adult planktivorous specimens are distinct from the adult carnivorous specimens. The δ13C signatures suggest a feeding ground associated with marine coastal waters that are shared by fish in different ontogenetic phases. The diet tracers indicated that the fish feeding habits do not vary along seasons of the year, probably reflecting the prey availability in the study area. This fish has economic importance and the concentration of THg was compared to World Health Organization limit, showing that the adult specimens of T. lepturus are very close to the tolerable limit for safe regular ingestion.

Combined solid state and solution NMR studies of {alpha},{epsilon}-{sup 15}N labeled bovine rhodopsin

Energy Technology Data Exchange (ETDEWEB)

Werner, Karla; Lehner, Ines [Johann Wolfgang Goethe-Universitaet Frankfurt, Center for Biomolecular Magnetic Resonance (Germany); Dhiman, Harpreet Kaur [University of Pittsburgh School of Medicine, Department of Structural Biology (United States); Richter, Christian; Glaubitz, Clemens; Schwalbe, Harald, E-mail: schwalbe@nmr.uni-frankfurt.de; Klein-Seetharaman, Judith [Johann Wolfgang Goethe-Universitaet Frankfurt, Center for Biomolecular Magnetic Resonance (Germany); Khorana, H. Gobind [Massachusetts Institute of Technology, Departments of Biology and Chemistry (United States)], E-mail: khorana@mit.edu

2007-04-15

Rhodopsin is the visual pigment of the vertebrate rod photoreceptor cell and is the only member of the G protein coupled receptor family for which a crystal structure is available. Towards the study of dynamics in rhodopsin, we report NMR-spectroscopic investigations of {alpha},{epsilon}-{sup 15}N-tryptophan labeled rhodopsin in detergent micelles and reconstituted in phospholipids. Using a combination of solid state {sup 13}C,{sup 15}N-REDOR and HETCOR experiments of all possible {sup 13}C'{sub i-1} carbonyl/{sup 15}N{sub i}-tryptophan isotope labeled amide pairs, and H/D exchange {sup 1}H,{sup 15}N-HSQC experiments conducted in solution, we assigned chemical shifts to all five rhodopsin tryptophan backbone {sup 15}N nuclei and partially to their bound protons. {sup 1}H,{sup 15}N chemical shift assignment was achieved for indole side chains of Trp35{sup 1.30} and Trp175{sup 4.65}. {sup 15}N chemical shifts were found to be similar when comparing those obtained in the native like reconstituted lipid environment and those obtained in detergent micelles for all tryptophans except Trp175{sup 4.65} at the membrane interface. The results suggest that the integrated solution and solid state NMR approach presented provides highly complementary information in the study of structure and dynamics of large membrane proteins like rhodopsin.

A liver-function test using 15N-labelled ammonium chloride

International Nuclear Information System (INIS)

Jung, K.; Hirscherg, K.; Faust, H.; Matkowitz, R.

1985-01-01

Malfunction of the liver involves disturbances of urea synthesis and ammonia detoxification. These phenomena became apparent, especially during ammonia loading of patients. The functional state of the liver can be assessed by oral administration of 15 NH 4 Cl and subsequent analysis of 15 N-urea and 15 N-ammonia in urine by emission spectrometry. Clinical tests based on the ratio of the excess abundances (see Appendix) of 15 N-ammonia to 15 N-urea excreted in urine 3 h after oral administration gave values for patients with liver disease which differed significantly from those for healthy subjects. Absorption disturbances, which often accompany liver diseases, do not influence the effectiveness of the method. (orig.)

Liver-function test using /sup 15/N-labelled ammonium chloride

Energy Technology Data Exchange (ETDEWEB)

Jung, K; Hirscherg, K; Faust, H; Matkowitz, R

1985-08-01

Malfunction of the liver involves disturbances of urea synthesis and ammonia detoxification. These phenomena became apparent, especially during ammonia loading of patients. The functional state of the liver can be assessed by oral administration of /sup 15/NH/sub 4/Cl and subsequent analysis of /sup 15/N-urea and /sup 15/N-ammonia in urine by emission spectrometry. Clinical tests based on the ratio of the excess abundances (see Appendix) of /sup 15/N-ammonia to /sup 15/N-urea excreted in urine 3 h after oral administration gave values for patients with liver disease which differed significantly from those for healthy subjects. Absorption disturbances, which often accompany liver diseases, do not influence the effectiveness of the method.

Balance study of the fate of 15N fertilizer

International Nuclear Information System (INIS)

Korte, F.; Sotiriou, N.

1980-01-01

An interim report is presented on a series of experiments with wooden box-type lysimeters (60 cm x 60 cm x 70 cm) loaded with a sandy soil, a loess soil and straw-amended soil. The lysimeters support crops rotated over a five-year period to be studied - potato, barley, sugar-beet, barley (with winter rape) and finally (1979) potato. Each lysimeter received split applications of urea at total rates of 0, 50 or 100 kg.ha -1 . The effects of soil residues of the herbicide monolinuron were also studied. The report deals with data collected during the first three years of the planned experiments (1975 - 1977 inclusive). 15 N-labelled urea (47 atom 15 N% excess) was initially used but in some experiments this was followed by applications of unlabelled urea in order to study the fate of the residual 15 N in the subsequent years. The results to date indicated that in the first year highest recoveries in the plant of the applied 15 N obtained on the sandy soil. The low recoveries of 15 N in the subsequent years when unlabelled urea was supplied also indicated significant storage by soil or root organic matter of the applied 15 N. Compared with the control (zero application of urea nitrogen), potato took up more total nitrogen in the presence of fertilizer including more of the unlabelled soil pool nitrogen. Analyses of the soil profiles in terms of total soil nitrogen and fertilizer-derived nitrogen (on the basis of 15 N assays) indicated leaching of the labelled nitrogen down the soil profile in all cases during the three-year period. Analysis of NO 3 -N in leachates confirmed the presence of labelled urea-derived nitrogen. (author)

Studies of 15N transamination following application of various tracer substances. 1

International Nuclear Information System (INIS)

Schadereit, R.; Krawielitzki, K.; Herrmann, U.

1986-01-01

4 groups of 3 growing Wistar rats each were orally given 15 N-labelled methionine, lysine, glycine and ammonia sulphate, resp., over 10 days. Measuring the 15 N accumulation in the amino acids (AA) of the body protein, the transamination of the individual 15 N substances and thus their suitability as tracer substances for studies of N metabolism was determined. None of the tested 15 N-AA achieved a proportionate labelling of all AA of the body protein. The AA used as tracer in each case showed the highest 15 N labelling. Of the amino- 15 N detected in the animal body, about 19% were found in Met after 15 N Met application, 88% in Lys after 15 N Lys application and 50% in Gly after 15 N Gly application. After the application of 15 N-ammonia sulphate about 42% of the body amino- 15 N are apportioned to the essential and 58% to the non-essential AA. Thus, this substance produces a more proportional labelling of the essential and non-essential AA of the body protein than 15 N-Gly. The following quotas of the 15 N amounts applied were found in the AA of the animal bodies: tracer substance lysine 52%, glycine 32%, ammonia sulphate 24%, methionine 21%. After summing up the amino acid 15 N amounts in the animal body, eliminating in each case the tracer AA and taking into account the molecular weight of the AA, there was a good agreement of the intensity of the accumulation of 15 N in the individual AA, irrespective of the applied tracer substance. (author)

NMR 1H,13C, 15N backbone and 13C side chain resonance assignment of the G12C mutant of human K-Ras bound to GDP.

Science.gov (United States)

Sharma, Alok K; Lee, Seung-Joo; Rigby, Alan C; Townson, Sharon A

2018-05-02

K-Ras is a key driver of oncogenesis, accounting for approximately 80% of Ras-driven human cancers. The small GTPase cycles between an inactive, GDP-bound and an active, GTP-bound state, regulated by guanine nucleotide exchange factors and GTPase activating proteins, respectively. Activated K-Ras regulates cell proliferation, differentiation and survival by signaling through several effector pathways, including Raf-MAPK. Oncogenic mutations that impair the GTPase activity of K-Ras result in a hyperactivated state, leading to uncontrolled cellular proliferation and tumorogenesis. A cysteine mutation at glycine 12 is commonly found in K-Ras associated cancers, and has become a recent focus for therapeutic intervention. We report here 1 H N, 15 N, and 13 C resonance assignments for the 19.3 kDa (aa 1-169) human K-Ras protein harboring an oncogenic G12C mutation in the GDP-bound form (K-RAS G12C-GDP ), using heteronuclear, multidimensional NMR spectroscopy. Backbone 1 H- 15 N correlations have been assigned for all non-proline residues, except for the first methionine residue.

Metabolic studies in colostomized laying hens using 15N-labelled wheat. 4

International Nuclear Information System (INIS)

Gruhn, K.; Glotz, D.

1979-01-01

3 colostomized laying hybrids received over 4 days a dosage of 672 mg 15 N excess ( 15 N'), 20.3 mg lysine 15 N', 23.0 mg histidine 15 N' and 66.7 mg arginine 15 N' with a ration customary in production. After feeding the same unlabelled ration for another 4 days the hens were killed and the N content of the blood as well as of its fractions (cells, plasma, free amino acids of the plasma) was determined. The 15 N' was determined in the total blood, the corpuscles, the plasma, the nonprotein-N (NPN) fraction as well as in the amino acids lysine, histidine and arginine. The average amount of the blood cell N in the total blood N was 58.5% and that of the plasma 40.3%; the corresponding 15 N' values amounted to 66.1% and 33.9%, respectively. The sum of the 15 N' of the basic amino acids of the blood cells, on an average, amounted to 39.7% of the total cell 15 N'; the corresponding average value for the total 15 N' in lysine, histidine and arginine of the blood plasma 15 N' was 23.6.% and the quota of the three free amino acids of the total NP 15 N' of the plasma was 6.2%. (author)

Results from the BRACE 1.5 study: Climate change impacts of 1.5 C and 2 C warming

Science.gov (United States)

O'Neill, B. C.; Anderson, B.; Monaghan, A. J.; Ren, X.; Sanderson, B.; Tebaldi, C.

2017-12-01

In 2015, 195 countries negotiated the Paris Agreement on climate change, which set long-term goals of limiting global mean warming to well below 2 C and possibly 1.5 C. This event stimulated substantial scientific interest in climate outcomes and impacts on society associated with those levels of warming. Recently, the first set of global climate model simulations explicitly designed to meet those targets were undertaken with the Community Earth System Model (CESM) for use by the research community (Sanderson et al, accepted). The BRACE 1.5 project models societal impacts from these climate outcomes, combined with assumptions about future socioeconomic conditions according to the Shared Socioeconomic Pathways. These analyses build on a recently completed study of the Benefits of Reduced Anthropogenic Climate changE (BRACE), published as a set of 20 papers in Climatic Change, which examined the difference in impacts between two higher scenarios resulting in about 2.5 C and 3.7 C warming by late this century. BRACE 1.5 consists of a set of six papers to be submitted to a special collection in Environmental Research Letters that takes a similar approach but focuses on impacts at 1.5 and 2 C warming. We ask whether impacts differ substantially between the two climate scenarios, accounting for uncertainty in climate outcomes through the use of initial condition ensembles of CESM simulations, and in societal conditions by using alternative SSP-based development pathways. Impact assessment focuses on the health and agricultural sectors; modeling approaches include the use of a global mutli-region CGE model for economic analysis, both a process-based and an empirical crop model, a model of spatial population change, a model of climatic suitability for the aedes aegypti mosquito, and an epidemiological model of heat-related mortality. A methodological analysis also evaluates the use of climate model emulation techniques for providing climate information sufficient to

15N-labelled pyrazines of triterpenic acids

International Nuclear Information System (INIS)

Vlk, Martin; Micolova, Petra; Sarek, Jan

2016-01-01

Triterpenoid pyrazines from our research group were found selectively cytotoxic on several cancer cell lines with IC 50 in low micromolar range. This sparked our interest in preparing their labeled analogs for metabolic studies. In this work, we prepared a set of non-labeled pyrazines from seven triterpenoid skeletal types along with their 15 N labelled analogs. In this work, we present the synthesis and characterization of the target 15 N labelled pyrazines. Currently, these compounds are being studied in complex metabolic studies. (author)

Doubly 15N-substituted diazenylium: THz laboratory spectra and fractionation models

Science.gov (United States)

Dore, L.; Bizzocchi, L.; Wirström, E. S.; Degli Esposti, C.; Tamassia, F.; Charnley, S. B.

2017-07-01

Context. Isotopic fractionation in dense molecular cores has been suggested as a possible origin of large 14N/15N ratio variations in solar system materials. While chemical models can explain some observed variations with different fractionation patterns for molecules with -NH or -CN functional groups, they fail to reproduce the observed ratios in diazenylium (N2H+). Aims: Observations of doubly 15N-substituted species could provide important constraints and insights for theoretical chemical models of isotopic fractionation. However, spectroscopic data are very scarce. Methods: The rotational spectra of the fully 15N-substituted isopologues of the diazenylium ion, 15N2H+ and 15N2D+, have been investigated in the laboratory well into the THz region by using a source-modulation microwave spectrometer equipped with a negative glow discharge cell. An extended chemical reaction network has been used to estimate what ranges of 15N fractionation in doubly 15N-substituted species could be expected in the interstellar medium (ISM). Results: For each isotopologue of the H- and D-containing pair, nine rotational transitions were accurately measured in the frequency region 88 GHz-1.2 THz. The analysis of the spectrum provided very precise rest frequencies at millimeter and sub-millimeter wavelengths, useful for the radioastronomical identification of the rotational lines of 15N2H+ and 15N2D+ in the ISM.

{sup 13}C, {sup 15}N Resonance Assignment of Parts of the HET-s Prion Protein in its Amyloid Form

Energy Technology Data Exchange (ETDEWEB)

Siemer, Ansgar B. [Physical Chemistry (Switzerland); Ritter, Christiane [Salk Institute, Structural Biology Laboratory (United States); Steinmetz, Michel O. [Paul Scherrer Institut, Biomolecular Research, Structural Biology (Switzerland); Ernst, Matthias [Physical Chemistry (Switzerland); Riek, Roland [Salk Institute, Structural Biology Laboratory (United States); Meier, Beat H. [Physical Chemistry (Switzerland)

2006-02-15

The partial {sup 15}N and {sup 13}C solid-state NMR resonance assignment of the HET-s prion protein fragment 218-289 in its amyloid form is presented. It is based on experiments measured at MAS frequencies in the range of 20-40 kHz using exclusively adiabatic polarization-transfer schemes. The resonance assignment within each residue is based on two-dimensional {sup 13}C--{sup 13}C correlation spectra utilizing the DREAM mixing scheme. The sequential linking of the assigned residues used a set of two- and three-dimensional {sup 15}N--{sup 13}C correlation experiments. Almost all cross peaks visible in the spectra are assigned, but only resonances from 43 of the 78 amino-acid residues could be detected. The missing residues are thought to be highly disordered and/or highly dynamic giving rise to broad resonance lines that escaped detection in the experiments applied. The line widths of the observed resonances are narrow and comparable to line widths observed in micro-crystalline samples. The 43 assigned residues are located in two fragments of about 20 residues.

15N/14N isotopic ratio and statistical analysis: an efficient way of linking seized Ecstasy tablets

International Nuclear Information System (INIS)

Palhol, Fabien; Lamoureux, Catherine; Chabrillat, Martine; Naulet, Norbert

2004-01-01

In this study, the 15 N/ 14 N isotopic ratios of 106 samples of 3,4-methylenedioxymethamphetamine (MDMA) extracted from Ecstasy tablets are presented. These ratios, measured using gas chromatography-combustion-isotope ratio mass spectrometry (GC-C-IRMS), show a large discrimination between samples with a range of δ 15 N values between -17 and +19%o, depending on the precursors and the method used in clandestine laboratories. Thus, δ 15 N values can be used in a statistical analysis carried out in order to link Ecstasy tablets prepared with the same precursors and synthetic pathway. The similarity index obtained after principal component analysis and hierarchical cluster analysis appears to be an efficient way to group tablets seized in different places

Geomorphic control on the δ15N of mountain forests

Directory of Open Access Journals (Sweden)

R. G. Hilton

2013-03-01

Full Text Available Mountain forests are subject to high rates of physical erosion which can export particulate nitrogen from ecosystems. However, the impact of geomorphic processes on nitrogen budgets remains poorly constrained. We have used the elemental and isotopic composition of soil and plant organic matter to investigate nitrogen cycling in the mountain forest of Taiwan, from 24 sites with distinct geomorphic (topographic slope and climatic (precipitation, temperature characteristics. The organic carbon to nitrogen ratio of soil organic matter decreased with soil 14C age, providing constraint on average rates of nitrogen loss using a mass balance model. Model predictions suggest that present day estimates of nitrogen deposition exceed contemporary and historic nitrogen losses. We found ∼6‰ variability in the stable isotopic composition (δ15N of soil and plants which was not related to soil 14C age or climatic conditions. Instead, δ15N was significantly, negatively correlated with topographic slope. Using the mass balance model, we demonstrate that the correlation can be explained by an increase in nitrogen loss by non-fractioning pathways on steeper slopes, where physical erosion most effectively removes particulate nitrogen. Published data from forests on steep slopes are consistent with the correlation. Based on our dataset and these observations, we hypothesise that variable physical erosion rates can significantly influence soil δ15N, and suggest particulate nitrogen export is a major, yet underappreciated, loss term in the nitrogen budget of mountain forests.

Synthesis of 15N isotope labeled alanine

International Nuclear Information System (INIS)

Oliveira, Claudineia R. de; Bendassolli, Jose Albertino; Sant'Ana, Carlos Roberto; Tagliassachi, Romulo Barbieri; Maximo, Everaldo; Prestes, Clelber Vieira

2005-01-01

The application of light chemical elements and their stable isotopes in biological studies have been increased over the last years. The use of 15 N labeled amino acids is an important tool for elucidation of peptides structures. This paper describe a method for the synthesis of 15 N isotope labeled alanine at lower costs than international ones, as well as the details of the recovery system of the nitrogen residues. In the present work an amination of α-haloacids, with the bromopropionic carboxylic acid and labeled aqua ammonia ( 15 NH 3 aq) was carried out. In order to avoid eventually losses of 15 NH 3 , special cares were adopted, since the production cost is high. Although the acquisition cost of the 13 N (radioactive) labeled compounds is lower, the obtained stable tracer will allow the accomplishment of important studies of the nitrogen cycling in living things, less occupational and environment hazards, and the time limitation problems in field studies. The tests took place in triplicates with NH 3 (aq) being employed. With the establishment of the system for 15 NH 3 recovery, an average of 94 % of the ammonia employed in the synthesis process was recovered. The purity of the amino acid was state determined by TLC (Thin Layer Chromatography) and HPLC (High-Performance Liquid Chromatography) with a fluorescence detector. The Rf and the retention time of the synthesized sample were similar the sigma standard. Finally, regarding the established conditions, it was possible to obtain the alanine with a production cost about 40 % lower than the international price. (author)

Coral skeletal {delta}{sup 15}N reveals isotopic traces of an agricultural revolution

Energy Technology Data Exchange (ETDEWEB)

Marion, Guy S. [Department of Biological Sciences, Stanford University, Stanford, CA 94305 (United States)]. E-mail: g.marion@uq.edu.au; Dunbar, Robert B. [Department of Geological and Environmental Sciences, Stanford University, Stanford, CA 94305 (United States); Mucciarone, David A. [Department of Geological and Environmental Sciences, Stanford University, Stanford, CA 94305 (United States); Kremer, James N. [Department of Marine Sciences, University of Connecticut at Avery Point, Groton, CT 06340 (United States); Lansing, J. Stephen [Department of Anthropology, University of Arizona, Tucson, AZ 85721 (United States); Arthawiguna, Alit [Installation for Agricultural Research (IP 2TP), Kotak Pos 3480, Denpasar, Bali (Indonesia)

2005-09-01

This study introduces a new method of tracing the history of nutrient loading in coastal oceans via {delta}{sup 15}N analysis of organic nitrogen preserved in the skeleton of the massive Porites coral. Four coral cores were collected in Bali, Indonesia, from reefs exposed to high levels of fertilizers in agricultural run-off, from lagoonal corals impacted by sewage, and from a reef located 30 km offshore. Skeletal {delta}{sup 15}N in the agriculturally exposed coral declined from 10.7 {+-} 0.4 per mille in 1970-1971, when synthetic fertilizers (-0.8 per mille {+-} 0.2 per mille ) were introduced to Bali, to a depleted 'anthropogenic' baseline of 3.5 per mille {+-} 0.4% in the mid-1990s. {delta}{sup 15}N values were negatively correlated with rainfall, suggesting that marine {delta}{sup 15}N lowers during flood-born influxes of waste fertilizers. Reef cores exposed to untreated sewage in terrestrial discharge were enriched (7.8 and 7.3 {+-} 0.4 per mille ), while the offshore core reflected background oceanic signals (6.2 {+-} 0.4 per mille). {delta}{sup 15}N, N concentration, and C:N systematics indicate that the N isotopic composition of skeletal organic matter was generally well preserved over 30 years. We suggest that skeletal organic {delta}{sup 15}N can serve as a recorder of past nitrogen sources. In Bali, this tracer suggests that the intensification of Western style agricultural practices since 1970 are contributing to the degradation of coastal coral reefs.

Density and viscosity of aqueous solutions of N,N-dimethylethanolamine at p = 0.1 MPa from T = (293.15 to 363.15) K

Energy Technology Data Exchange (ETDEWEB)

Bernal-Garcia, J. Manuel [Instituto Mexicano del Petroleo, Mexico D.F. C.P. 07330 (Mexico); Hall, Kenneth R. [Chemical Engineering Department, Texas A and M University, College Station, TX 77843 (United States); Estrada-Baltazar, Alejandro [Departamento de Ingenieria Quimica, Instituto Tecnologico de Celaya, Celaya, Guanajuato, CP 38010 (Mexico); Iglesias-Silva, Gustavo A. [Departamento de Ingenieria Quimica, Instituto Tecnologico de Celaya, Celaya, Guanajuato, CP 38010 (Mexico)]. E-mail: gais@iqcelaya.itc.mx

2005-08-15

This work presents atmospheric density and viscosity values for (N,N-dimethylethanolamine + water) over the entire composition range from T (293.15 to 363.15) K for density and from T = (313.15 to 353.15) K for viscosity. Density measurements come from a vibrating tube densimeter while we have used three different Cannon-Fenske viscosimeters for the viscosity measurements. Excess molar volumes and viscosity deviations are calculated using a Redlich-Kister type equation. Excess molar volumes present negative deviations from ideality and viscosity deviations are positive at all temperatures and compositions in this work.

Density and viscosity of aqueous solutions of N,N-dimethylethanolamine at p = 0.1 MPa from T = (293.15 to 363.15) K

International Nuclear Information System (INIS)

Bernal-Garcia, J. Manuel; Hall, Kenneth R.; Estrada-Baltazar, Alejandro; Iglesias-Silva, Gustavo A.

2005-01-01

This work presents atmospheric density and viscosity values for (N,N-dimethylethanolamine + water) over the entire composition range from T (293.15 to 363.15) K for density and from T = (313.15 to 353.15) K for viscosity. Density measurements come from a vibrating tube densimeter while we have used three different Cannon-Fenske viscosimeters for the viscosity measurements. Excess molar volumes and viscosity deviations are calculated using a Redlich-Kister type equation. Excess molar volumes present negative deviations from ideality and viscosity deviations are positive at all temperatures and compositions in this work

Effect of local sugar and base geometry on {sup 13}C and {sup 15}N magnetic shielding anisotropy in DNA nucleosides

Energy Technology Data Exchange (ETDEWEB)

Brumovska, Eva [University of South Bohemia and Biology Centre AS CR v.v.i., Faculty of Science (Czech Republic); Sychrovsky, Vladimir; Vokacova, Zuzana [Institute of Organic Chemistry and Biochemistry, AS CR v.v.i. (Czech Republic); Sponer, Jiri [Institute of Biophysics, AS CR v.v.i. (Czech Republic); Schneider, Bohdan [Biotechnological Institute AS CR (Czech Republic); Trantirek, Lukas [University of South Bohemia and Biology Centre AS CR v.v.i., Faculty of Science (Czech Republic)], E-mail: trant@paru.cas.cz

2008-11-15

Density functional theory was employed to study the dependence of {sup 13}C and {sup 15}N magnetic shielding tensors on the glycosidic torsion angle ({chi}) and conformation of the sugar ring in 2'-deoxyadenosine, 2'-deoxyguanosine, 2'-deoxycytidine, and 2'-deoxythymidine. In general, the magnetic shielding of the glycosidic nitrogens and the sugar carbons was found to depend on both the conformation of the sugar ring and {chi}. Our calculations indicate that the magnetic shielding anisotropy of the C6 atom in pyrimidine and the C8 atom in purine bases depends strongly on {chi}. The remaining base carbons were found to be insensitive to both sugar pucker and {chi} re-orientation. These results call into question the underlying assumptions of currently established methods for interpreting residual chemical shift anisotropies and {sup 13}C and {sup 15}N auto- and cross-correlated relaxation rates and highlight possible limitations of DNA applications of these methods.

The Influence of Seed-borne N in 15N Isotope Dilution Studies with Legumes The Influence of Seed-borne N in 15N Isotope Dilution Studies with Legumes

DEFF Research Database (Denmark)

Jensen, Erik Steen; Andersen, A. J.; Thomsen, J. D.

1985-01-01

The distriution of seed-borne N in shoot and root of pea and field bean was studied using three methods: 1) determination of the N content in shoot and root of plants grown in sand culture without other N sources. 2) 15N isotope dilution in plants grown in Rhizobium-free medium supplied with 15N-...... of corrections for seed-borne N in studies of nitrogen fixation in legumes is discussed....

Comparison of halo of 11Be, 15C, and 19C

Science.gov (United States)

Kharab, R.; Kumar, R.; Singh, P.; Sharma, H. C.

2007-12-01

We have compared the halo of 11Be, 15C, and 19C nuclei by analyzing the one-neutron stripping reaction data on the Be target at 60-, 54-, and 57-MeV/ A beam energies, respectively, within the framework of the eikonal approximation approach. The determination of effective range through the comparison of the total cross section data and prediction has revealed that the halo of 19C is the well developed, while that of 15C is the least and that of 11Be lies in between these two. The longitudinal momentum distribution data also strengthen these observations.

δ15N of seagrass leaves for monitoring anthropogenic nutrient increases in coral reef ecosystems

International Nuclear Information System (INIS)

Yamamuro, M.; Kayanne, H.; Yamano, H.

2003-01-01

In a coral reef environment, a slight increase in dissolved inorganic nitrogen (DIN;≥1.0 μM) can alter the ecosystem via macroalgal blooms. We collected seagrass leaves from the tropical and subtropical Pacific Ocean in five countries and examined the interactions between nutrient concentrations (C, N, P), molar ratios of nutrients, and δ 15 N to find a possible indicator of the DIN conditions. Within most sites, the concentrations of nutrients and their molar ratios showed large variations owing to species-specific values. On the other hand, almost identical δ 15 N values were found in seagrass leaves of several species at each site. The correlations between δ 15 N and nutrient concentrations and between δ 15 N and molar ratios of nutrients suggested that nutrient availability did not affect the δ 15 N value of seagrass leaves by altering the physiological condition of the plants. Increases in δ 15 N of seagrass leaves mostly matched increases in DIN concentrations in the bottom water. We suggest that δ 15 N in seagrass leaves can be a good tool to monitor time-integrated decrease/increase of DIN concentrations at a site, both in the water column and the interstitial water

Estimate of symbiotically fixed nitrogen in field grown soybeans using variations in 15N natural abundance

International Nuclear Information System (INIS)

Amarger, N.; Durr, J.C.; Bourguignon, C.; Lagacherie, B.; Mariotti, A.; Mariotti, F.

1979-01-01

The use of variations in natural abundance of 15 N between nitrogen fixing and non nitrogen fixing soybeans was investigated for quantitative estimate of symbiotic nitrogen fixation. Isotopic analysis of 4 varieties of inoculated and non-inoculated soybeans growing under field conditions, with and without N-fertilizer was determined. It was found that inoculated soybeans had a significantly lower 15 N content than non-inoculated ones. Estimates of the participation of fixed N to the total nitrogen content of inoculated soybeans were calculated from these differences. They were compared to estimates calculated from differences in N yield between inoculated and non-inoculated plants and to the nitrogenase activity, measured by the C 2 H 2 reduction assay over the growing season. Estimates given by the 15 N measurements were correlated with the C 2 H 2 reducing activity but not with the differences in the N yield. This shows that the isotopic composition was dependent on the amount of fixed nitrogen and consequently that the estimates of fixed nitrogen based on natural 15 N abundance should be reliable. The absence of correlation between estimates based on 15 N content and estimates based on N yield was explained by differences in the uptake of soil nitrogen between inoculated and non inoculated soybeans. (Auth.)

Compound-specific δ15N amino acid measurements in littoral mussels in the California upwelling ecosystem: a new approach to generating baseline δ15N Isoscapes for coastal ecosystems.

Directory of Open Access Journals (Sweden)

Natasha L Vokhshoori

Full Text Available We explored δ(15N compound-specific amino acid isotope data (CSI-AA in filter-feeding intertidal mussels (Mytilus californianus as a new approach to construct integrated isoscapes of coastal primary production. We examined spatial δ(15N gradients in the California Upwelling Ecosystem (CUE, determining bulk δ(15N values of mussel tissue from 28 sites between Port Orford, Oregon and La Jolla, California, and applying CSI-AA at selected sites to decouple trophic effects from isotopic values at the base of the food web. Bulk δ(15N values showed a strong linear trend with latitude, increasing from North to South (from ∼ 7‰ to ∼ 12‰, R(2 = 0.759. In contrast, CSI-AA trophic position estimates showed no correlation with latitude. The δ(15N trend is therefore most consistent with a baseline δ(15N gradient, likely due to the mixing of two source waters: low δ(15N nitrate from the southward flowing surface California Current, and the northward transport of the California Undercurrent (CUC, with (15N-enriched nitrate. This interpretation is strongly supported by a similar linear gradient in δ(15N values of phenylalanine (δ(15NPhe, the best AA proxy for baseline δ(15N values. We hypothesize δ(15N(Phe values in intertidal mussels can approximate annual integrated δ(15N values of coastal phytoplankton primary production. We therefore used δ(15N(Phe values to generate the first compound-specific nitrogen isoscape for the coastal Northeast Pacific, which indicates a remarkably linear gradient in coastal primary production δ(15N values. We propose that δ(15N(Phe isoscapes derived from filter feeders can directly characterize baseline δ(15N values across major biochemical provinces, with potential applications for understanding migratory and feeding patterns of top predators, monitoring effects of climate change, and study of paleo- archives.

An automated GC-C-GC-IRMS setup to measure palaeoatmospheric δ13C-CH4, δ15N-N2O and δ18O-N2O in one ice core sample

Directory of Open Access Journals (Sweden)

P. Sperlich

2013-08-01

Full Text Available Air bubbles in ice core samples represent the only opportunity to study the mixing ratio and isotopic variability of palaeoatmospheric CH4 and N2O. The highest possible precision in isotope measurements is required to maximize the resolving power for CH4 and N2O sink and source reconstructions. We present a new setup to measure δ13C-CH4, δ15N-N2O and δ18O-N2O isotope ratios in one ice core sample and with one single IRMS instrument, with a precision of 0.09, 0.6 and 0.7‰, respectively, as determined on 0.6–1.6 nmol CH4 and 0.25–0.6 nmol N2O. The isotope ratios are referenced to the VPDB scale (δ13C-CH4, the N2-air scale (δ15N-N2O and the VSMOW scale (δ18O-N2O. Ice core samples of 200–500 g are melted while the air is constantly extracted to minimize gas dissolution. A helium carrier gas flow transports the sample through the analytical system. We introduce a new gold catalyst to oxidize CO to CO2 in the air sample. CH4 and N2O are then separated from N2, O2, Ar and CO2 before they get pre-concentrated and separated by gas chromatography. A combustion unit is required for δ13C-CH4 analysis, which is equipped with a constant oxygen supply as well as a post-combustion trap and a post-combustion GC column (GC-C-GC-IRMS. The post-combustion trap and the second GC column in the GC-C-GC-IRMS combination prevent Kr and N2O interferences during the isotopic analysis of CH4-derived CO2. These steps increase the time for δ13C-CH4 measurements, which is used to measure δ15N-N2O and δ18O-N2O first and then δ13C-CH4. The analytical time is adjusted to ensure stable conditions in the ion source before each sample gas enters the IRMS, thereby improving the precision achieved for measurements of CH4 and N2O on the same IRMS. The precision of our measurements is comparable to or better than that of recently published systems. Our setup is calibrated by analysing multiple reference gases that were injected over bubble-free ice samples. We show

Investigation on the absorption of /sup 14/C-leucine and /sup 15/N-leucine in rats after feeding a fish meal diet in comparison with a gelatine diet

Energy Technology Data Exchange (ETDEWEB)

Bergner, U; Adam, K; Bergner, H [Humboldt-Universitaet, Berlin (German Democratic Republic). Sektion Tierproduktion und Veterinaermedizin

1981-01-01

Albino rats received after nine days of adaptation to a fish meal diet in comparison with a gelatine diet /sup 14/C-U-L-leucine and /sup 15/N-L-leucine via a pellet made from the specific diet after food deprivation for 15 h. Thereafter, the animals consumed the non-labelled experimental diet ad libitum. 30 min, and 1, 2, 4 and 8 h, resp., after intake of the labelled food, four rats at a time were sacrificed. The contents of the digestive tract and tissue samples were examined for /sup 14/C and /sup 15/N and their percentages in the TCA-soluble fraction determined. If these values are regarded as non-absorbed leucine, the /sup 14/C values obtained up to the four hour period of the experiment would be too high. Presumably, they are in the case of both diets simulated by other /sup 14/C metabolites which originate from the leucine catabolism and reach the intestinal lumen. Amino acids labelled with /sup 15/N should be preferred in studies on the absorption of amino acids because, in case of catabolization, the /sup 15/N aminogroup is excreted mainly as urea via urine.

Metabolism of [15N]alanine in the ectomycorrhizal fungus Paxillus involutus

International Nuclear Information System (INIS)

Chalot, M.; Finlay, R.D.; Ek, H.; Söderström, B.

1995-01-01

Chalot, M., Finlay, R. D., Ek, H., and Söderström, B. 1995. Metabolism of [ 15 N]alanine in the ectomycorrhizal fungus Paxillus involutus. Experimental Mycology 19, 297-304. Alanine metabolism in the ectomycorrhizal fungus Paxillus involutus was investigated using [ 15 N]alanine. Short-term exposure of mycelial discs to [ 15 N]alanine showed that the greatest flow of 15 N was to glutamate and to aspartate. Levels of enrichment were as high as 15-20% for glutamate and 13-18% for aspartate, whereas that of alanine reached 30%. Label was also detected in the amino-N of glutamine and in serine and glycine, although at lower levels. Preincubation of mycelia with aminooxyacetate, an inhibitor of transamination reactions. resulted in complete inhibition of the flow of the label to glutamate, aspartate, and amino-N of glutamine, whereas [ 15 N]alanine rapidly accumulated. This evidence indicates the direct involvement of alanine aminotransferase for translocation of 15 N from alanine to glutamate. Alanine may be a convenient reservoir of both nitrogen and carbon. (author)

Nitrogen-15 labeling of Crotalaria juncea green manure Marcação do adubo verde Crotalaria juncea com 15N

Directory of Open Access Journals (Sweden)

Edmilson José Ambrosano

2003-02-01

Full Text Available Most studies dealing with the utilization of 15N labeled plant material do not present details about the labeling technique. This is especially relevant for legume species since biological nitrogen fixation difficults plant enrichment. A technique was developed for labeling leguminous plant tissue with 15N to obtain labeled material for nitrogen dynamics studies. Sun hemp (Crotalaria juncea L. was grown on a Paleudalf, under field conditions. An amount of 58.32 g of urea with 70.57 ± 0.04 atom % 15N was sprayed three times on plants grown on eight 6-m²-plots. The labelled material presented 2.412 atom % 15N in a total dry matter equivalent to 9 Mg ha-1 This degree of enrichment enables the use of the green manure in pot or field experiments requiring 15N-labeled material.A grande maioria dos estudos com a utilização de material vegetal marcado com o isótopo 15N não apresentam detalhes tão importantes sobre como foram obtidos esses materiais. Em se tratando de marcação de leguminosas as dificuldades em se obter material marcado com 15N são ainda maiores pelo fato de serem plantas fixadoras de nitrogênio. Isso posto foi estabelecida uma técnica de marcação de leguminosas com nitrogênio (15N, com o objetivo de obter material vegetal marcado isotopicamente para estudos de dinâmica do nitrogênio. Cultivou-se a leguminosa crotalária júncea (Crotalaria juncea L., em Argissolo Vermelho Amarelo distrófico, em campo. Ao se aplicarem via foliar 58,32 gramas de uréia em oito canteiros experimentais, (uréia com 70,57 ± 0,04% de átomos de 15N parceladas em três vezes, obteve-se material vegetal marcado seco que continha 2,412 % em átomos de 15N em uma massa seca equivalente a 9 Mg ha-1. Essa marcação permite o uso dessa massa vegetal em estudos de dinâmica de nitrogênio.

Optimized set of two-dimensional experiments for fast sequential assignment, secondary structure determination, and backbone fold validation of 13C/15N-labelled proteins

International Nuclear Information System (INIS)

Bersch, Beate; Rossy, Emmanuel; Coves, Jacques; Brutscher, Bernhard

2003-01-01

NMR experiments are presented which allow backbone resonance assignment, secondary structure identification, and in favorable cases also molecular fold topology determination from a series of two-dimensional 1 H- 15 N HSQC-like spectra. The 1 H- 15 N correlation peaks are frequency shifted by an amount ± ω X along the 15 N dimension, where ω X is the C α , C β , or H α frequency of the same or the preceding residue. Because of the low dimensionality (2D) of the experiments, high-resolution spectra are obtained in a short overall experimental time. The whole series of seven experiments can be performed in typically less than one day. This approach significantly reduces experimental time when compared to the standard 3D-based methods. The here presented methodology is thus especially appealing in the context of high-throughput NMR studies of protein structure, dynamics or molecular interfaces

The crystal structure of the mixed-layer Aurivillius phase Bi 5Ti 1.5W 1.5O 15

Science.gov (United States)

Tellier, J.; Boullay, Ph.; Créon, N.; Mercurio, D.

2005-09-01

The crystal structure of the 1+2 mixed-layer Aurivillius phase Bi 5Ti 1.5W 1.5O 15 (SG I2cm n o 46: -cba, Z=4, a=5.4092(3) Å, b=5.3843(3) Å and c=41.529(3) Å) consisting of the ordered intergrowth of one and two octahedra thick perovskite-type blocks separated by [Bi 2O 2] 2+ slabs is reported. Supported by an electron diffraction investigation and, using the Rietveld analysis, it is shown that this compound should be described using a I-centering lattice in agreement with the generalised structural model of the Aurivillius type compounds recently presented by the authors. The structure of this Bi 5Ti 1.5W 1.5O 15 phase is analyzed in comparison with the related simple members (Bi 2WO 6 and Bi 3Ti 1.5W 0.5O 9). The crystal structure of Bi 3Ti 1.5W 0.5O 9 is also reported.

NMR experiments for resonance assignments of 13C, 15N doubly-labeled flexible polypeptides: Application to the human prion protein hPrP(23-230)

International Nuclear Information System (INIS)

Liu Aizhuo; Riek, Roland; Wider, Gerhard; Schroetter, Christine von; Zahn, Ralph; Wuethrich, Kurt

2000-01-01

A combination of three heteronuclear three-dimensional NMR experiments tailored for sequential resonance assignments in uniformly 15 N, 13 C-labeled flexible polypeptide chains is described. The 3D (H)N(CO-TOCSY)NH, 3D (H)CA(CO-TOCSY)NH and 3D (H)CBCA(CO-TOCSY)NH schemes make use of the favorable 15 N chemical shift dispersion in unfolded polypeptides, exploit the slow transverse 15 N relaxation rates of unfolded polypeptides in high resolution constant-time [ 1 H, 15 N]-correlation experiments, and use carbonyl carbon homonuclear isotropic mixing to transfer magnetization sequentially along the amino acid sequence. Practical applications are demonstrated with the 100-residue flexible tail of the recombinant human prion protein, making use of spectral resolution up to 0.6 Hz in the 15 N dimension, simultaneous correlation with the two adjacent amino acid residues to overcome problems associated with spectral overlap, and the potential of the presently described experiments to establish nearest-neighbor correlations across proline residues in the amino acid sequence

Carbono, nitrogênio e abundância natural de δ13c e δ15n em uma cronossequência de agricultura sob plantio direto no cerrado goiano

Directory of Open Access Journals (Sweden)

Roni Fernandes Guareschi

2014-08-01

Full Text Available A conversão do cerrado nativo em sistemas agropecuários pode alterar com o passar dos anos de cultivo os teores de C e N, bem como o sinal isotópico do δ13C e δ15N do solo. Desta forma, o objetivo deste trabalho foi avaliar os teores de C, N e abundância natural de δ13C e δ15N no perfil do solo em uma cronossequência de agricultura sob sistema plantio direto (SPD no cerrado goiano. Para isso, em Montividiu, GO, foram selecionadas áreas sob SPD com diferentes tempos de implantação: SPD com três anos de implantação (SPD3, SPD com 15 anos de implantação (SPD15 e SPD com 20 anos de implantação (SPD20, as quais foram comparadas com áreas de cerrado nativo (CE e pastagem (PA. Foram coletadas amostras de solo nas profundidades de 0,00-0,05; 0,05-0,10; 0,10-0,20; 0,20-0,30; 0,30-0,40; 0,40-0,50; 0,50-0,60; 0,60-0,80; e 0,80-1,00 m. O solo das áreas de estudo foi classificado como Latossolo Vermelho distroférrico. O manejo do solo sob SPD após 20 anos aumentou os teores de C e N na camada superficial do solo (0,00-0,05 m, em relação às outras áreas avaliadas. Nas demais profundidades avaliadas, observou-se que está ocorrendo aumento nos teores C e N com o passar dos anos de adoção do SPD (três para 15 anos; no entanto, tais áreas ainda não foram capazes de recuperar os teores desses elementos em relação à vegetação nativa de CE. Por meio dos resultados de δ13C, pôde-se constatar que a origem da MOS nas áreas de SPD é referente à plantas do ciclo fotossintético C4. Verificou-se que até os 0,30 m do perfil do solo os resultados de δ13C estão reduzindo com o passar dos anos de adoção do SPD. Os menores e maiores valores de δ15N foram encontrados nas áreas de CE e PA, SPD3, enquanto SPD15 e SPD20 apresentaram valores intermediários de δ15N, em relação às demais áreas avaliadas.

Trace elements and stable isotopes (δ13C and δ15N) in shallow and deep-water organisms from the East China Sea

International Nuclear Information System (INIS)

Asante, Kwadwo Ansong; Agusa, Tetsuro; Mochizuki, Hiroko; Ramu, Karri; Inoue, Suguru; Kubodera, Tsunemi; Takahashi, Shin; Subramanian, Annamalai; Tanabe, Shinsuke

2008-01-01

Trace elements (22) and stable isotope ratios (δ 15 N and δ 13 C) were analyzed in marine organisms from shallow (SW) and deep-water (DW) of the East China Sea to understand biomagnification and prey source of trace elements. In the benthic marine organisms from DW, δ 15 N values were negatively correlated with Ba, Cu, Ag, Mo, Sr, As, and Co concentrations. This may be due to the specific accumulation in lower trophic animals and/or the biodilution through the food web in DW. Relationships between δ 15 N and concentrations of Co, Cr, Bi, and Tl in fish and Ag, Bi, V, Hg, and Tl in crustaceans showed positive correlations, suggesting that trophic position was affecting the concentrations of those elements in phyla, with higher trophic animals retaining higher concentrations than the lower trophic animals. Positive correlations between δ 13 C and Rb were observed in marine organisms. Therefore, Rb may be a possible substitute of δ 13 C as tracer of prey source in the East China Sea although further investigation is required. - This is the first study on trophic transfer and prey source of trace elements in marine organisms from the East China Sea

Reaction π-p → eta'n in the 15-40 GeV/c momentum range

International Nuclear Information System (INIS)

Apel, W.D.; Augenstein, K.H.; Krueger, M.; Mueller, H.; Schinzel, D.; Schneider, H.; Sigurdsson, G.; Bertolucci, E.; Mannelli, I.; Pierazzini, G.M.; Quaglia, M.; Scribano, A.; Sergiampietri, F.; Vincelli, M.L.; Donskov, S.V.; Inyakin, A.V.; Johnson, R.; Kachanov, V.A.; Krasnokutsky, R.N.; Lednev, A.A.; Mikhailov, Yu.V.; Prokoshkin, Yu.D.; Shuvalov, R.S.; Kittenberger, V.; Leder, G.; Steuer, M.

1979-01-01

Measurements were made of the cross section of the reactions π - p → eta'(958)n, eta' → 2γ at momenta of 15, 20, 25, 30, and 40 GeV/c. The experiment was carried out on the IHEP 70 GeV accelerator using the 648 channel hodoscope spectrometer NICE for γ-ray detection. A total of 6000 eta' mesons were recorded. A sharp drop is seen in the differential cross section for t → 0. The dependences of the differential cross sections π - p → eta'n and π-p → etan on t are identical. On the basis of the ratio of the cross sections for these reactions at t = 0, i.e. R(eta'/n)sub(t=0) = 0.55 +- 0.06, the singlet-octet mixing angle for pseudoscalar mesons was determined to be β = -(18.2 +- 1.4) 0 . (Auth.)

Metabolic rates of 15N-D- and 15N-L-phenylalanine in an amino acid mixture for parenteral feeding

International Nuclear Information System (INIS)

Wutzke, K.; Heine, W.; Drescher, U.

1982-01-01

15 N investigations on the metabolism of L- and D-phenylalanine under conditions of parenteral feeding with the aminoacid solution Infesol in 6 infants revealed a retention rate of 83.4 +- 3.4 per cent for the L-form and of 36.6 +- 5.2 per cent for the D-form. When the D-isomer was raised from 1:3 to 1:1 in relation to the L-Form, 32.6 per cent of the infused D-phenylalanine were still retained. After continuous 24-hour infusion of the tracers, the maximum of 15 N excretion in the urine was reached between the 24th and the 30th hour. But little incorporation of 15 N-nitrogen was found in the serum and erythrocytes because of the relatively long half-life period of these proteins. Changes in the composition of commercial DL-amino acid mixtures will only be possible after determining the utilization rates of all essential and non-essential D-amino acids being used in such mixtures. (author)

Application of nitrogen and carbon stable isotopes (δ(15N and δ(13C to quantify food chain length and trophic structure.

Directory of Open Access Journals (Sweden)

Matthew J Perkins

Full Text Available Increasingly, stable isotope ratios of nitrogen (δ(15N and carbon (δ(13C are used to quantify trophic structure, though relatively few studies have tested accuracy of isotopic structural measures. For laboratory-raised and wild-collected plant-invertebrate food chains spanning four trophic levels we estimated nitrogen range (NR using δ(15N, and carbon range (CR using δ(13C, which are used to quantify food chain length and breadth of trophic resources respectively. Across a range of known food chain lengths we examined how NR and CR changed within and between food chains. Our isotopic estimates of structure are robust because they were calculated using resampling procedures that propagate variance in sample means through to quantified uncertainty in final estimates. To identify origins of uncertainty in estimates of NR and CR, we additionally examined variation in discrimination (which is change in δ(15N or δ(13C from source to consumer between trophic levels and among food chains. δ(15N discrimination showed significant enrichment, while variation in enrichment was species and system specific, ranged broadly (1.4‰ to 3.3‰, and importantly, propagated variation to subsequent estimates of NR. However, NR proved robust to such variation and distinguished food chain length well, though some overlap between longer food chains infers a need for awareness of such limitations. δ(13C discrimination was inconsistent; generally no change or small significant enrichment was observed. Consequently, estimates of CR changed little with increasing food chain length, showing the potential utility of δ(13C as a tracer of energy pathways. This study serves as a robust test of isotopic quantification of food chain structure, and given global estimates of aquatic food chains approximate four trophic levels while many food chains include invertebrates, our use of four trophic level plant-invertebrate food chains makes our findings relevant for a majority

Application of Nitrogen and Carbon Stable Isotopes (δ15N and δ13C) to Quantify Food Chain Length and Trophic Structure

Science.gov (United States)

Perkins, Matthew J.; McDonald, Robbie A.; van Veen, F. J. Frank; Kelly, Simon D.; Rees, Gareth; Bearhop, Stuart

2014-01-01

Increasingly, stable isotope ratios of nitrogen (δ15N) and carbon (δ13C) are used to quantify trophic structure, though relatively few studies have tested accuracy of isotopic structural measures. For laboratory-raised and wild-collected plant-invertebrate food chains spanning four trophic levels we estimated nitrogen range (NR) using δ15N, and carbon range (CR) using δ13C, which are used to quantify food chain length and breadth of trophic resources respectively. Across a range of known food chain lengths we examined how NR and CR changed within and between food chains. Our isotopic estimates of structure are robust because they were calculated using resampling procedures that propagate variance in sample means through to quantified uncertainty in final estimates. To identify origins of uncertainty in estimates of NR and CR, we additionally examined variation in discrimination (which is change in δ15N or δ13C from source to consumer) between trophic levels and among food chains. δ15N discrimination showed significant enrichment, while variation in enrichment was species and system specific, ranged broadly (1.4‰ to 3.3‰), and importantly, propagated variation to subsequent estimates of NR. However, NR proved robust to such variation and distinguished food chain length well, though some overlap between longer food chains infers a need for awareness of such limitations. δ13C discrimination was inconsistent; generally no change or small significant enrichment was observed. Consequently, estimates of CR changed little with increasing food chain length, showing the potential utility of δ13C as a tracer of energy pathways. This study serves as a robust test of isotopic quantification of food chain structure, and given global estimates of aquatic food chains approximate four trophic levels while many food chains include invertebrates, our use of four trophic level plant-invertebrate food chains makes our findings relevant for a majority of ecological systems

Application of nitrogen and carbon stable isotopes (δ(15)N and δ(13)C) to quantify food chain length and trophic structure.

Science.gov (United States)

Perkins, Matthew J; McDonald, Robbie A; van Veen, F J Frank; Kelly, Simon D; Rees, Gareth; Bearhop, Stuart

2014-01-01

Increasingly, stable isotope ratios of nitrogen (δ(15)N) and carbon (δ(13)C) are used to quantify trophic structure, though relatively few studies have tested accuracy of isotopic structural measures. For laboratory-raised and wild-collected plant-invertebrate food chains spanning four trophic levels we estimated nitrogen range (NR) using δ(15)N, and carbon range (CR) using δ(13)C, which are used to quantify food chain length and breadth of trophic resources respectively. Across a range of known food chain lengths we examined how NR and CR changed within and between food chains. Our isotopic estimates of structure are robust because they were calculated using resampling procedures that propagate variance in sample means through to quantified uncertainty in final estimates. To identify origins of uncertainty in estimates of NR and CR, we additionally examined variation in discrimination (which is change in δ(15)N or δ(13)C from source to consumer) between trophic levels and among food chains. δ(15)N discrimination showed significant enrichment, while variation in enrichment was species and system specific, ranged broadly (1.4‰ to 3.3‰), and importantly, propagated variation to subsequent estimates of NR. However, NR proved robust to such variation and distinguished food chain length well, though some overlap between longer food chains infers a need for awareness of such limitations. δ(13)C discrimination was inconsistent; generally no change or small significant enrichment was observed. Consequently, estimates of CR changed little with increasing food chain length, showing the potential utility of δ(13)C as a tracer of energy pathways. This study serves as a robust test of isotopic quantification of food chain structure, and given global estimates of aquatic food chains approximate four trophic levels while many food chains include invertebrates, our use of four trophic level plant-invertebrate food chains makes our findings relevant for a majority of

Impact of UV-B radiation on photosynthetic assimilation of 14C-bicarbonate and inorganic 15N-compounds by cyanobacteria

International Nuclear Information System (INIS)

Doehler, G.; Biermann, I.; Zink, J.

1986-01-01

The cyanobacteria Anabaena cylindrica and Synechococcus leopoliensis (=Anacystis nidulans) were grown at different levels of UV-B radiation (439, 717, 1230 and 1405 J m -2 d -1 , weighted according Caldwell, 1971) for 2 days. Dry weight was hardly affected but phycocyanin content of both species decreased linearly to the level of UV-B radiation. Contents of protein, carotenoids and chlorophyll a were reduced only after exposure to high doses (1230 J m -2 d -1 ) of UV-B radiation. Photosynthetic 14 CO 2 fixation of Anabaena cells was reduced linearly with increasing UV-B dose whereas no effect could be observed in Synechococcus. A depression of photosynthetic 15 N-nitrate uptake was found after UV-B stress in both species. UV-B irradiance caused an increase of 15 N-incorporation into glutamine, but no effect was noted for incorporation into alanine or aspartic acid. An increase of 15 N-excess in glutamic acid linear with the UV-B dose was observed in Synechococcus, only. Patterns of 14 C-labelled photosynthetic products were either less affected by UV-B radiation (Anabaena) or an enhancement of 14 C-label in total amino acids was detected (Synechococcus). The amount of total free amino acids increased parallel to the level of UV-B radiation. Only, the high dose of UV-B (1405 J m -2 d -1 , weighted) results in a decrease of the glutamine pool. Our results indicate an inhibition of glutamate synthase by UV-B irradiation in Anabaena, only. Results were discussed with reference to the damage of the photosynthetic apparatus. (orig.)

Medium-term response of microbial community to rhizodeposits of white clover and ryegrass and tracing of active processes induced by 13C and 15N labelled exudates

DEFF Research Database (Denmark)

Kusliene, Gedrime; Rasmussen, Jim; Kuzyakov, Yakov

2014-01-01

and actinomycetes was unaffected by plant species, but pool of Gram-negative and Gram-positive bacteria was greater under white clover at the 10 percent significance level. In the short term, microorganisms more actively utilised fresh exudates (13C-labelled) of ryegrass than of white clover. We expected ryegrass...... microbial groups in soil under white clover (Trifolium repens L.) and ryegrass (Lolium perenne L.) following leaf-labelling with 13C-bicarbonate and 15N-urea. In this way microbial N and 15N and the composition of PLFAs reflect the medium-term (two months) response of microorganisms to rhizodeposits......, whereas the 13C-label of the PLFAs reflects the short-term (one week) utilisation of root exudates following labelling of shoots. In the medium term, microbial biomass N and 15N were greater under the ryegrass, whereas total PLFA was higher under white clover. The relative abundance of fungi...

Deuterium isotope effects on 13C and 15N chemical shifts of intramolecularly hydrogen-bonded enaminocarbonyl derivatives of Meldrum’s and Tetronic acid

Science.gov (United States)

Ullah, Saif; Zhang, Wei; Hansen, Poul Erik

2010-07-01

Secondary deuterium isotope effects on 13C and 15N nuclear shieldings in a series of cyclic enamino-diesters and enamino-esters and acyclic enaminones and enamino-esters have been examined and analysed using NMR and DFT (B3LYP/6-31G(d,p)) methods. One-dimensional and two-dimensional NMR spectra of enaminocarbonyl and their deuterated analogues were recorded in CDCl 3 and CD 2Cl 2 at variable temperatures and assigned. 1JNH coupling constants for the derivatives of Meldrum's and tetronic acids reveal that they exist at the NH-form. It was demonstrated that deuterium isotope effects, for the hydrogen bonded compounds, due to the deuterium substitution at the nitrogen nucleus lead to large one-bond isotope effects at nitrogen, 1Δ 15N(D), and two-bond isotope effects on carbon nuclei, 2ΔC(ND), respectively. A linear correlations exist between 2ΔC(ND) and 1Δ 15N(D) whereas the correlation with δNH is divided into two. A good agreement between the experimentally observed 2ΔC(ND) and calculated dσ 13C/dR NH was obtained. A very good correlation between calculated NH bond lengths and observed NH chemical shifts is found. The observed isotope effects are shown to depend strongly on Resonance Assisted Hydrogen bonding.

Studies of liver-specific metabolic reactions with 15N. 1

International Nuclear Information System (INIS)

Hirschberg, K.; Jung, K.; Faust, H.; Matkowitz, R.

1987-01-01

The 15 N tracer technique was used to investigate liver-specific reactions (urea and hippurate synthesis) for studying the metabolism in the healthy and damaged pig liver. After [ 15 N]ammonium chloride administration the tracer distribution on non-protein compounds of serum and urine was followed. Blood samplings before and after liver passage rendered possible a direct analysis of the [ 15 N]ammonium metabolism. The thioacetamide-induced liver damage was used as model for an acute liver intoxication. The capacity for urea synthesis was not influenced by means of this noxious substance, but the metabolism of amino acids and hippuric acid. The considerably depressed excretion of [ 15 N]hippurate seems to be a suitable indicator of liver disfunction. (author)

Nicotine, acetanilide and urea multi-level2H-,13C- and15N-abundance reference materials for continuous-flow isotope ratio mass spectrometry

Science.gov (United States)

Schimmelmann, A.; Albertino, A.; Sauer, P.E.; Qi, H.; Molinie, R.; Mesnard, F.

2009-01-01

Accurate determinations of stable isotope ratios require a calibration using at least two reference materials with different isotopic compositions to anchor the isotopic scale and compensate for differences in machine slope. Ideally, the S values of these reference materials should bracket the isotopic range of samples with unknown S values. While the practice of analyzing two isotopically distinct reference materials is common for water (VSMOW-SLAP) and carbonates (NBS 19 and L-SVEC), the lack of widely available organic reference materials with distinct isotopic composition has hindered the practice when analyzing organic materials by elemental analysis/isotope ratio mass spectrometry (EA-IRMS). At present only L-glutamic acids USGS40 and USGS41 satisfy these requirements for ??13C and ??13N, with the limitation that L-glutamic acid is not suitable for analysis by gas chromatography (GC). We describe the development and quality testing of (i) four nicotine laboratory reference materials for on-line (i.e. continuous flow) hydrogen reductive gas chromatography-isotope ratio mass-spectrometry (GC-IRMS), (ii) five nicotines for oxidative C, N gas chromatography-combustion-isotope ratio mass-spectrometry (GC-C-IRMS, or GC-IRMS), and (iii) also three acetanilide and three urea reference materials for on-line oxidative EA-IRMS for C and N. Isotopic off-line calibration against international stable isotope measurement standards at Indiana University adhered to the 'principle of identical treatment'. The new reference materials cover the following isotopic ranges: ??2Hnicotine -162 to -45%o, ??13Cnicotine -30.05 to +7.72%, ?? 15Nnicotine -6.03 to +33.62%; ??15N acetanilide +1-18 to +40.57%; ??13Curea -34.13 to +11.71%, ??15Nurea +0.26 to +40.61% (recommended ?? values refer to calibration with NBS 19, L-SVEC, IAEA-N-1, and IAEA-N-2). Nicotines fill a gap as the first organic nitrogen stable isotope reference materials for GC-IRMS that are available with different ??13N

15N/14N variations in Cretaceous Atlantic sedimentary sequences: implication for past changes in marine nitrogen biogeochemistry

Science.gov (United States)

Rau, G.H.; Arthur, M.A.; Dean, W.E.

1987-01-01

At two locations in the Atlantic Ocean (DSDP Sites 367 and 530) early to middle Cretaceous organic-carbon-rich beds ("black shales") were found to have significantly lower ??15N values (lower 15N/14N ratios) than adjacent organic-carbon-poor beds (white limestones or green claystones). While these lithologies are of marine origin, the black strata in particular have ??15N values that are significantly lower than those previously found in the marine sediment record and most contemporary marine nitrogen pools. In contrast, black, organic-carbon-rich beds at a third site (DSDP Site 603) contain predominantly terrestrial organic matter and have C- and N-isotopic compositions similar to organic matter of modern terrestrial origin. The recurring 15N depletion in the marine-derived Cretaceous sequences prove that the nitrogen they contain is the end result of an episodic and atypical biogeochemistry. Existing isotopic and other data indicate that the low 15N relative abundance is the consequence of pelagic rather than post-depositional processes. Reduced ocean circulation, increased denitrification, and, hence, reduced euphotic zone nitrate availability may have led to Cretaceous phytoplankton assemblages that were periodically dominated by N2-fixing blue-green algae, a possible source of this sediment 15N-depletion. Lack of parallel isotopic shifts in Cretaceous terrestrially-derived nitrogen (Site 603) argues that the above change in nitrogen cycling during this period did not extend beyond the marine environment. ?? 1987.

Variations in natural abundances of 15N and 13C in potassium fed lentil plants grown under water stress

International Nuclear Information System (INIS)

Kurdali, F.; Al-Shammaa, M.

2007-12-01

The impact of two K-fertilizer treatments [K0 (0) and K1 (150 kg K 2 O/ha)] on dry matter production and N 2 fixation (Ndfa) by Lentil (Lens culinaris.) was evaluated in a pot experiment. The plants were also subjected to three soil moisture regimes starting from bud flower initiation stage to pod formation (low, 45-50%; moderate, 55-60% and high 75-80% of field capacity, abbreviated as FC1, FC2 and FC3, respectively). The 15 N natural abundance technique (%δ 1 5 N) was employed to evaluate N 2 fixation using barley as a reference crop. Moreover, the carbon isotope discrimination (%Δ 13 C) was determined to assess factors responsible for crop performance variability in the different treatments. Water restriction occurring during the post-flowering period considerably affects growth and N 2 -fixation. However, K-fertilizer enhanced plant performance by overcoming water shortage influences. The δ 15 N values in lentils ranged from +0.67 to +1.36% depending on soil moisture and K-fertilizer treatments; whereas, those of N 2 fixation and the reference plant were -0.45 and +2.94%, respectively. Consequently, Ndfa% ranged from 45 and 65%. Water stress reduced Δ 13 C values in the FC1K0 And FC1K1 treatments. However, K fertilizer enhanced the whole plants Δ 13 C along with dry matter yield and N 2 fixation. The water stressed plants amended with K (FC1K1) seemed to be the best treatment because of its highest pod yield, high N balance and N 2 -fixation with low consumption of irrigation water. This illustrates the ecological and economical importance of K-fertilizer in alleviating water stress occurring during the post-flowering period of lentil.(Authors)

Arctic sea ice at 1.5 and 2 °C

Science.gov (United States)

Screen, James A.

2018-05-01

In the Paris Agreement, nations committed to a more ambitious climate policy target, aiming to limit global warming to 1.5 °C rather than 2 °C above pre-industrial levels. Climate models now show that achieving the 1.5 °C goal would make a big difference for Arctic sea ice.

Study of some excited states in 21Ne-21Na, 18O-18F and 15N-15O nuclei

International Nuclear Information System (INIS)

Drain, D.

1977-01-01

The study of 21 Ne- 21 Na, 18 O- 18 F and 15 N- 15 O nuclei was performed through proton capture and transfer reactions and allows to determine the spins and parities of some excited states, give the gamma deexcitation schemes of these levels, compute the neutron and proton reduced width γ 2 sub(n) and γ 2 sub(p). The levels studied are: in 21 Na 4.15 20 Ne(p,p), (p,p'), (p,p'γ) and (pγ) reactions) and in 21 Ne: E(exc)=4.73, 5.69 and 5.78 MeV ( 20 Ne (p,p) reaction); in 18 O: E(exc) 17 O(d,p) reaction); in 15 O: 8.92 MeV doublet and 8.98 MeV level (angular correlation 14 N(p,γγ) and in 15 N: 9.05 14 N(d,p) reaction). A comparison with theoretical results is discussed and analog states are pointed out [fr

The measurement of 15N

International Nuclear Information System (INIS)

Fiedler, R.

1984-01-01

The use of mass spectrometry and emission spectrometry for the determination of 15 N in stable tracer studies is reviewed. Mass spectrometry has the advantage that more accurate results compared to emission spectrometry are possible. Emission spectrometry, however, is less expensive and only requires samples at least 50 times smaller for analysis. The sample preparation method is similar for both techniques. (U.K.)

On the differences between 1.5oC and 2oC of global warming

Science.gov (United States)

King, A.

2017-12-01

The Paris Agreement of 2015 has resulted in a drive to limit global warming to 2oC with an aim for a lower 1.5oC target. It is therefore vital that we understand some of the differences we would expect between these two levels of global warming. My research uses coupled climate model projections to investigate where and for what variables we can differentiate between worlds of 1.5oC and 2oC global warming. I place a particular focus on climate extremes and population exposure to those extremes. I have found that there are perceptible benefits in limiting global warming to 1.5oC as opposed to 2oC through reduced frequency and intensity of heat extremes, both over land and in ocean areas where thermal stress on coral has resulted in bleaching. Differences in high and low precipitation extremes between the 1.5oC and 2oC global warming levels are projected for some regions. I have also examined how "scalable" changes from the 1.5oC to 2oC level are. In areas of the world such as Eastern China I find that changes in anthropogenic aerosol concentrations will influence the level of change projected at 1.5oC and 2oC, such that past warming is likely to be a poor indicator of future changes. Overall, my research finds clear benefits to limiting global warming to 1.5oC relative to higher levels.

Synthesis of specifically 15N- and 13C-labeled antitumor (2-Haloethyl)nitrosoureas. The study of their conformations in solution by nitrogen-15 and carbon-13 nuclear magnetic resonance and evidence for stereoelectronic control in their aqueous decomposition

International Nuclear Information System (INIS)

Lown, J.W.; Chauhan, S.M.S.

1981-01-01

The synthesis of certain specifically 15 N, 13 C, and 2 H isotope labeled 1-(2-chloroethyl)-3-alkyl-1-nitrosoureas (CENUs) is described. Spectroscopic examination of CENUs and their isotope-labeled counterparts by 1 H, 15 N, and 13 C NMR and infrared spectra indicates that they adopt preferred conformations in nonpolar aprotic solvents in which the NO group is aligned toward the 2-chloroethyl group. The result is in accord with the conformation of MeCCNU in the crystalline state derived from X-ray diffraction. The chemical shifts and coupling constants in the CENUs change with both solvent polarity and basicity. In aqueous phosphate buffer there is evidence for the formation of a tetrahedral intermediate, the conformation of which alters according to the reaction conditions and ultimately controls the formation of the aqueous decomposition products of CENUs. This is revealed most clearly by 13 C NMR of carbonyl- 13 C- and nitroso- 15 N-labeled BCNU and CCNU where two distinct 15 N-coupled 13 C doublets with different chemical shifts are observed. The rate of conformational change is comparable with the rate of decomposition of CENUs (via the second conformer) and may therefore represent the critical initial step of the latter process in vivo. The intermediacy of the postulated tetrahedral intermediates for CENUs is supported by observed 18 O exchange into the carbonyl group in 18 O-enriched water. Consideration of the conformations of the intermediates and of the alignment of the heteroatom lone pairs provides a satisfactory interpretation of the reactions of CENUs in aqueous solution as well as their pH dependence in terms of strict steroelectronic control and accounts for the formation of the observed products

Early-stage changes in natural (13)C and (15)N abundance and nutrient dynamics during different litter decomposition.

Science.gov (United States)

Gautam, Mukesh Kumar; Lee, Kwang-Sik; Song, Byeong-Yeol; Lee, Dongho; Bong, Yeon-Sik

2016-05-01

Decomposition, nutrient, and isotopic (δ(13)C and δ(15)N) dynamics during 1 year were studied for leaf and twig litters of Pinus densiflora, Castanea crenata, Erigeron annuus, and Miscanthus sinensis growing on a highly weathered soil with constrained nutrient supply using litterbags in a cool temperate region of South Korea. Decay constant (k/year) ranged from 0.58 to 1.29/year, and mass loss ranged from 22.36 to 58.43 % among litter types. The results demonstrate that mass loss and nutrient dynamics of decomposing litter were influenced by the seasonality of mineralization and immobilization processes. In general, most nutrients exhibited alternate phases of rapid mineralization followed by gradual immobilization, except K, which was released throughout the field incubation. At the end of study, among all the nutrients only N and P showed net immobilization. Mobility of different nutrients from decomposing litter as the percentage of initial litter nutrient concentration was in the order of K > Mg > Ca > N ≈ P. The δ(13)C (0.32-6.70 ‰) and δ(15)N (0.74-3.90 ‰) values of residual litters showed nonlinear increase and decrease, respectively compared to initial isotopic values during decomposition. Litter of different functional types and chemical quality converged toward a conservative nutrient use strategy through mechanisms of slow decomposition and slow nutrient mobilization. Our results indicate that litter quality and season, are the most important regulators of litter decomposition in these forests. The results revealed significant relationships between litter decomposition rates and N, C:N ratio and P, and seasonality (temperature). These results and the convergence of different litters towards conservative nutrient use in these nutrient constrained ecosystems imply optimization of litter management because litter removal can have cascading effects on litter decomposition and nutrient availability in these systems.

Thermodynamic properties of (LiCl + N,N-dimethylacetamide) and (LiBr + N,N-dimethylacetamide) at temperatures from (323.15 to 423.15) K

International Nuclear Information System (INIS)

Nasirzadeh, Karamat; Neueder, Roland; Kunz, Werner

2005-01-01

Precise vapor pressure data for LiCl and LiBr solutions in N,N-dimethylacetamide are given for T = (323.15 to 423.15) K. The molality ranges covered in this study are about m = (0.073 to 1.89) mol . kg -1 for lithium chloride and m = (0.06 to 1.75) mol . kg -1 for lithium bromide. Osmotic coefficients are calculated by taking into account the second virial coefficient of N,N-dimethylacetamide. The parameters of the extended Pitzer-ion interaction model of Archer, of the MSA-NRTL model and of the chemical model of Barthel are evaluated. These models accurately reproduce the experimental osmotic coefficients within different concentration ranges. The parameters of the Pitzer-ion interaction model of Archer are used to calculate the mean molal activity coefficients and excess Gibbs free energies. The non-ideal behaviors of these systems are discussed in terms of the model parameters

Influence of organic N Sources on N transformation and uptake by lupine plants using 15N technique

International Nuclear Information System (INIS)

Abdel-Salam, A.A.; Gadalla, A.M.; Abdel- Aziz, H.A.; Galal, Y.G.M.; EL-degwy, S.M.

2008-01-01

A pot experiment was carried out under greenhouse conditions to evaluate the comparative efficiency and transformation of nitrogen applied either as mineral or organic forms. The obtained data showed that shoot dry weight was enhanced by compost and its mixture with leucaena. When organic sources were combined with 15 N, the leucaena.compost mixture (LC p ) gave the highest yield, and the other two were not significantly different from each other. Reinforcing the organic N with mineral N caused an average greater N.uptake over the non reinforced treatment. Similar trend was noticed with root system. Nitrogen uptake by roots was increased according to the order of LC > L > C. N derived from fertilizer (% Ndff) by lupine shoots was significantly affected by fertilizer addition either alone or reinforced with organic plant residues. Both, the portions (%) or absolute values (mg pot -1 ) of Ndff were increased by adding the organic residues. The highest value of Ndfs was recorded with application of leucaena followed by compost, then Leucaena + compost. Portion Ndfa reflected an effective response of lupines plants to Rhizobium inoculation. Addition of LC mixture combined with 15 N-fertilizer had enhanced the N 2 fixation and increased Ndfa value by about 66.7 % over those recorded with 15 N0 treatment. Organic amendment of leucaena could be an efficient source for N to infertile sandy soils

N-15 tracing helps explaining N leaching losses from contrasting forest ecosystems

Science.gov (United States)

Staelens, J.; Rütting, T.; Huygens, D.; Müller, C.; Verheyen, K.; Boeckx, P.

2009-04-01

Despite chronically enhanced nitrogen (N) deposition to forest ecosystems in Europe and NE America, considerable N retention by forests has been observed, reducing N leaching losses. Organic and mineral soil layers typically immobilize more N than the aboveground biomass, but it is unclear which factors determine N retention in forest ecoystems. However, this knowledge is crucial to assess the impact of changing anthropogenic N emissions on future N cycling and N loss of forests. For coniferous and deciduous forest stands at comparable sites, it is known that both N deposition onto the forest floor as well as N loss by leaching below the rooting zone are significantly higher in coniferous stands. In addition, the N loss in coniferous stands is often more enhanced than can be explained by the higher N input only. This suggests lower N retention by coniferous stands, and may be related to differences in litter and soil characteristics, microbial activity, and N uptake by plant roots. To test this hypothesis, we studied the effect of forest type on N retention using 15N tracing techniques: a field tracer experiment and a combination of in situ isotope pool dilution and a tracing model. The N dynamics were examined for two adjacent forest stands (pedunculate oak (Quercus robur L.) and Scots pine (Pinus sylvestris L.)) on a well-drained sandy soil and with a similar stand history, located in a region with high N deposition (Belgium). Input-output N budgets were established by quantifying atmospheric deposition and leaching below the rooting zone, and confirmed the above finding of higher N deposition and disproportionately higher N loss for the pine stand compared to the oak stand. First, the fate of inorganic N within the ecosystems was studied by spraying three pulses of dissolved 15N, either as ammonium or as nitrate, onto the forest floor in 12 plots of 25 m2. The organic and mineral soil layers, tree roots, soil water percolate, ferns, and tree foliage were sampled

Application time of nitrogen fertilizer 15N by a potato crop (Solanum Tuberosum L.)

International Nuclear Information System (INIS)

Bastidas, O.G.; Urquiaga, S.

1987-01-01

This study was performed at the ''San Jorge'' experimental farm of the Instituto Colombiano Agropecuario (ICA), Bogota, Colombia. The study was performed to investigate the effect of timing of application of nitrogen fertilizer on the productivity of, and the efficiency of utilization of 15 N-labelled fertilizer by, a potato crop (Solanum tuberosum L.), cv. Tequendama. The crop was fertilized with 100, 200 and 100 Kg/ha -1 of N, P 2 O 5 and K 2 O respectively. The N fertilizers were either added as 15 N labelled urea (2.955 at.% 15 N excess) or as labelled ammonium sulphate (2.071 at.% 15 N excess). In all treatments with nitrogen, a total of 100 Kg N ha -1 was added, but the nitrogen was added either in two or three split doses (only one dose being labelled with 15 N) at the following times: at planting, 35 days after emergence (DAE) and/or 60 DAE. It was found that: a) Nitrogen fertilization increased tuber production from 24 to 43 t/ha -1 ; b) The tubers constituted approximately 80% of total plant dry matter and 70% of the total nitrogen and fertilizer N accumulated by the plant; c) The fertilizer use efficiency varied between 49 and 68%, and the highest efficiency occurred when the nitrogen was split in three doses; d) The urea and ammonium sulphate gave similar results in all parameters evaluated; e) When the total nitrogen difference method was applied to interpretation of the results the fertilizer use efficiency was overestimated by 15 to 30%

Kerma factors and reaction cross sections for n + 12C between 15 and 18 MeV

International Nuclear Information System (INIS)

Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.

1988-01-01

Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from 12 C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The 12 C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range. (author)

{delta}{sup 15}N of seagrass leaves for monitoring anthropogenic nutrient increases in coral reef ecosystems

Energy Technology Data Exchange (ETDEWEB)

Yamamuro, M.; Kayanne, H.; Yamano, H

2003-04-01

In a coral reef environment, a slight increase in dissolved inorganic nitrogen (DIN;{>=}1.0 {mu}M) can alter the ecosystem via macroalgal blooms. We collected seagrass leaves from the tropical and subtropical Pacific Ocean in five countries and examined the interactions between nutrient concentrations (C, N, P), molar ratios of nutrients, and {delta}{sup 15}N to find a possible indicator of the DIN conditions. Within most sites, the concentrations of nutrients and their molar ratios showed large variations owing to species-specific values. On the other hand, almost identical {delta}{sup 15}N values were found in seagrass leaves of several species at each site. The correlations between {delta}{sup 15}N and nutrient concentrations and between {delta}{sup 15}N and molar ratios of nutrients suggested that nutrient availability did not affect the {delta}{sup 15}N value of seagrass leaves by altering the physiological condition of the plants. Increases in {delta}{sup 15}N of seagrass leaves mostly matched increases in DIN concentrations in the bottom water. We suggest that {delta}{sup 15}N in seagrass leaves can be a good tool to monitor time-integrated decrease/increase of DIN concentrations at a site, both in the water column and the interstitial water.

Methodical investigation of the endogenous N excretion in feces by 15N-labelled rats

International Nuclear Information System (INIS)

Bergner, U.; Bergner, H.

1983-01-01

Wistar rats (approximately 100g live weight, n = 8) received a wheat diet and were labelled over a period of 7 days with 15 N-ammonium acetate. From day 1 - 5 of the experiment after the end of the labelling feces and urine were collected and analysed. After the animals were killed (day 5 of the experiment) the atom-% 15 N excess ( 15 N') in the contents of the digestive tract as well as in the tissues of stomach wall, intestinal wall, liver, pancreas and blood plasma was determined. The TCA-soluble fraction of the blood plasma showed 0.44 atom-% 15 N' on day 5 after the end of 15 N labelling. 3 hours before the killing fecal N also showed 0.44 and during the last collection period (24 hours before) an average of 0.51 atom-% 15 N'. Urine decreased in the same period from 0.71 to 0.59 atom-% 15 N'. The endogenous fecal N is calculated to 88%. As the tissues of the digestive tract are likely to supply the biggest part of the endogenous fecal protein, the values of atom-% 15 N' from the TCA-precipitable fraction of the intestinal wall and of the pancreas gland was calculed to an average of 0.526. According to this the calculation endogenous fecal N is 84%. It is probable that the quota of endogenous fecal N in the total amount of fecal N varies in dependence on the fermentable crude fiber in the diet as well as on the age of the test animals and thus the bacterial protein synthesis in the colon. As the N used by the bacteria is likely to come from the TCA-soluble fraction of the blood, the calculation formula suggested, which uses the TCA-soluble fraction of the blood plasma, achieves good approximate values also for higher bacterial protein synthesis in the colon. (author)

HECTR [Hydrogen Event Containment Transient Response] Version 1.5N: A modification of HECTR Version 1.5 for application to N Reactor

International Nuclear Information System (INIS)

Camp, A.L.; Dingman, S.E.

1987-05-01

This report describes HECTR Version 1.5N, which is a special version of HECTR developed specifically for application to the N Reactor. HECTR is a fast-running, lumped-parameter containment analysis computer program that is most useful for performing parametric studies. The main purpose of HECTR is to analyze nuclear reactor accidents involving the transport and combustion of hydrogen, but HECTR can also function as an experiment analysis tool and can solve a limited set of other types of containment problems. Version 1.5N is a modification of Version 1.5 and includes changes to the spray actuation logic, and models for steam vents, vacuum breakers, and building cross-vents. Thus, all of the key features of the N Reactor confinement can be modeled. HECTR is designed for flexibility and provides for user control of many important parameters, if built-in correlations and default values are not desired

Volumetric properties of ascorbic acid (vitamin C) and thiamine hydrochloride (vitamin B1) in dilute HCl and in aqueous NaCl solutions at (283.15, 293.15, 298.15, 303.15, 308.15, and 313.15) K

International Nuclear Information System (INIS)

Ayranci, Guler; Sahin, Melike; Ayranci, Erol

2007-01-01

Apparent molar volumes and apparent molar isentropic compressibilities of ascorbic acid (vitamin C) and thiamine hydrochloride (vitamin B 1 ) were determined from accurately measured density and sound velocity data in water and in aqueous NaCl solutions at (283.15, 293.15, 298.15, 303.15, 308.15, and 313.15) K. These volume and compressibility data were extrapolated to zero concentration using suitable empirical or theoretical equations to determine the corresponding infinite dilution values. Apparent molar expansibilities at infinite dilution were determined from slopes of apparent molar volume vs. temperature plots. Ionization of both ascorbic acid and thiamine hydrochloride were suppressed using sufficiently acidic solutions. Apparent molar volumes at infinite dilution for ascorbic acid and thiamine hydrochloride were found to increase with temperature in acidic solutions and in the presence of co-solute, NaCl. Apparent molar expansibility at infinite dilution were found to be constant over the temperature range studied and were all positive, indicating the hydrophilic character of the two vitamins studied in water and in the presence of co-solute, NaCl. Apparent molar isentropic compressibilities of ascorbic acid at infinite dilution were positive in water and in the presence of co-solute, NaCl, at low molalities. Those of thiamine hydrochloride at infinitive dilution were all negative, consistent with its ionic nature. Transfer apparent molar volumes of vitamins at infinite dilution from water solutions to NaCl solutions at various temperatures were determined. The results were interpreted in terms of complex vitamin-water-co-solute (NaCl) interactions

(13)C and (15)N solid-state NMR studies on albendazole and cyclodextrin albendazole complexes.

Science.gov (United States)

Ferreira, M João G; García, A; Leonardi, D; Salomon, Claudio J; Lamas, M Celina; Nunes, Teresa G

2015-06-05

(13)C and (15)N solid-state nuclear magnetic resonance (NMR) spectra were recorded from albendazole (ABZ) and from ABZ:β-cyclodextrin, ABZ:methyl-β-cyclodextrin, ABZ:hydroxypropyl-β-cyclodextrin and ABZ:citrate-β-cyclodextrin, which were prepared by the spray-drying technique. ABZ signals were typical of a crystalline solid for the pure drug and of an amorphous compound obtained from ABZ:cyclodextrin samples. Relevant spectral differences were correlated with chemical interaction between ABZ and cyclodextrins. The number and type of complexes revealed a strong dependence on the cyclodextrin group substituent. Solid-state NMR data were consistent with the presence of stable inclusion complexes. Copyright © 2015 Elsevier Ltd. All rights reserved.

Thermodynamic properties of (LiCl + N,N-dimethylacetamide) and (LiBr + N,N-dimethylacetamide) at temperatures from (323.15 to 423.15) K

Energy Technology Data Exchange (ETDEWEB)

Nasirzadeh, Karamat [Institut fuer Physikalische and Theoretische Chemie, Universitaet Regensburg, D-93040 Regensburg (Germany) and Department of Chemistry, Azarbaijan University of Tarbiat Moallem, Tabriz (Iran, Islamic Republic of)]. E-mail: Karamat.Nasirzadeh@chemie.uni-regensburg.de; Neueder, Roland [Institut fuer Physikalische and Theoretische Chemie, Universitaet Regensburg, D-93040 Regensburg (Germany); Kunz, Werner [Institut fuer Physikalische and Theoretische Chemie, Universitaet Regensburg, D-93040 Regensburg (Germany)

2005-04-15

Precise vapor pressure data for LiCl and LiBr solutions in N,N-dimethylacetamide are given for T = (323.15 to 423.15) K. The molality ranges covered in this study are about m = (0.073 to 1.89) mol . kg{sup -1} for lithium chloride and m = (0.06 to 1.75) mol . kg{sup -1} for lithium bromide. Osmotic coefficients are calculated by taking into account the second virial coefficient of N,N-dimethylacetamide. The parameters of the extended Pitzer-ion interaction model of Archer, of the MSA-NRTL model and of the chemical model of Barthel are evaluated. These models accurately reproduce the experimental osmotic coefficients within different concentration ranges. The parameters of the Pitzer-ion interaction model of Archer are used to calculate the mean molal activity coefficients and excess Gibbs free energies. The non-ideal behaviors of these systems are discussed in terms of the model parameters.

Impact of UV-B (290-320 nm) radiation on photosynthesis-mediated uptake of 15N-ammonia and 15N-nitrate of several marine diatoms

International Nuclear Information System (INIS)

Doehler, G.; Stolter, H.

1986-01-01

The marine diatoms Ditylum brigthwellii, Lithodesmium variabile, Odontella sinensis, Synedra planctonica and Thalassiosira rotula grown at 18 0 C under normal air conditions (0.035 vol.% CO 2 ) were exposed to different levels (439 and 717 J m -2 d -1 , weighted) of UV-B radiation for 2 d (5 h/d). Pigmentation, protein and total nitrogen content were reduced linearly to the dose of UV-B radiation. Photosynthesis-mediated uptake of 15 N-ammonia was more affected by UV-B irradiance in all tested diatoms than that of 15 N-nitrate. A species-dependent behavior in the assimilation of inorganic nitrogenous compounds has been observed: Synedra was a very sensitive species to UV-B radiation whereas the same UV-B doses had no effect on the assimilation rate of ammonia and nitrate of the Lithodesmium cells. The results were discussed with reference to the inhibition of the enzymes of the nitrogen metabolism. (author)

Nitrogen and water regime effects on corn yields determined by N-15 methodology

International Nuclear Information System (INIS)

Halitligil, M.B.; Akin, A.

2002-01-01

This investigation was carried out to determine the relationships between fertilizer N leaching and N fertilizer application time, method and irrigation rate by using 15 N methodology. Therefore, in the field experiments, the effects of three factors namely a) Irrigation rate (optimum 240 mm, high 360 mm), b) N application time (All at planting, 1/2 at planting and 1/2 after planting when plant heights were 50 cm), c) N application method (side dress and broadcast) were investigated. The field experiments were conducted using randomized block design as split-split plot and 4 replications. As the test plant hybrid corn was selected and at planting row spaces were arranged as 0.80 m x 0.25 m. Nitrogen was applied 120 kg N/ha to the all treatments as urea fertilizer (46 % N). In addition, to the sub-plots (which received half of N at planting and the other half when plant heights were 50 cm) 15 N labelled urea (2.63 % 15 N a.e. as 120 kg N/ha) was applied. After harvesting, total N and 15 N analyses were done for plant and soil samples. The results showed that the seed and total yields were increased with higher (360 mm) irrigation. When N application was side dressed the availability of N was increased, and also its loss by leaching from the active root zone was decreased. In conclusion, it was observed that at high irrigation rate was saved about 84 kg N/ha by side dressing rather than broadcasting of the applied N fertilizer

Interannual changes in δ15N values in Fucus vesiculosus L

International Nuclear Information System (INIS)

Carballeira, Carlos; Rey-Asensio, Ana; Carballeira, Alejo

2014-01-01

Highlights: • Isotopic values change along the thallus of F. vesiculosus. • δ 15 N values along the thallus are different between control and polluted sites. • δ 15 N values are temporally unstable at polluted sites. - Abstract: The natural abundance of 15 N (δ 15 N) has been widely used to detect anthropogenically derived N loads in environmental impact studies. The present study involved retrospective analysis of subsamples of Fucus vesiculosus L. collected during a period of three years (2008–2010) from two sites: a control site, within a coastal reference area, and an area affected by the effluents of a marine land-based fish farm. The isotopic signal in different subsamples of the macroalgae thalli (tissue that has grown during the same period) varied depending on the age of the tissue. Moreover, the isotopic signal decreased significantly with the age of the frond to within a certain range. The δ 15 N of F. vesiculosus is temporally unstable; therefore, measurement of the δ 15 N of macroalgal tissues does not allow reliable retrospective biomonitoring of environmental pollution. Further knowledge about the growth and other biological aspects of this species is required

Empirical correlation between protein backbone {sup 15}N and {sup 13}C secondary chemical shifts and its application to nitrogen chemical shift re-referencing

Energy Technology Data Exchange (ETDEWEB)

Wang Liya [Cold Spring Harbor Laboratory (United States); Markley, John L. [University of Wisconsin, Biochemistry Department (United States)], E-mail: markley@nmrfam.wisc.edu

2009-06-15

The linear analysis of chemical shifts (LACS) has provided a robust method for identifying and correcting {sup 13}C chemical shift referencing problems in data from protein NMR spectroscopy. Unlike other approaches, LACS does not require prior knowledge of the three-dimensional structure or inference of the secondary structure of the protein. It also does not require extensive assignment of the NMR data. We report here a way of extending the LACS approach to {sup 15}N NMR data from proteins, so as to enable the detection and correction of inconsistencies in chemical shift referencing for this nucleus. The approach is based on our finding that the secondary {sup 15}N chemical shift of the backbone nitrogen atom of residue i is strongly correlated with the secondary chemical shift difference (experimental minus random coil) between the alpha and beta carbons of residue i - 1. Thus once alpha and beta {sup 13}C chemical shifts are available (their difference is referencing error-free), the {sup 15}N referencing can be validated, and an appropriate offset correction can be derived. This approach can be implemented prior to a structure determination and can be used to analyze potential referencing problems in database data not associated with three-dimensional structure. Application of the LACS algorithm to the current BMRB protein chemical shift database, revealed that nearly 35% of the BMRB entries have {delta}{sup 15}N values mis-referenced by over 0.7 ppm and over 25% of them have {delta}{sup 1}H{sup N} values mis-referenced by over 0.12 ppm. One implication of the findings reported here is that a backbone {sup 15}N chemical shift provides a better indicator of the conformation of the preceding residue than of the residue itself.

Determination of N metabolism parameters following 15N-amino acid infusion based on a mathematical model

International Nuclear Information System (INIS)

Pahle, T.; Koehler, R.; Souffrant, W.B.; Gebhardt, G.; Matkowitz, R.; Hartig, W.

1983-01-01

Two female pigs (25 kg live weight) received a continuous infusion of 15 N-glycine and 15 N-lysine solutions, resp., for 45 h and for further 72 h unlabelled amino acid solutions. The main protein and energy sources, however, were administered orally. The time course of the 15 N level and the differential urinary N excretion were determined from blood urea and urine. For the demonstration of synthesis and decay rates of the total body protein a mathematical model has been developed. The suitability of 15 N-lysine and 15 N-glycine for the determination of N metabolism parameters is discussed

Adsorption, translocation and redistribution of nitrogen (15N) in orange trees

International Nuclear Information System (INIS)

Fenilli, Tatiele Anete Bergamo; Boaretto, Antonio Enedi Boaretto; Bendassolli, Jose Albertino; Trivelin, Paulo Cesar Ocheuze; Muraoka, Takashi

2002-01-01

The objective was to evaluate the absorption of 15 N from nutrient solution by young orange trees and the translocation and the redistribution of the absorbed N. The treatments were constituted by four periods of 15 N labelling (spring, summer, autumn and winter). In the first treatment, the young orange trees received 15 N in the nutrient solution during the spring and five replicates of the plants were picked at the end of the period. The new part, which was developed during the 15 N labelling period, was separated from the other part (old part) in branch and leaf, and also in flower and fruit when they were. The old part was separated in leaf, stem and root. This same procedure was followed in the other treatments. The total N and the isotope ratios 15 N/ 14 N were performed by mass spectrometry. The major part of absorbed N during the spring and summer was translocated to the new part of the orange trees, but in autumn and winter the absorbed N was concentrated in the old plant part. The redistribution of N from of old plant parts was more intensive during the autumn and winter. (author)

Thermodynamic properties of LiCl solutions in N-methylacetamide at 308.15-328.15 K

Science.gov (United States)

Manin, N. G.; Kolker, A. M.

2017-12-01

Enthalpies of dissolution of crystalline LiCl and enthalpies of dilution of LiCl solutions in N-methylacetamide (NMA) with electrolyte concentrations no greater than 0.32 m are measured on an isoperibolic calorimeter at 308.15, 318.15, and 328.5 K. Standard enthalpies of the dissolution of LiCl in NMA are calculated at different temperatures. The thermodynamic properties of the solution and its components are calculated and analyzed in the investigated range of concentrations and temperatures.

Estimate of symbiotically fixed nitrogen in field grown soybeans using variations in /sup 15/N natural abundance

Energy Technology Data Exchange (ETDEWEB)

Amarger, N; Durr, J C; Bourguignon, C; Lagacherie, B [INRA Centre de Recherches de Dijon, 21 (France). Lab. de Microbiologie des Sols; Mariotti, A; Mariotti, F [Paris-6 Univ., 75 (France). Lab. de Geologie Dynamique

1979-07-01

The use of variations in natural abundance of /sup 15/N between nitrogen fixing and non nitrogen fixing soybeans was investigated for quantitative estimate of symbiotic nitrogen fixation. Isotopic analysis of 4 varieties of inoculated and non-inoculated soybeans growing under field conditions, with and without N-fertilizer was determined. It was found that inoculated soybeans had a significantly lower /sup 15/N content than non-inoculated ones. Estimates of the participation of fixed N to the total nitrogen content of inoculated soybeans were calculated from these differences. They were compared to estimates calculated from differences in N yield between inoculated and non-inoculated plants and to the nitrogenase activity, measured by the C/sub 2/H/sub 2/ reduction assay over the growing season. Estimates given by the /sup 15/N measurements were correlated with the C/sub 2/H/sub 2/ reducing activity but not with the differences in the N yield. This shows that the isotopic composition was dependent on the amount of fixed nitrogen and consequently that the estimates of fixed nitrogen based on natural /sup 15/N abundance should be reliable. The absence of correlation between estimates based on /sup 15/N content and estimates based on N yield was explained by differences in the uptake of soil nitrogen between inoculated and non inoculated soybeans.

{sup 15}N/{sup 14}N isotopic ratio and statistical analysis: an efficient way of linking seized Ecstasy tablets

Energy Technology Data Exchange (ETDEWEB)

Palhol, Fabien; Lamoureux, Catherine; Chabrillat, Martine; Naulet, Norbert

2004-05-10

In this study, the {sup 15}N/{sup 14}N isotopic ratios of 106 samples of 3,4-methylenedioxymethamphetamine (MDMA) extracted from Ecstasy tablets are presented. These ratios, measured using gas chromatography-combustion-isotope ratio mass spectrometry (GC-C-IRMS), show a large discrimination between samples with a range of {delta}{sup 15}N values between -17 and +19%o, depending on the precursors and the method used in clandestine laboratories. Thus, {delta}{sup 15}N values can be used in a statistical analysis carried out in order to link Ecstasy tablets prepared with the same precursors and synthetic pathway. The similarity index obtained after principal component analysis and hierarchical cluster analysis appears to be an efficient way to group tablets seized in different places.

Acúmulo de nutrientes e destino do nitrogênio (15N aplicado em pomar jovem de laranjeira Nutrients accumulation and fate of nitrogen (15N in Young bearing orange trees

Directory of Open Access Journals (Sweden)

Rodrigo Marcelli Boaretto

2007-01-01

Full Text Available Informações sobre absorção de nutrientes em pomares cítricos são importantes para recomendações do manejo da fertilidade do solo. Contudo, estudos sobre a distribuição dos nutrientes na planta e a validação das doses de nitrogênio (N recomendadas são escassos na literatura brasileira. O presente trabalho avaliou (i o acúmulo de nutrientes e a distribuição do N (15N aplicado em citros e (ii validou a dose de N recomendada para pomares em início de produção. Em laranjeiras 'Pêra' sobre limoeiro 'Cravo', com 3 a 4 anos de idade, foram aplicadas doses de 150; 300; 450 e 600 g de N por planta, como sulfato de amônio, divididas em três parcelas, entre a primavera e o verão. Incluiu-se um tratamento-testemunha sem N. No mesmo pomar, em outras três plantas, aplicaram-se 300 g por planta de N-[(15NH42SO 4] enriquecido em 15N, para estudar o destino do N do fertilizante no pomar. Foram avaliadas a produção de frutos e o aproveitamento do 15N pela biomassa da planta. A eficiência do fertilizante, estimada com base na absorção de N pela planta, variou entre 20% e 27% do total aplicado. Os frutos exportaram 35% do N absorvido do fertilizante, e a dose de 400 g de N proporcionou a máxima produção de laranjas.Information about nutrient absorption of citrus orchards is important to establish guidelines for best soil fertility management. However, studies on the fate of applied N fertilizers and validation of nitrogen (N dose recommendations are scarce in the literature. The present work evaluated (i the accumulation of nutrients and the distribution of N (15N applied to citrus orchard and (ii validated the N fertilization rate applied to young bearing orange trees. Three- to four-year-old Pêra sweet orange trees Pera grafted on Rangpur lime were fertilized with 150, 300, 450, and 600 g of N per tree, as ammonium sulfate, split in three applications from spring to summer. A control treatment without N was included. In the same

Metabolic regulation in Streptomyces parvulus during actinomycin D synthesis, studied with 13C- and 15N-labeled precursors by 13C and 15N nuclear magnetic resonance spectroscopy and by gas chromatography-mass spectrometry

International Nuclear Information System (INIS)

Inbar, L.; Lapidot, A.

1988-01-01

Recent studies have suggested that the onset of synthesis of actinomycin D in Streptomyces is due to a release from L-glutamate catabolic repression. In the present investigation we showed that S. parvulus has the capacity to maintain high levels of intracellular glutamate during the synthesis of actinomycin D. The results seem contradictory, since actinomycin D synthesis cannot start before a release from L-glutamate catabolic repression, but a relatively high intracellular pool of glutamate is needed for the synthesis of actinomycin D. Utilizing different labeled precursors, D-[U- 13 C]fructose and 13 C- and 15 N-labeled L-glutamate, and nuclear magnetic resonance techniques, we showed that carbon atoms of an intracellular glutamate pool of S. parvulus were not derived biosynthetically from the culture medium glutamte source but rather from D-fructose catabolism. A new intracellular pyrimidine derivative whose nitrogen and carbon skeletons were derived from exogenous L-glutamate was obtained as the main glutamate metabolite. Another new pyrimidine derivative that had a significantly reduced intracellular mobility and that was derived from D-fructose catabolism was identified in the cell extracts of S. parvulus during actinomycin D synthesis. These pyrimidine derivatives may serve as a nitrogen store for actinomycin D synthesis. In the present study, the N-trimethyl group of a choline derivative was observed by 13 C nuclear magnetic resonance spectroscopy in growing S. parvulus cells. The choline group, as well as the N-methyl groups of sarcosine, N-methyl-valine, and the methyl groups of an actinomycin D chromophore, arose from D-fructose catabolism. The 13 C enrichments found in the peptide moieties of actinomycin D were in accordance with a mechanism of actinomycin D synthesis from L-glutamate and D-fructose