WorldWideScience

Sample records for yac contigs covering

  1. YAC contig information - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 8908/lsdba.nbdc00318-06-001 Description of data contents YAC contigs on the rice chromosomes Data file File name: rgp_physical...map_yac_contigs.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rgp-physicalmap/LATEST/rgp_physical...sciencedbc.jp/togodb/view/rgp_physicalmap_yac_contigs#en Data acquisition method The range including YAC con...m Description Chrom. No. Chromosome number Region Region number Physical map image The file name of rice physical...n Download License Update History of This Database Site Policy | Contact Us YAC contig information - RGP physicalmap | LSDB Archive ...

  2. Construction of a YAC contig and STS map spanning 2.5 Mbp in Xq25, the critical region for the X-linked lymphoproliferative (XLP) gene

    Energy Technology Data Exchange (ETDEWEB)

    Lanyi, A.; Li, B.F.; Li, S. [Univ. of Nebraska Medical Center, Omaha, NE (United States)] [and others

    1994-09-01

    X-linked lymphoproliferative disease (XLP) is characterized by a marked vulnerability in Epstein-Barr virus (EBV) infection. Infection of XLP patients with EBV invariably results in fatal mononucleosis, agammaglobulinemia or B-cell lymphoma. The XLP gene lies within a 10 cM region in Xq25 between DXS42 and DXS10. Initial chromosome studies revealed an interstitial, cytogenetically visible deletion in Xq25 in one XLP family (43-004). We estimated the size of the Xq25 deletion by dual laser flow karyotyping to involve 2% of the X chromosome, or approximately 3 Mbp of DNA sequences. To further delineate the deletion we performed a series of pulsed field gel electrophoresis (PFGE) analyses which showed that DXS6 and DXS100, two Xq25-specific markers, are missing from 45-004 DNA. Five yeast artificial chromosomes (YACs) from a chromosome X specific YAC library containing sequences deleted in patient`s 43-004 DNA were isolated. These five YACs did not overlap, and their end fragments were used to screen the CEPH MegaYAC library. Seven YACs were isolated from the CEPH MegaYAC library. They could be arranged into a contig which spans between DXS6 and DXS100. The contig contains a minimum of 2.5 Mbp of human DNA. A total of 12 YAC end clone, lambda subclones and STS probes have been used to order clones within the contig. These reagents were also used in Southern blot and patients showed interstitial deletions in Xq25. The size of these deletions range between 0.5 and 2.5 Mbp. The shortest deletion probably represents the critical region for the XLP gene.

  3. High-resolution YAC-cosmid-STS map of human chromosome 13.

    Science.gov (United States)

    Cayanis, E; Russo, J J; Kalachikov, S; Ye, X; Park, S H; Sunjevaric, I; Bonaldo, M F; Lawton, L; Venkatraj, V S; Schon, E; Soares, M B; Rothstein, R; Warburton, D; Edelman, I S; Zhang, P; Efstratiadis, A; Fischer, S G

    1998-01-01

    We have assembled a high-resolution physical map of human chromosome 13 DNA (approximately 114 Mb) from hybridization, PCR, and FISH mapping data using a specifically designed set of computer programs. Although the mapping of 13p is limited, 13q (approximately 98 Mb) is covered by an almost continuous contig of 736 YACs aligned to 597 contigs of cosmids. Of a total of 10,789 cosmids initially selected from a chromosome 13-specific cosmid library (16,896 colonies) using inter-Alu PCR probes from the YACs and probes for markers mapped to chromosome 13, 511 were assembled in contigs that were established from cross-hybridization relationships between the cosmids. The 13q YAC-cosmid map was annotated with 655 sequence tagged sites (STSs) with an average spacing of 1 STS per 150 kb. This set of STSs, each identified by a D number and cytogenetic location, includes database markers (198), expressed sequence tags (93), and STSs generated by sequencing of the ends of cosmid inserts (364). Additional annotation has been provided by positioning 197 cosmids mapped by FISH on 13q. The final (comprehensive) map, a list of STS primers, and raw data used in map assembly are available at our Web site (genome1.ccc.columbia.edu/ approximately genome/) and can serve as a resource to facilitate accurate localization of additional markers, provide substrates for sequencing, and assist in the discovery of chromosome 13 genes associated with hereditary diseases.

  4. Construction of a yeast artifical chromosome contig spanning the spinal muscular atrophy disease gene region

    Energy Technology Data Exchange (ETDEWEB)

    Kleyn, P.W.; Wang, C.H.; Vitale, E.; Pan, J.; Ross, B.M.; Grunn, A.; Palmer, D.A.; Warburton, D.; Brzustowicz, L.M.; Gilliam, T.G. (New York State Psychiatric Institute, NY (United States)); Lien, L.L.; Kunkel, L.M. (Howard Hughes Medical Institute, Boston, MA (United States))

    1993-07-15

    The childhood spinal muscular atrophies (SMAs) are the most common, serious neuromuscular disorders of childhood second to Duchenne muscular dystrophy. A single locus for these disorders has been mapped by recombination events to a region of 0.7 centimorgan (range, 0.1-2.1 centimorgans) between loci D5S435 and MAP1B on chromosome 5q11.2-13.3. By using PCR amplification to screen yeast artificial chromosome (YAC) DNA pools and the PCR-vectorette method to amplify YAC ends, a YAC contig was constructed across the disease gene region. Nine walk steps identified 32 YACs, including a minimum of seven overlapping YAC clones (average size, 460 kb) that span the SMA region. The contig is characterized by a collection of 30 YAC-end sequence tag sites together with seven genetic markers. The entire YAC contig spans a minimum of 3.2 Mb; the SMA locus is confined to roughly half of this region. Microsatellite markers generated along the YAC contig segregate with the SMA locus in all families where the flanking markers (D5S435 and MAP1B) recombine. Construction of a YAC contig across the disease gene region is an essential step in isolation of the SMA-encoding gene. 26 refs., 3 figs., 1 tab.

  5. Development of a YAC contig covering the minimal region of a CSNB1 locus in Xp11

    Energy Technology Data Exchange (ETDEWEB)

    Boycott, K.M.; Gratton, K.J.; Moore, B.J. [Univ. of Calgary (Canada)] [and others

    1994-09-01

    X-linked congenital stationary night blindness (CSNB1) is an eye disorder that includes impairment of night vision, reduced visual acuity and, in some cases, myopia and congenital nystagmus. Electroretinography reveals a marked reduction of the b-wave in affected individuals suggesting that X-linked CSNB is due to a molecular defect in the bipolar layer of the retina. Based on our studies of a large four generation family with X-linked CSNB, a CSNB1 locus was mapped to a 4-5 cM region at Xp11.23-Xp11.22 bounded telomerically by DXS426 and centromerically by DXS988. Using a panel of radiation and conventional somatic cell hybrids, a detailed map of new and published STSs has been generated for the minimal region of CSNB1. PCR primer pairs for STSs has been generated for the minimal region of CSNB1. PCR primer pairs for twenty-five STSs, including eleven end-clones, were used to isolate YAC clones from CEPH, mega-CEPH, and X chromosome-specific YAC libraries. In total, fifty-two YACs were characterized for STS overlaps and assembled to provide a minimum of 3 Mb of physical coverage in the region between DXS426 and DXS988. Five gaps proximal to SYP are still to be closed. Our physical map suggests the following gene order: Xpter-OTAL1-GF1-DXS1011E-MG81-HUMCRAS2P-SYP-Xcen. STS analysis of the YACs revealed three subregions of the physical map which appear to be particularly susceptible to internal deletions and end-clone analysis demonstrated chimerism in six of seventeen YACs. A physical map of Xp11.23-Xp11.22 will provide a resource for the isolation of candidate genes for the X-linked CSNB gene which maps to this region.

  6. A YAC contig and an EST map in the pericentromeric region of chromosome 13 surrounding the loci for neurosensory nonsyndromic deafness (DFNB1 and DFNA3) and Limb-Girdle muscular dystrophy type 2C (LGMD2C)

    Energy Technology Data Exchange (ETDEWEB)

    Guilford, P.; Crozet, F.; Blanchard, S. [Institut Pasteur, Paris (France)] [and others

    1995-09-01

    Two forms of inherited childhood nonsyndromic deafness (DFNB1 and DFNA3) and a Duchenne-like form of progressive muscular dystrophy (LGMD2C) have been mapped to the pericentromeric region of chromosome 13. To clone the genes responsible for these diseases we constructed a yeast artificial chromosome (YAC) contig spanning an 8-cM region between the polymorphic markers D13S221. The contig comprises 24 sequence-tagged sites, among which 15 were newly obtained. This contig allowed us to order the polymorphic markers centromere- D13S175-D13S141-D13S143-D13S115-AFM128yc1-D13S292-D13S283-AFM323vh5-D13S221-telomere. Eight expressed sequence tags, previously assigned to 13q11-q12 (D13S182E, D13S183E, D13S502E, D13S504E, D13S505E, D13S837E, TUBA2, ATP1AL1), were localized on the YAC contig. YAC screening of a cDNA library derived from mouse cochlea allowed us to identify an {alpha}-tubulin gene (TUBA2) that was subsequently precisely mapped within the candidate region. 36 refs., 2 figs., 2 tabs.

  7. A 1.7-Mb YAC contig around the human BDNF gene (11p13): integration of the physical, genetic, and cytogenetic maps in relation to WAGR syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Rosier, M.F.; Martin, A.; Houlgatte, R. [Genetique Moleculaire et Biologie du Development, Villejuif (France)] [and others

    1994-11-01

    WAGR (Wilms tumor, aniridia, genito-urinary abnormalities, mental retardation) syndrome in humans is associated with deletions of the 11p13 region. The brain-derived neurotrophic factor (BDNF) gene maps to this region, and its deletion seems to contribute to the severity of the patient`s mental retardation. Yeast artificial chromosomes (YACs) carrying the BDNF gene have been isolated and characterized. Localization of two known exons of this gene leads to a minimal estimation of its size of about 40 kb. Chimerism of the BDNF YACs has been investigated by fluorescence in situ hybridization and chromosome assignment on somatic cell hybrids. Using the BDNF gene, YAC end sequence tagged sites (STS), and Genethon microsatellite markers, the authors constructed a 1.7-Mb contig and refined the cytogenetic map at 11p13. The resulting integrated physical, genetic, and cytogenetic map constitutes a resource for the characterization of genes that may be involved in the WAGR syndrome. 42 refs., 2 figs., 3 tabs.

  8. Refined mapping and YAC contig construction of the X-linked cleft palate and ankyloglossia locus (CPX) including the proximal X-Y homology breakpoint within Xq21.3

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, S.A.; Brennan, L.; Richardson, M. [Queen Charlotte`s Hospital, London (United Kingdom)] [and others

    1996-01-01

    The gene for X-linked cleft palate (CPX) has previously been mapped in an Icelandic kindred between the unordered proximal markers DXS1002/DXS349/DXS95 and the distal marker DXYS1X, which maps to the proximal end of the X-Y homology region in Xq21.3. Using six sequence-tagged sites (STSs) within the region, a total of 91 yeast artificial chromosome (YAC) clones were isolated and overlapped in a single contig that spans approximately 3.1 Mb between DXS1002 and DXYS1X. The order of microsatellite and STS markers in this was established as DXS1002-DXS1168-DXS349-DXS95-DXS364-DXS1196-DXS472-DXS1217-DXYS1X. A long-range restriction map of this region was created using eight nonchimeric, overlapping YAC clones. Analysis of newly positioned polymorphic markers in recombinant individuals from the Icelandic family has enabled us to identify DXS1196 and DXS1217 as the flanking markers for CPX. The maximum physical distance containing the CPX gene has been estimated to be 2.0 Mb, which is spanned by a minimum set of five nonchimeric YAC clones. In addition, YAC end clone and STS analyses have pinpointed the location of the proximal boundary of the X-Y homology region within the map. 40 refs., 2 figs., 2 tabs.

  9. Mapping of the locus for autosomal dominant amelogenesis imperfecta (AIH2) to a 4-Mb YAC contig on chromosome 4q11-q21

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, C.; Holmgren, G.; Forsman, K. [Univ. Hospital, Umea (Sweden)]|[Univ. of Umea (Sweden)] [and others

    1997-01-15

    Amelogenesis imperfecta (Al) is a clinically and genetically heterogeneous group of inherited enamel defects. We recently mapped a locus for autosomal dominant local hypoplastic amelogenesis imperfecta (AIH2) to the long arm of chromosome 4. The disease gene was localized to a 17.6-cM region between the markers D4S392 and D4S395. The albumin gene (ALB), located in the same interval, was a candidate gene for autosomal dominant AI (ADAI) since albumin has a potential role in enamel maturation. Here we describe refined mapping of the AIH2 locus and the construction of marker maps by radiation hybrid mapping and yeast artificial chromosome (YAC)-based sequence tagged site-content mapping. A radiation hybrid map consisting of 11 microsatellite markers in the 5-cM interval between D4S409 and D4S1558 was constructed. Recombinant haplotypes in six Swedish ADAI families suggest that the disease gene is located in the interval between D4S2421 and ALB. ALB is therefore not likely to be the disease-causing gene. Affected members in all six families share the same allele haplotypes, indicating a common ancestral mutation in all families. The AIH2 critical region is less than 4 cM and spans a physical distance of approximately 4 Mb as judged from radiation hybrid maps. A YAC contig over the AIH2 critical region including several potential candidate genes was constructed. 35 refs., 4 figs., 1 tab.

  10. A 2-megabase physical contig incorporating 43 DNA markers on the human X chromosome at p11.23-p11.22 from ZNF21 to DXS255

    Energy Technology Data Exchange (ETDEWEB)

    Boycott, K.M.; Bech-Hansen, N.T. [Univ. of Calgary, Alberta (Canada); Halley, G.R.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States)

    1996-05-01

    A comprehensive physical contig of yeast artificial chromosomes (YACs) and cosmid clones between ZNF21 and DXS255 has been constructed, spanning 2 Mb within the region Xp11.23-p11.22. As a portion of the region was found to be particularly unstable in yeast, the integrity of the contig is dependent on additional information provided by the sequence-tagged site (STS) content of cosmid clones and DNA marker retention in conventional and radiation hybrids. The contig was formatted with 43 DNA markers, including 19 new STSs from YAC insert ends and an internal Alu-PCR product. The density of STSs across the contig ranges from one marker every 20 kb to one every 60 kb, with an average density of one marker every 50 kb. The relative order of previously known gene and expressed sequence tags in this region is predicted to be Xpter-ZNF21-DXS7465E (MG66)-DXS7927E (MG81)-WASP, DXS1011E, DXS7467E (MG21)-DXS-7466E (MG44)-GATA1-DXS7469E (Xp664)-TFE3-SYP (DXS1007E)-Xcen. This contig extends the coverage in Xp11 and provides a framework for the future identification and mapping of new genes, as well as the resources for developing DNA sequencing templates. 47 refs., 1 fig., 4 tabs.

  11. The human MCP-2 gene (SCYA8): Cloning, sequence analysis, tissue expression, and assignment to the CC chemokine gene contig on chromosome 17q11.2

    Energy Technology Data Exchange (ETDEWEB)

    Van Coillie, E.; Fiten, P.; Van Damme, J.; Opdenakker, G. [Univ. of Leuven (Belgium)] [and others

    1997-03-01

    Monocyte chemotactic proteins (MCPs) form a subfamily of chemokines that recruit leukocytes to sites of inflammation and that may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. With the use of degenerate primers that were based on CC chemokine consensus sequences, the known MIP-1{alpha}/LD78{alpha}, MCP-1, and MCP-3 genes and the previously unidentified eotaxin and MCP-2 genes were isolated from a YAC contig from human chromosome 17q11.2. The amplified genomic MCP-2 fragment was used to isolate an MCP-2 cosmid from which the gene sequence was determined. The MCP-2 gene shares with the MCP-1 and MCP-3 genes a conserved intron-exon structure and a coding nucleotide sequence homology of 77%. By Northern blot analysis the 1.0-kb MCP-2 mRNA was predominantly detectable in the small intestine, peripheral blood, heart, placenta, lung, skeletal muscle, ovary, colon, spinal cord, pancreas, and thymus. Transcripts of 1.5 and 2.4 kb were found in the testis, the small intestine, and the colon. The isolation of the MCP-2 gene from the chemokine contig localized it on YAC clones of chromosome 17q11.2, which also contain the eotaxin, MCP-1, MCP-3, and NCC-1/MCP-4 genes. The combination of using degenerate primer PCR and YACs illustrates that novel genes can efficiently be isolated from gene cluster contigs with less redundancy and effort than the isolation of novel ESTs. 42 refs., 5 figs., 2 tabs.

  12. Contig Maps and Genomic Sequencing Identify Candidate Genes in the Usher 1C Locus

    Science.gov (United States)

    Higgins, Michael J.; Day, Colleen D.; Smilinich, Nancy J.; Ni, L.; Cooper, Paul R.; Nowak, Norma J.; Davies, Chris; de Jong, Pieter J.; Hejtmancik, Fielding; Evans, Glen A.; Smith, Richard J.H.; Shows, Thomas B.

    1998-01-01

    Usher syndrome 1C (USH1C) is a congenital condition manifesting profound hearing loss, the absence of vestibular function, and eventual retinal degeneration. The USH1C locus has been mapped genetically to a 2- to 3-cM interval in 11p14–15.1 between D11S899 and D11S861. In an effort to identify the USH1C disease gene we have isolated the region between these markers in yeast artificial chromosomes (YACs) using a combination of STS content mapping and Alu–PCR hybridization. The YAC contig is ∼3.5 Mb and has located several other loci within this interval, resulting in the order CEN-LDHA-SAA1-TPH-D11S1310-(D11S1888/KCNC1)-MYOD1-D11S902D11S921-D11S1890-TEL. Subsequent haplotyping and homozygosity analysis refined the location of the disease gene to a 400-kb interval between D11S902 and D11S1890 with all affected individuals being homozygous for the internal marker D11S921. To facilitate gene identification, the critical region has been converted into P1 artificial chromosome (PAC) clones using sequence-tagged sites (STSs) mapped to the YAC contig, Alu–PCR products generated from the YACs, and PAC end probes. A contig of >50 PAC clones has been assembled between D11S1310 and D11S1890, confirming the order of markers used in haplotyping. Three PAC clones representing nearly two-thirds of the USH1C critical region have been sequenced. PowerBLAST analysis identified six clusters of expressed sequence tags (ESTs), two known genes (BIR,SUR1) mapped previously to this region, and a previously characterized but unmapped gene NEFA (DNA binding/EF hand/acidic amino-acid-rich). GRAIL analysis identified 11 CpG islands and 73 exons of excellent quality. These data allowed the construction of a transcription map for the USH1C critical region, consisting of three known genes and six or more novel transcripts. Based on their map location, these loci represent candidate disease loci for USH1C. The NEFA gene was assessed as the USH1C locus by the sequencing of an amplified NEFA

  13. Report of the Fourth International Workshop on human X chromosome mapping 1993

    Energy Technology Data Exchange (ETDEWEB)

    Schlessinger, D.; Mandel, J.L.; Monaco, A.P.; Nelson, D.L.; Willard, H.F. [eds.

    1993-12-31

    Vigorous interactive efforts by the X chromosome community have led to accelerated mapping in the last six months. Seventy-five participants from 12 countries around the globe contributed progress reports to the Fourth International X Chromosome Workshop, at St. Louis, MO, May 9-12, 1993. It became clear that well over half the chromosome is now covered by YAC contigs that are being extended, verified, and aligned by their content of STSs and other markers placed by cytogenetic or linkage mapping techniques. The major aim of the workshop was to assemble the consensus map that appears in this report, summarizing both consensus order and YAC contig information.

  14. Yeast artificial chromosome cloning in the glycerol kinase and adrenal hypoplasia congenita region of Xp21

    Energy Technology Data Exchange (ETDEWEB)

    Worley, K.C.; Ellison, K.A.; Zhang, Y.H.; Wang, D.F.; Mason, J.; Roth, E.J.; Adams, V.; Fogt, D.D.; Zhu, X.M.; Towbin, J.A. [Baylor College of Medicine, Houston, TX (United States)] [and others

    1993-05-01

    The adrenal hypoplasia congenita (AHC) and glycerol kinase (GK) loci are telomeric to the Duchenne muscular dystrophy locus in Xp21. The authors developed a pair of yeast artificial chromosome (YAC) contigs spanning at least 1.2 Mb and encompassing the region from the telomeric end of the Duchenne muscular dystrophy (DMD) locus to beyond YHX39 (DXS727), including the genes for AHC and GK. The centromeric contig consists of 13 YACs reaching more than 600 kb from DMD through GK. The telomeric contig group consists of 8 YACs containing more than 600 kb including the markers YHX39 (DXS727) and QST-59 (DXS319). Patient deletion breakpoints in the region of the two YAC contigs define at least eight intervals, and seven deletion breakpoints are contained within these contigs. In addition to the probes developed from YAC ends, they have mapped eight Alu-PCR probes amplified from a radiation-reduced somatic cell hybrid, two anonymous DNA probes, and one Alu-PCR product amplified from a cosmid end, for a total of 26 new markers within this region of 2 Mb or less. One YAC in the centromeric contig contains an insert encompassing the minimum interval for GK deficiency defined by patient deletion breakpoints, and this clone includes all or part of the GK gene. 33 refs., 3 figs., 5 tabs.

  15. YAC clone information - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 08/lsdba.nbdc00318-06-002 Description of data contents YAC clones selected with DNA markers Data file File name: rgp_physical...map_yac_clones.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rgp-physicalmap/LATEST/rgp_physical...sciencedbc.jp/togodb/view/rgp_physicalmap_yac_clones#en Data acquisition method YAC clones selected with RGP...rom. No. Chromosome number Region Region number Physical map image The file name of rice physical map Order ...bout This Database Database Description Download License Update History of This Database Site Policy | Contact Us YAC clone information - RGP physicalmap | LSDB Archive ...

  16. Transfer of an expression YAC into goat fetal fibroblasts by cell fusion for mammary gland bioreactor

    International Nuclear Information System (INIS)

    Zhang Xufeng; Wu Guoxiang; Chen, Jian-Quan; Zhang Aimin; Liu Siguo; Jiao Binghua; Cheng Guoxiang

    2005-01-01

    Yeast artificial chromosomes (YACs) as transgenes in transgenic animals are likely to ensure optimal expression levels. Microinjection of YACs is the exclusive technique used to produce YACs transgenic livestock so far. However, low efficiency and high cost are its critical restrictive factors. In this study, we presented a novel procedure to produce YACs transgenic livestock as mammary gland bioreactor. A targeting vector, containing the gene of interest-a human serum albumin minigene (intron 1, 2), yeast selectable marker (G418R), and mammalian cell resistance marker (neo r ), replaced the α-lactalbumin gene in a 210 kb human α-lactalbumin YAC by homogeneous recombination in yeasts. The chimeric YAC was introduced into goat fetal fibroblasts using polyethylene glycol-mediated spheroplast fusion. PCR and Southern analysis showed that intact YAC was integrated in the genome of resistant cells. Perhaps, it may offer a cell-based route by nuclear transfer to produce YACs transgenic livestock

  17. A method for high efficiency YAC lipofection into murine embryonic stem cells.

    Science.gov (United States)

    Lee, J T; Jaenisch, R

    1996-01-01

    We describe a modified protocol for introducing yeast artificial chromosomes (YACs) into murine embryonic stem (ES) cells by lipofection. With a decreased DNA:cell ratio, increased concentration of condensing agents and altered culture conditions, this protocol reduces the requirement for YAC DNA to a few micrograms, improves the recovery of neomycin-resistant ES colonies and increases the yield of clones containing both flanking vector markers and insert. These modifications enable generation of sufficient 'intact' transgenic clones for biological analysis with a single experiment. PMID:9016681

  18. Evaluation of Texture Profile, Color and Determination of FOS in Yacón Products (Smallanthus sonchifolius

    Directory of Open Access Journals (Sweden)

    Valeria Cristina Del Castillo

    2016-07-01

    Full Text Available Textural characteristics, color and fructooligosaccharides (FOS content, in yacón root products (syrup and dried snack subjected to different pretreatments with NaCl, blanching and ascorbic acid were evaluated. Yacón from Salta Capital, with 8 months of growth were used. Texture profiles and Color were evaluated instrumentally and FOS content by HPLC. There were significant differences between the samples treated with NaCl and the ones treated by blanching and ascorbic acid for fracture strength, fracture number and hardness according to pretreatment used, and for hardness and tackiness by the drying time. Regarding to color: longer drying time reduces sample brightness. In processed products the FOS content is lower than in fresh yacón, but higher in sucrose, glucose and fructose.

  19. Efecto de gelificantes en la formulación de dulce de yacón

    OpenAIRE

    Maldonado,Silvina; Singh,Judith del Carmen

    2008-01-01

    El yacón (Smallanthus sonchifolius) es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se ag...

  20. Dicty_cDB: Contig-U12086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

  1. Physical and transcription map of a 25 Mb region on human chromosome 7 (region q21-q22)

    Energy Technology Data Exchange (ETDEWEB)

    Scherer, S. [Univ. of Toronto (Canada)]|[Hosptial for Sick Children, Toronto (Canada); Little, S.; Vandenberg, A. [Hospital for Sick Children, Toronto (Canada)] [and others

    1994-09-01

    We are interested in the q21-q22 region of chromosome 7 because of its implication in a number of diseases. This region of about 25 Mb appears to be involved in ectrodactyly/ectodermal dysplasia/cleft plate (EEC) and split hand/split foot deformity (SHFD1), as well as myelodysplastic syndrome and acute non-lymphocyte leukemia. In order to identify the genes responsible for these and other diseases, we have constructed a physical map of this region. The proximal and distal boundaries of the region were operationally defined by the microsatellite markers D7S660 and D7S692, which are about 35 cM apart. This region between these two markers could be divided into 13 intervals on the basis of chromosome breakpoints contained in somatic cell hybrids. The map positions for 43 additional microsatellite markers and 25 cloned genes were determined with respect to these intervals. A physical map based on contigs of over 250 YACs has also been assembled. While the contigs encompass all of the known genetic markers mapped to the region and almost cover the entire 25-Mb region, there are 3 gaps on the map. One of these gaps spans a set of DNA markers for which no corresponding YAC clones could be identified. To connect the two adjacent contigs we have initiated cosmid walking with a chromosome 7-specific library (Lawrence Livermore Laboratory). A tiling path of 60 contiguous YAC clones has been assembled and used for direct cDNA selection. Over 300 cDNA clones have been isolated and characterized. They are being grouped into transcription units by Northern blot analysis and screening of full-length cDNA libraries. Further, exon amplification and direct cDNA library screening with evolutionarily conserved sequences are being performed for a 1-Mb region spanning the SHFD1 locus to ensure detection of all transcribed sequences.

  2. Dicty_cDB: Contig-U09640-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig

  3. Dicty_cDB: Contig-U09694-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

  4. AcEST: CL1889Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1889Contig1 491 2 Adiantum capillus-veneris contig: CL1889contig1 sequence. Link ...apillus-veneris contig: CL1889contig1 sequence. Link to clone list Link to clone list Clone ID BP919609 BP91

  5. Dicty_cDB: Contig-U15058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15058-1 no gap 1987 4 4423139 4424727 PLUS 2 4 U15058 0 0 0 0 0 0 0 0 1 0 1 0 0 0 Show Contig...-U15058-1 Contig ID Contig-U15058-1 Contig update 2004. 6.11 Contig sequence >Contig-U15058-1 (Contig...-U15058-1Q) /CSM_Contig/Contig-U15058-1Q.Seq.d AAAAAAGGTTACTCACAAAGTTAAAGAAATCAATGAAAGATTTACCACCC...ACTCAAGGGGGTAGGAGAATAAAATCAACCGATTATCCAGGCNTTAAG CGACCTTTTTCCCAAAAAAAAAAGATGTTCAGAAAAT Gap no gap Contig len...srx*atffpkkkdvq k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15058-1 (Contig-U15058-1Q) /CSM_Contig/Contig

  6. Dicty_cDB: Contig-U14745-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

  7. Dicty_cDB: Contig-U03367-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

  8. Dicty_cDB: Contig-U16086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16086-1 gap included 1018 - - - - 3 4 U16086 0 0 0 0 0 1 1 0 0 0 1 0 0 0 Show Contig-U16086-1 Contig... ID Contig-U16086-1 Contig update 2004. 6.11 Contig sequence >Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig.../Contig-U16086-1Q.Seq.d AATTTGATGAAGTAGTAGTAGAGGTAAAACATGTATCAAAACATTATAAG ATTGCAGG...ACTTGGATATAAATGAAG GTAGCTCATCAAATTTTTCAAATAATGATAATTTTAAATCGGTAGATCAA ATTACCAATGACCTTAGCCGTATTTTAT Gap gap included Contig...KSVDQI TNDLSRIL own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig/Contig

  9. Dicty_cDB: Contig-U13737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13737-1 no gap 672 6 1762420 1761754 MINUS 1 1 U13737 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13737-1 Contig ID Contig-U13737-1 Contig update 2002.12.18 Contig sequence >Contig-U13737-1 (Contig...-U13737-1Q) /CSM_Contig/Contig-U13737-1Q.Seq.d NNNNNNNNNNAAAATTAGAAAATGGTACAATTGTTTTTAGAGATATTTCA...AGAATAGAAGGAAAATAT AGATCAATGGGGTGGCACAACA Gap no gap Contig length 672 Chromosome...gwhn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13737-1 (Contig-U13737-1Q) /CSM_Contig/Contig

  10. Dicty_cDB: Contig-U06307-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06307-1 no gap 637 6 29174 29801 PLUS 4 5 U06307 4 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06307-1 Contig ID Contig-U06307-1 Contig update 2002. 9.13 Contig sequence >Contig-U06307-1 (Contig...-U06307-1Q) /CSM_Contig/Contig-U06307-1Q.Seq.d CCCGCGTCCGAATGCCTCGTATTTTACACACTATGCTCCGTGTGGGTAAT TTAG...ATAGTATTTTTATTTTATT CTTTTTCTTTTAAAAATTTTTTATATTGTCAACAATATAATCAAATAAAT GTATTTAATTATCGGGTATTAAAAAAAAAAAAAAAAA Gap no gap Contig...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06307-1 (Contig-U06307-1Q) /CSM_Contig/Contig-U063

  11. Dicty_cDB: Contig-U15541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15541-1 gap included 2750 - - - - 634 1127 U15541 1 129 1 375 19 0 2 32 4 69 1 0 1 0 Show Contig...-U15541-1 Contig ID Contig-U15541-1 Contig update 2004. 6.11 Contig sequence >Contig-U15541-1 (Contig...-U15541-1Q) /CSM_Contig/Contig-U15541-1Q.Seq.d ATAATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAG...AAAAAT AAAAATAAAAATAAATAAATAATCATTTCATATTAATATTTTTTTTTATT TTTAAAAAAA Gap gap included Contig...ffyf*k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Contig

  12. Dicty_cDB: Contig-U06822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06822-1 no gap 468 3 438742 439211 PLUS 1 1 U06822 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06822-1 Contig ID Contig-U06822-1 Contig update 2001. 8.30 Contig sequence >Contig-U06822-1 (Contig...-U06822-1Q) /CSM_Contig/Contig-U06822-1Q.Seq.d ATATTATTCTATTCACTCGTAATAATACATATAAATTGATATCAATCAGA AA...TGCTATTAAGACTTTGGAGCAAAAAAC TAACAAATCAATTCAAAA Gap no gap Contig length 468 Chromosome number (1..6, M) 3 Ch...*mmlklkeikllvllrlwskkltnqfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06822-1 (Contig-U06822-1Q) /CSM_Contig/Contig

  13. Dicty_cDB: Contig-U01997-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

  14. Dicty_cDB: Contig-U13254-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

  15. Dicty_cDB: Contig-U13891-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13891-1 no gap 1355 6 799802 798446 MINUS 4 4 U13891 0 0 0 0 1 1 1 0 0 0 1 0 0 0 Show Contig...-U13891-1 Contig ID Contig-U13891-1 Contig update 2002.12.18 Contig sequence >Contig-U13891-1 (Contig...-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d TTTTAAAATATTTCAAAATTAGCGAGCACGCATTCGCATATAAATATATT ...ACAAATAAAAAAAAAAAATAAAAAAAATA ATTTA Gap no gap Contig length 1355 Chromosome numb...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U138

  16. Dicty_cDB: Contig-U16093-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q

  17. Dicty_cDB: Contig-U06384-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063

  18. Dicty_cDB: Contig-U12545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

  19. Dicty_cDB: Contig-U10823-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

  20. Dicty_cDB: Contig-U13065-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

  1. Dicty_cDB: Contig-U08861-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

  2. Dicty_cDB: Contig-U06829-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06829-1 no gap 449 5 4394444 4394893 PLUS 1 1 U06829 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06829-1 Contig ID Contig-U06829-1 Contig update 2001. 8.30 Contig sequence >Contig-U06829-1 (Contig...-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d GTAAAAGAATGTAATGAAAATGAAAAAATTAATTTTATAATAAAATTATT ...ATGATTTAGAATTGGTACAATTAGTTTA Gap no gap Contig length 449 Chromosome number (1..6, M) 5 Chromosome length 50...04. 6.10 Homology vs CSM-cDNA Query= Contig-U06829-1 (Contig-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d (

  3. Dicty_cDB: Contig-U12073-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

  4. Dicty_cDB: Contig-U09615-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

  5. Dicty_cDB: Contig-U04432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04432-1 no gap 600 1 1520578 1521098 PLUS 1 1 U04432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04432-1 Contig ID Contig-U04432-1 Contig update 2001. 8.29 Contig sequence >Contig-U04432-1 (Contig...-U04432-1Q) /CSM_Contig/Contig-U04432-1Q.Seq.d AATTATAATCAAAACAAATTAATAAAAAAAATGATTAATAGTTTTGTCTC ...TCAACAATATGAAATTGCAAGAT TAAATGGTTATGATAATGCCCATAATTTACCAAGAGATATTAGTCAAATA Gap no gap Contig length 600 Chro...ni**fkgrnsnknyfsrymgtiessti*n ckikwl**cp*ftkry*sn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U04432-1 (Contig

  6. Dicty_cDB: Contig-U15828-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

  7. Dicty_cDB: Contig-U01750-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

  8. Dicty_cDB: Contig-U07021-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  9. Dicty_cDB: Contig-U16108-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16108-1 gap included 1456 4 1889609 1888449 MINUS 4 6 U16108 0 0 2 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U16108-1 Contig ID Contig-U16108-1 Contig update 2004. 6.11 Contig sequence >Contig-U16108-1 (Contig-U16108-1Q) /CSM_Contig/Contig-U1610...AAAATCA TAAAATCAAAAATTGTATAATTAAAATAAAAATAAAAAAAAAAACAAAAA TAAAAAAAAAAAACAA Gap gap included Contig length 1...DFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIGDNFYTKTGYNEIAETNNIIILYPQALET...---NYVNNDNIKTMFDIQSEHAFITNSFGNNCTYLGPDYINNCNFNAPWDFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIG

  10. Dicty_cDB: Contig-U13974-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

  11. Dicty_cDB: Contig-U16008-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L

  12. Dicty_cDB: Contig-U11342-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

  13. Dicty_cDB: Contig-U11195-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

  14. Dicty_cDB: Contig-U01791-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01791-1 no gap 527 2 7629792 7630319 PLUS 1 1 U01791 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01791-1 Contig ID Contig-U01791-1 Contig update 2001. 8.29 Contig sequence >Contig-U01791-1 (Contig...-U01791-1Q) /CSM_Contig/Contig-U01791-1Q.Seq.d GTTTGATTATAATTTATATGAATGTGAAATTAGACAAGCATTATCAAATA ...TCGTTCCCTTATGATTTAAGAACAACTTT GAATAGTTACAGAAATGGTGAATTTAGTATTTATCAATAAATTTTTTTTT AAAGATTTATAATTAAAATAAAAAAAA Gap no gap Contig...SILWSIESIGSLIVSAQINDDRETMELLHRYQIPQKFLIPLF QILALIDQLEKDLSHQIELDKFTINRDYYFLKSFSNLIEPPLNCLGILKTSRPHFRIFKL VGKNMISQVLETIG

  15. Dicty_cDB: Contig-U09412-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

  16. Dicty_cDB: Contig-U12357-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

  17. Dicty_cDB: Contig-U10996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

  18. Dicty_cDB: Contig-U12049-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

  19. Dicty_cDB: Contig-U13894-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

  20. Dicty_cDB: Contig-U15462-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

  1. Dicty_cDB: Contig-U09720-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK

  2. Dicty_cDB: Contig-U09379-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn

  3. Dicty_cDB: Contig-U15566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

  4. Dicty_cDB: Contig-U04334-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04334-1 no gap 399 4 3746420 3746021 MINUS 3 3 U04334 0 0 0 0 0 0 3 0 0 0 0 0 0 0 Show Contig...-U04334-1 Contig ID Contig-U04334-1 Contig update 2001. 8.29 Contig sequence >Contig-U04334-1 (Contig...-U04334-1Q) /CSM_Contig/Contig-U04334-1Q.Seq.d CAAAAAAAAAAAAGTAAAACAATAAATTATATAAAAAAAATAAAAAAAAT...CTAATTTCA AACAATATCAATAAAATGTTATATAATTACTATTAAAATGAAAAAAAAA Gap no gap Contig len...ce QKKKSKTINYIKKIKKMSIINTISKLSLSNSLKSNITIGNLNGTTVNNYTHNETSSKFTE FFYKII*qnkrwf*kvkelnkkkrkkdyiissfcklysiyfvfs

  5. Dicty_cDB: Contig-U10335-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

  6. Dicty_cDB: Contig-U12399-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

  7. Dicty_cDB: Contig-U11404-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

  8. Dicty_cDB: Contig-U09569-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09569-1 gap included 1424 5 3658944 3660352 PLUS 8 14 U09569 0 0 8 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09569-1 Contig ID Contig-U09569-1 Contig update 2002. 9.13 Contig sequence >Contig-U09569-1 (Contig-U09569-1Q) /CSM_Contig/Contig-U0956...TTAAAAA TAAAATAAATATAAAATAAAATAAAAATTAACAA Gap gap included Contig length 1424 Chromosome number (1..6, M) 5...NQTFQQKYYVNDQYYNYKNGGPIILYINGEGPVSSPPYSSDDGVVIYAQA LNCMIVTLEHRFYGESSPFSELTIENLQYLSHQQALEDLATFVVDFQSKLVGAGHIVTIG...YLSHQQALEDLATFVVDFQSKLVGAGHIVTIG GSYSGALSAWFRIKYPHITVGSIASLGVVHSILDFTAFDAYVSYA---

  9. Dicty_cDB: Contig-U15306-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15306-1 no gap 2452 3 3887051 3889342 PLUS 54 91 U15306 0 0 0 49 4 1 0 0 0 0 0 0 0 0 Show Contig...-U15306-1 Contig ID Contig-U15306-1 Contig update 2004. 6.11 Contig sequence >Contig-U15306-1 (Contig...-U15306-1Q) /CSM_Contig/Contig-U15306-1Q.Seq.d AAGCATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTA...TTTTAGAACTTCAAAAAATAGTAC AAATTTTTTCAAATTAAGATAAAAAAAATAAAACAAAAATTAATTTAAAA CA Gap no gap Contig length 2452...*naagtgkgeegrt*hkslpywlapqvkgsvmprggqghygasrggrkhmgidfssivg qdivapisgkvvnfkgartkypmlqlypskkftefdylqmlyvhppvginmgasyqvsvg dtig

  10. Dicty_cDB: Contig-U14772-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14772-1 no gap 665 1 1988279 1987624 MINUS 1 1 U14772 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14772-1 Contig ID Contig-U14772-1 Contig update 2002.12.18 Contig sequence >Contig-U14772-1 (Contig...-U14772-1Q) /CSM_Contig/Contig-U14772-1Q.Seq.d AAAAACAATAACCATCGTTTTTTATTTTTATTTTCAAAATATGGATTTAA...AAATTAATGAAGAAAAAA AAGTAANNNNNNNNN Gap no gap Contig length 665 Chromosome number...DADTTISFLSSQNLSQLSIIKNLVNGKTIG DKKVIVDFYDFKKVIPTPTPIPTPTPPTKTQEESNKKIKLTNEKPKEKKP

  11. Dicty_cDB: Contig-U11141-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

  12. Dicty_cDB: Contig-U13202-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

  13. Dicty_cDB: Contig-U15062-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15062-1 no gap 1282 3 4759691 4758480 MINUS 5 6 U15062 0 0 0 0 0 0 1 0 1 1 1 0 1 0 Show Contig...-U15062-1 Contig ID Contig-U15062-1 Contig update 2004. 6.11 Contig sequence >Contig-U15062-1 (Contig...-U15062-1Q) /CSM_Contig/Contig-U15062-1Q.Seq.d CAAATATTTAAATAAATTTAACATTATAAAAACAAAAATTAATAAAGTA...TTTTCAATAGATAATAATAAAAAAAAAAAAAAAAAAA AAAAAAAAATTATTTTAAAAATAAAAAAAAAA Gap no gap Contig length 1282 Chromos...KMSHNHNSNNNKTTTTTTNDSGSAIANGINLEKILADVKECN YNLVNSITATEAIQKEKESLENELSTKGTIGDGKRIKKLQYNISLQTETLMKTLMKLDSL SITG

  14. Dicty_cDB: Contig-U09432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09432-1 gap included 993 5 741953 740957 MINUS 1 2 U09432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09432-1 Contig ID Contig-U09432-1 Contig update 2002. 9.13 Contig sequence >Contig-U09432-1 (Contig...-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d AGGAAATATTTTAATATTTTATTTTTTTTATTTTTTTTATTTATTA...TTTTGGTGGTAAATATAGATATGAAAATAAA CAAATCCAAATTTTAGTTGAATTAAATTTCACTGATACCACTCAAAAAAA AAA Gap gap included Contig...iy*sni*SVKFGICYNYAKYHLSICNHTIYPGSDNQSLYFKLSSIFDS PTILSGYAVIYNSLDQIITNGTYNLILDEDVPTIG

  15. Dicty_cDB: Contig-U15005-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15005-1 no gap 2023 1 1509217 1507616 MINUS 2 4 U15005 0 0 0 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U15005-1 Contig ID Contig-U15005-1 Contig update 2004. 6.11 Contig sequence >Contig-U15005-1 (Contig...-U15005-1Q) /CSM_Contig/Contig-U15005-1Q.Seq.d AATTTTCTTTTCTTTTTAAAACTTAAGTACCATATGGCAGAATATACAC...ATAATAACGATATTAA Gap no gap Contig length 2023 Chromosome number (1..6, M) 1 Chro...HMAEYTHYFIQYNLTDIFYEDVNIEKYSCSICYESVYKKEIYQCKEIHWF CKTCWAESLFKKKECMICRCIVKSISELSRNRFIEQDFLNIKVNCPNSFKYIDENKNNNN KIKDLENGCKDIITIG

  16. Dicty_cDB: Contig-U10406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10406-1 no gap 661 4 1621526 1620875 MINUS 1 1 U10406 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U10406-1 Contig ID Contig-U10406-1 Contig update 2002. 9.13 Contig sequence >Contig-U10406-1 (Contig...-U10406-1Q) /CSM_Contig/Contig-U10406-1Q.Seq.d NNNNNNNNNNATAAGTAAAAGAGTTATTGGTCCAAGATTAGATGATGACA...TACAAATAAGTAAAGTTG ATAAAGAACAT Gap no gap Contig length 661 Chromosome number (1....cid sequence XXXISKRVIGPRLDDDNNNNDNDKFNNNNKKAIGPSRIGPTIGPSIGPSRYNTNNNDSNH NSNNDDDDDSSEEDEEDTKSEWERVRNMIENNKN

  17. Dicty_cDB: Contig-U16457-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

  18. Dicty_cDB: Contig-U04768-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

  19. Dicty_cDB: Contig-U13326-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13326-1 no gap 240 6 1728259 1728019 MINUS 1 1 U13326 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show Contig...-U13326-1 Contig ID Contig-U13326-1 Contig update 2002.12.18 Contig sequence >Contig-U13326-1 (Contig...-U13326-1Q) /CSM_Contig/Contig-U13326-1Q.Seq.d AATGACTCAACAAATCTTGGAGAGTATGCAAAATACTTTCCAATCTATGG...CCTCGTTAAAGGTGCTGGTGC TGAATTAAGTTCTCGTGCTCATGAGTGTTTCATTAGTGCCTTGGATATTG CCTCTGATTATACCTACGAGAAAATTACCATTGGCTTGGA Gap no gap Contig...FQSMDGPTIKRLATTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF ISALDIASDYTYEKITIGL Translated Amino Acid sequence (All Fra

  20. Dicty_cDB: Contig-U15036-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

  1. Dicty_cDB: Contig-U13455-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

  2. Dicty_cDB: Contig-U14400-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

  3. Dicty_cDB: Contig-U10709-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

  4. Dicty_cDB: Contig-U10837-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

  5. Dicty_cDB: Contig-U12765-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

  6. Dicty_cDB: Contig-U09480-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

  7. Dicty_cDB: Contig-U09345-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09345-1 gap included 1216 4 3361857 3360637 MINUS 4 5 U09345 1 0 1 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U09345-1 Contig ID Contig-U09345-1 Contig update 2002. 9.13 Contig sequence >Contig-U09345-1 (Contig-U09345-1Q) /CSM_Contig/Contig-U0934...AATGGTATTTTAAAAATAA Gap gap included Contig length 1216 Chromosome number (1..6, M) 4 Chromosome length 5430...ALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPITQKGYAYTGFEQTSS QSISDFIYSHSKI...LLALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPI

  8. Dicty_cDB: Contig-U15323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK

  9. Dicty_cDB: Contig-U14236-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

  10. Dicty_cDB: Contig-U10291-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10291-1 no gap 932 4 3203354 3204286 PLUS 2 2 U10291 0 0 1 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10291-1 Contig ID Contig-U10291-1 Contig update 2002. 9.13 Contig sequence >Contig-U10291-1 (Contig...-U10291-1Q) /CSM_Contig/Contig-U10291-1Q.Seq.d GTAAAGGTTTTATGTGTATATTTTTTAATGACCTTTTCGAATTAGTTTCA ...CAAAATAGATTAAATCTTAGTTACTCTCATGC TAATCAATATGTTGAGAGTTTTCCATCACAAATGTTATCAACAATTGCAA AATTCATTAGTTTCTTATTTGGTT...SLMYSL FNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAE ELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSY

  11. Dicty_cDB: Contig-U07545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07545-1 no gap 439 3 4955441 4955098 MINUS 1 1 U07545 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U07545-1 Contig ID Contig-U07545-1 Contig update 2002. 5. 9 Contig sequence >Contig-U07545-1 (Contig...-U07545-1Q) /CSM_Contig/Contig-U07545-1Q.Seq.d ATATGAAATACTTAATACTTTTAATTTTCCTTTTAATAAATTCAACTTTT...ATGTTTCAGAGTCTGGTTG Gap no gap Contig length 439 Chromosome number (1..6, M) 3 Chromosome length 6358359 Sta...e MKYLILLIFLLINSTFGNIQFSKYISNSGNDNNSCGSFTSPCKTIGYSIQQIKSYEYNQY SIEILLDSGNYYSQNPINLYGLNISISAQNSNDLVQFLVPNINGT

  12. Dicty_cDB: Contig-U15359-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15359-1 no gap 1420 6 1334613 1333192 MINUS 3 3 U15359 0 1 0 0 1 0 0 0 0 1 0 0 0 0 Show Contig...-U15359-1 Contig ID Contig-U15359-1 Contig update 2004. 6.11 Contig sequence >Contig-U15359-1 (Contig...-U15359-1Q) /CSM_Contig/Contig-U15359-1Q.Seq.d TATAGCATCATTTGCAAAGTTTAGTTTAAAGAAAAAAGAGAAAGCGGAA...A AAAAAAACTGGAAAAATTAA Gap no gap Contig length 1420 Chromosome number (1..6, M) 6 Chromosome length 3595308...SSGF DEPSLAVMYVDRALKGASAVQTIGRLSRVSKGKNACYIVDFVNTRREISDAFGQYWRETC LKGETRKTVLELKLNRVLGKLSAIEPLANGRLEESVEYILRD

  13. Dicty_cDB: Contig-U09581-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09581-1 gap included 1235 1 2575525 2576764 PLUS 1 2 U09581 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09581-1 Contig ID Contig-U09581-1 Contig update 2002. 9.13 Contig sequence >Contig-U09581-1 (Contig-U09581-1Q) /CSM_Contig/Contig-U09581...ATCAAAATAAATTTTTGTAACATTAATAATAAATAAN Gap gap included Contig length 1235 Chromosome number (1..6, M) 1 Chro... VFD420Z ,579,1237 Translated Amino Acid sequence KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVS...ames) Frame A: KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVSII CDTIQ

  14. Dicty_cDB: Contig-U04729-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq

  15. Dicty_cDB: Contig-U06929-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06929-1 no gap 726 5 4252576 4251850 MINUS 1 1 U06929 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06929-1 Contig ID Contig-U06929-1 Contig update 2001. 8.30 Contig sequence >Contig-U06929-1 (Contig...-U06929-1Q) /CSM_Contig/Contig-U06929-1Q.Seq.d AGTTCATTCATTTAGTCGTATGATAGTATCACCATTTATAAATCCAAAAT...TAAATTAAATAAATA Gap no gap Contig length 726 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start p...PSAISNNSNNS NNNDDNRPPILGLPFLFDYKNRITRGSRFFETIHYKIVHVTSATEFGIRRISKLYGTKWQ LEIGLKHQITQSGALQCLFTHTIGQTTIFGLSFGF

  16. Dicty_cDB: Contig-U15525-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15525-1 gap included 3361 6 202399 204109 PLUS 34 57 U15525 0 0 7 0 7 6 0 0 4 3 7 0 0 0 Show Contig...-U15525-1 Contig ID Contig-U15525-1 Contig update 2004. 6.11 Contig sequence >Contig-U15525-1 (Contig-U15525-1Q) /CSM_Contig/Contig-U15525...ATTTAATTAAATAATAATA Gap gap included Contig length 3361 Chromosome number (1..6, M) 6 Chromosome length 3595...TEATCLILSVD ETVQNNQAEQAQAGPQINNQTRQALSRVEVFKQ--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKVLCLNIELELK...lslnsiqslpqlkqlv*ssll mkpfkiiklnklklvhklitkhvklyhg*rcss--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKV

  17. Dicty_cDB: Contig-U09822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

  18. Dicty_cDB: Contig-U11883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

  19. Dicty_cDB: Contig-U13680-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

  20. Dicty_cDB: Contig-U15718-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15718-1 gap included 3735 6 2645446 2642451 MINUS 153 276 U15718 0 0 0 118 ...1 0 0 20 3 10 1 0 0 0 Show Contig-U15718-1 Contig ID Contig-U15718-1 Contig update 2004. 6.11 Contig sequence >Contig...-U15718-1 (Contig-U15718-1Q) /CSM_Contig/Contig-U15718-1Q.Seq.d AAATTATTAAATTGTTTATTAATTTTTTTTTTTAC...CCTG Gap gap included Contig length 3735 Chromosome number (1..6, M) 6 Chromosome length 3595308 Start point...ptqtppptqtpt nhsigvnecdccpegqycllifghercfiandggdgipeetigcpgvttgtptstdggtg hytesgtgnphlcdrhhcrsgmechvingipecl

  1. Dicty_cDB: Contig-U15573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

  2. Dicty_cDB: Contig-U01204-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

  3. Dicty_cDB: Contig-U12043-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12043-1 gap included 1898 6 2694437 2692539 MINUS 7 13 U12043 0 6 0 0 0 0 0... 1 0 0 0 0 0 0 Show Contig-U12043-1 Contig ID Contig-U12043-1 Contig update 2002.12.18 Contig sequence >Contig-U12043-1 (Contig...-U12043-1Q) /CSM_Contig/Contig-U12043-1Q.Seq.d GAAACCATTCGTTTAAAGAAATGAAATATTTATATATATTAA...ATAAA AATAAATT Gap gap included Contig length 1898 Chromosome number (1..6, M) 6 Chromosome length 3595308 S...VPDIVSGILASKYASITLLNSGEM DLTNGITIGLLENSTSDQLFQINPILNTSLTNILVGQRFSIPFEISIKDSTISNQL

  4. Dicty_cDB: Contig-U16467-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG

  5. Dicty_cDB: Contig-U12682-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  6. Dicty_cDB: Contig-U03323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC

  7. Cellular, molecular and functional characterisation of YAC transgenic mouse models of Friedreich ataxia.

    Directory of Open Access Journals (Sweden)

    Sara Anjomani Virmouni

    Full Text Available Friedreich ataxia (FRDA is an autosomal recessive neurodegenerative disorder, caused by a GAA repeat expansion mutation within intron 1 of the FXN gene. We have previously established and performed preliminary characterisation of several human FXN yeast artificial chromosome (YAC transgenic FRDA mouse models containing GAA repeat expansions, Y47R (9 GAA repeats, YG8R (90 and 190 GAA repeats and YG22R (190 GAA repeats.We now report extended cellular, molecular and functional characterisation of these FXN YAC transgenic mouse models. FXN transgene copy number analysis of the FRDA mice demonstrated that the YG22R and Y47R lines each have a single copy of the FXN transgene while the YG8R line has two copies. Single integration sites of all transgenes were confirmed by fluorescence in situ hybridisation (FISH analysis of metaphase and interphase chromosomes. We identified significant functional deficits, together with a degree of glucose intolerance and insulin hypersensitivity, in YG8R and YG22R FRDA mice compared to Y47R and wild-type control mice. We also confirmed increased somatic GAA repeat instability in the cerebellum and brain of YG22R and YG8R mice, together with significantly reduced levels of FXN mRNA and protein in the brain and liver of YG8R and YG22R compared to Y47R.Together these studies provide a detailed characterisation of our GAA repeat expansion-based YAC transgenic FRDA mouse models that will help investigations of FRDA disease mechanisms and therapy.

  8. Dicty_cDB: Contig-U15069-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15069-1 no gap 1241 1 2719927 2720886 PLUS 37 43 U15069 16 2 0 0 0 5 8 0 0 1 1 0 4 0 Show Contig...-U15069-1 Contig ID Contig-U15069-1 Contig update 2004. 6.11 Contig sequence >Contig-U15069-1 (Contig...-U15069-1Q) /CSM_Contig/Contig-U15069-1Q.Seq.d TTTCAAACCAAAACATAAAATAATTAAAAATGACAACTGTTAAACCA...AAAAATAAAATAAATAAAAATAGTTTTAAA Gap no gap Contig length 1241 Chromosome number (1..6, M) 1 Chromosome length...07Z ,263,623 est42= VSJ431Z ,390,646 est43= CHB363Z ,460,1187 Translated Amino Acid sequence snqnik*lkmttvkptspenprvffditig

  9. Dicty_cDB: Contig-U12316-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

  10. COCACOLA: binning metagenomic contigs using sequence COmposition, read CoverAge, CO-alignment and paired-end read LinkAge.

    Science.gov (United States)

    Lu, Yang Young; Chen, Ting; Fuhrman, Jed A; Sun, Fengzhu

    2017-03-15

    The advent of next-generation sequencing technologies enables researchers to sequence complex microbial communities directly from the environment. Because assembly typically produces only genome fragments, also known as contigs, instead of an entire genome, it is crucial to group them into operational taxonomic units (OTUs) for further taxonomic profiling and down-streaming functional analysis. OTU clustering is also referred to as binning. We present COCACOLA, a general framework automatically bin contigs into OTUs based on sequence composition and coverage across multiple samples. The effectiveness of COCACOLA is demonstrated in both simulated and real datasets in comparison with state-of-art binning approaches such as CONCOCT, GroopM, MaxBin and MetaBAT. The superior performance of COCACOLA relies on two aspects. One is using L 1 distance instead of Euclidean distance for better taxonomic identification during initialization. More importantly, COCACOLA takes advantage of both hard clustering and soft clustering by sparsity regularization. In addition, the COCACOLA framework seamlessly embraces customized knowledge to facilitate binning accuracy. In our study, we have investigated two types of additional knowledge, the co-alignment to reference genomes and linkage of contigs provided by paired-end reads, as well as the ensemble of both. We find that both co-alignment and linkage information further improve binning in the majority of cases. COCACOLA is scalable and faster than CONCOCT, GroopM, MaxBin and MetaBAT. The software is available at https://github.com/younglululu/COCACOLA . fsun@usc.edu. Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com

  11. Evaluación químico bromatológica de las variedades Yurac Llajum, Gello Llajum y Yurac Checche de Smallanthus Sonchifolius (Poepp & Endl).H. Robinson (Yacón) procedente de Puno

    OpenAIRE

    Ramos Zapana, Rubén; Arias Arroyo, Gladys

    2014-01-01

    Las variedades Yurac llajum, Qello llajum y Yurac checche de la especie Smallanthus sonchifolius (Poepp & Endl) (Yacón), procedente de la provincia de Sandia del Departamento de Puno, se desarrollan entre 1500 a 3000 msnm. Conocidas como “yacón”, “yakuma”, “llaqón”, “llacun” o “llacuma” en quechua; en aymara “aricoma” o “aricuma“; en español “Yacón”, “Jacón”, “llacón”, “arboloco”, “Puhe”, “jicama”, “jíquima”, “jikima” o “jiquimilla”. Estas raíces tuberosas de sabor dulce y refrescante, de asp...

  12. Projector : automatic contig mapping for gap closure purposes

    NARCIS (Netherlands)

    van Hijum, SAFT; Zomer, AL; Kuipers, OP; Kok, J

    2003-01-01

    Projector was designed for automatic positioning of contigs from an unfinished prokaryotic genome onto a template genome of a closely related strain or species. Projector mapped 84 contigs of Lactococcus lactis MG1363 (corresponding to 81% of the assembly nucleotides) against the genome of L.lactis

  13. Mice lacking caspase-2 are protected from behavioral changes, but not pathology, in the YAC128 model of Huntington disease

    Directory of Open Access Journals (Sweden)

    Bissada Nagat

    2011-08-01

    Full Text Available Abstract Background Huntington Disease (HD is a neurodegenerative disorder in which caspase activation and cleavage of substrates, including the huntingtin protein, has been invoked as a pathological mechanism. Specific changes in caspase-2 (casp2 activity have been suggested to contribute to the pathogenesis of HD, however unique casp2 cleavage substrates have remained elusive. We thus utilized mice completely lacking casp2 (casp2-/- to examine the role played by casp2 in the progression of HD. This 'substrate agnostic' approach allows us to query the effect of casp2 on HD progression without pre-defining proteolytic substrates of interest. Results YAC128 HD model mice lacking casp2 show protection from well-validated motor and cognitive features of HD, including performance on rotarod, swimming T-maze, pre-pulse inhibition, spontaneous alternation and locomotor tasks. However, the specific pathological features of the YAC128 mice including striatal volume loss and testicular degeneration are unaltered in mice lacking casp2. The application of high-resolution magnetic resonance imaging (MRI techniques validates specific neuropathology in the YAC128 mice that is not altered by ablation of casp2. Conclusions The rescue of behavioral phenotypes in the absence of pathological improvement suggests that different pathways may be operative in the dysfunction of neural circuitry in HD leading to behavioral changes compared to the processes leading to cell death and volume loss. Inhibition of caspase-2 activity may be associated with symptomatic improvement in HD.

  14. Cinética de la transferencia de masa durante la deshidratación osmótica de yacón (Smallanthus sonchifolius Cinética de transferência de massa durante a desidratação osmótica de yacón (Smallanthus sonchifolius

    Directory of Open Access Journals (Sweden)

    Silvina Maldonado

    2008-03-01

    Full Text Available El yacón (Smallanthus sonchifolius es un tubérculo andino de vida útil muy corta bajo condiciones ambientales. Los objetivos de este trabajo fueron determinar: 1 la cinética de deshidratación osmótica de yacón, utilizando sacarosa como soluto; 2 el ajuste de la ecuación de Peleg a los datos experimentales; y 3 el coeficiente de difusión usando la ecuación de Hawkes y Flink. La fruta se peló y cortó en placas de 3 x 3 x 0,3 cm. Se la deshidrató osmóticamente con solución de sacarosa al 40% (p/p, hasta aw = 0,97. El proceso se realizó a temperatura de 25 °C y con agitación continua (105 rpm. Se determinó la pérdida de peso de las muestras, la ganancia de sólidos y la retención de agua. Los parámetros obtenidos para el ajuste de pérdida de agua y ganancia de sólidos son respectivamente: k1: 8,2 0,1 y k2: 0,53 ± 0,06; k1: 234 ± 8 y k2: 2,6 ± 0,5. La mayor transferencia de masa, tanto de agua como de soluto, ocurre durante los primeros 60 a 90 minutos de proceso, lográndose una ganancia media de sólidos de 9,5 [g.100 g-1 MF] y una pérdida de agua de 68,8 [g.100 g-1MF]. Se puede asegurar que es posible aplicar satisfactoriamente el proceso de deshidratación osmótica en yacón como pre tratamiento de conservación.O yacón (Smallanthus sonchifolius é um tubérculo andino de vida útil muito curta sob condições ambientais. Os objetivos deste trabalho foram determinar: 1 a cinética de desidratação osmótica do yacón, utilizando sacarose como soluto; 2 o ajuste da equação de Peleg aos dados experimentais; e 3 o coeficiente de difusão usando a equação de Hawkes e Flink. A fruta foi descascada e cortada em placas de 3 x 3 x 0,3 cm. Foi desidratada osmoticamente usando uma solução de sacarose aos 40% (p/p, até aw = 0,97. O processo foi conduzido mantendo a temperatura constante em 25 °C e com agitação orbital contínua (105 rpm. Determinou-se a perda de peso das mostras, o ganho de sólidos e a retenção de

  15. Contig-Layout-Authenticator (CLA): A Combinatorial Approach to Ordering and Scaffolding of Bacterial Contigs for Comparative Genomics and Molecular Epidemiology.

    Science.gov (United States)

    Shaik, Sabiha; Kumar, Narender; Lankapalli, Aditya K; Tiwari, Sumeet K; Baddam, Ramani; Ahmed, Niyaz

    2016-01-01

    A wide variety of genome sequencing platforms have emerged in the recent past. High-throughput platforms like Illumina and 454 are essentially adaptations of the shotgun approach generating millions of fragmented single or paired sequencing reads. To reconstruct whole genomes, the reads have to be assembled into contigs, which often require further downstream processing. The contigs can be directly ordered according to a reference, scaffolded based on paired read information, or assembled using a combination of the two approaches. While the reference-based approach appears to mask strain-specific information, scaffolding based on paired-end information suffers when repetitive elements longer than the size of the sequencing reads are present in the genome. Sequencing technologies that produce long reads can solve the problems associated with repetitive elements but are not necessarily easily available to researchers. The most common high-throughput technology currently used is the Illumina short read platform. To improve upon the shortcomings associated with the construction of draft genomes with Illumina paired-end sequencing, we developed Contig-Layout-Authenticator (CLA). The CLA pipeline can scaffold reference-sorted contigs based on paired reads, resulting in better assembled genomes. Moreover, CLA also hints at probable misassemblies and contaminations, for the users to cross-check before constructing the consensus draft. The CLA pipeline was designed and trained extensively on various bacterial genome datasets for the ordering and scaffolding of large repetitive contigs. The tool has been validated and compared favorably with other widely-used scaffolding and ordering tools using both simulated and real sequence datasets. CLA is a user friendly tool that requires a single command line input to generate ordered scaffolds.

  16. Efecto de gelificantes en la formulación de dulce de yacón Efeito de gelificante na formulação do doce do yacon

    OpenAIRE

    Silvina Maldonado; Judith del Carmen Singh

    2008-01-01

    El yacón (Smallanthus sonchifolius) es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se ag...

  17. difusividad, masa, humedad, volumen y sólidos en yacón (Smallantus sonchifolius deshidratado osmóticamente

    Directory of Open Access Journals (Sweden)

    Julio Rojas Naccha

    2012-01-01

    Full Text Available Se evaluó la capacidad predictiva de la Red Neuronal Artificial (RNA en el efecto de la concentración (30,40, 50 y 60 % p/p y temperatura (30, 40 y 50°C de la solución de fructooligosacaridos (FOS en la masa,humedad, volumen y sólidos en cubos de yacón osmodeshidratados, y en el coeficiente de difusividad efectivamedia del agua, con y sin encogimiento. Se aplicó la RNA del tipoFeedforwardcon los algoritmos deentrenamientoBackpropagationy de ajuste de pesosLevenberg-Marquardt, usando la topología: error metade 10-5, tasa de aprendizaje de 0.01, coeficiente de momento de 0.5, 2 neuronas de entrada, 6 neuronas desalida, una capa oculta con 18 neuronas, 15 etapas de entrenamiento y funciones de transferencialogsig-purelin. El error promedio global por la RNA fue 3.44% y los coeficientes de correlación fueron mayores a0.9. No se encontraron diferencias significativas entre los valores experimentales con losvalores predichos porla RNA y con los valores predichos por un modelo estadístico de regresión polinomial de segundo orden (p >0.95.Palabras clave:Red Neuronal Artificial (RNA, difusividad efectiva, yacón, deshidratación osmótica

  18. Dicty_cDB: Contig-U16279-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AB254080 |pid:none) Streptomyces kanamyceticus kanam... 47 0.002 CP000964_3229( CP000964 |pid:none) Klebsiella pneumoni...nkkmtkpvasyeldekrfltllgkligetenlqnrppalipiednag rhviealtpylkanggvleleqvhcdpvnypkrgniiie... letters Score E Sequences producing significant alignments: (bits) Value Contig-U16279-1 (Contig-U16279-1Q....................................................done Score E Sequences producing significant alignments: (bits) Val....................................done Score E Sequences producing significant alignments: (bits) Val

  19. A Blumeria graminis f.sp. hordei BAC library - contig building and microsynteny studies

    DEFF Research Database (Denmark)

    Pedersen, C.; Wu, B.; Giese, H.

    2002-01-01

    A bacterial artificial chromosome (BAC) library of Blumeria graminis f.sp. hordei, containing 12,000 clones with an average insert size of 41 kb, was constructed. The library represents about three genome equivalents and BAC-end sequencing showed a high content of repetitive sequences, making...... contigs, at or close to avirulence loci, were constructed. Single nucleotide polymorphism (SNP) markers were developed from BAC-end sequences to link the contigs to the genetic maps. Two other BAC contigs were used to study microsynteny between B. graminis and two other ascomycetes, Neurospora crassa...

  20. Cloning of the anhidrotic ectodermal dysplasia gene: Identification of cDNAs associated with CpG islands mapped near translocation breakpoint in two female patients

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, A.K.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States); Kere, J. [Univ. of Helsinki (Finland)] [and others

    1994-09-01

    The gene for the X chromosomal developmental disorder anhidrotic ectodermal dysplasia (EDA) has been mapped to Xq12-q13 by linkage analysis and is expressed in a few females with chromosomal translocations involving band Xq12-q13. A yeast artificial chromosome (YAC) contig (2.0 Mb) spanning two translocation breakpoints has been assembled by sequence-tagged site (STS)-based chromosomal walking. The two translocation breakpoints (X:autosome translocations from the affected female patients) have been mapped less than 60 kb apart within a YAC contig. Unique probes and intragenic STSs (mapped between the two translocations) have been developed and a somatic cell hybrid carrying the translocated X chromosome from the AK patient has been analyzed by isolating unique probes that span the breakpoint. Several STSs made from intragenic sequences have been found to be conserved in mouse, hamster and monkey, but we have detected no mRNAs in a number of tissues tested. However, a probe and STS developed from the DNA spanning the AK breakpoint is conserved in mouse, hamster and monkey, and we have detected expressed sequences in skin cells and cDNA libraries. In addition, unique sequences have been obtained from two CpG islands in the region that maps proximal to the breakpoints. cDNAs containing these sequences are being studied as candidates for the gene affected in the etiology of EDA.

  1. ESTminer: a Web interface for mining EST contig and cluster databases.

    Science.gov (United States)

    Huang, Yecheng; Pumphrey, Janie; Gingle, Alan R

    2005-03-01

    ESTminer is a Web application and database schema for interactive mining of expressed sequence tag (EST) contig and cluster datasets. The Web interface contains a query frame that allows the selection of contigs/clusters with specific cDNA library makeup or a threshold number of members. The results are displayed as color-coded tree nodes, where the color indicates the fractional size of each cDNA library component. The nodes are expandable, revealing library statistics as well as EST or contig members, with links to sequence data, GenBank records or user configurable links. Also, the interface allows 'queries within queries' where the result set of a query is further filtered by the subsequent query. ESTminer is implemented in Java/JSP and the package, including MySQL and Oracle schema creation scripts, is available from http://cggc.agtec.uga.edu/Data/download.asp agingle@uga.edu.

  2. Dicty_cDB: Contig-U03802-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available T-2KB Trichosurus... 48 3e-11 4 ( DY894715 ) CeleSEQ14351 Cunninghamella elegans pBluescript (... 58 4e-11 3... letters Score E Sequences producing significant alignments: (bits) Value Contig-U03802-1 (Contig-U... letters Searching..................................................done Score E Sequences producing significant al...1... 62 4e-05 1 ( EJ306703 ) 1095390099376 Global-Ocean-Sampling_GS-27-01-01-1... 62 4e-05 1 ( CP000238 ) Baumannia cicadellinicola... AY241394 |pid:none) Melopsittacus undulatus Mn superox... 244 2e-63 AF329270_1( AF329270 |pid:none) Gallus gallus manganes

  3. LTC: a novel algorithm to improve the efficiency of contig assembly for physical mapping in complex genomes

    Directory of Open Access Journals (Sweden)

    Feuillet Catherine

    2010-11-01

    Full Text Available Abstract Background Physical maps are the substrate of genome sequencing and map-based cloning and their construction relies on the accurate assembly of BAC clones into large contigs that are then anchored to genetic maps with molecular markers. High Information Content Fingerprinting has become the method of choice for large and repetitive genomes such as those of maize, barley, and wheat. However, the high level of repeated DNA present in these genomes requires the application of very stringent criteria to ensure a reliable assembly with the FingerPrinted Contig (FPC software, which often results in short contig lengths (of 3-5 clones before merging as well as an unreliable assembly in some difficult regions. Difficulties can originate from a non-linear topological structure of clone overlaps, low power of clone ordering algorithms, and the absence of tools to identify sources of gaps in Minimal Tiling Paths (MTPs. Results To address these problems, we propose a novel approach that: (i reduces the rate of false connections and Q-clones by using a new cutoff calculation method; (ii obtains reliable clusters robust to the exclusion of single clone or clone overlap; (iii explores the topological contig structure by considering contigs as networks of clones connected by significant overlaps; (iv performs iterative clone clustering combined with ordering and order verification using re-sampling methods; and (v uses global optimization methods for clone ordering and Band Map construction. The elements of this new analytical framework called Linear Topological Contig (LTC were applied on datasets used previously for the construction of the physical map of wheat chromosome 3B with FPC. The performance of LTC vs. FPC was compared also on the simulated BAC libraries based on the known genome sequences for chromosome 1 of rice and chromosome 1 of maize. Conclusions The results show that compared to other methods, LTC enables the construction of highly

  4. Physical mapping in highly heterozygous genomes: a physical contig map of the Pinot Noir grapevine cultivar

    Directory of Open Access Journals (Sweden)

    Jurman Irena

    2010-03-01

    Full Text Available Abstract Background Most of the grapevine (Vitis vinifera L. cultivars grown today are those selected centuries ago, even though grapevine is one of the most important fruit crops in the world. Grapevine has therefore not benefited from the advances in modern plant breeding nor more recently from those in molecular genetics and genomics: genes controlling important agronomic traits are practically unknown. A physical map is essential to positionally clone such genes and instrumental in a genome sequencing project. Results We report on the first whole genome physical map of grapevine built using high information content fingerprinting of 49,104 BAC clones from the cultivar Pinot Noir. Pinot Noir, as most grape varieties, is highly heterozygous at the sequence level. This resulted in the two allelic haplotypes sometimes assembling into separate contigs that had to be accommodated in the map framework or in local expansions of contig maps. We performed computer simulations to assess the effects of increasing levels of sequence heterozygosity on BAC fingerprint assembly and showed that the experimental assembly results are in full agreement with the theoretical expectations, given the heterozygosity levels reported for grape. The map is anchored to a dense linkage map consisting of 994 markers. 436 contigs are anchored to the genetic map, covering 342 of the 475 Mb that make up the grape haploid genome. Conclusions We have developed a resource that makes it possible to access the grapevine genome, opening the way to a new era both in grape genetics and breeding and in wine making. The effects of heterozygosity on the assembly have been analyzed and characterized by using several complementary approaches which could be easily transferred to the study of other genomes which present the same features.

  5. Efecto hepatoprotector del extracto acuoso de Smallanthus sonchifolius (yacón en un modelo de intoxicación con acetaminofén

    Directory of Open Access Journals (Sweden)

    Acela Inés Arnao-Salas

    2012-07-01

    Full Text Available En la medicina tradicional se ha publicado que las hojas de Smallanthus sonchifolius (yacón poseen efectos antidiabético y hepatoprotector. Objetivos: Evaluar en suero y hematíes el efecto hepatoprotector del extracto acuoso de hojas de yacón (EAY en un modelo de intoxicación con acetaminofén en ratas. Diseño: Experimental, transversal. Institución: Centro de Investigación de Bioquímica y Nutrición, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Material biológico: Hojas de yacón. Intervenciones: Se formó cinco grupos de ratas hembra (n=6 que recibieron por cinco días, por vía oral, suero fisiológico (SF, EAY o silimarina (Sil (50 mg/kg y luego de 1 hora, SF o acetaminofén (A 250 mg/kg, según lo siguiente: G1 (control; SF-SF, G2 (SF-A, G3 (EAY (200 mg/kg-A, G4 (EAY (400 mg/kg-A y G5 (Sil-A. Principales medidas de los resultados: Actividad de aspartato amino transferasas (AST, alanina amino transferasa (ALT, fosfatasa alcalina (FAL γ γ-amino transferasa (γ-GTP; niveles de bilirrubina total (BT, proteνnas y lipoperoxidaciσn (MDA. En hematíes, actividades de superóxido dismutasa (SOD, catalasa (CAT y hemoglobina. Resultados: Se observó aumento significativo (p<0,05 en la actividad de γ-GTP entre el grupo G2 y los grupos G3 y G4. Hubo disminuciσn significativa (p<0,05 de proteνnas en el grupo G2 con respecto G1. El nivel de MDA fue menor en el grupo que recibió 200 mg/kg de EAY con respecto al control. Las actividades de AST, ALT y FAL no mostraron diferencias significativas. La relación SOD/CAT fue similar entre los grupos G1, G4 y G5, evidencia de una recuperación del daño causado por el acetaminofén. Conclusiones: La administración del EAY tuvo un efecto hepatoprotector comparable a la silimarina.

  6. Efecto del smallanthus sonchifolius "yacón" en el tratamiento de hiperlipemias comparado con dieta sola y gemfibrozilo. Trujillo, 2007

    OpenAIRE

    Reyes Beltrán, María Esther Daisy

    2009-01-01

    Autor: María Esther Daisy Reyes Beltrán Título Tesis Doctoral: Efecto del Smallanthus sonchifolius “yacón” en el tratamiento de hiperlipemias comparado con dieta sola y gemfibrozilo. Trujillo, 2007. Asesor: Dr. Juan Jorge Huamán Saavedra. Páginas Totales: 40 Institución: Facultad de Medicina, Universidad Nacional de Trujillo. El aumento de LDL colesterol y de triglicéridos y la disminución de HDL colesterol son factores de riesgo coronario. Es de interés saber si existe alguna variació...

  7. Two sequence-ready contigs spanning the two copies of a 200-kb duplication on human 21q: partial sequence and polymorphisms.

    Science.gov (United States)

    Potier, M; Dutriaux, A; Orti, R; Groet, J; Gibelin, N; Karadima, G; Lutfalla, G; Lynn, A; Van Broeckhoven, C; Chakravarti, A; Petersen, M; Nizetic, D; Delabar, J; Rossier, J

    1998-08-01

    Physical mapping across a duplication can be a tour de force if the region is larger than the size of a bacterial clone. This was the case of the 170- to 275-kb duplication present on the long arm of chromosome 21 in normal human at 21q11.1 (proximal region) and at 21q22.1 (distal region), which we described previously. We have constructed sequence-ready contigs of the two copies of the duplication of which all the clones are genuine representatives of one copy or the other. This required the identification of four duplicon polymorphisms that are copy-specific and nonallelic variations in the sequence of the STSs. Thirteen STSs were mapped inside the duplicated region and 5 outside but close to the boundaries. Among these STSs 10 were end clones from YACs, PACs, or cosmids, and the average interval between two markers in the duplicated region was 16 kb. Eight PACs and cosmids showing minimal overlaps were selected in both copies of the duplication. Comparative sequence analysis along the duplication showed three single-basepair changes between the two copies over 659 bp sequenced (4 STSs), suggesting that the duplication is recent (less than 4 mya). Two CpG islands were located in the duplication, but no genes were identified after a 36-kb cosmid from the proximal copy of the duplication was sequenced. The homology of this chromosome 21 duplicated region with the pericentromeric regions of chromosomes 13, 2, and 18 suggests that the mechanism involved is probably similar to pericentromeric-directed mechanisms described in interchromosomal duplications. Copyright 1998 Academic Press.

  8. Dicty_cDB: Contig-U14477-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

  9. Comparative genomic mapping of the bovine Fragile Histidine Triad (FHIT tumour suppressor gene: characterization of a 2 Mb BAC contig covering the locus, complete annotation of the gene, analysis of cDNA and of physiological expression profiles

    Directory of Open Access Journals (Sweden)

    Boussaha Mekki

    2006-05-01

    Full Text Available Abstract Background The Fragile Histidine Triad gene (FHIT is an oncosuppressor implicated in many human cancers, including vesical tumors. FHIT is frequently hit by deletions caused by fragility at FRA3B, the most active of human common fragile sites, where FHIT lays. Vesical tumors affect also cattle, including animals grazing in the wild on bracken fern; compounds released by the fern are known to induce chromosome fragility and may trigger cancer with the interplay of latent Papilloma virus. Results The bovine FHIT was characterized by assembling a contig of 78 BACs. Sequence tags were designed on human exons and introns and used directly to select bovine BACs, or compared with sequence data in the bovine genome database or in the trace archive of the bovine genome sequencing project, and adapted before use. FHIT is split in ten exons like in man, with exons 5 to 9 coding for a 149 amino acids protein. VISTA global alignments between bovine genomic contigs retrieved from the bovine genome database and the human FHIT region were performed. Conservation was extremely high over a 2 Mb region spanning the whole FHIT locus, including the size of introns. Thus, the bovine FHIT covers about 1.6 Mb compared to 1.5 Mb in man. Expression was analyzed by RT-PCR and Northern blot, and was found to be ubiquitous. Four cDNA isoforms were isolated and sequenced, that originate from an alternative usage of three variants of exon 4, revealing a size very close to the major human FHIT cDNAs. Conclusion A comparative genomic approach allowed to assemble a contig of 78 BACs and to completely annotate a 1.6 Mb region spanning the bovine FHIT gene. The findings confirmed the very high level of conservation between human and bovine genomes and the importance of comparative mapping to speed the annotation process of the recently sequenced bovine genome. The detailed knowledge of the genomic FHIT region will allow to study the role of FHIT in bovine cancerogenesis

  10. Comparative genomic mapping of the bovine Fragile Histidine Triad (FHIT) tumour suppressor gene: characterization of a 2 Mb BAC contig covering the locus, complete annotation of the gene, analysis of cDNA and of physiological expression profiles.

    Science.gov (United States)

    Uboldi, Cristina; Guidi, Elena; Roperto, Sante; Russo, Valeria; Roperto, Franco; Di Meo, Giulia Pia; Iannuzzi, Leopoldo; Floriot, Sandrine; Boussaha, Mekki; Eggen, André; Ferretti, Luca

    2006-05-23

    The Fragile Histidine Triad gene (FHIT) is an oncosuppressor implicated in many human cancers, including vesical tumors. FHIT is frequently hit by deletions caused by fragility at FRA3B, the most active of human common fragile sites, where FHIT lays. Vesical tumors affect also cattle, including animals grazing in the wild on bracken fern; compounds released by the fern are known to induce chromosome fragility and may trigger cancer with the interplay of latent Papilloma virus. The bovine FHIT was characterized by assembling a contig of 78 BACs. Sequence tags were designed on human exons and introns and used directly to select bovine BACs, or compared with sequence data in the bovine genome database or in the trace archive of the bovine genome sequencing project, and adapted before use. FHIT is split in ten exons like in man, with exons 5 to 9 coding for a 149 amino acids protein. VISTA global alignments between bovine genomic contigs retrieved from the bovine genome database and the human FHIT region were performed. Conservation was extremely high over a 2 Mb region spanning the whole FHIT locus, including the size of introns. Thus, the bovine FHIT covers about 1.6 Mb compared to 1.5 Mb in man. Expression was analyzed by RT-PCR and Northern blot, and was found to be ubiquitous. Four cDNA isoforms were isolated and sequenced, that originate from an alternative usage of three variants of exon 4, revealing a size very close to the major human FHIT cDNAs. A comparative genomic approach allowed to assemble a contig of 78 BACs and to completely annotate a 1.6 Mb region spanning the bovine FHIT gene. The findings confirmed the very high level of conservation between human and bovine genomes and the importance of comparative mapping to speed the annotation process of the recently sequenced bovine genome. The detailed knowledge of the genomic FHIT region will allow to study the role of FHIT in bovine cancerogenesis, especially of vesical papillomavirus-associated cancers of

  11. The binning of metagenomic contigs for microbial physiology of mixed cultures.

    Science.gov (United States)

    Strous, Marc; Kraft, Beate; Bisdorf, Regina; Tegetmeyer, Halina E

    2012-01-01

    So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population. In the present study eight metagenomic samples from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to existing algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a 100 times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt).

  12. The binning of metagenomic contigs for microbial physiology of mixed cultures

    Directory of Open Access Journals (Sweden)

    Marc eStrous

    2012-12-01

    Full Text Available So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population.In the present study eight metagenomic samples originating from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to exisiting algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a hunderd times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt.

  13. CSAR-web: a web server of contig scaffolding using algebraic rearrangements.

    Science.gov (United States)

    Chen, Kun-Tze; Lu, Chin Lung

    2018-05-04

    CSAR-web is a web-based tool that allows the users to efficiently and accurately scaffold (i.e. order and orient) the contigs of a target draft genome based on a complete or incomplete reference genome from a related organism. It takes as input a target genome in multi-FASTA format and a reference genome in FASTA or multi-FASTA format, depending on whether the reference genome is complete or incomplete, respectively. In addition, it requires the users to choose either 'NUCmer on nucleotides' or 'PROmer on translated amino acids' for CSAR-web to identify conserved genomic markers (i.e. matched sequence regions) between the target and reference genomes, which are used by the rearrangement-based scaffolding algorithm in CSAR-web to order and orient the contigs of the target genome based on the reference genome. In the output page, CSAR-web displays its scaffolding result in a graphical mode (i.e. scalable dotplot) allowing the users to visually validate the correctness of scaffolded contigs and in a tabular mode allowing the users to view the details of scaffolds. CSAR-web is available online at http://genome.cs.nthu.edu.tw/CSAR-web.

  14. AAV-dominant negative tumor necrosis factor (DN-TNF gene transfer to the striatum does not rescue medium spiny neurons in the YAC128 mouse model of Huntington's disease.

    Directory of Open Access Journals (Sweden)

    Laura Taylor Alto

    Full Text Available CNS inflammation is a hallmark of neurodegenerative disease, and recent studies suggest that the inflammatory response may contribute to neuronal demise. In particular, increased tumor necrosis factor (TNF signaling is implicated in the pathology of both Parkinson's disease (PD and Alzheimer's disease (AD. We have previously shown that localized gene delivery of dominant negative TNF to the degenerating brain region can limit pathology in animal models of PD and AD. TNF is upregulated in Huntington's disease (HD, like in PD and AD, but it is unknown whether TNF signaling contributes to neuronal degeneration in HD. We used in vivo gene delivery to test whether selective reduction of soluble TNF signaling could attenuate medium spiny neuron (MSN degeneration in the YAC128 transgenic (TG mouse model of Huntington's disease (HD. AAV vectors encoding cDNA for dominant-negative tumor necrosis factor (DN-TNF or GFP (control were injected into the striatum of young adult wild type WT and YAC128 TG mice and achieved 30-50% target coverage. Expression of dominant negative TNF protein was confirmed immunohistologically and biochemically and was maintained as mice aged to one year, but declined significantly over time. However, the extent of striatal DN-TNF gene transfer achieved in our studies was not sufficient to achieve robust effects on neuroinflammation, rescue degenerating MSNs or improve motor function in treated mice. Our findings suggest that alternative drug delivery strategies should be explored to determine whether greater target coverage by DN-TNF protein might afford some level of neuroprotection against HD-like pathology and/or that soluble TNF signaling may not be the primary driver of striatal neuroinflammation and MSN loss in YAC128 TG mice.

  15. Tourette syndrome in a pedigree with a 7;18 translocation: Identification of a YAC spanning the translocation breakpoint at 18q22.3

    Energy Technology Data Exchange (ETDEWEB)

    Boghosian-Sell, L.; Overhauser, J. [Thomas Jefferson Univ., Philadelphia, PA (United States); Comings, D.E. [City of Hope Medical Center, Duarte, CA (United States)

    1996-11-01

    Tourette syndrome is a neuropsychiatric disorder characterized by the presence of multiple, involuntary motor and vocal tics. Associated pathologies include attention deficit disorder and obsessive-compulsive disorder (OCD). Extensive linkage analysis based on an autosomal dominant mode of transmission with reduced penetrance has failed to show linkage with polymorphic markers, suggesting either locus heterogeneity or a polygenic origin for Tourette syndrome. An individual diagnosed with Tourette syndrome has been described carrying a constitutional chromosome translocation. Other family members carrying the translocation exhibit features seen in Tourette syndrome including motor tics, vocal tics, and OCD. Since the disruption of specific genes by a chromosomal rearrangement can elicit a particular phenotype, we have undertaken the physical mapping of the 7;18 translocation such that genes mapping at the site of the breakpoint can be identified and evaluated for a possible involvement in Tourette syndrome. Using somatic cell hybrids retaining either the der(7) or the der(18), a more precise localization of the breakpoints on chromosomes 7 and 18 have been determined. Furthermore, physical mapping has identified two YAC clones that span the translocation breakpoint on chromosome 18 as determined by FISH. These YAC clones will be useful for the eventual identification of genes that map to chromosomes 7 and 18 at the site of the translocation. 41 refs., 3 figs., 1 tab.

  16. CBrowse: a SAM/BAM-based contig browser for transcriptome assembly visualization and analysis.

    Science.gov (United States)

    Li, Pei; Ji, Guoli; Dong, Min; Schmidt, Emily; Lenox, Douglas; Chen, Liangliang; Liu, Qi; Liu, Lin; Zhang, Jie; Liang, Chun

    2012-09-15

    To address the impending need for exploring rapidly increased transcriptomics data generated for non-model organisms, we developed CBrowse, an AJAX-based web browser for visualizing and analyzing transcriptome assemblies and contigs. Designed in a standard three-tier architecture with a data pre-processing pipeline, CBrowse is essentially a Rich Internet Application that offers many seamlessly integrated web interfaces and allows users to navigate, sort, filter, search and visualize data smoothly. The pre-processing pipeline takes the contig sequence file in FASTA format and its relevant SAM/BAM file as the input; detects putative polymorphisms, simple sequence repeats and sequencing errors in contigs and generates image, JSON and database-compatible CSV text files that are directly utilized by different web interfaces. CBowse is a generic visualization and analysis tool that facilitates close examination of assembly quality, genetic polymorphisms, sequence repeats and/or sequencing errors in transcriptome sequencing projects. CBrowse is distributed under the GNU General Public License, available at http://bioinfolab.muohio.edu/CBrowse/ liangc@muohio.edu or liangc.mu@gmail.com; glji@xmu.edu.cn Supplementary data are available at Bioinformatics online.

  17. Dicty_cDB: Contig-U05126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000939 ) Clostridium botulinum B1 str. Okra, complete genome. 34 2.5 18 ( GE803619 ) EST_scau_evk_893885 ...scauevk mixed_tissue Sebastes... 32 2.6 3 ( AM462416 ) Vitis vinifera contig VV78X219254.19, whole genom...

  18. Physical mapping of a commonly deleted region, the site of a candidate tumor suppressor gene, at 12q22 in human male germ cell tumors

    Energy Technology Data Exchange (ETDEWEB)

    Murty, V.V.V.S.; Bosl, G.J.; Chaganti, R.S.K. [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)] [and others

    1996-08-01

    A candidate tumor suppressor gene (TSG) site at 12q22 characterized by a high frequency of loss of heterozygosity (LOH) and a homozygous deletion has previously (LOH) and a homozygous deletion has previously been reported in human male germ cell tumors (GCTs). In a detailed deletion mapping analysis of 67 normal-tumor DNAs utilizing 20 polymorphic markers mapped to 12q22-q24, we identified the limits of the minimal region of deletion at 12q22 between D12S377 (priximal) and D12S296 (distal). We have constructed a YAC contig map of a 3-cM region of this band between the proximal marker D12S101 and the distal marker D12S346, which contained the minimal region of deletion in GCTs. The map is composed of 53 overlapping YACs and 3 cosmids onto which 25 polymorphic and nonpolymorphic sequence-tagged sites (STSs) were placed in a unique order. The size of the minimal region of deletion was approximately 2 Mb from overlapping, nonchimeric YACs that spanned the region. We also developed a radiation hybrid (RH) map of the region between D12S101 and D12S346 containing 17 loci. The consensus order developed by RH mapping is in good agreement with the YAC STS-content map order. The RH map estimated the distance between D12S101 and D12S346 to be 246 cR{sub 8000} and the minimal region of deletion to be 141 cR{sub 8000}. In addition, four genes that were previously mapped to 12q22 have been excluded as candidate genes. The leads gained from the deletion mapping and physical maps should expedite the isolation and characterization of the TSG at 12q22. 35 refs., 4 figs., 2 tabs.

  19. Efecto de gelificantes en la formulación de dulce de yacón Efeito de gelificante na formulação do doce do yacon

    Directory of Open Access Journals (Sweden)

    Silvina Maldonado

    2008-06-01

    Full Text Available El yacón (Smallanthus sonchifolius es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se agregó benzoato de sodio, metabisulfito de sodio y ácido cítrico. Se desarrolló un dulce tipo pan. Se registró la evolución de temperatura durante la cocción. Se empacó y envasó el dulce en bandejas. Se analizaron parámetros de textura principales y secundarios. La formulación que alcanzó valores de textura similares a la referencia fue: 0,48% de agar-agar; 12% de sacarosa; 17% de glucosa; 23% de agua; 996,75 ppm de metabisulfito; 498,50 ppm de ácido cítrico y 1435,7 ppm de benzoato de sodio. Se realizó una prueba sensorial a través de la evaluación de los parámetros más representativos de la textura, utilizando para ello una escala hedónica, determinando la aceptación de la formulación seleccionada.O yacón (Smallanthus sonchifolius é um tubérculo andino cultivado nas encostas Dos Andes. É uma planta perene que chega a sua maduração entre 6 meses e 1 ano. Este trabalho propõe a formulação de um produto alimentício a partir do yacón agregando solutos: glicose, sacarose e combinação de barreiras de estresse. Estudou-se o efeito de gelificantes: ágar-ágar e arábica, em três concentrações 0.30, 0.41 e 0.48%. Agregou-se benzoato de sódio, metabisulfito de sódio, e ácido cítrico. Desenvolveu-se um doce tipo pão. Registrou-se a evolução da temperatura durate cozimento. Empacotou-se e envasou-se o doce em bandejas. Analisaram-se parâmetros de textura principais e secundários. A formulação que atingiu os

  20. Dicty_cDB: Contig-U11311-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A from... 58 6e-07 2 ( AM481444 ) Vitis vinifera contig VV78X144362.4, whole genome... 68 1e-06 1 ( AY604469 ) Prodonto...117 4e-27 AY604469_1( AY604469 |pid:none) Prodontorhabditis wirthi strain DF... 125 5e-27 ( P25202 ) RecName

  1. Dicty_cDB: Contig-U16102-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 6 ( BJ408668 ) Dictyostelium discoideum cDNA clone:dds46g14, 3' ... 44 3.0 2 ( CV162186 ) CS_hyp_01d11_M13Reverse Blue crab hypoder...08_M13Reverse Blue crab hypodermis, nor... 42 3.6 2 ( AM474408 ) Vitis vinifera contig VV78X173370.5, whole

  2. Sequence analysis and transcript identification within 1.5 MB of DNA deleted together with the NDP and MAO genes in atypical Norrie disease patients presenting with a profound phenotype.

    Science.gov (United States)

    Suárez-Merino, B; Bye, J; McDowall, J; Ross, M; Craig, I W

    2001-06-01

    Mutations at the Norrie disease gene locus, NDP, manifest in a broad range of defects. These range from a relatively mild, late-onset, exudative vitreoretinopathy to congenital blindness and sensorineural deafness combined, in some cases, with mental retardation. In addition, extensive deletions involving the NDP locus, located at Xp11.3, the adjacent monoamine oxidadase genes MAOA and MAOB, and additional material, result in a more severe pattern of symptoms. The phenotypes include all or some of the following; mental retardation, involuntary movements, hypertensive crises and hypogonadism. We extended an existing YAC contig to embrace the boundaries of three of the largest deletions and converted this into four PAC contigs. Computer analysis and experimental data have resulted in the identification of several putative loci, including a phosphatase inhibitor 2-like gene (dJ154.1) and a 250-bp sequence which resembles a homeobox domain (dA113.3), 1.2 Mb and 400 kb respectively from the MAO/NDP cluster. The pattern of expression of dJ154.1 suggests that it may represent an important factor contributing to the complex phenotypes of these deletion patients. Hum Mutat 17:523, 2001. Copyright 2001 Wiley-Liss, Inc.

  3. A high-resolution whole genome radiation hybrid map of human chromosome 17q22-q25.3 across the genes for GH and TK

    Energy Technology Data Exchange (ETDEWEB)

    Foster, J.W.; Schafer, A.J.; Critcher, R. [Univ. of Cambridge (United Kingdom)] [and others

    1996-04-15

    We have constructed a whole genome radiation hybrid (WG-RH) map across a region of human chromosome 17q, from growth hormone (GH) to thymidine kinase (TK). A panel of 128 WG-RH hybrid cell lines generated by X-irradiation and fusion has been tested for the retention of 39 sequence-tagged site (STS) markers by the polymerase chain reaction. This genome mapping technique has allowed the integration of existing VNTR and microsatellite markers with additional new markers and existing STS markers previously mapped to this region by other means. The WG-RH map includes eight expressed sequence tag (EST) and three anonymous markers developed for this study, together with 23 anonymous microsatellites and five existing ESTs. Analysis of these data resulted in a high-density comprehensive map across this region of the genome. A subset of these markers has been used to produce a framework map consisting of 20 loci ordered with odds greater than 1000:1. The markers are of sufficient density to build a YAC contig across this region based on marker content. We have developed sequence tags for both ends of a 2.1-Mb YAC and mapped these using the WG-RH panel, allowing a direct comparison of cRay{sub 6000} to physical distance. 31 refs., 3 figs., 2 tabs.

  4. INE: a rice genome database with an integrated map view.

    Science.gov (United States)

    Sakata, K; Antonio, B A; Mukai, Y; Nagasaki, H; Sakai, Y; Makino, K; Sasaki, T

    2000-01-01

    The Rice Genome Research Program (RGP) launched a large-scale rice genome sequencing in 1998 aimed at decoding all genetic information in rice. A new genome database called INE (INtegrated rice genome Explorer) has been developed in order to integrate all the genomic information that has been accumulated so far and to correlate these data with the genome sequence. A web interface based on Java applet provides a rapid viewing capability in the database. The first operational version of the database has been completed which includes a genetic map, a physical map using YAC (Yeast Artificial Chromosome) clones and PAC (P1-derived Artificial Chromosome) contigs. These maps are displayed graphically so that the positional relationships among the mapped markers on each chromosome can be easily resolved. INE incorporates the sequences and annotations of the PAC contig. A site on low quality information ensures that all submitted sequence data comply with the standard for accuracy. As a repository of rice genome sequence, INE will also serve as a common database of all sequence data obtained by collaborating members of the International Rice Genome Sequencing Project (IRGSP). The database can be accessed at http://www. dna.affrc.go.jp:82/giot/INE. html or its mirror site at http://www.staff.or.jp/giot/INE.html

  5. Physical mapping of the Bloom syndrome region by the identification of YAC and P1 clones from human chromosome 15 band q26.1

    Energy Technology Data Exchange (ETDEWEB)

    Straughen, J.; Groden, J. [Univ. of Cincinnati College of Medicine, OH (United States); Ciocci, S. [New York Blood Center, NY (United States)] [and others

    1996-07-01

    The gene for Bloom syndrome (BLM) has been mapped to human chromosome 15 band q26.1 by homozygosity mapping. Further refinement of the location of BLM has relied upon linkage-disequilibrium mapping and somatic intragenic recombination. In combination with these mapping approaches and to identify novel DNA markers and probes for the BLM candidate region, a contiguous representation of the 2-Mb region that contains the BLM gene was generated and is presented here. YAC and P1 clones from the region have been identified and ordered by using previously available genetic markers in the region along with newly developed sequence-tagged sites from radiation-restriction map of the 2-Mb region that allowed estimation of the distance between polymorphic microsatellite loci is also reported. This map and the DNA markers derived from it were instrumental in the recent identification of the BLM gene. 25 refs., 3 figs., 3 tabs.

  6. Genome scan identifies a locus affecting gamma-globin expression in human beta-cluster YAC transgenic mice

    Energy Technology Data Exchange (ETDEWEB)

    Lin, S.D.; Cooper, P.; Fung, J.; Weier, H.U.G.; Rubin, E.M.

    2000-03-01

    Genetic factors affecting post-natal g-globin expression - a major modifier of the severity of both b-thalassemia and sickle cell anemia, have been difficult to study. This is especially so in mice, an organism lacking a globin gene with an expression pattern equivalent to that of human g-globin. To model the human b-cluster in mice, with the goal of screening for loci affecting human g-globin expression in vivo, we introduced a human b-globin cluster YAC transgene into the genome of FVB mice . The b-cluster contained a Greek hereditary persistence of fetal hemoglobin (HPFH) g allele resulting in postnatal expression of human g-globin in transgenic mice. The level of human g-globin for various F1 hybrids derived from crosses between the FVB transgenics and other inbred mouse strains was assessed. The g-globin level of the C3HeB/FVB transgenic mice was noted to be significantly elevated. To map genes affecting postnatal g-globin expression, a 20 centiMorgan (cM) genome scan of a C3HeB/F VB transgenics [prime] FVB backcross was performed, followed by high-resolution marker analysis of promising loci. From this analysis we mapped a locus within a 2.2 cM interval of mouse chromosome 1 at a LOD score of 4.2 that contributes 10.4% of variation in g-globin expression level. Combining transgenic modeling of the human b-globin gene cluster with quantitative trait analysis, we have identified and mapped a murine locus that impacts on human g-globin expression in vivo.

  7. Dicty_cDB: Contig-U01541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ula chromosome 7 BAC clone mth2-7... 36 3.7 5 ( FG283242 ) 1108457714276 New World Screwworm Egg 9261 ESTs C...1-1... 40 3.8 2 ( AM448784 ) Vitis vinifera contig VV78X077229.13, whole genom... 40 3.8 5 ( FG299281 ) 1108793334783 New World...malized cDNA li... 34 3.8 3 ( FG298782 ) 1108793320683 New World Screwworm Larvae 9387 EST... 40 3.8 2 ( AC2...) Populus trichocarpa clone POP011-A24, complete se... 38 3.9 5 ( FG298363 ) 1108793311332 New World Screwwo...rm Larvae 9387 EST... 40 3.9 2 ( AE017263 ) Mesoplasma florum L1 complete genome. 34 3.9 11 ( FG290177 ) 1108793315292 New World

  8. Direct selection of expressed sequences on a YAC clone revealed proline-rich-like genes and BARE-1 sequences physically linked to the complex ¤Mla¤ powdery mildew resistance locus of barley (¤Hordeum vulgare¤ L.)

    DEFF Research Database (Denmark)

    Schwarz, G.; Michalek, W.; Jahoor, A.

    2002-01-01

    homology to the copia-like retroelement BA REI of barley, putatively involved in evolution of disease resistance loci. The high degree of clones representing barley rRNA sequences or false positives is a major disadvantage of direct selection of cDNAs in barley. (C) 2002 Elsevier Science Ireland Ltd. All...... gene. Of 22 selected cDNA clones, six were re-located on the YAC by southern analysis. Two of these clones are predicted to encode members of the hydroxyproline-rich glycoprotein and proline-rich protein gene families which have been implicated in plant defense response. Four sequences showed high...

  9. Human Chromosome 21: Mapping of the chromosomes and cloning of cDNAs

    Energy Technology Data Exchange (ETDEWEB)

    Antonarakis, S.E.

    1991-09-01

    The objective of the research funded by DOE grant DE-FG02-89ER60857 from 6/15/89 to 8/31/91 was to contribute to the physical mapping of human chromosome 21 (HC21) by cloning large fragments of DNA into Yeast Artificial Chromosomes (YACs) and identify YACs that map on HC21. A total of 54 sequence tagged sites (STS) have been developed and mapped in our laboratory to HC21 and can be used as initial reference points for YAC identification and construction of overlapping clones. A small YAC library was constructed which is HC21 specific. DNA from somatic cell hybrid WAV17 or from flow-sorted HC21 was partially digested with EcoRI, ligated into vectors PJS97, PJS98, and YACs have been obtained with average size insert of more than 300 kb. This library has been deposited in D. Patterson's lab for the Joint YAC screening effort. Additional YAC libraries from ICI Pharmaceuticals or from Los Alamos National Laboratories have been screened with several STS and positive YACs have been identified. Work in progress includes screening of YAC libraries in order to construct overlapping clones, characterization of the cloning ends of YACs, characterization of additional STS and cloning of HC21 specific cDNAs. 15 refs., 2 figs., 5 tabs.

  10. L’Anaphore associative: contigüité métonymique

    Directory of Open Access Journals (Sweden)

    Gemma Peña Martínez

    2008-04-01

    Full Text Available Cet article porte sur les rapports de contigüité exigés lors de la résolution des anaphores associatives. Il s’agit en général de relations métonymiques, car les différents rapports, à caractère notamment socioculturel, entre référent et marque anaphorique convergent dans un même cadre conceptuel, se faisant écho d’éléments ou caractéristiques du même domaine cognitif. L’anaphore associative reprenant ainsi un attribut concret du référent, nous envisageons donc une classification de ces marques anaphoriques d’après des rapports métonymiques, tels que partie à tout, objet à matière et caractéristique ou propriété à objet.

  11. Gene content and organization of a 281-kbp contig from the genome of the extremely thermophilic archaeon, Sulfolobus solfataricus P2

    NARCIS (Netherlands)

    Charlebois, R.; Confalonieri, F.; Curtis, B.; Doolittle, W.F.; Duguet, M.; Erauso, G.; Faguy, D.; Gaasterland, T.; Garrett, R.A.; Gordon, P.; Kozera, C.; Medina, N.; Oost, van der J.; Peng, X.; Ragan, M.; She, Q.; Singh, R.K.

    2000-01-01

    The sequence of a 281-kbp contig from the crenarchaeote Sulfolobus solfataricus P2 was determined and analysed. Notable features in this region include 29 ribosomal protein genes, 12 tRNA genes (four of which contain archaeal-type introns), operons encoding enzymes of histidine biosynthesis,

  12. Primary proton and helium spectra at energy range from 50 TeV to 1015 eV observed with the new Tibet AS core detector array

    Directory of Open Access Journals (Sweden)

    Huang Jing

    2013-06-01

    Full Text Available A new EAS hybrid experiment has been designed by constructing a YAC (Yangbajing Air shower Core detector array inside the existing Tibet-III air shower array. The first step of YAC, called “YAC-I” has been successfully carried out in 2009–2010 together with Tibet-III air-shower array. YAC-II has also been operated from 2011. Preliminary results of YAC-I and performance of YAC-II are presented in this paper. The primary proton and helium spectra at energy range from50 TeV to 1015 eV derived from YAC-I data based on QGSJET2 and SIBYLL2.1 are reported. The obtained P+He spectrum is smoothly connected with directobservation data below 100 TeV and also with our previously reported results at higher energies within statistical error s. Based on these results and the sharp kneeof all-particle energy spectrum observed by our experiment, the possible origin of the sharp knee is discussed. See the published papers.

  13. Full-length huntingtin levels modulate body weight by influencing insulin-like growth factor 1 expression

    DEFF Research Database (Denmark)

    Pouladi, Mahmoud A; Xie, Yuanyun; Skotte, Niels Henning

    2010-01-01

    of the IGF-1 pathway in mediating the effect of htt on body weight. IGF-1 expression was examined in transgenic mouse lines expressing different levels of FL wild-type (WT) htt (YAC18 mice), FL mutant htt (YAC128 and BACHD mice) and truncated mutant htt (shortstop mice). We demonstrate that htt influences...... body weight by modulating the IGF-1 pathway. Plasma IGF-1 levels correlate with body weight and htt levels in the transgenic YAC mice expressing human htt. The effect of htt on IGF-1 expression is independent of CAG size. No effect on body weight is observed in transgenic YAC mice expressing...... and decreases the body weight of YAC128 animals to WT levels. Furthermore, given the ubiquitous expression of IGF-1 within the central nervous system, we also examined the impact of FL htt levels on IGF-1 expression in different regions of the brain, including the striatum, cerebellum of YAC18, YAC128...

  14. Radiation hybrid mapping of human chromosome 18

    International Nuclear Information System (INIS)

    Francke, U.; Moon, A.J.; Chang, E.; Foellmer, B.; Strauss, B.; Haschke, A.; Chihlin Hsieh; Geigl, E.M.; Welch, S.

    1990-01-01

    The authors have generated a Chinese hamster V79/380-6 HPRT minus x human leukocyte hybrid cell line (18/V79) with chromosome 18 as the only human chromosome that is retained at high frequency without specific selection. Hybrid cells were selected in HAT medium, and 164 individual colonies were isolated. Of 110 colonies screened for human DNA by PCR amplification using a primer specific for human Alu repeats 67 (61%) were positive. These were expanded in culture for large-scale DNA preparations. Retesting expanded clones by PCR with Alu and LINE primers has revealed unique patterns of amplification products. In situ hybridization of biotin labelled total human DNA to metaphase spreads from various hybrids revealed the presence of one or more human DNA fragments integrated in hamster chromosomes. The authors have generated a resource that should allow the construction of a radiation map, to be compared with the YAC contig map also under construction in their laboratory

  15. Empowering Youth to Take Charge of School Wellness

    Science.gov (United States)

    Hughes, Luanne J.; Savoca, LeeAnne; Grenci, Alexandra

    2015-01-01

    Youth Advisory Councils (YACs) ensure that students are represented in school wellness discussions. YACs empower students to present ideas, insights, and input on nutrition and physical activity; work alongside peers to assess wellness needs; and develop recommendations for enhancing/expanding the school wellness environment. YACs provide a…

  16. Construction and characterization of a yeast artificial chromosome library containing seven haploid human genome equivalents

    International Nuclear Information System (INIS)

    Albertsen, H.M.; Abderrahim, H.; Cann, H.M.; Dausset, J.; Le Paslier, D.; Cohen, D.

    1990-01-01

    Prior to constructing a library of yeast artificial chromosomes (YACs) containing very large human DNA fragments, the authors performed a series of preliminary experiments aimed at developing a suitable protocol. They found an inverse relationship between YAC insert size and transformation efficiency. Evidence of occasional rearrangement within YAC inserts was found resulting in clonally stable internal deletions or clonally unstable size variations. A protocol was developed for preparative electrophoretic enrichment of high molecular mass human DNA fragments from partial restriction digests and ligation with the YAC vector in agarose. A YAC library has been constructed from large fragments of DNA from an Epstein-Barr virus-transformed human lymphoblastoid cell line. The library presently contains 50,000 clones, 95% of which are greater than 250 kilobase pairs in size. The mean YAC size of the library, calculated from 132 randomly isolated clones, is 430 kilobase pairs. The library thus contains the equivalent of approximately seven haploid human genomes

  17. Área foliar del yacón (Smallanthus sonchifolius (Poep. & Endl. H. Rob. estimada mediante método indirecto.

    Directory of Open Access Journals (Sweden)

    Juan Francisco Seminario-Cunya

    2016-12-01

    Full Text Available El objetivo de este trabajo fue estimar el área foliar de ocho morfotipos de yacón mediante análisis de regresión lineal simple. La investigación se realizó entre los años 2014 y 2015, en el Programa de Raíces y Tubérculos Andinos de la Universidad Nacional de Cajamarca, Perú (7° 10’ 00’’ S, 78° 30’00’’ W, 2650 msnm. Se tomaron cien hojas de cada morfotipo, incluyendo hojas de los estratos basal, medio y terminal de plantas en plena oración. Las siluetas de las hojas frescas se dibujaron en papel y se midió el largo (L y ancho mayor de la lámina (W. El área medida (o real de la lámina se determinó con planímetro digital. Con el área medida (variable dependiente y los valores de largo, ancho, largo al cuadrado, ancho al cuadrado, largo x ancho y largo/ancho (como variables independientes, se realizó el análisis de regresión para cada morfotipo. En todos los morfotipos, excepto en dos, las mejores ecuaciones para estimar el área foliar, fueron aquellas en donde intervino el producto de L x W. La ecuación A= 20,41 + 0,4167 (L x W (r2 = 0,89 permitió estimar el área foliar de los ocho morfotipos en conjunto. El área del peciolo de los morfotipos en estudio signi có 15%, respecto del área total de la hoja.

  18. Genetic and physical analysis of a YAC contig spanning the fungal disease resistance locus Asc of tomato (Lycopersicon esculentum)

    NARCIS (Netherlands)

    Mesbah, L.A.; Kneppers, T.J.A.; Takken, F.L.W.; Laurent, P.; Hille, J.; Nijkamp, H.J.J.

    1998-01-01

    The Alternaria stem canker disease of tomato is caused by the necrotrophic fungal pathogen Alternaria alternata f. sp. lycopersici (AAL). The fungus produces AAL toxins that kill the plant tissue. Resistance to the fungus segregates as a single locus, called Asc, and has been genetically mapped on

  19. Genetic and physical analysis of a YAC contig spannig the fungal disease resistance locus Asc of tomato (Lycopersicon esculentum)

    NARCIS (Netherlands)

    Mesbah, L.A.; Kneppers, T.J.A.; Takken, F.L.W.; Laurent, P.J.F.; Hille, J.; Nijkamp, H.J.J.

    1999-01-01

    The Alternaria in stem canker disease of tomato is caused by the necrotrophic fungal pathogen Alternaria alternata f. sp. lycopersici (AAL). The fungus produces AAL toxins that kill the plant tissue. Resistance to the fungus segregates as a single locus, called Asc, and has been genetically mapped

  20. Automated integration of genomic physical mapping data via parallel simulated annealing

    Energy Technology Data Exchange (ETDEWEB)

    Slezak, T.

    1994-06-01

    The Human Genome Center at the Lawrence Livermore National Laboratory (LLNL) is nearing closure on a high-resolution physical map of human chromosome 19. We have build automated tools to assemble 15,000 fingerprinted cosmid clones into 800 contigs with minimal spanning paths identified. These islands are being ordered, oriented, and spanned by a variety of other techniques including: Fluorescence Insitu Hybridization (FISH) at 3 levels of resolution, ECO restriction fragment mapping across all contigs, and a multitude of different hybridization and PCR techniques to link cosmid, YAC, AC, PAC, and Pl clones. The FISH data provide us with partial order and distance data as well as orientation. We made the observation that map builders need a much rougher presentation of data than do map readers; the former wish to see raw data since these can expose errors or interesting biology. We further noted that by ignoring our length and distance data we could simplify our problem into one that could be readily attacked with optimization techniques. The data integration problem could then be seen as an M x N ordering of our N cosmid clones which ``intersect`` M larger objects by defining ``intersection`` to mean either contig/map membership or hybridization results. Clearly, the goal of making an integrated map is now to rearrange the N cosmid clone ``columns`` such that the number of gaps on the object ``rows`` are minimized. Our FISH partially-ordered cosmid clones provide us with a set of constraints that cannot be violated by the rearrangement process. We solved the optimization problem via simulated annealing performed on a network of 40+ Unix machines in parallel, using a server/client model built on explicit socket calls. For current maps we can create a map in about 4 hours on the parallel net versus 4+ days on a single workstation. Our biologists are now using this software on a daily basis to guide their efforts toward final closure.

  1. ScaffoldScaffolder: solving contig orientation via bidirected to directed graph reduction.

    Science.gov (United States)

    Bodily, Paul M; Fujimoto, M Stanley; Snell, Quinn; Ventura, Dan; Clement, Mark J

    2016-01-01

    The contig orientation problem, which we formally define as the MAX-DIR problem, has at times been addressed cursorily and at times using various heuristics. In setting forth a linear-time reduction from the MAX-CUT problem to the MAX-DIR problem, we prove the latter is NP-complete. We compare the relative performance of a novel greedy approach with several other heuristic solutions. Our results suggest that our greedy heuristic algorithm not only works well but also outperforms the other algorithms due to the nature of scaffold graphs. Our results also demonstrate a novel method for identifying inverted repeats and inversion variants, both of which contradict the basic single-orientation assumption. Such inversions have previously been noted as being difficult to detect and are directly involved in the genetic mechanisms of several diseases. http://bioresearch.byu.edu/scaffoldscaffolder. paulmbodily@gmail.com Supplementary data are available at Bioinformatics online. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  2. Enhanced Store-Operated Calcium Entry Leads to Striatal Synaptic Loss in a Huntington's Disease Mouse Model.

    Science.gov (United States)

    Wu, Jun; Ryskamp, Daniel A; Liang, Xia; Egorova, Polina; Zakharova, Olga; Hung, Gene; Bezprozvanny, Ilya

    2016-01-06

    In Huntington's disease (HD), mutant Huntingtin (mHtt) protein causes striatal neuron dysfunction, synaptic loss, and eventual neurodegeneration. To understand the mechanisms responsible for synaptic loss in HD, we developed a corticostriatal coculture model that features age-dependent dendritic spine loss in striatal medium spiny neurons (MSNs) from YAC128 transgenic HD mice. Age-dependent spine loss was also observed in vivo in YAC128 MSNs. To understand the causes of spine loss in YAC128 MSNs, we performed a series of mechanistic studies. We previously discovered that mHtt protein binds to type 1 inositol (1,4,5)-trisphosphate receptor (InsP3R1) and increases its sensitivity to activation by InsP3. We now report that the resulting increase in steady-state InsP3R1 activity reduces endoplasmic reticulum (ER) Ca(2+) levels. Depletion of ER Ca(2+) leads to overactivation of the neuronal store-operated Ca(2+) entry (nSOC) pathway in YAC128 MSN spines. The synaptic nSOC pathway is controlled by the ER resident protein STIM2. We discovered that STIM2 expression is elevated in aged YAC128 striatal cultures and in YAC128 mouse striatum. Knock-down of InsP3R1 expression by antisense oligonucleotides or knock-down or knock-out of STIM2 resulted in normalization of nSOC and rescue of spine loss in YAC128 MSNs. The selective nSOC inhibitor EVP4593 was identified in our previous studies. We now demonstrate that EVP4593 reduces synaptic nSOC and rescues spine loss in YAC128 MSNs. Intraventricular delivery of EVP4593 in YAC128 mice rescued age-dependent striatal spine loss in vivo. Our results suggest EVP4593 and other inhibitors of the STIM2-dependent nSOC pathway as promising leads for HD therapeutic development. In Huntington's disease (HD) mutant Huntingtin (mHtt) causes early corticostriatal synaptic dysfunction and eventual neurodegeneration of medium spine neurons (MSNs) through poorly understood mechanisms. We report here that corticostriatal cocultures prepared from

  3. Scaffold filling, contig fusion and comparative gene order inference

    Directory of Open Access Journals (Sweden)

    Rounsley Steve

    2010-06-01

    Full Text Available Abstract Background There has been a trend in increasing the phylogenetic scope of genome sequencing without finishing the sequence of the genome. Increasing numbers of genomes are being published in scaffold or contig form. Rearrangement algorithms, however, including gene order-based phylogenetic tools, require whole genome data on gene order or syntenic block order. How then can we use rearrangement algorithms to compare genomes available in scaffold form only? Can the comparative evidence predict the location of unsequenced genes? Results Our method involves optimally filling in genes missing from the scaffolds, while incorporating the augmented scaffolds directly into the rearrangement algorithms as if they were chromosomes. This is accomplished by an exact, polynomial-time algorithm. We then correct for the number of extra fusion/fission operations required to make scaffolds comparable to full assemblies. We model the relationship between the ratio of missing genes actually absent from the genome versus merely unsequenced ones, on one hand, and the increase of genomic distance after scaffold filling, on the other. We estimate the parameters of this model through simulations and by comparing the angiosperm genomes Ricinus communis and Vitis vinifera. Conclusions The algorithm solves the comparison of genomes with 18,300 genes, including 4500 missing from one genome, in less than a minute on a MacBook, putting virtually all genomes within range of the method.

  4. Scaffold filling, contig fusion and comparative gene order inference.

    Science.gov (United States)

    Muñoz, Adriana; Zheng, Chunfang; Zhu, Qian; Albert, Victor A; Rounsley, Steve; Sankoff, David

    2010-06-04

    There has been a trend in increasing the phylogenetic scope of genome sequencing without finishing the sequence of the genome. Increasing numbers of genomes are being published in scaffold or contig form. Rearrangement algorithms, however, including gene order-based phylogenetic tools, require whole genome data on gene order or syntenic block order. How then can we use rearrangement algorithms to compare genomes available in scaffold form only? Can the comparative evidence predict the location of unsequenced genes? Our method involves optimally filling in genes missing from the scaffolds, while incorporating the augmented scaffolds directly into the rearrangement algorithms as if they were chromosomes. This is accomplished by an exact, polynomial-time algorithm. We then correct for the number of extra fusion/fission operations required to make scaffolds comparable to full assemblies. We model the relationship between the ratio of missing genes actually absent from the genome versus merely unsequenced ones, on one hand, and the increase of genomic distance after scaffold filling, on the other. We estimate the parameters of this model through simulations and by comparing the angiosperm genomes Ricinus communis and Vitis vinifera. The algorithm solves the comparison of genomes with 18,300 genes, including 4500 missing from one genome, in less than a minute on a MacBook, putting virtually all genomes within range of the method.

  5. A post-assembly genome-improvement toolkit (PAGIT) to obtain annotated genomes from contigs.

    Science.gov (United States)

    Swain, Martin T; Tsai, Isheng J; Assefa, Samual A; Newbold, Chris; Berriman, Matthew; Otto, Thomas D

    2012-06-07

    Genome projects now produce draft assemblies within weeks owing to advanced high-throughput sequencing technologies. For milestone projects such as Escherichia coli or Homo sapiens, teams of scientists were employed to manually curate and finish these genomes to a high standard. Nowadays, this is not feasible for most projects, and the quality of genomes is generally of a much lower standard. This protocol describes software (PAGIT) that is used to improve the quality of draft genomes. It offers flexible functionality to close gaps in scaffolds, correct base errors in the consensus sequence and exploit reference genomes (if available) in order to improve scaffolding and generating annotations. The protocol is most accessible for bacterial and small eukaryotic genomes (up to 300 Mb), such as pathogenic bacteria, malaria and parasitic worms. Applying PAGIT to an E. coli assembly takes ∼24 h: it doubles the average contig size and annotates over 4,300 gene models.

  6. Disease-toxicant interactions in manganese exposed Huntington disease mice: early changes in striatal neuron morphology and dopamine metabolism.

    Directory of Open Access Journals (Sweden)

    Jennifer L Madison

    Full Text Available YAC128 Huntington's disease (HD transgenic mice accumulate less manganese (Mn in the striatum relative to wild-type (WT littermates. We hypothesized that Mn and mutant Huntingtin (HTT would exhibit gene-environment interactions at the level of neurochemistry and neuronal morphology. Twelve-week-old WT and YAC128 mice were exposed to MnCl(2-4H(2O (50 mg/kg on days 0, 3 and 6. Striatal medium spiny neuron (MSN morphology, as well as levels of dopamine (DA and its metabolites (which are known to be sensitive to Mn-exposure, were analyzed at 13 weeks (7 days from initial exposure and 16 weeks (28 days from initial exposure. No genotype-dependent differences in MSN morphology were apparent at 13 weeks. But at 16 weeks, a genotype effect was observed in YAC128 mice, manifested by an absence of the wild-type age-dependent increase in dendritic length and branching complexity. In addition, genotype-exposure interaction effects were observed for dendritic complexity measures as a function of distance from the soma, where only YAC128 mice were sensitive to Mn exposure. Furthermore, striatal DA levels were unaltered at 13 weeks by genotype or Mn exposure, but at 16 weeks, both Mn exposure and the HD genotype were associated with quantitatively similar reductions in DA and its metabolites. Interestingly, Mn exposure of YAC128 mice did not further decrease DA or its metabolites versus YAC128 vehicle exposed or Mn exposed WT mice. Taken together, these results demonstrate Mn-HD disease-toxicant interactions at the onset of striatal dendritic neuropathology in YAC128 mice. Our results identify the earliest pathological change in striatum of YAC128 mice as being between 13 to 16 weeks. Finally, we show that mutant HTT suppresses some Mn-dependent changes, such as decreased DA levels, while it exacerbates others, such as dendritic pathology.

  7. Report of the fifth international workshop on human X chromosome mapping

    Energy Technology Data Exchange (ETDEWEB)

    Willard, H.F.; Cremers, F.; Mandel, J.L.; Monaco, A.P.; Nelson, D.L.; Schlessinger, D.

    1994-12-31

    A high-quality integrated genetic and physical map of the X chromosome from telomere to telomere, based primarily on YACs formatted with probes and STSs, is increasingly close to reality. At the Fifth International X Chromosome Workshop, organized by A.M. Poustka and D. Schlessinger in Heidelberg, Germany, April 24--27, 1994, substantial progress was recorded on extension and refinement of the physical map, on the integration of genetic and cytogenetic data, on attempts to use the map to direct gene searches, and on nascent large-scale sequencing efforts. This report summarizes physical and genetic mapping information presented at the workshop and/or published since the reports of the fourth International X Chromosome Workshop. The principle aim of the workshop was to derive a consensus map of the chromosome, in terms of physical contigs emphasizing the location of genes and microsatellite markers. The resulting map is presented and updates previous versions. This report also updates the list of highly informative microsatellites. The text highlights the working state of the map, the genes known to reside on the X, and the progress toward integration of various types of data.

  8. Fine mapping of the EDA gene: A translocation breakpoint is associated with a CpG island that is transcribed

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, A.K.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States); Montonen, O. [Univ. of Helsinki (Finland)] [and others

    1996-01-01

    In order to identify the gene for human X-linked anhidrotic ectodermal dysplasia (EDA), a translocation breakpoint in a female with t(X;1)(q13.1;p36.3) and EDA (patient AK) was finely mapped. The EDA region contains five groups of rare-cutter restriction sites that define CpG islands. The two more centromeric of these islands are associated with transcripts of 3.5 kb and 1.8 kb. The third CpG island maps within <1 kb of the translocation breakpoint in patient AK, as indicated by a genomic rearrangement, and {approximately}100 kb centromeric from another previously mapped translocation breakpoint (patient AnLy). Northern analysis with a probe from this CpG island detected an {approximately}6-kb mRNA in several fetal tissues tested. An extended YAC contig of 1,200 kb with an average of fivefold coverage was constructed. The two most telomeric CpG islands map 350 kb telomeric of the two translocations. Taken together, the results suggest that the CpG island just proximal of the AK translocation breakpoint lies at the 5{prime} end of a candidate gene for EDA. 26 refs., 4 figs., 1 tab.

  9. Car Covers | Outdoor Covers Canada

    OpenAIRE

    Covers, Outdoor

    2018-01-01

    Protect your car from the elements with Ultimate Touch Car Cover. The multi-layer non-woven fabric is soft on the finish and offers 4 seasons all weather protection.https://outdoorcovers.ca/car-covers/

  10. Study on bystander effect and associated mechanism mediated through culture medium

    International Nuclear Information System (INIS)

    Tu Xumin; Lei Suwen; Zhang Zhixing; Lv Huimin

    2005-01-01

    Objective: To study the bystander effect and associated mechanism mediated through the irradiated cell culture medium. Methods: Splenic natural killer (NK) cells were obtained from healthy male ICR strain mice. Culture medium irradiated with different doses of 60 Co γ-rays was used for culturing Yac-I lymphoma cells. The degree of injury of the latter by activated NK cells was observed. A part of the culture media were pretreated with 1% DMSO, a scavenger of reactive oxygen species (ROS), in order to investigate the possible mechanism of a radiation-induced bystander response. Results: Severer injury was induced in Yac-I cells cultured in the media pre-irradiated with different doses of γ-rays than that in Yac-I cells cultured in unirradiated medium, as shown by increased sensitivity to murine splenic NK cells (P<0.01). Culturing Yac-I cells in DMSO-pretreated medium considerably reduced the activation of NK cells, especially in 0.25 Gy and 0.5 Gy γ-irradiated media. Therefore, it can be expected that DMSO can partly suppress ROS-induced bystander effect. Conclusion: The irradiated culture medium of Yac-I cells can trigger bystander effect. ROS likely plays an important role in radiation-induced bystander effect that can be partly suppressed by pretreatment with DMSO. (authors)

  11. Fate of tumor cells injected into left ventricle of heart in BALB/c mice: role of natural killer cells

    DEFF Research Database (Denmark)

    Basse, P; Hokland, P; Heron, I

    1988-01-01

    The arrest, retention, and elimination (i.e., clearance) of radiolabeled YAC-1 lymphoma cells injected either iv or into the left ventricle (LV) of the heart were studied in male BALB/c mice, with special emphasis on the role of natural killer (NK) cells. After iv injection YAC-1 cells were...... extent, the bone, skin, and muscle. The only organs that could arrest the LV-injected tumor cells were the lungs and the liver. In the lungs clearance of YAC-1 cells began immediately after the cells were arrested. However, the rate of clearance could be almost abrogated by pretreatment of the recipients...... with anti-asialo GM1 antiserum, which destroys most of the NK cells in vivo and strongly depresses the in vitro NK cell activity. In contrast, YAC-1 cells arrested in the liver were not cleared from this organ during the first 1-2 hours after arrest. After this delay clearance of the cells commenced...

  12. Dantrolene is neuroprotective in Huntington's disease transgenic mouse model

    Directory of Open Access Journals (Sweden)

    Chen Xi

    2011-11-01

    Full Text Available Abstract Background Huntington's disease (HD is a progressive neurodegenerative disorder caused by a polyglutamine expansion in the Huntingtin protein which results in the selective degeneration of striatal medium spiny neurons (MSNs. Our group has previously demonstrated that calcium (Ca2+ signaling is abnormal in MSNs from the yeast artificial chromosome transgenic mouse model of HD (YAC128. Moreover, we demonstrated that deranged intracellular Ca2+ signaling sensitizes YAC128 MSNs to glutamate-induced excitotoxicity when compared to wild type (WT MSNs. In previous studies we also observed abnormal neuronal Ca2+ signaling in neurons from spinocerebellar ataxia 2 (SCA2 and spinocerebellar ataxia 3 (SCA3 mouse models and demonstrated that treatment with dantrolene, a ryanodine receptor antagonist and clinically relevant Ca2+ signaling stabilizer, was neuroprotective in experiments with these mouse models. The aim of the current study was to evaluate potential beneficial effects of dantrolene in experiments with YAC128 HD mouse model. Results The application of caffeine and glutamate resulted in increased Ca2+ release from intracellular stores in YAC128 MSN cultures when compared to WT MSN cultures. Pre-treatment with dantrolene protected YAC128 MSNs from glutamate excitotoxicty, with an effective concentration of 100 nM and above. Feeding dantrolene (5 mg/kg twice a week to YAC128 mice between 2 months and 11.5 months of age resulted in significantly improved performance in the beam-walking and gait-walking assays. Neuropathological analysis revealed that long-term dantrolene feeding to YAC128 mice significantly reduced the loss of NeuN-positive striatal neurons and reduced formation of Httexp nuclear aggregates. Conclusions Our results support the hypothesis that deranged Ca2+ signaling plays an important role in HD pathology. Our data also implicate the RyanRs as a potential therapeutic target for the treatment of HD and demonstrate that Ryan

  13. Dantrolene is neuroprotective in Huntington's disease transgenic mouse model.

    Science.gov (United States)

    Chen, Xi; Wu, Jun; Lvovskaya, Svetlana; Herndon, Emily; Supnet, Charlene; Bezprozvanny, Ilya

    2011-11-25

    Huntington's disease (HD) is a progressive neurodegenerative disorder caused by a polyglutamine expansion in the Huntingtin protein which results in the selective degeneration of striatal medium spiny neurons (MSNs). Our group has previously demonstrated that calcium (Ca2+) signaling is abnormal in MSNs from the yeast artificial chromosome transgenic mouse model of HD (YAC128). Moreover, we demonstrated that deranged intracellular Ca2+ signaling sensitizes YAC128 MSNs to glutamate-induced excitotoxicity when compared to wild type (WT) MSNs. In previous studies we also observed abnormal neuronal Ca2+ signaling in neurons from spinocerebellar ataxia 2 (SCA2) and spinocerebellar ataxia 3 (SCA3) mouse models and demonstrated that treatment with dantrolene, a ryanodine receptor antagonist and clinically relevant Ca2+ signaling stabilizer, was neuroprotective in experiments with these mouse models. The aim of the current study was to evaluate potential beneficial effects of dantrolene in experiments with YAC128 HD mouse model. The application of caffeine and glutamate resulted in increased Ca2+ release from intracellular stores in YAC128 MSN cultures when compared to WT MSN cultures. Pre-treatment with dantrolene protected YAC128 MSNs from glutamate excitotoxicty, with an effective concentration of 100 nM and above. Feeding dantrolene (5 mg/kg) twice a week to YAC128 mice between 2 months and 11.5 months of age resulted in significantly improved performance in the beam-walking and gait-walking assays. Neuropathological analysis revealed that long-term dantrolene feeding to YAC128 mice significantly reduced the loss of NeuN-positive striatal neurons and reduced formation of Httexp nuclear aggregates. Our results support the hypothesis that deranged Ca2+ signaling plays an important role in HD pathology. Our data also implicate the RyanRs as a potential therapeutic target for the treatment of HD and demonstrate that RyanR inhibitors and Ca2+ signaling stabilizers such as

  14. Tools to covisualize and coanalyze proteomic data with genomes and transcriptomes: validation of genes and alternative mRNA splicing

    DEFF Research Database (Denmark)

    Pang, Chi; Tay, Aidan; Aya, Carlos

    2014-01-01

    contigs, along with RNA-seq reads. This is done in the Integrated Genome Viewer (IGV). A Results Analyzer reports the precise base position where LC-MS/MS-derived peptides cover genes or gene isoforms, on the chromosomes or contigs where this occurs. In prokaryotes, the PG Nexus pipeline facilitates...... the validation of genes, where annotation or gene prediction is available, or the discovery of genes using a "virtual protein"-based unbiased approach. We illustrate this with a comprehensive proteogenomics analysis of two strains of Campylobacter concisus . For higher eukaryotes, the PG Nexus facilitates gene...

  15. Fate of tumor cells injected into left ventricle of heart in BALB/c mice: role of natural killer cells

    DEFF Research Database (Denmark)

    Basse, P; Hokland, P; Heron, I

    1988-01-01

    The arrest, retention, and elimination (i.e., clearance) of radiolabeled YAC-1 lymphoma cells injected either iv or into the left ventricle (LV) of the heart were studied in male BALB/c mice, with special emphasis on the role of natural killer (NK) cells. After iv injection YAC-1 cells were...

  16. Detection of a Usp-like gene in Calotropis procera plant from the de novo assembled genome contigs of the high-throughput sequencing dataset

    KAUST Repository

    Shokry, Ahmed M.

    2014-02-01

    The wild plant species Calotropis procera (C. procera) has many potential applications and beneficial uses in medicine, industry and ornamental field. It also represents an excellent source of genes for drought and salt tolerance. Genes encoding proteins that contain the conserved universal stress protein (USP) domain are known to provide organisms like bacteria, archaea, fungi, protozoa and plants with the ability to respond to a plethora of environmental stresses. However, information on the possible occurrence of Usp in C. procera is not available. In this study, we uncovered and characterized a one-class A Usp-like (UspA-like, NCBI accession No. KC954274) gene in this medicinal plant from the de novo assembled genome contigs of the high-throughput sequencing dataset. A number of GenBank accessions for Usp sequences were blasted with the recovered de novo assembled contigs. Homology modelling of the deduced amino acids (NCBI accession No. AGT02387) was further carried out using Swiss-Model, accessible via the EXPASY. Superimposition of C. procera USPA-like full sequence model on Thermus thermophilus USP UniProt protein (PDB accession No. Q5SJV7) was constructed using RasMol and Deep-View programs. The functional domains of the novel USPA-like amino acids sequence were identified from the NCBI conserved domain database (CDD) that provide insights into sequence structure/function relationships, as well as domain models imported from a number of external source databases (Pfam, SMART, COG, PRK, TIGRFAM). © 2014 Académie des sciences.

  17. Land Cover - Minnesota Land Cover Classification System

    Data.gov (United States)

    Minnesota Department of Natural Resources — Land cover data set based on the Minnesota Land Cover Classification System (MLCCS) coding scheme. This data was produced using a combination of aerial photograph...

  18. Comparative mapping in the beige-satin region of mouse chromosome 13

    Energy Technology Data Exchange (ETDEWEB)

    Perou, C.M.; Pryor, R.; Kaplan, J. [Univ. of Utah School of Medicine, Salt Lake City, UT (United States)] [and others

    1997-01-15

    The proximal end of mouse chromosome (Chr) 13 contains regions conserved on human chromosomes 1q42-q44, 6p23-p21, and 7p22-p13. This region also contains mutations that may be models for human disease, including beige (human Chediak-Higashi syndrome). An interspecific backcross of SB/Le and Mus spretus mice was used to generate a molecular genetic linkage map of mouse chromosome 13 with an emphasis on the proximal region including beige (bg) and satin (sa). This map provides the gene order of the two phenotypic markers bg and sa relative to restriction fragment length polymorphisms and simple sequence length polymorphisms in 131 backcross animals. In parallel, we have created a physical map of the region using Nidogen (Nid) as a molecular starting point for cloning a YAC contig that was used to identify the beige gene. The physical map provides the fine-structure order of genes and anonymous DNA fragments that was not resolved by the genetic linkage mapping. The results show that the bg region of mouse Chr 13 is highly conserved on human Chr 1q42-q44 and provide a starting point for a complete functional analysis of the entire bg-sa interval. 37 refs., 4 figs., 1 tab.

  19. Giant panda BAC library construction and assembly of a 650-kb contig spanning major histocompatibility complex class II region

    Directory of Open Access Journals (Sweden)

    Pan Hui-Juan

    2007-09-01

    Full Text Available Abstract Background Giant panda is rare and endangered species endemic to China. The low rates of reproductive success and infectious disease resistance have severely hampered the development of captive and wild populations of the giant panda. The major histocompatibility complex (MHC plays important roles in immune response and reproductive system such as mate choice and mother-fetus bio-compatibility. It is thus essential to understand genetic details of the giant panda MHC. Construction of a bacterial artificial chromosome (BAC library will provide a new tool for panda genome physical mapping and thus facilitate understanding of panda MHC genes. Results A giant panda BAC library consisting of 205,800 clones has been constructed. The average insert size was calculated to be 97 kb based on the examination of 174 randomly selected clones, indicating that the giant panda library contained 6.8-fold genome equivalents. Screening of the library with 16 giant panda PCR primer pairs revealed 6.4 positive clones per locus, in good agreement with an expected 6.8-fold genomic coverage of the library. Based on this BAC library, we constructed a contig map of the giant panda MHC class II region from BTNL2 to DAXX spanning about 650 kb by a three-step method: (1 PCR-based screening of the BAC library with primers from homologous MHC class II gene loci, end sequences and BAC clone shotgun sequences, (2 DNA sequencing validation of positive clones, and (3 restriction digest fingerprinting verification of inter-clone overlapping. Conclusion The identifications of genes and genomic regions of interest are greatly favored by the availability of this giant panda BAC library. The giant panda BAC library thus provides a useful platform for physical mapping, genome sequencing or complex analysis of targeted genomic regions. The 650 kb sequence-ready BAC contig map of the giant panda MHC class II region from BTNL2 to DAXX, verified by the three-step method, offers a

  20. An origin-deficient yeast artificial chromosome triggers a cell cycle checkpoint.

    Science.gov (United States)

    van Brabant, A J; Buchanan, C D; Charboneau, E; Fangman, W L; Brewer, B J

    2001-04-01

    Checkpoint controls coordinate entry into mitosis with the completion of DNA replication. Depletion of nucleotide precursors by treatment with the drug hydroxyurea triggers such a checkpoint response. However, it is not clear whether the signal for this hydroxyurea-induced checkpoint pathway is the presence of unreplicated DNA, or rather the persistence of single-stranded or damaged DNA. In a yeast artificial chromosome (YAC) we have engineered an approximately 170 kb region lacking efficient replication origins that allows us to explore the specific effects of unreplicated DNA on cell cycle progression. Replication of this YAC extends the length of S phase and causes cells to engage an S/M checkpoint. In the absence of Rad9 the YAC becomes unstable, undergoing deletions within the origin-free region.

  1. National Land Cover Database (NLCD) Land Cover Collection

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The National Land Cover Database (NLCD) Land Cover Collection is produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC)...

  2. Delineating Rearrangements in Single Yeast Artificial Chromosomes by Quantitative DNA Fiber Mapping

    Energy Technology Data Exchange (ETDEWEB)

    Weier, Heinz-Ulrich G.; Greulich-Bode, Karin M.; Wu, Jenny; Duell, Thomas

    2009-09-18

    Cloning of large chunks of human genomic DNA in recombinant systems such as yeast or bacterial artificial chromosomes has greatly facilitated the construction of physical maps, the positional cloning of disease genes or the preparation of patient-specific DNA probes for diagnostic purposes. For this process to work efficiently, the DNA cloning process and subsequent clone propagation need to maintain stable inserts that are neither deleted nor otherwise rearranged. Some regions of the human genome; however, appear to have a higher propensity than others to rearrange in any host system. Thus, techniques to detect and accurately characterize such rearrangements need to be developed. We developed a technique termed 'Quantitative DNA Fiber Mapping (QDFM)' that allows accurate tagging of sequence elements of interest with near kilobase accuracy and optimized it for delineation of rearrangements in recombinant DNA clones. This paper demonstrates the power of this microscopic approach by investigating YAC rearrangements. In our examples, high-resolution physical maps for regions within the immunoglobulin lambda variant gene cluster were constructed for three different YAC clones carrying deletions of 95 kb and more. Rearrangements within YACs could be demonstrated unambiguously by pairwise mapping of cosmids along YAC DNA molecules. When coverage by YAC clones was not available, distances between cosmid clones were estimated by hybridization of cosmids onto DNA fibers prepared from human genomic DNA. In addition, the QDFM technology provides essential information about clone stability facilitating closure of the maps of the human genome as well as those of model organisms.

  3. Landfill Top Covers

    DEFF Research Database (Denmark)

    Scheutz, Charlotte; Kjeldsen, Peter

    2011-01-01

    The purpose of the final cover of a landfill is to contain the waste and to provide for a physical separation between the waste and the environment for protection of public health. Most landfill covers are designed with the primary goal to reduce or prevent infiltration of precipitation...... into the landfill in order to minimize leachate generation. In addition the cover also has to control the release of gases produced in the landfill so the gas can be ventilated, collected and utilized, or oxidized in situ. The landfill cover should also minimize erosion and support vegetation. Finally the cover...... is landscaped in order to fit into the surrounding area/environment or meet specific plans for the final use of the landfill. To fulfill the above listed requirements landfill covers are often multicomponent systems which are placed directly on top of the waste. The top cover may be placed immediately after...

  4. Evapotranspiration (ET) covers.

    Science.gov (United States)

    Rock, Steve; Myers, Bill; Fiedler, Linda

    2012-01-01

    Evapotranspiration (ET) cover systems are increasingly being used at municipal solid waste (MSW) landfills, hazardous waste landfills, at industrial monofills, and at mine sites. Conventional cover systems use materials with low hydraulic permeability (barrier layers) to minimize the downward migration of water from the surface to the waste (percolation), ET cover systems use water balance components to minimize percolation. These cover systems rely on soil to capture and store precipitation until it is either transpired through vegetation or evaporated from the soil surface. Compared to conventional membrane or compacted clay cover systems, ET cover systems are expected to cost less to construct. They are often aesthetic because they employ naturalized vegetation, require less maintenance once the vegetative system is established, including eliminating mowing, and may require fewer repairs than a barrier system. All cover systems should consider the goals of the cover in terms of protectiveness, including the pathways of risk from contained material, the lifecycle of the containment system. The containment system needs to be protective of direct contact of people and animals with the waste, prevent surface and groundwater water pollution, and minimize release of airborne contaminants. While most containment strategies have been based on the dry tomb strategy of keeping waste dry, there are some sites where adding or allowing moisture to help decompose organic waste is the current plan. ET covers may work well in places where complete exclusion of precipitation is not needed. The U.S. EPA Alternative Cover Assessment Program (ACAP), USDOE, the Nuclear Regulatory Commission, and others have researched ET cover design and efficacy, including the history of their use, general considerations in their design, performance, monitoring, cost, current status, limitations on their use, and project specific examples. An on-line database has been developed with information

  5. Land Cover

    Data.gov (United States)

    Kansas Data Access and Support Center — The Land Cover database depicts 10 general land cover classes for the State of Kansas. The database was compiled from a digital classification of Landsat Thematic...

  6. Interrelationships between soil cover and plant cover depending on land use

    Directory of Open Access Journals (Sweden)

    Tiina Köster

    2013-05-01

    Full Text Available Interrelationships between soil cover and plant cover of normally developed (or postlithogenic mineral soils are analysed on the basis of four sampling soil groups. The four-link pedo-ecological sequence of analysed soils, rendzinas → brown soils → pseudopodzolic soils → gley-podzols, forms a representative cross section in relation to the normal mineral soils of Estonia. All groups differ substantially from each other in terms of soil properties (calcareousness, acidity, nutrition conditions, profile fabric and humus cover. The primary tasks of the research were (1 to elucidate the main pedo-ecological characteristics of the four soil groups and their suitability for plant cover, (2 to evaluate comparatively soils in terms of productivity, sustainability, biodiversity and environmental protection ability and (3 to analyse possibilities for ecologically sound matching of soil cover with suitable plant cover. On the basis of the same material, the influence of land-use change on humus cover (epipedon fabric, properties of the entire soil cover and soil–plant interrelationship were also analysed. An ecosystem approach enables us to observe particularities caused by specific properties of a soil type (species, variety in biological turnover and in the formation of biodiversity.

  7. Cis-Acting Determinants Affecting Centromere Function, Sister-Chromatid Cohesion and Reciprocal Recombination during Meiosis in Saccharomyces Cerevisiae

    OpenAIRE

    Sears, D. D.; Hegemann, J. H.; Shero, J. H.; Hieter, P.

    1995-01-01

    We have employed a system that utilizes homologous pairs of human DNA-derived yeast artificial chromosomes (YACs) as marker chromosomes to assess the specific role (s) of conserved centromere DNA elements (CDEI, CDEII and CDEIII) in meiotic chromosome disjunction fidelity. Thirteen different centromere (CEN) mutations were tested for their effects on meiotic centromere function. YACs containing a wild-type CEN DNA sequence segregate with high fidelity in meiosis I (99% normal segregation) and...

  8. The European sea bass Dicentrarchus labrax genome puzzle: comparative BAC-mapping and low coverage shotgun sequencing

    Directory of Open Access Journals (Sweden)

    Volckaert Filip AM

    2010-01-01

    Full Text Available Abstract Background Food supply from the ocean is constrained by the shortage of domesticated and selected fish. Development of genomic models of economically important fishes should assist with the removal of this bottleneck. European sea bass Dicentrarchus labrax L. (Moronidae, Perciformes, Teleostei is one of the most important fishes in European marine aquaculture; growing genomic resources put it on its way to serve as an economic model. Results End sequencing of a sea bass genomic BAC-library enabled the comparative mapping of the sea bass genome using the three-spined stickleback Gasterosteus aculeatus genome as a reference. BAC-end sequences (102,690 were aligned to the stickleback genome. The number of mappable BACs was improved using a two-fold coverage WGS dataset of sea bass resulting in a comparative BAC-map covering 87% of stickleback chromosomes with 588 BAC-contigs. The minimum size of 83 contigs covering 50% of the reference was 1.2 Mbp; the largest BAC-contig comprised 8.86 Mbp. More than 22,000 BAC-clones aligned with both ends to the reference genome. Intra-chromosomal rearrangements between sea bass and stickleback were identified. Size distributions of mapped BACs were used to calculate that the genome of sea bass may be only 1.3 fold larger than the 460 Mbp stickleback genome. Conclusions The BAC map is used for sequencing single BACs or BAC-pools covering defined genomic entities by second generation sequencing technologies. Together with the WGS dataset it initiates a sea bass genome sequencing project. This will allow the quantification of polymorphisms through resequencing, which is important for selecting highly performing domesticated fish.

  9. Silicone covered vs. Non- covered endotracheal self expandable metallic stent: An experimental study

    Energy Technology Data Exchange (ETDEWEB)

    Do, Young Soo; Lee, Byung Hee; Kim, Soo Ah; Kim, Kie Hwan; Chin, Soo Yil; Cho, Kyung Ja; Cho, Dae Soon [Korea Cancer Center Hospital, Seoul (Korea, Republic of)

    1994-10-15

    To evaluate pathologic changes of the trachea and the lung after insertion of silicone covered and non covered Gianturco stent in the trachea of dog. Silicone covered(covered) and non covered(bare) Gianturco stent, six in each, were inserted into the tracheal lumen of six consecutive dogs. After 1-10 weeks observation, the dogs were sacrificed and their tracheas and lungs were examined grossly and histopathologically. Serial chest radiographs were performed to evaluate pneumonia and stent migration every 3-5 days. Pneumonia was observed in one of bare stent group and five of covered stent group. Stent migration was noted in three of covered stent group. In bare stent group, the epithelium of the trachea was markedly thickened by hyperplasia and stent was covered by granulation tissue from 6 weeks after stent insertion. Inflammation was focal at contact site between the stent and the trachea. In covered stent group, the epithelium was denuded at multiple areas and there were multifocal squamous metaplasia of the mucosa. Inflammatory reaction of the trachea was diffuse. Inflammatory reaction was more severe and stent migration was more frequent in covered stent group. The use of covered stent in the trachea should be studied further.

  10. Branched polynomial covering maps

    DEFF Research Database (Denmark)

    Hansen, Vagn Lundsgaard

    2002-01-01

    A Weierstrass polynomial with multiple roots in certain points leads to a branched covering map. With this as the guiding example, we formally define and study the notion of a branched polynomial covering map. We shall prove that many finite covering maps are polynomial outside a discrete branch ...... set. Particular studies are made of branched polynomial covering maps arising from Riemann surfaces and from knots in the 3-sphere. (C) 2001 Elsevier Science B.V. All rights reserved.......A Weierstrass polynomial with multiple roots in certain points leads to a branched covering map. With this as the guiding example, we formally define and study the notion of a branched polynomial covering map. We shall prove that many finite covering maps are polynomial outside a discrete branch...

  11. Mekong Land Cover Dasboard: Regional Land Cover Mointoring Systems

    Science.gov (United States)

    Saah, D. S.; Towashiraporn, P.; Aekakkararungroj, A.; Phongsapan, K.; Triepke, J.; Maus, P.; Tenneson, K.; Cutter, P. G.; Ganz, D.; Anderson, E.

    2016-12-01

    SERVIR-Mekong, a USAID-NASA partnership, helps decision makers in the Lower Mekong Region utilize GIS and Remote Sensing information to inform climate related activities. In 2015, SERVIR-Mekong conducted a geospatial needs assessment for the Lower Mekong countries which included individual country consultations. The team found that many countries were dependent on land cover and land use maps for land resource planning, quantifying ecosystem services, including resilience to climate change, biodiversity conservation, and other critical social issues. Many of the Lower Mekong countries have developed national scale land cover maps derived in part from remote sensing products and geospatial technologies. However, updates are infrequent and classification systems do not always meet the needs of key user groups. In addition, data products stop at political boundaries and are often not accessible making the data unusable across country boundaries and with resource management partners. Many of these countries rely on global land cover products to fill the gaps of their national efforts, compromising consistency between data and policies. These gaps in national efforts can be filled by a flexible regional land cover monitoring system that is co-developed by regional partners with the specific intention of meeting national transboundary needs, for example including consistent forest definitions in transboundary watersheds. Based on these facts, key regional stakeholders identified a need for a land cover monitoring system that will produce frequent, high quality land cover maps using a consistent regional classification scheme that is compatible with national country needs. SERVIR-Mekong is currently developing a solution that leverages recent developments in remote sensing science and technology, such as Google Earth Engine (GEE), and working together with production partners to develop a system that will use a common set of input data sources to generate high

  12. Land cover mapping of North and Central America—Global Land Cover 2000

    Science.gov (United States)

    Latifovic, Rasim; Zhu, Zhi-Liang

    2004-01-01

    The Land Cover Map of North and Central America for the year 2000 (GLC 2000-NCA), prepared by NRCan/CCRS and USGS/EROS Data Centre (EDC) as a regional component of the Global Land Cover 2000 project, is the subject of this paper. A new mapping approach for transforming satellite observations acquired by the SPOT4/VGTETATION (VGT) sensor into land cover information is outlined. The procedure includes: (1) conversion of daily data into 10-day composite; (2) post-seasonal correction and refinement of apparent surface reflectance in 10-day composite images; and (3) extraction of land cover information from the composite images. The pre-processing and mosaicking techniques developed and used in this study proved to be very effective in removing cloud contamination, BRDF effects, and noise in Short Wave Infra-Red (SWIR). The GLC 2000-NCA land cover map is provided as a regional product with 28 land cover classes based on modified Federal Geographic Data Committee/Vegetation Classification Standard (FGDC NVCS) classification system, and as part of a global product with 22 land cover classes based on Land Cover Classification System (LCCS) of the Food and Agriculture Organisation. The map was compared on both areal and per-pixel bases over North and Central America to the International Geosphere–Biosphere Programme (IGBP) global land cover classification, the University of Maryland global land cover classification (UMd) and the Moderate Resolution Imaging Spectroradiometer (MODIS) Global land cover classification produced by Boston University (BU). There was good agreement (79%) on the spatial distribution and areal extent of forest between GLC 2000-NCA and the other maps, however, GLC 2000-NCA provides additional information on the spatial distribution of forest types. The GLC 2000-NCA map was produced at the continental level incorporating specific needs of the region.

  13. Myeloid- and lymphoid-specific breakpoint cluster regions in chromosome band 13q14 in acute leukemia.

    Science.gov (United States)

    Coignet, L J; Lima, C S; Min, T; Streubel, B; Swansbury, J; Telford, N; Swanton, S; Bowen, A; Nagai, M; Catovsky, D; Fonatsch, C; Dyer, M J

    1999-07-01

    Abnormalities of chromosome band 13q14 occur in hematologic malignancies of all lineages and at all stages of differentiation. Unlike other chromosomal translocations, which are usually specific for a given lineage, the chromosomal translocation t(12;13)(p12;q14) has been observed in both B-cell and T-cell precursor acute lymphoblastic leukemia (BCP-, TCP-ALL), in differentiated and undifferentiated acute myeloblastic leukemia (AML), and in chronic myeloid leukemia (CML) at progression to blast crisis. The nature of these translocations and their pathologic consequences remain unknown. To begin to define the gene(s) involved on chromosome 13, we have performed fluorescence in situ hybridization (FISH) using a panel of YACs from the region, on a series of 10 cases of acute leukemia with t(12;13)(p12;q14) and 1 case each with "variant" translocations including t(12;13)(q21;q14), t(10;13)(q24;q14) and t(9;13)(p21;q14). In 8/13 cases/cell lines, the 13q14 break fell within a single 1.4 Mb CEPH MegaYAC. This YAC fell immediately telomeric of the forkhead (FKHR) gene, which is disrupted in the t(2;13)(q35;q14) seen in pediatric alveolar rhabdomyosarcoma. Seven of the 8 cases with breaks in this YAC were AML. In 4/13 cases, the 13q14 break fell within a 1.7-Mb YAC located about 3 Mb telomeric of the retinoblastoma (RB1) gene: all 4 cases were ALL. One case of myelodysplastic syndrome exhibited a break within 13q12, adjacent to the BRCA2 gene. These data indicate the presence of myeloid- and lymphoid-specific breakpoint cluster regions within chromosome band 13q14 in acute leukemia.

  14. Active role of a human genomic insert in replication of a yeast artificial chromosome.

    Science.gov (United States)

    van Brabant, A J; Fangman, W L; Brewer, B J

    1999-06-01

    Yeast artificial chromosomes (YACs) are a common tool for cloning eukaryotic DNA. The manner by which large pieces of foreign DNA are assimilated by yeast cells into a functional chromosome is poorly understood, as is the reason why some of them are stably maintained and some are not. We examined the replication of a stable YAC containing a 240-kb insert of DNA from the human T-cell receptor beta locus. The human insert contains multiple sites that serve as origins of replication. The activity of these origins appears to require the yeast ARS consensus sequence and, as with yeast origins, additional flanking sequences. In addition, the origins in the human insert exhibit a spacing, a range of activation efficiencies, and a variation in times of activation during S phase similar to those found for normal yeast chromosomes. We propose that an appropriate combination of replication origin density, activation times, and initiation efficiencies is necessary for the successful maintenance of YAC inserts.

  15. Branched polynomial covering maps

    DEFF Research Database (Denmark)

    Hansen, Vagn Lundsgaard

    1999-01-01

    A Weierstrass polynomial with multiple roots in certain points leads to a branched covering map. With this as the guiding example, we formally define and study the notion of a branched polynomial covering map. We shall prove that many finite covering maps are polynomial outside a discrete branch...... set. Particular studies are made of branched polynomial covering maps arising from Riemann surfaces and from knots in the 3-sphere....

  16. Mean species cover: a harmonized indicator of shrub cover for forest inventories

    Science.gov (United States)

    Iciar Alberdi; Sonia Condés; Ronald E. Mcroberts; Susanne Winter

    2018-01-01

    Because shrub cover is related to many forest ecosystem functions, it is one of the most relevant variables for describing these communities. Nevertheless, a harmonized indicator of shrub cover for large-scale reporting is lacking. The aims of the study were threefold: to define a shrub indicator that can be used by European countries for harmonized shrub cover...

  17. Features of the organization of bread wheat chromosome 5BS based on physical mapping.

    Science.gov (United States)

    Salina, Elena A; Nesterov, Mikhail A; Frenkel, Zeev; Kiseleva, Antonina A; Timonova, Ekaterina M; Magni, Federica; Vrána, Jan; Šafář, Jan; Šimková, Hana; Doležel, Jaroslav; Korol, Abraham; Sergeeva, Ekaterina M

    2018-02-09

    The IWGSC strategy for construction of the reference sequence of the bread wheat genome is based on first obtaining physical maps of the individual chromosomes. Our aim is to develop and use the physical map for analysis of the organization of the short arm of wheat chromosome 5B (5BS) which bears a number of agronomically important genes, including genes conferring resistance to fungal diseases. A physical map of the 5BS arm (290 Mbp) was constructed using restriction fingerprinting and LTC software for contig assembly of 43,776 BAC clones. The resulting physical map covered ~ 99% of the 5BS chromosome arm (111 scaffolds, N50 = 3.078 Mb). SSR, ISBP and zipper markers were employed for anchoring the BAC clones, and from these 722 novel markers were developed based on previously obtained data from partial sequencing of 5BS. The markers were mapped using a set of Chinese Spring (CS) deletion lines, and F2 and RICL populations from a cross of CS and CS-5B dicoccoides. Three approaches have been used for anchoring BAC contigs on the 5BS chromosome, including clone-by-clone screening of BACs, GenomeZipper analysis, and comparison of BAC-fingerprints with in silico fingerprinting of 5B pseudomolecules of T. dicoccoides. These approaches allowed us to reach a high level of BAC contig anchoring: 96% of 5BS BAC contigs were located on 5BS. An interesting pattern was revealed in the distribution of contigs along the chromosome. Short contigs (200-999 kb) containing markers for the regions interrupted by tandem repeats, were mainly localized to the 5BS subtelomeric block; whereas the distribution of larger 1000-3500 kb contigs along the chromosome better correlated with the distribution of the regions syntenic to rice, Brachypodium, and sorghum, as detected by the Zipper approach. The high fingerprinting quality, LTC software and large number of BAC clones selected by the informative markers in screening of the 43,776 clones allowed us to significantly increase the

  18. Land-cover change detection

    Science.gov (United States)

    Chen, Xuexia; Giri, Chandra; Vogelmann, James

    2012-01-01

    Land cover is the biophysical material on the surface of the earth. Land-cover types include grass, shrubs, trees, barren, water, and man-made features. Land cover changes continuously.  The rate of change can be either dramatic and abrupt, such as the changes caused by logging, hurricanes and fire, or subtle and gradual, such as regeneration of forests and damage caused by insects (Verbesselt et al., 2001).  Previous studies have shown that land cover has changed dramatically during the past sevearal centuries and that these changes have severely affected our ecosystems (Foody, 2010; Lambin et al., 2001). Lambin and Strahlers (1994b) summarized five types of cause for land-cover changes: (1) long-term natural changes in climate conditions, (2) geomorphological and ecological processes, (3) human-induced alterations of vegetation cover and landscapes, (4) interannual climate variability, and (5) human-induced greenhouse effect.  Tools and techniques are needed to detect, describe, and predict these changes to facilitate sustainable management of natural resources.

  19. Evaluation of stress tolerance and fermentative behavior of indigenous Saccharomyces cerevisiae

    Directory of Open Access Journals (Sweden)

    Cíntia Lacerda Ramos

    2013-09-01

    Full Text Available Sixty six indigenous Saccharomyces cerevisiae strains were evaluated in stressful conditions (temperature, osmolarity, sulphite and ethanol tolerance and also ability to flocculate. Eighteen strains showed tolerant characteristics to these stressful conditions, growing at 42 ºC, in 0.04% sulphite, 1 mol L-1 NaCl and 12% ethanol. No flocculent characteristics were observed. These strains were evaluated according to their fermentative performance in sugar cane juice. The conversion factors of substrates into ethanol (Yp/s, glycerol (Yg/s and acetic acid (Yac/s, were calculated. The highest values of Yp/s in sugar cane juice fermentation were obtained by four strains, one isolated from fruit (0.46 and the others from sugar cane (0.45, 0.44 and 0.43. These values were higher than the value obtained using traditional yeast (0.38 currently employed in the Brazilian bioethanol industry. The parameters Yg/s and Yac/s were low for all strains. The UFLA FW221 presented the higher values for parameter related to bioethanol production. Thus, it was tested in co-culture with Lactobacillus fermentum. Besides this, a 20-L vessel for five consecutive batches of fermentation was performed. This strain was genetically stable and remained viable during all batches, producing high amounts of ethanol. The UFLA FW221 isolated from fruit was suitable to produce bioethanol in sugar cane juice. Therefore, the study of the biodiversity of yeasts from different environmental can reveal strains with desired characteristics to industrial applications.

  20. 77 FR 48733 - Transitional Program for Covered Business Method Patents-Definitions of Covered Business Method...

    Science.gov (United States)

    2012-08-14

    ... Office 37 CFR Part 42 Transitional Program for Covered Business Method Patents--Definitions of Covered... Business Method Patents-- Definitions of Covered Business Method Patent and Technological Invention AGENCY... forth in detail the definitions of the terms ``covered business method patent'' and ``technological...

  1. Covering folded shapes

    Directory of Open Access Journals (Sweden)

    Oswin Aichholzer

    2014-05-01

    Full Text Available Can folding a piece of paper flat make it larger? We explore whether a shape S must be scaled to cover a flat-folded copy of itself. We consider both single folds and arbitrary folds (continuous piecewise isometries \\(S\\to\\mathbb{R}^2\\. The underlying problem is motivated by computational origami, and is related to other covering and fixturing problems, such as Lebesgue's universal cover problem and force closure grasps. In addition to considering special shapes (squares, equilateral triangles, polygons and disks, we give upper and lower bounds on scale factors for single folds of convex objects and arbitrary folds of simply connected objects.

  2. A contig-based strategy for the genome-wide discovery of microRNAs without complete genome resources.

    Directory of Open Access Journals (Sweden)

    Jun-Zhi Wen

    Full Text Available MicroRNAs (miRNAs are important regulators of many cellular processes and exist in a wide range of eukaryotes. High-throughput sequencing is a mainstream method of miRNA identification through which it is possible to obtain the complete small RNA profile of an organism. Currently, most approaches to miRNA identification rely on a reference genome for the prediction of hairpin structures. However, many species of economic and phylogenetic importance are non-model organisms without complete genome sequences, and this limits miRNA discovery. Here, to overcome this limitation, we have developed a contig-based miRNA identification strategy. We applied this method to a triploid species of edible banana (GCTCV-119, Musa spp. AAA group and identified 180 pre-miRNAs and 314 mature miRNAs, which is three times more than those were predicted by the available dataset-based methods (represented by EST+GSS. Based on the recently published miRNA data set of Musa acuminate, the recall rate and precision of our strategy are estimated to be 70.6% and 92.2%, respectively, significantly better than those of EST+GSS-based strategy (10.2% and 50.0%, respectively. Our novel, efficient and cost-effective strategy facilitates the study of the functional and evolutionary role of miRNAs, as well as miRNA-based molecular breeding, in non-model species of economic or evolutionary interest.

  3. Land cover and water yield: inference problems when comparing catchments with mixed land cover

    Directory of Open Access Journals (Sweden)

    A. I. J. M. van Dijk

    2012-09-01

    Full Text Available Controlled experiments provide strong evidence that changing land cover (e.g. deforestation or afforestation can affect mean catchment streamflow (Q. By contrast, a similarly strong influence has not been found in studies that interpret Q from multiple catchments with mixed land cover. One possible reason is that there are methodological issues with the way in which the Budyko framework was used in the latter type studies. We examined this using Q data observed in 278 Australian catchments and by making inferences from synthetic Q data simulated by a hydrological process model (the Australian Water Resources Assessment system Landscape model. The previous contrasting findings could be reproduced. In the synthetic experiment, the land cover influence was still present but not accurately detected with the Budyko- framework. Likely sources of interpretation bias demonstrated include: (i noise in land cover, precipitation and Q data; (ii additional catchment climate characteristics more important than land cover; and (iii covariance between Q and catchment attributes. These methodological issues caution against the use of a Budyko framework to quantify a land cover influence in Q data from mixed land-cover catchments. Importantly, however, our findings do not rule out that there may also be physical processes that modify the influence of land cover in mixed land-cover catchments. Process model simulations suggested that lateral water redistribution between vegetation types and recirculation of intercepted rainfall may be important.

  4. Armored Geomembrane Cover Engineering

    Directory of Open Access Journals (Sweden)

    Kevin Foye

    2011-06-01

    Full Text Available Geomembranes are an important component of modern engineered barriers to prevent the infiltration of stormwater and runoff into contaminated soil and rock as well as waste containment facilities—a function generally described as a geomembrane cover. This paper presents a case history involving a novel implementation of a geomembrane cover system. Due to this novelty, the design engineers needed to assemble from disparate sources the design criteria for the engineering of the cover. This paper discusses the design methodologies assembled by the engineering team. This information will aid engineers designing similar cover systems as well as environmental and public health professionals selecting site improvements that involve infiltration barriers.

  5. Chromosome region-specific libraries for human genome analysis. Final progress report, 1 March 1991--28 February 1994

    Energy Technology Data Exchange (ETDEWEB)

    Kao, F.T.

    1994-04-01

    The objectives of this grant proposal include (1) development of a chromosome microdissection and PCR-mediated microcloning technology, (2) application of this microtechnology to the construction of region-specific libraries for human genome analysis. During this grant period, the authors have successfully developed this microtechnology and have applied it to the construction of microdissection libraries for the following chromosome regions: a whole chromosome 21 (21E), 2 region-specific libraries for the long arm of chromosome 2, 2q35-q37 (2Q1) and 2q33-q35 (2Q2), and 4 region-specific libraries for the entire short arm of chromosome 2, 2p23-p25 (2P1), 2p21-p23 (2P2), 2p14-p16 (wP3) and 2p11-p13 (2P4). In addition, 20--40 unique sequence microclones have been isolated and characterized for genomic studies. These region-specific libraries and the single-copy microclones from the library have been used as valuable resources for (1) isolating microsatellite probes in linkage analysis to further refine the disease locus; (2) isolating corresponding clones with large inserts, e.g. YAC, BAC, P1, cosmid and phage, to facilitate construction of contigs for high resolution physical mapping; and (3) isolating region-specific cDNA clones for use as candidate genes. These libraries are being deposited in the American Type Culture Collection (ATCC) for general distribution.

  6. MANAGEMENT EFFECTS ON GROUND COVER CLUMPINESS: SCALING FROM FIELD TO SENTINEL-2 COVER ESTIMATES

    Directory of Open Access Journals (Sweden)

    P. Scarth

    2017-11-01

    Full Text Available Significant progress has been made in the development of cover data and derived products based on remotely sensed fractional cover information and field data across Australia, and these cover data sets are now used for quantifying and monitoring grazing land condition. The availability of a dense time-series of nearly 30 years of cover data to describe the spatial and temporal patterns in landscape changes over time can help with monitoring the effectiveness of grazing land management practice change. With the advent of higher spatial resolution data, such as that provided by the Copernicus Sentinel 2 series of satellites, we can look beyond reporting purely on cover amount and more closely at the operational monitoring and reporting on spatial arrangement of cover and its links with land condition. We collected high spatial resolution cover transects at 20 cm intervals over the Wambiana grazing trials in the Burdekin catchment in Queensland, Australia. Spatial variance analysis was used to determine the cover autocorrelation at various support intervals. Coincident Sentinel-2 imagery was collected and processed over all the sites providing imagery to link with the field data. We show that the spatial arrangement and temporal dynamics of cover are important indicators of grazing land condition for both productivity and water quality outcomes. The metrics and products derived from this research will assist land managers to prioritize investment and practice change strategies for long term sustainability and improved water quality, particularly in the Great Barrier Reef catchments.

  7. Landfill covers for dry environments

    International Nuclear Information System (INIS)

    Dwyer, S.F.

    1996-01-01

    A large-scale landfill cover field test is currently underway at Sandia National Laboratories in Albuquerque, New Mexico. It is intended to compare and document the performance of alternative landfill cover technologies of various costs and complexities for interim stabilization and/or final closure of landfills in arid and semi-arid environments. Test plots of traditional designs recommended by the US Environmental Protection Agency for both RCRA Subtitle open-quote C close-quote and open-quote D close-quote regulated facilities have been constructed side-by-side with the alternative covers and will serve as baselines for comparison to these alternative covers. The alternative covers were designed specifically for dry environments. The covers will be tested under both ambient and stressed conditions. All covers have been instrumented to measure water balance variables and soil temperature. An on-site weather station records all pertinent climatological data. A key to acceptance of an alternative environmental technology is seeking regulatory acceptance and eventual permitting. The lack of acceptance by regulatory agencies is a significant barrier to development and implementation of innovative cover technologies. Much of the effort on this demonstration has been toward gaining regulatory and public acceptance

  8. On approximating restricted cycle covers

    NARCIS (Netherlands)

    Manthey, Bodo

    2008-01-01

    A cycle cover of a graph is a set of cycles such that every vertex is part of exactly one cycle. An $L$-cycle cover is a cycle cover in which the length of every cycle is in the set $L$. The weight of a cycle cover of an edge-weighted graph is the sum of the weights of its edges. We come close to

  9. Constraining eye movement in individuals with Parkinson's disease during walking turns.

    Science.gov (United States)

    Ambati, V N Pradeep; Saucedo, Fabricio; Murray, Nicholas G; Powell, Douglas W; Reed-Jones, Rebecca J

    2016-10-01

    Walking and turning is a movement that places individuals with Parkinson's disease (PD) at increased risk for fall-related injury. However, turning is an essential movement in activities of daily living, making up to 45 % of the total steps taken in a given day. Hypotheses regarding how turning is controlled suggest an essential role of anticipatory eye movements to provide feedforward information for body coordination. However, little research has investigated control of turning in individuals with PD with specific consideration for eye movements. The purpose of this study was to examine eye movement behavior and body segment coordination in individuals with PD during walking turns. Three experimental groups, a group of individuals with PD, a group of healthy young adults (YAC), and a group of healthy older adults (OAC), performed walking and turning tasks under two visual conditions: free gaze and fixed gaze. Whole-body motion capture and eye tracking characterized body segment coordination and eye movement behavior during walking trials. Statistical analysis revealed significant main effects of group (PD, YAC, and OAC) and visual condition (free and fixed gaze) on timing of segment rotation and horizontal eye movement. Within group comparisons, revealed timing of eye and head movement was significantly different between the free and fixed gaze conditions for YAC (p  0.05). In addition, while intersegment timings (reflecting segment coordination) were significantly different for YAC and OAC during free gaze (p training programs for those with PD, possibly promoting better coordination during turning and potentially reducing the risk of falls.

  10. A segment of the apospory-specific genomic region is highly microsyntenic not only between the apomicts Pennisetum squamulatum and buffelgrass, but also with a rice chromosome 11 centromeric-proximal genomic region.

    Science.gov (United States)

    Gualtieri, Gustavo; Conner, Joann A; Morishige, Daryl T; Moore, L David; Mullet, John E; Ozias-Akins, Peggy

    2006-03-01

    Bacterial artificial chromosome (BAC) clones from apomicts Pennisetum squamulatum and buffelgrass (Cenchrus ciliaris), isolated with the apospory-specific genomic region (ASGR) marker ugt197, were assembled into contigs that were extended by chromosome walking. Gene-like sequences from contigs were identified by shotgun sequencing and BLAST searches, and used to isolate orthologous rice contigs. Additional gene-like sequences in the apomicts' contigs were identified by bioinformatics using fully sequenced BACs from orthologous rice contigs as templates, as well as by interspecies, whole-contig cross-hybridizations. Hierarchical contig orthology was rapidly assessed by constructing detailed long-range contig molecular maps showing the distribution of gene-like sequences and markers, and searching for microsyntenic patterns of sequence identity and spatial distribution within and across species contigs. We found microsynteny between P. squamulatum and buffelgrass contigs. Importantly, this approach also enabled us to isolate from within the rice (Oryza sativa) genome contig Rice A, which shows the highest microsynteny and is most orthologous to the ugt197-containing C1C buffelgrass contig. Contig Rice A belongs to the rice genome database contig 77 (according to the current September 12, 2003, rice fingerprint contig build) that maps proximal to the chromosome 11 centromere, a feature that interestingly correlates with the mapping of ASGR-linked BACs proximal to the centromere or centromere-like sequences. Thus, relatedness between these two orthologous contigs is supported both by their molecular microstructure and by their centromeric-proximal location. Our discoveries promote the use of a microsynteny-based positional-cloning approach using the rice genome as a template to aid in constructing the ASGR toward the isolation of genes underlying apospory.

  11. A Segment of the Apospory-Specific Genomic Region Is Highly Microsyntenic Not Only between the Apomicts Pennisetum squamulatum and Buffelgrass, But Also with a Rice Chromosome 11 Centromeric-Proximal Genomic Region1[W

    Science.gov (United States)

    Gualtieri, Gustavo; Conner, Joann A.; Morishige, Daryl T.; Moore, L. David; Mullet, John E.; Ozias-Akins, Peggy

    2006-01-01

    Bacterial artificial chromosome (BAC) clones from apomicts Pennisetum squamulatum and buffelgrass (Cenchrus ciliaris), isolated with the apospory-specific genomic region (ASGR) marker ugt197, were assembled into contigs that were extended by chromosome walking. Gene-like sequences from contigs were identified by shotgun sequencing and BLAST searches, and used to isolate orthologous rice contigs. Additional gene-like sequences in the apomicts' contigs were identified by bioinformatics using fully sequenced BACs from orthologous rice contigs as templates, as well as by interspecies, whole-contig cross-hybridizations. Hierarchical contig orthology was rapidly assessed by constructing detailed long-range contig molecular maps showing the distribution of gene-like sequences and markers, and searching for microsyntenic patterns of sequence identity and spatial distribution within and across species contigs. We found microsynteny between P. squamulatum and buffelgrass contigs. Importantly, this approach also enabled us to isolate from within the rice (Oryza sativa) genome contig Rice A, which shows the highest microsynteny and is most orthologous to the ugt197-containing C1C buffelgrass contig. Contig Rice A belongs to the rice genome database contig 77 (according to the current September 12, 2003, rice fingerprint contig build) that maps proximal to the chromosome 11 centromere, a feature that interestingly correlates with the mapping of ASGR-linked BACs proximal to the centromere or centromere-like sequences. Thus, relatedness between these two orthologous contigs is supported both by their molecular microstructure and by their centromeric-proximal location. Our discoveries promote the use of a microsynteny-based positional-cloning approach using the rice genome as a template to aid in constructing the ASGR toward the isolation of genes underlying apospory. PMID:16415213

  12. Completion of the National Land Cover Database (NLCD) 1992-2001 Land Cover Change Retrofit Product

    Science.gov (United States)

    The Multi-Resolution Land Characteristics Consortium has supported the development of two national digital land cover products: the National Land Cover Dataset (NLCD) 1992 and National Land Cover Database (NLCD) 2001. Substantial differences in imagery, legends, and methods betwe...

  13. Climate Impacts of Cover Crops

    Science.gov (United States)

    Lombardozzi, D.; Wieder, W. R.; Bonan, G. B.; Morris, C. K.; Grandy, S.

    2016-12-01

    Cover crops are planted in agricultural rotation with the intention of protecting soil rather than harvest. Cover crops have numerous environmental benefits that include preventing soil erosion, increasing soil fertility, and providing weed and pest control- among others. In addition to localized environmental benefits, cover crops can have important regional or global biogeochemical impacts by increasing soil organic carbon, changing emissions of greenhouse trace gases like nitrous oxide and methane, and reducing hydrologic nitrogen losses. Cover crops may additionally affect climate by changing biogeophysical processes, like albedo and latent heat flux, though these potential changes have not yet been evaluated. Here we use the coupled Community Atmosphere Model (CAM5) - Community Land Model (CLM4.5) to test how planting cover crops in the United States may change biogeophysical fluxes and climate. We present seasonal changes in albedo, heat fluxes, evaporative partitioning, radiation, and the resulting changes in temperature. Preliminary analyses show that during seasons when cover crops are planted, latent heat flux increases and albedo decreases, changing the evaporative fraction and surface temperatures. Understanding both the biogeophysical changes caused by planting cover crops in this study and the biogeochemical changes found in other studies will give a clearer picture of the overall impacts of cover crops on climate and atmospheric chemistry, informing how this land use strategy will impact climate in the future.

  14. AcEST: [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2194Contig1 771 2 Adiantum capillus-veneris contig: CL2194contig1 sequence. Link to clone list...apillus-veneris contig: CL2194contig1 sequence. Link to clone list Link to clone list Clone ID BP915172 DK95

  15. Completion of the National Land Cover Database (NLCD) 1992–2001 Land Cover Change Retrofit product

    Science.gov (United States)

    Fry, J.A.; Coan, Michael; Homer, Collin G.; Meyer, Debra K.; Wickham, J.D.

    2009-01-01

    The Multi-Resolution Land Characteristics Consortium has supported the development of two national digital land cover products: the National Land Cover Dataset (NLCD) 1992 and National Land Cover Database (NLCD) 2001. Substantial differences in imagery, legends, and methods between these two land cover products must be overcome in order to support direct comparison. The NLCD 1992-2001 Land Cover Change Retrofit product was developed to provide more accurate and useful land cover change data than would be possible by direct comparison of NLCD 1992 and NLCD 2001. For the change analysis method to be both national in scale and timely, implementation required production across many Landsat Thematic Mapper (TM) and Enhanced Thematic Mapper Plus (ETM+) path/rows simultaneously. To meet these requirements, a hybrid change analysis process was developed to incorporate both post-classification comparison and specialized ratio differencing change analysis techniques. At a resolution of 30 meters, the completed NLCD 1992-2001 Land Cover Change Retrofit product contains unchanged pixels from the NLCD 2001 land cover dataset that have been cross-walked to a modified Anderson Level I class code, and changed pixels labeled with a 'from-to' class code. Analysis of the results for the conterminous United States indicated that about 3 percent of the land cover dataset changed between 1992 and 2001.

  16. The physical and genetic framework of the maize B73 genome.

    Directory of Open Access Journals (Sweden)

    Fusheng Wei

    2009-11-01

    Full Text Available Maize is a major cereal crop and an important model system for basic biological research. Knowledge gained from maize research can also be used to genetically improve its grass relatives such as sorghum, wheat, and rice. The primary objective of the Maize Genome Sequencing Consortium (MGSC was to generate a reference genome sequence that was integrated with both the physical and genetic maps. Using a previously published integrated genetic and physical map, combined with in-coming maize genomic sequence, new sequence-based genetic markers, and an optical map, we dynamically picked a minimum tiling path (MTP of 16,910 bacterial artificial chromosome (BAC and fosmid clones that were used by the MGSC to sequence the maize genome. The final MTP resulted in a significantly improved physical map that reduced the number of contigs from 721 to 435, incorporated a total of 8,315 mapped markers, and ordered and oriented the majority of FPC contigs. The new integrated physical and genetic map covered 2,120 Mb (93% of the 2,300-Mb genome, of which 405 contigs were anchored to the genetic map, totaling 2,103.4 Mb (99.2% of the 2,120 Mb physical map. More importantly, 336 contigs, comprising 94.0% of the physical map ( approximately 1,993 Mb, were ordered and oriented. Finally we used all available physical, sequence, genetic, and optical data to generate a golden path (AGP of chromosome-based pseudomolecules, herein referred to as the B73 Reference Genome Sequence version 1 (B73 RefGen_v1.

  17. Automatic design of magazine covers

    Science.gov (United States)

    Jahanian, Ali; Liu, Jerry; Tretter, Daniel R.; Lin, Qian; Damera-Venkata, Niranjan; O'Brien-Strain, Eamonn; Lee, Seungyon; Fan, Jian; Allebach, Jan P.

    2012-03-01

    In this paper, we propose a system for automatic design of magazine covers that quantifies a number of concepts from art and aesthetics. Our solution to automatic design of this type of media has been shaped by input from professional designers, magazine art directors and editorial boards, and journalists. Consequently, a number of principles in design and rules in designing magazine covers are delineated. Several techniques are derived and employed in order to quantify and implement these principles and rules in the format of a software framework. At this stage, our framework divides the task of design into three main modules: layout of magazine cover elements, choice of color for masthead and cover lines, and typography of cover lines. Feedback from professional designers on our designs suggests that our results are congruent with their intuition.

  18. Do cover crop mixtures have the same ability to suppress weeds as competitive monoculture cover crops?

    Directory of Open Access Journals (Sweden)

    Brust, Jochen

    2014-02-01

    Full Text Available An increasing number of farmers use cover crop mixtures instead of monoculture cover crops to improve soil and crop quality. However, only little information is available about the weed suppression ability of cover crop mixtures. Therefore, two field experiments were conducted in Baden-Württemberg between 2010 and 2012, to compare growth and weed suppression of monoculture cover crops and cover crop mixtures. In the first experiment, heterogeneous results between yellow mustard and the cover crop mixture occurred. For further research, a field experiment was conducted in 2012 to compare monocultures of yellow mustard and hemp with three cover crop mixtures. The evaluated mixtures were: “MELO”: for soil melioration; “BETA”: includes only plant species with no close relation to main cash crops in Central Europe and “GPS”: for usage as energy substrate in spring. Yellow mustard, MELO, BETA and GPS covered 90% of the soil in less than 42 days and were able to reduce photosynthetically active radiation (PAR on soil surface by more than 96% after 52 days. Hemp covered 90% of the soil after 47 days and reduced PAR by 91% after 52 days. Eight weeks after planting, only BETA showed similar growth to yellow mustard which produced the highest dry matter. The GPS mixture had comparatively poor growth, while MELO produced similar dry matter to hemp. Yellow mustard, MELO and BETA reduced weed growth by 96% compared with a no cover crop control, while hemp and GPS reduced weeds by 85% and 79%. In spring, weed dry matter was reduced by more than 94% in plots with yellow mustard and all mixtures, while in hemp plots weeds were only reduced by 71%. The results suggest that the tested cover crop mixtures offer similar weed suppression ability until spring as the monoculture of the competitive yellow mustard.

  19. Gainesville's urban forest canopy cover

    Science.gov (United States)

    Francisco Escobedo; Jennifer A. Seitz; Wayne Zipperer

    2009-01-01

    Ecosystem benefits from trees are linked directly to the amount of healthy urban forest canopy cover. Urban forest cover is dynamic and changes over time due to factors such as urban development, windstorms, tree removals, and growth. The amount of a city's canopy cover depends on its land use, climate, and people's preferences. This fact sheet examines how...

  20. Mapping land cover through time with the Rapid Land Cover Mapper—Documentation and user manual

    Science.gov (United States)

    Cotillon, Suzanne E.; Mathis, Melissa L.

    2017-02-15

    The Rapid Land Cover Mapper is an Esri ArcGIS® Desktop add-in, which was created as an alternative to automated or semiautomated mapping methods. Based on a manual photo interpretation technique, the tool facilitates mapping over large areas and through time, and produces time-series raster maps and associated statistics that characterize the changing landscapes. The Rapid Land Cover Mapper add-in can be used with any imagery source to map various themes (for instance, land cover, soils, or forest) at any chosen mapping resolution. The user manual contains all essential information for the user to make full use of the Rapid Land Cover Mapper add-in. This manual includes a description of the add-in functions and capabilities, and step-by-step procedures for using the add-in. The Rapid Land Cover Mapper add-in was successfully used by the U.S. Geological Survey West Africa Land Use Dynamics team to accurately map land use and land cover in 17 West African countries through time (1975, 2000, and 2013).

  1. Climate under cover

    CERN Document Server

    Takakura, Tadashi

    2002-01-01

    1.1. INTRODUCTION Plastic covering, either framed or floating, is now used worldwide to protect crops from unfavorable growing conditions, such as severe weather and insects and birds. Protected cultivation in the broad sense, including mulching, has been widely spread by the innovation of plastic films. Paper, straw, and glass were the main materials used before the era of plastics. Utilization of plastics in agriculture started in the developed countries and is now spreading to the developing countries. Early utilization of plastic was in cold regions, and plastic was mainly used for protection from the cold. Now plastic is used also for protection from wind, insects and diseases. The use of covering techniques started with a simple system such as mulching, then row covers and small tunnels were developed, and finally plastic houses. Floating mulch was an exception to this sequence: it was introduced rather recently, although it is a simple structure. New development of functional and inexpensive films trig...

  2. Alternative cover design

    International Nuclear Information System (INIS)

    1988-11-01

    The special study on Alternative Cover Designs is one of several studies initiated by the US Department of Energy (DOE) in response to the proposed US Environmental Protection Agency (EPA) groundwater standards. The objective of this study is to investigate the possibility of minimizing the infiltration of precipitation through stabilized tailings piles by altering the standard design of covers currently used on the Uranium Mill Tailings Remedial Action (UMTRA) Project. Prior. to the issuance of the proposed standards, UMTRA Project piles had common design elements to meet the required criteria, the most important of which were for radon diffusion, long-term stability, erosion protection, and groundwater protection. The standard pile covers consisted of three distinct layers. From top to bottom they were: rock for erosion protection; a sand bedding layer; and the radon barrier, usually consisting of a clayey sand material, which also functioned to limit infiltration into the tailings. The piles generally had topslopes from 2 to 4 percent and sideslopes of 20 percent

  3. Benthic Cover

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Benthic cover (habitat) maps are derived from aerial imagery, underwater photos, acoustic surveys, and data gathered from sediment samples. Shallow to moderate-depth...

  4. Special study on vegetative covers

    International Nuclear Information System (INIS)

    1988-11-01

    This report describes the findings of a special study on the use of vegetative covers to stabilize tailings piles for the Uranium Mill Tailings Remedial Action (UMTRA) Project. The principal rationale for using plants would be to establish a dynamic system for controlling water balance. Specifically, vegetation would be used to intercept and transpire precipitation to the atmosphere, rather than allowing water to drain into the tailings and mobilize contaminants. This would facilitate compliance with groundwater standards proposed for the UMTRA Project by the Environmental Protection Agency. The goals of the study were to evaluate the feasibility of using vegetative covers on UMTRA Project piles, define the advantages and disadvantages of vegetative covers, and develop general guidelines for their use when such use seems reasonable. The principal method for the study was to analyze and apply to the UMTRA Project the results of research programs on vegetative covers at other US Department of Energy (DOE) waste management facilities. The study also relied upon observations made of existing stabilized piles at UMTRA Project sites where natural vegetation is growing on the rock-covered surfaces. Water balance and erosion models were also used to quantify the long-term performance of vegetative covers planned for the topslopes of stabilized piles at Grand Junction and Durango, Colorado, two UMTRA Project sites where the decision was made during the course of this special study to use vegetative covers. Elements in the design and construction of the vegetative covers at these two sites are discussed in the report, with explanations of the differing features that reflect differing environmental conditions. 28 refs., 18 figs., 9 tabs

  5. Evaluation of burial ground soil covers

    International Nuclear Information System (INIS)

    Fenimore, J.W.

    1976-11-01

    Solid radioactive waste burial at the Savannah River Plant between 1955 and 1972 filled a 76-acre site. Burial operations then were shifted to an adjacent site, and a program was begun to develop a land cover that would: (1) minimize soil erosion; and (2) protect the buried waste from deep-rooted plants, since radionuclides can be recycled by uptake through root systems. In anticipation of the need for a suitable soil cover, five grass species were planted on 20 plots (4 plots of each species) at the burial ground (Facility 643-G) in 1969. The grass plots were planted for evaluation of viability, root depth, and erosion protection existing under conditions of low fertility and minimum care. In addition, 16 different artificial soil covers were installed on 32 plots (each cover on two plots) to evaluate: (1) resistance of cover to deterioration from weathering; (2) resistance of cover to encroachment by deep-rooted plants; and (3) soil erosion protection provided by the cover. All test plots were observed and photographed in 1970 and in 1974. After both grass and artificial soil covers were tested five years, the following results were observed: Pensacola Bahia grass was the best of the five cover grasses tested; and fifteen of the sixteen artificial covers that were tested controlled vegetation growth and soil erosion. Photographs of the test plots will be retaken at five-year intervals for future documentation

  6. Optimal shortening of uniform covering arrays.

    Directory of Open Access Journals (Sweden)

    Jose Torres-Jimenez

    Full Text Available Software test suites based on the concept of interaction testing are very useful for testing software components in an economical way. Test suites of this kind may be created using mathematical objects called covering arrays. A covering array, denoted by CA(N; t, k, v, is an N × k array over [Formula: see text] with the property that every N × t sub-array covers all t-tuples of [Formula: see text] at least once. Covering arrays can be used to test systems in which failures occur as a result of interactions among components or subsystems. They are often used in areas such as hardware Trojan detection, software testing, and network design. Because system testing is expensive, it is critical to reduce the amount of testing required. This paper addresses the Optimal Shortening of Covering ARrays (OSCAR problem, an optimization problem whose objective is to construct, from an existing covering array matrix of uniform level, an array with dimensions of (N - δ × (k - Δ such that the number of missing t-tuples is minimized. Two applications of the OSCAR problem are (a to produce smaller covering arrays from larger ones and (b to obtain quasi-covering arrays (covering arrays in which the number of missing t-tuples is small to be used as input to a meta-heuristic algorithm that produces covering arrays. In addition, it is proven that the OSCAR problem is NP-complete, and twelve different algorithms are proposed to solve it. An experiment was performed on 62 problem instances, and the results demonstrate the effectiveness of solving the OSCAR problem to facilitate the construction of new covering arrays.

  7. Influence of cover defects on the attenuation of radon with earthen covers

    International Nuclear Information System (INIS)

    Kalkwarf, D.R.; Mayer, D.W.

    1983-11-01

    Experimental and theoretical evaluations of radon flux through laboratory-scale defective soil columns are presented together with a survey of literature on the formation and prevention of defects in soil covers. This report focuses on air-filled, centimeter-scale defects that are most probable in earthen covers for attenuating radon emission from uranium-mill tailings. Examples include shirnkage and erosion cracks, erosion piping, animal burrows and air channels formed by the biodegradation of vegetation roots. Calculations based on mathematical models indicate that collections of defects which could increase the radon flux from an earthen cover by a factor of two would be easily detected by visual inspection. However, these models ignore air-turbulence in the defect and drying of the soil around the defect. Laboratory measurements showed that turbulent diffusion of radon occurred through defects as narrow as 0.3 cm when subjected to a transverse air velocity of 1 to 6 miles per hour at the surface. Both turbulence and more-rapid drying of soil can accelerate radon flux to the cover surface. Consequently, recommended methods to inhibit defect formation should be applied. 29 references, 3 figures, 5 tables

  8. [Snow cover pollution monitoring in Ufa].

    Science.gov (United States)

    Daukaev, R A; Suleĭmanov, R A

    2008-01-01

    The paper presents the results of examining the snow cover polluted with heavy metals in the large industrial town of Ufa. The level of man-caused burden on the snow cover of the conventional parts of the town was estimated and compared upon exposure to a wide range of snow cover pollutants. The priority snow cover pollutants were identified among the test heavy metals.

  9. Dicty_cDB: CHA362 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP

  10. Combinatorial aspects of covering arrays

    Directory of Open Access Journals (Sweden)

    Charles J. Colbourn

    2004-11-01

    Full Text Available Covering arrays generalize orthogonal arrays by requiring that t -tuples be covered, but not requiring that the appearance of t -tuples be balanced.Their uses in screening experiments has found application in software testing, hardware testing, and a variety of fields in which interactions among factors are to be identified. Here a combinatorial view of covering arrays is adopted, encompassing basic bounds, direct constructions, recursive constructions, algorithmic methods, and applications.

  11. Forest Cover Estimation in Ireland Using Radar Remote Sensing: A Comparative Analysis of Forest Cover Assessment Methodologies

    Science.gov (United States)

    Devaney, John; Barrett, Brian; Barrett, Frank; Redmond, John; O`Halloran, John

    2015-01-01

    Quantification of spatial and temporal changes in forest cover is an essential component of forest monitoring programs. Due to its cloud free capability, Synthetic Aperture Radar (SAR) is an ideal source of information on forest dynamics in countries with near-constant cloud-cover. However, few studies have investigated the use of SAR for forest cover estimation in landscapes with highly sparse and fragmented forest cover. In this study, the potential use of L-band SAR for forest cover estimation in two regions (Longford and Sligo) in Ireland is investigated and compared to forest cover estimates derived from three national (Forestry2010, Prime2, National Forest Inventory), one pan-European (Forest Map 2006) and one global forest cover (Global Forest Change) product. Two machine-learning approaches (Random Forests and Extremely Randomised Trees) are evaluated. Both Random Forests and Extremely Randomised Trees classification accuracies were high (98.1–98.5%), with differences between the two classifiers being minimal (forest area and an increase in overall accuracy of SAR-derived forest cover maps. All forest cover products were evaluated using an independent validation dataset. For the Longford region, the highest overall accuracy was recorded with the Forestry2010 dataset (97.42%) whereas in Sligo, highest overall accuracy was obtained for the Prime2 dataset (97.43%), although accuracies of SAR-derived forest maps were comparable. Our findings indicate that spaceborne radar could aid inventories in regions with low levels of forest cover in fragmented landscapes. The reduced accuracies observed for the global and pan-continental forest cover maps in comparison to national and SAR-derived forest maps indicate that caution should be exercised when applying these datasets for national reporting. PMID:26262681

  12. Dicty_cDB: CHR241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

  13. Covered Bridge Security Manual

    Science.gov (United States)

    Brett Phares; Terry Wipf; Ryan Sievers; Travis Hosteng

    2013-01-01

    The design, construction, and use of covered timber bridges is all but a lost art in these days of pre-stressed concrete, high-performance steel, and the significant growth both in the volume and size of vehicles. Furthermore, many of the existing covered timber bridges are preserved only because of their status on the National Registry of Historic Places or the...

  14. Summary of decontamination cover manufacturing experience

    International Nuclear Information System (INIS)

    Ulrich, G.B.; Berry, H.W.

    1995-02-01

    Decontamination cover forming cracks and vent cup assembly leaks through the decontamination covers were early manufacturing problems. The decontamination cover total manufacturing process yield was as low as 55%. Applicable tooling and procedures were examined. All manufacturing steps from foil fabrication to final assembly leak testing were considered as possible causes or contributing factors to these problems. The following principal changes were made to correct these problems: (1) the foil annealing temperature was reduced from 1375 degrees to 1250 degrees C, (2) the decontamination cover fabrication procedure (including visual inspection for surface imperfections and elimination of superfluous operations) was improved, (3) the postforming dye penetrant inspection procedure was revised for increased sensitivity, (4) a postforming (prewelding) 1250 degrees C/1 h vacuum stress-relief operation was added, (5) a poststress relief (prewelding) decontamination cover piece-part leak test was implemented, (6) the hold-down fixture used during the decontamination cover-to-cup weld was modified, and concomitantly, and (7) the foil fabrication process was changed from the extruding and rolling of 63-mm-diam vacuum arc-remelted ingots (extrusion process) to the rolling of 19-mm-square arc-melted drop castings (drop cast process). Since these changes were incorporated, the decontamination cover total manufacturing process yield has been 91 %. Most importantly, more than 99% of the decontamination covers welded onto vent cup assemblies were acceptable. The drastic yield improvement is attributed primarily to the change in the foil annealing temperature from 1375 degrees to 1250 degrees C and secondarily to the improvements in the decontamination cover fabrication procedure

  15. Sensitivity of selected landscape pattern metrics to land-cover misclassification and differences in land-cover composition

    Science.gov (United States)

    James D. Wickham; Robert V. O' Neill; Kurt H. Riitters; Timothy G. Wade; K. Bruce Jones

    1997-01-01

    Calculation of landscape metrics from land-cover data is becoming increasingly common. Some studies have shown that these measurements are sensitive to differences in land-cover composition, but none are known to have tested also their a sensitivity to land-cover misclassification. An error simulation model was written to test the sensitivity of selected land-scape...

  16. Integrated physical map of bread wheat chromosome arm 7DS to facilitate gene cloning and comparative studies.

    Science.gov (United States)

    Tulpová, Zuzana; Luo, Ming-Cheng; Toegelová, Helena; Visendi, Paul; Hayashi, Satomi; Vojta, Petr; Paux, Etienne; Kilian, Andrzej; Abrouk, Michaël; Bartoš, Jan; Hajdúch, Marián; Batley, Jacqueline; Edwards, David; Doležel, Jaroslav; Šimková, Hana

    2018-03-08

    Bread wheat (Triticum aestivum L.) is a staple food for a significant part of the world's population. The growing demand on its production can be satisfied by improving yield and resistance to biotic and abiotic stress. Knowledge of the genome sequence would aid in discovering genes and QTLs underlying these traits and provide a basis for genomics-assisted breeding. Physical maps and BAC clones associated with them have been valuable resources from which to generate a reference genome of bread wheat and to assist map-based gene cloning. As a part of a joint effort coordinated by the International Wheat Genome Sequencing Consortium, we have constructed a BAC-based physical map of bread wheat chromosome arm 7DS consisting of 895 contigs and covering 94% of its estimated length. By anchoring BAC contigs to one radiation hybrid map and three high resolution genetic maps, we assigned 73% of the assembly to a distinct genomic position. This map integration, interconnecting a total of 1713 markers with ordered and sequenced BAC clones from a minimal tiling path, provides a tool to speed up gene cloning in wheat. The process of physical map assembly included the integration of the 7DS physical map with a whole-genome physical map of Aegilops tauschii and a 7DS Bionano genome map, which together enabled efficient scaffolding of physical-map contigs, even in the non-recombining region of the genetic centromere. Moreover, this approach facilitated a comparison of bread wheat and its ancestor at BAC-contig level and revealed a reconstructed region in the 7DS pericentromere. Copyright © 2018. Published by Elsevier B.V.

  17. Allegheny County Land Cover Areas

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — The Land Cover dataset demarcates 14 land cover types by area; such as Residential, Commercial, Industrial, Forest, Agriculture, etc. If viewing this description on...

  18. Geometric covers, graph orientations, counter games

    DEFF Research Database (Denmark)

    Berglin, Edvin

    -directed graph is dynamic (can be altered by some outside actor), some orientations may need to be reversed in order to maintain the low out-degree. We present a new algorithm that is simpler than earlier work, yet matches or outperforms the efficiency of these results with very few exceptions. Counter games...... example is Line Cover, also known as Point-Line Cover, where a set of points in a geometric space are to be covered by placing a restricted number of lines. We present new FPT algorithms for the sub-family Curve Cover (which includes Line Cover), as well as for Hyperplane Cover restricted to R 3 (i...... are a type of abstract game played over a set of counters holding values, and these values may be moved between counters according to some set of rules. Typically they are played between two players: the adversary who tries to concentrate the greatest value possible in a single counter, and the benevolent...

  19. A globally complete map of supraglacial debris cover and a new toolkit for debris cover research

    Science.gov (United States)

    Herreid, Sam; Pellicciotti, Francesca

    2017-04-01

    A growing canon of literature is focused on resolving the processes and implications of debris cover on glaciers. However, this work is often confined to a handful of glaciers that were likely selected based on criteria optimizing their suitability to test a specific hypothesis or logistical ease. The role of debris cover in a glacier system is likely to not go overlooked in forthcoming research, yet the magnitude of this role at a global scale has not yet been fully described. Here, we present a map of debris cover for all glacierized regions on Earth including the Greenland Ice Sheet using 30 m Landsat data. This dataset will begin to open a wider context to the high quality, localized findings from the debris-covered glacier research community and help inform large-scale modeling efforts. A global map of debris cover also facilitates analysis attempting to isolate first order geomorphological and climate controls of supraglacial debris production. Furthering the objective of expanding the inclusion of debris cover in forthcoming research, we also present an under development suite of open-source, Python based tools. Requiring minimal and often freely available input data, we have automated the mapping of: i) debris cover, ii) ice cliffs, iii) debris cover evolution over the Landsat era and iv) glacier flow instabilities from altered debris structures. At the present time, debris extent is the only globally complete quantity but with the expanding repository of high quality global datasets and further tool development minimizing manual tasks and computational cost, we foresee all of these tools being applied globally in the near future.

  20. Tools to covisualize and coanalyze proteomic data with genomes and transcriptomes: validation of genes and alternative mRNA splicing.

    Science.gov (United States)

    Pang, Chi Nam Ignatius; Tay, Aidan P; Aya, Carlos; Twine, Natalie A; Harkness, Linda; Hart-Smith, Gene; Chia, Samantha Z; Chen, Zhiliang; Deshpande, Nandan P; Kaakoush, Nadeem O; Mitchell, Hazel M; Kassem, Moustapha; Wilkins, Marc R

    2014-01-03

    Direct links between proteomic and genomic/transcriptomic data are not frequently made, partly because of lack of appropriate bioinformatics tools. To help address this, we have developed the PG Nexus pipeline. The PG Nexus allows users to covisualize peptides in the context of genomes or genomic contigs, along with RNA-seq reads. This is done in the Integrated Genome Viewer (IGV). A Results Analyzer reports the precise base position where LC-MS/MS-derived peptides cover genes or gene isoforms, on the chromosomes or contigs where this occurs. In prokaryotes, the PG Nexus pipeline facilitates the validation of genes, where annotation or gene prediction is available, or the discovery of genes using a "virtual protein"-based unbiased approach. We illustrate this with a comprehensive proteogenomics analysis of two strains of Campylobacter concisus . For higher eukaryotes, the PG Nexus facilitates gene validation and supports the identification of mRNA splice junction boundaries and splice variants that are protein-coding. This is illustrated with an analysis of splice junctions covered by human phosphopeptides, and other examples of relevance to the Chromosome-Centric Human Proteome Project. The PG Nexus is open-source and available from https://github.com/IntersectAustralia/ap11_Samifier. It has been integrated into Galaxy and made available in the Galaxy tool shed.

  1. A Scaffold Analysis Tool Using Mate-Pair Information in Genome Sequencing

    Directory of Open Access Journals (Sweden)

    Pan-Gyu Kim

    2008-01-01

    Full Text Available We have developed a Windows-based program, ConPath, as a scaffold analyzer. ConPath constructs scaffolds by ordering and orienting separate sequence contigs by exploiting the mate-pair information between contig-pairs. Our algorithm builds directed graphs from link information and traverses them to find the longest acyclic graphs. Using end read pairs of fixed-sized mate-pair libraries, ConPath determines relative orientations of all contigs, estimates the gap size of each adjacent contig pair, and reports wrong assembly information by validating orientations and gap sizes. We have utilized ConPath in more than 10 microbial genome projects, including Mannheimia succiniciproducens and Vibro vulnificus, where we verified contig assembly and identified several erroneous contigs using the four types of error defined in ConPath. Also, ConPath supports some convenient features and viewers that permit investigation of each contig in detail; these include contig viewer, scaffold viewer, edge information list, mate-pair list, and the printing of complex scaffold structures.

  2. On numerically pluricanonical cyclic coverings

    International Nuclear Information System (INIS)

    Kulikov, V S; Kharlamov, V M

    2014-01-01

    We investigate some properties of cyclic coverings f:Y→X (where X is a complex surface of general type) branched along smooth curves B⊂X that are numerically equivalent to a multiple of the canonical class of X. Our main results concern coverings of surfaces of general type with p g =0 and Miyaoka-Yau surfaces. In particular, such coverings provide new examples of multi-component moduli spaces of surfaces with given Chern numbers and new examples of surfaces that are not deformation equivalent to their complex conjugates

  3. Measuring and analyzing urban tree cover

    Science.gov (United States)

    David J. Nowak; Rowan A. Rowntree; E. Gregory McPherson; Susan M. Sisinni; Esther R. Kirkmann; Jack C. Stevens

    1996-01-01

    Measurement of city tree cover can aid in urban vegetation planning, management, and research by revealing characteristics of vegetation across a city. Urban tree cover in the United States ranges from 0.4% in Lancaster, California, to 55% in Baton Rouge, Louisiana. Two important factors that affect the amount of urban tree cover are the natural environment and land...

  4. Quantization of noncompact coverings and its physical applications

    Science.gov (United States)

    Ivankov, Petr

    2018-02-01

    A rigorous algebraic definition of noncommutative coverings is developed. In the case of commutative algebras this definition is equivalent to the classical definition of topological coverings of locally compact spaces. The theory has following nontrivial applications: • Coverings of continuous trace algebras, • Coverings of noncommutative tori, • Coverings of the quantum SU(2) group, • Coverings of foliations, • Coverings of isospectral deformations of Spin - manifolds. The theory supplies the rigorous definition of noncommutative Wilson lines.

  5. Percent Forest Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — Forests provide economic and ecological value. High percentages of forest cover (FORPCT) generally indicate healthier ecosystems and cleaner surface water. More...

  6. Land cover fire proneness in Europe

    Directory of Open Access Journals (Sweden)

    Mario Gonzalez Pereira

    2014-12-01

    Full Text Available Aim of study: This study aims to identify and characterize the spatial and temporal evolution of the types of vegetation that are most affected by forest fires in Europe. The characterization of the fuels is an important issue of the fire regime in each specific ecosystem while, on the other hand, fire is an important disturbance for global vegetation dynamics.Area of study: Southern European countries: Portugal, Spain, France, Italy and Greece.Material and Methods: Corine Land Cover maps for 2000 and 2006 (CLC2000, CLC2006 and burned area (BA perimeters, from 2000 to 2013 in Europe are combined to access the spatial and temporal evolution of the types of vegetation that are most affected by wild fires using descriptive statistics and Geographical Information System (GIS techniques.Main results: The spatial and temporal distribution of BA perimeters, vegetation and burnt vegetation by wild fires was performed and different statistics were obtained for Mediterranean and entire Europe, confirming the usefulness of the proposed land cover system. A fire proneness index is proposed to assess the fire selectivity of land cover classes. The index allowed to quantify and to compare the propensity of vegetation classes and countries to fire.Research highlights: The usefulness and efficiency of the land cover classification scheme and fire proneness index. The differences between northern Europe and southern Europe and among the Mediterranean region in what concerns to vegetation cover, fire incidence, area burnt in land cover classes and fire proneness between classes for the different countries.Keywords: Fire proneness; Mixed forests; Land cover/land use; Fire regime; Europe; GIS; Corine land cover. 

  7. Scenarios of land cover in China

    Science.gov (United States)

    Yue, Tian Xiang; Fan, Ze Meng; Liu, Ji Yuan

    2007-02-01

    A method for surface modeling of land cover change (SMLC) is developed on the basis of establishing transition probability matrixes between land cover types and HLZ types. SMLC is used to simulate land cover scenarios of China for the years 2039, 2069 and 2099, for which HLZ scenarios are first simulated in terms of HadCM3 climatic scenarios that are downscaled in zonal model of spatial climate change in China. This paper also analyzes spatial distribution of land cover types, area change and mean center shift of each land cover type, ecotope diversity, and patch connectivity under the land cover scenarios. The results show that cultivated land would decrease and woodland would expand greatly with climatic change, which coincides with consequences expected by implementation of Grain-for-Green policy. Nival area would shrink, and desertification area would expand at a comparatively slow rate in future 100 years. Climate change would generally cause less ecotope diversity and more patch connectivity. Ecosystems in China would have a pattern of beneficial cycle after efficient ecological conservation and restoration. However, if human activities would exceed regulation capacity of ecosystems themselves, the ecosystems in China might deteriorate more seriously.

  8. Mapping of Micro-Tom BAC-End Sequences to the Reference Tomato Genome Reveals Possible Genome Rearrangements and Polymorphisms

    Science.gov (United States)

    Asamizu, Erika; Shirasawa, Kenta; Hirakawa, Hideki; Sato, Shusei; Tabata, Satoshi; Yano, Kentaro; Ariizumi, Tohru; Shibata, Daisuke; Ezura, Hiroshi

    2012-01-01

    A total of 93,682 BAC-end sequences (BESs) were generated from a dwarf model tomato, cv. Micro-Tom. After removing repetitive sequences, the BESs were similarity searched against the reference tomato genome of a standard cultivar, “Heinz 1706.” By referring to the “Heinz 1706” physical map and by eliminating redundant or nonsignificant hits, 28,804 “unique pair ends” and 8,263 “unique ends” were selected to construct hypothetical BAC contigs. The total physical length of the BAC contigs was 495, 833, 423 bp, covering 65.3% of the entire genome. The average coverage of euchromatin and heterochromatin was 58.9% and 67.3%, respectively. From this analysis, two possible genome rearrangements were identified: one in chromosome 2 (inversion) and the other in chromosome 3 (inversion and translocation). Polymorphisms (SNPs and Indels) between the two cultivars were identified from the BLAST alignments. As a result, 171,792 polymorphisms were mapped on 12 chromosomes. Among these, 30,930 polymorphisms were found in euchromatin (1 per 3,565 bp) and 140,862 were found in heterochromatin (1 per 2,737 bp). The average polymorphism density in the genome was 1 polymorphism per 2,886 bp. To facilitate the use of these data in Micro-Tom research, the BAC contig and polymorphism information are available in the TOMATOMICS database. PMID:23227037

  9. CLC2000 land cover database of the Netherlands; monitoring land cover changes between 1986 and 2000

    OpenAIRE

    Hazeu, G.W.

    2003-01-01

    The 1986 CORINE land cover database of the Netherlands was revised and updated on basis of Landsat satellite images and ancillary data. Interpretation of satellite images from 1986 and 2000 resulted in the CLC2000, CLC1986rev and CLCchange databases. A standard European legend and production methodology was applied. Thirty land cover classes were discerned. Most extended land cover types were pastures (231), arable land (211) and complex cultivation patterns (242). Between 1986 and 2000 aroun...

  10. Carbon Assessment of Hawaii Land Cover Map (CAH_LandCover)

    Data.gov (United States)

    Department of the Interior — While there have been many maps produced that depict vegetation for the state of Hawai‘i only a few of these display land cover for all of the main Hawaiian Islands,...

  11. The art of the cover.

    Science.gov (United States)

    Porter, Nora

    2017-07-01

    Often, it's difficult to match up our cover artwork with the subjects of our lead articles and special reports. Of necessity, we sometimes turn to pure abstraction. How else to illustrate technical policy articles on subjects such as changing research protocols or informed consent, or abstract ideas like congruence, duality, imbalance, causality? At such times, we have to be pretty creative, and my search for cover art can be long and challenging. In the end, we hope that the reader will make the connection between cover and content. However, at other times, the subject of a lead article or special report overflows with artistic possibilities. © 2017 The Hastings Center.

  12. The Regional Land Cover Monitoring System: Building regional capacity through innovative land cover mapping approaches

    Science.gov (United States)

    Saah, D.; Tenneson, K.; Hanh, Q. N.; Aekakkararungroj, A.; Aung, K. S.; Goldstein, J.; Cutter, P. G.; Maus, P.; Markert, K. N.; Anderson, E.; Ellenburg, W. L.; Ate, P.; Flores Cordova, A. I.; Vadrevu, K.; Potapov, P.; Phongsapan, K.; Chishtie, F.; Clinton, N.; Ganz, D.

    2017-12-01

    Earth observation and Geographic Information System (GIS) tools, products, and services are vital to support the environmental decision making by governmental institutions, non-governmental agencies, and the general public. At the heart of environmental decision making is the monitoring land cover and land use change (LCLUC) for land resource planning and for ecosystem services, including biodiversity conservation and resilience to climate change. A major challenge for monitoring LCLUC in developing regions, such as Southeast Asia, is inconsistent data products at inconsistent intervals that have different typologies across the region and are typically made in without stakeholder engagement or input. Here we present the Regional Land Cover Monitoring System (RLCMS), a novel land cover mapping effort for Southeast Asia, implemented by SERVIR-Mekong, a joint NASA-USAID initiative that brings Earth observations to improve environmental decision making in developing countries. The RLCMS focuses on mapping biophysical variables (e.g. canopy cover, tree height, or percent surface water) at an annual interval and in turn using those biophysical variables to develop land cover maps based on stakeholder definitions of land cover classes. This allows for flexible and consistent land cover classifications that can meet the needs of different institutions across the region. Another component of the RLCMS production is the stake-holder engagement through co-development. Institutions that directly benefit from this system have helped drive the development for regional needs leading to services for their specific uses. Examples of services for regional stakeholders include using the RLCMS to develop maps using the IPCC classification scheme for GHG emission reporting and developing custom annual maps as an input to hydrologic modeling/flood forecasting systems. In addition to the implementation of this system and the service stemming from the RLCMS in Southeast Asia, it is

  13. Using ASTER Imagery in Land Use/cover Classification of Eastern Mediterranean Landscapes According to CORINE Land Cover Project

    Directory of Open Access Journals (Sweden)

    Recep Gundogan

    2008-02-01

    Full Text Available The satellite imagery has been effectively utilized for classifying land covertypes and detecting land cover conditions. The Advanced Spaceborne Thermal Emissionand Reflection Radiometer (ASTER sensor imagery has been widely used in classificationprocess of land cover. However, atmospheric corrections have to be made by preprocessingsatellite sensor imagery since the electromagnetic radiation signals received by the satellitesensors can be scattered and absorbed by the atmospheric gases and aerosols. In this study,an ASTER sensor imagery, which was converted into top-of-atmosphere reflectance(TOA, was used to classify the land use/cover types, according to COoRdination ofINformation on the Environment (CORINE land cover nomenclature, for an arearepresenting the heterogonous characteristics of eastern Mediterranean regions inKahramanmaras, Turkey. The results indicated that using the surface reflectance data ofASTER sensor imagery can provide accurate (i.e. overall accuracy and kappa values of83.2% and 0.79, respectively and low-cost cover mapping as a part of inventory forCORINE Land Cover Project.

  14. Well-covered graphs and factors

    DEFF Research Database (Denmark)

    Randerath, Bert; Vestergaard, Preben D.

    2006-01-01

    A maximum independent set of vertices in a graph is a set of pairwise nonadjacent vertices of largest cardinality α. Plummer defined a graph to be well-covered, if every independent set is contained in a maximum independent set of G. Every well-covered graph G without isolated vertices has a perf...

  15. Percent Wetland Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — Wetlands act as filters, removing or diminishing the amount of pollutants that enter surface water. Higher values for percent of wetland cover (WETLNDSPCT) may be...

  16. Covering sources of toxic vapors with foam

    International Nuclear Information System (INIS)

    Aue, W. P.; Guidetti, F.

    2009-01-01

    In a case of chemical terrorism, first responders might well be confronted with a liquid source of toxic vapor which keeps spreading out its hazardous contents. With foam as an efficient and simple means, such a source could be covered up in seconds and the spread of vapors mitigated drastically. Once covered, the source could then wait for a longer time to be removed carefully and professionally by a decontamination team. In order to find foams useful for covering up toxic vapor sources, a large set of measurements has been performed in order to answer the following questions: - Which foams could be used for this purpose? - How thick should the foam cover be? - For how long would such a foam cover be effective? - Could the practical application of foam cause a spread of the toxic chemical? The toxic vapors sources included GB, GD and HD. Among the foams were 10 fire fighter foams (e.g. AFFF, protein) and the aqueous decontamination foam CASCAD. Small scale experiments showed that CASCAD is best suited for covering a toxic source; a 10 cm layer of it covers and decontaminates GB. The large scale experiments confirmed that any fire fighter foam is a suitable cover for a longer or shorter period.(author)

  17. Climatological determinants of woody cover in Africa

    OpenAIRE

    Good, Stephen P.; Caylor, Kelly K.

    2011-01-01

    Determining the factors that influence the distribution of woody vegetation cover and resolving the sensitivity of woody vegetation cover to shifts in environmental forcing are critical steps necessary to predict continental-scale responses of dryland ecosystems to climate change. We use a 6-year satellite data record of fractional woody vegetation cover and an 11-year daily precipitation record to investigate the climatological controls on woody vegetation cover across the African continent....

  18. Weed Control with Cover Crops in Irrigated Potatoes

    Directory of Open Access Journals (Sweden)

    G.H. Mehring

    2016-01-01

    Full Text Available Field experiments at Oakes, ND, USA in 2010 and Carrington, ND, USA in 2011 were conducted to evaluate the potential for cover crops grown in the Northern Great Plains, USA in order to reduce weed emergence and density in irrigated potatoes. Treatments included five cover crop treatments and three cover crop termination treatments. Termination of cover crops was done with glyphosate, disk-till, and roto-till. Cover crop biomass accumulation was greatest for rye/canola and triticale at Oakes, and hairy vetch and hairy vetch/rye at Carrington. Cover crop and termination affected weed control 14, 29, and 51 days after planting (DAP at Oakes. Weed control at Carrington was at least 90% for all cover crop and termination treatments at all three evaluation timings. Marketable yield at Oakes was greater when roto-till was used to terminate the cover crops compared with disk-till or herbicide, which is beneficial for organic systems where herbicides are not used. Marketable yield at Carrington was not affected by cover crop or termination treatments. Results suggest that cover crops can successfully be integrated into irrigated potato production for weed control with yields equal to no cover crop, and with attention to potential mechanical difficulties.

  19. Border Lakes land-cover classification

    Science.gov (United States)

    Marvin Bauer; Brian Loeffelholz; Doug. Shinneman

    2009-01-01

    This document contains metadata and description of land-cover classification of approximately 5.1 million acres of land bordering Minnesota, U.S.A. and Ontario, Canada. The classification focused on the separation and identification of specific forest-cover types. Some separation of the nonforest classes also was performed. The classification was derived from multi-...

  20. Cover times of random searches

    Science.gov (United States)

    Chupeau, Marie; Bénichou, Olivier; Voituriez, Raphaël

    2015-10-01

    How long must one undertake a random search to visit all sites of a given domain? This time, known as the cover time, is a key observable to quantify the efficiency of exhaustive searches, which require a complete exploration of an area and not only the discovery of a single target. Examples range from immune-system cells chasing pathogens to animals harvesting resources, from robotic exploration for cleaning or demining to the task of improving search algorithms. Despite its broad relevance, the cover time has remained elusive and so far explicit results have been scarce and mostly limited to regular random walks. Here we determine the full distribution of the cover time for a broad range of random search processes, including Lévy strategies, intermittent strategies, persistent random walks and random walks on complex networks, and reveal its universal features. We show that for all these examples the mean cover time can be minimized, and that the corresponding optimal strategies also minimize the mean search time for a single target, unambiguously pointing towards their robustness.

  1. Genomic Anatomy of a Premier Major Histocompatibility Complex Paralogous Region on Chromosome 1q21–q22

    Science.gov (United States)

    Shiina, Takashi; Ando, Asako; Suto, Yumiko; Kasai, Fumio; Shigenari, Atsuko; Takishima, Nobusada; Kikkawa, Eri; Iwata, Kyoko; Kuwano, Yuko; Kitamura, Yuka; Matsuzawa, Yumiko; Sano, Kazumi; Nogami, Masahiro; Kawata, Hisako; Li, Suyun; Fukuzumi, Yasuhito; Yamazaki, Masaaki; Tashiro, Hiroyuki; Tamiya, Gen; Kohda, Atsushi; Okumura, Katsuzumi; Ikemura, Toshimichi; Soeda, Eiichi; Mizuki, Nobuhisa; Kimura, Minoru; Bahram, Seiamak; Inoko, Hidetoshi

    2001-01-01

    Human chromosomes 1q21–q25, 6p21.3–22.2, 9q33–q34, and 19p13.1–p13.4 carry clusters of paralogous loci, to date best defined by the flagship 6p MHC region. They have presumably been created by two rounds of large-scale genomic duplications around the time of vertebrate emergence. Phylogenetically, the 1q21–25 region seems most closely related to the 6p21.3 MHC region, as it is only the MHC paralogous region that includes bona fide MHC class I genes, the CD1 and MR1 loci. Here, to clarify the genomic structure of this model MHC paralogous region as well as to gain insight into the evolutionary dynamics of the entire quadriplication process, a detailed analysis of a critical 1.7 megabase (Mb) region was performed. To this end, a composite, deep, YAC, BAC, and PAC contig encompassing all five CD1 genes and linking the centromeric +P5 locus to the telomeric KRTC7 locus was constructed. Within this contig a 1.1-Mb BAC and PAC core segment joining CD1D to FCER1A was fully sequenced and thoroughly analyzed. This led to the mapping of a total of 41 genes (12 expressed genes, 12 possibly expressed genes, and 17 pseudogenes), among which 31 were novel. The latter include 20 olfactory receptor (OR) genes, 9 of which are potentially expressed. Importantly, CD1, SPTA1, OR, and FCERIA belong to multigene families, which have paralogues in the other three regions. Furthermore, it is noteworthy that 12 of the 13 expressed genes in the 1q21–q22 region around the CD1 loci are immunologically relevant. In addition to CD1A-E, these include SPTA1, MNDA, IFI-16, AIM2, BL1A, FY and FCERIA. This functional convergence of structurally unrelated genes is reminiscent of the 6p MHC region, and perhaps represents the emergence of yet another antigen presentation gene cluster, in this case dedicated to lipid/glycolipid antigens rather than antigen-derived peptides. [The nucleotide sequence data reported in this paper have been submitted to the DDBJ, EMBL, and GenBank databases under

  2. Factors influencing radon attenuation by tailing covers

    International Nuclear Information System (INIS)

    Silker, W.B.; Rogers, V.C.

    1981-07-01

    The US NRC, in its Generic Environmental Impact Statement on uranium milling has specified that the radon flux escaping a uranium mill tailings pile will be reduced to pCi/m 2 s by application of covering layers of soils and clays. These covers present a radon diffusion barrier, which sufficiently increases the time required for radon passage from the tailings to the atmosphere to allow for decay of 222 Rn within the cover. The depth of cover necessary to reduce the escaping radon flux to the prescribed level is to be determined by calculation, and requires precise knowledge of the radon diffusion coefficient in the covering media. A Radon Attenuation Test Facility was developed to determine rates of radon diffusion through candidate cover materials. This paper describes this facility and its application for determining the influence of physical properties of the soil column on the radon diffusion coefficient

  3. Structural integrity assessment of HANARO pool cover

    International Nuclear Information System (INIS)

    Ryu, Jeong Soo

    2001-11-01

    This report is for the seismic analysis and the structural integrity evaluation of HANARO Pool Cover in accordances with the requirement of the Technical Specification for Seismic Analysis of HANARO Pool Cover. For performing the seismic analysis and evaluating the structural integrity for HANARO Pool Cover, the finite element analysis model using ANSYS 5.7 was developed and the dynamic characteristics were analyzed. The seismic response spectrum analyses of HANARO Pool Cover under the design floor response spectrum loads of OBE and SSE were performed. The analysis results show that the stress values in HANARO Pool Cover for the seismic loads are within the ASME Code limits. It is also confirmed that the fatigue usage factor is less than 1.0. Therefore any damage on structural integrity is not expected when an HANARO Pool Cover is installed in the upper part of the reactor pool

  4. On Covering Approximation Subspaces

    Directory of Open Access Journals (Sweden)

    Xun Ge

    2009-06-01

    Full Text Available Let (U';C' be a subspace of a covering approximation space (U;C and X⊂U'. In this paper, we show that and B'(X⊂B(X∩U'. Also, iff (U;C has Property Multiplication. Furthermore, some connections between outer (resp. inner definable subsets in (U;C and outer (resp. inner definable subsets in (U';C' are established. These results answer a question on covering approximation subspace posed by J. Li, and are helpful to obtain further applications of Pawlak rough set theory in pattern recognition and artificial intelligence.

  5. Germ line transmission of a yeast artificial chromosome spanning the murine [alpha][sub 1](I) collagen locus

    Energy Technology Data Exchange (ETDEWEB)

    Strauss, W.M.; Dausman, J.; Beard, C.; Jaenisch, R. (Massachusetts Inst. of Technology, Cambridge (United States)); Johnson, C.; Lawrence, J.B. (Univ. of Massachusetts Medical School, Worcester (United States))

    1993-03-26

    Molecular complementation of mutant phenotypes by transgenic technology is a potentially important tool for gene identification. A technology was developed to allow the transfer of a physically intact yeast artificial chromosome (YAC) into the germ line of the mouse. A purified 150-kilobase YAC encompassing the murine gene Col1a1 was efficiently introduced into embryonic stem (ES) cells via lipofection. Chimeric founder mice were derived from two transfected ES cell clones. These chimeras transmitted the full length transgene through the germ line, generating two transgenic mouse strains. Transgene expression was visualized as nascent transcripts in interphase nuclei and quantitated by ribonuclease protection analysis. Both assays indicated that the transgene was expressed at levels comparable to the endogenous collagen gene. 32 refs., 3 figs., 1 tab.

  6. Primary care for young adult cancer survivors: an international perspective

    DEFF Research Database (Denmark)

    Hølge-Hazelton, Bibi; Blake-Gumbs, Lyla; Miedema, Baujke

    2010-01-01

    health insurance in Denmark, The Netherlands, and Canada but not in the US. Once the YAC has completed acute treatment and follow-up care, they often return to the care of the FPs who may potentially be expected to deal with and take action upon any possible medical, mental health, and psychosocial...... issues the YA cancer patient may present with. The role of the FP in follow-up care seems to be very limited. CONCLUSIONS: YACs in the western world seem to have comparable medical and psychosocial problems. However, the nature of health insurance is such that it impacts differently on the care...... continuing medical education (CME) initiatives, and an enhanced cooperative effort between those delivering and coordinating cancer care....

  7. Mapping Forest Cover and Forest Cover Change with Airborne S-Band Radar

    Directory of Open Access Journals (Sweden)

    Ramesh K. Ningthoujam

    2016-07-01

    Full Text Available Assessments of forest cover, forest carbon stocks and carbon emissions from deforestation and degradation are increasingly important components of sustainable resource management, for combating biodiversity loss and in climate mitigation policies. Satellite remote sensing provides the only means for mapping global forest cover regularly. However, forest classification with optical data is limited by its insensitivity to three-dimensional canopy structure and cloud cover obscuring many forest regions. Synthetic Aperture Radar (SAR sensors are increasingly being used to mitigate these problems, mainly in the L-, C- and X-band domains of the electromagnetic spectrum. S-band has not been systematically studied for this purpose. In anticipation of the British built NovaSAR-S satellite mission, this study evaluates the benefits of polarimetric S-band SAR for forest characterisation. The Michigan Microwave Canopy Scattering (MIMICS-I radiative transfer model is utilised to understand the scattering mechanisms in forest canopies at S-band. The MIMICS-I model reveals strong S-band backscatter sensitivity to the forest canopy in comparison to soil characteristics across all polarisations and incidence angles. Airborne S-band SAR imagery over the temperate mixed forest of Savernake Forest in southern England is analysed for its information content. Based on the modelling results, S-band HH- and VV-polarisation radar backscatter and the Radar Forest Degradation Index (RFDI are used in a forest/non-forest Maximum Likelihood classification at a spatial resolution of 6 m (70% overall accuracy, κ = 0.41 and 20 m (63% overall accuracy, κ = 0.27. The conclusion is that S-band SAR such as from NovaSAR-S is likely to be suitable for monitoring forest cover and its changes.

  8. Land Use and Land Cover - MO 2015 Silver Land Cover (GDB)

    Data.gov (United States)

    NSGIC State | GIS Inventory — MoRAP produced and integrated data to map land cover and wetlands for the Upper Silver Creek Watershed in Illinois. LiDAR elevation and vegetation height information...

  9. Land Use and Land Cover - MO 2015 Meramec Land Cover (GDB)

    Data.gov (United States)

    NSGIC State | GIS Inventory — MoRAP produced and integrated data to map land cover and wetlands for the Meramec River bottomland in Missouri. LiDAR elevation and vegetation height information and...

  10. High Potential Source for Biomass Degradation Enzyme Discovery and Environmental Aspects Revealed through Metagenomics of Indian Buffalo Rumen

    Directory of Open Access Journals (Sweden)

    K. M. Singh

    2014-01-01

    Full Text Available The complex microbiomes of the rumen functions as an effective system for plant cell wall degradation, and biomass utilization provide genetic resource for degrading microbial enzymes that could be used in the production of biofuel. Therefore the buffalo rumen microbiota was surveyed using shot gun sequencing. This metagenomic sequencing generated 3.9 GB of sequences and data were assembled into 137270 contiguous sequences (contigs. We identified potential 2614 contigs encoding biomass degrading enzymes including glycoside hydrolases (GH: 1943 contigs, carbohydrate binding module (CBM: 23 contigs, glycosyl transferase (GT: 373 contigs, carbohydrate esterases (CE: 259 contigs, and polysaccharide lyases (PE: 16 contigs. The hierarchical clustering of buffalo metagenomes demonstrated the similarities and dissimilarity in microbial community structures and functional capacity. This demonstrates that buffalo rumen microbiome was considerably enriched in functional genes involved in polysaccharide degradation with great prospects to obtain new molecules that may be applied in the biofuel industry.

  11. A Novel Yeast Genomics Method for Identifying New Breast Cancer Susceptibility Genes

    National Research Council Canada - National Science Library

    Brown, J. M; Brown, James A

    2007-01-01

    ...) a hallmark of most breast cancers when deleted. Using a collection of yeast strains carrying the deletion of a unique open reading frame, we have transfected a yeast artificial chromosome (YAC...

  12. Updating the 2001 National Land Cover Database land cover classification to 2006 by using Landsat imagery change detection methods

    Science.gov (United States)

    Xian, George; Homer, Collin G.; Fry, Joyce

    2009-01-01

    The recent release of the U.S. Geological Survey (USGS) National Land Cover Database (NLCD) 2001, which represents the nation's land cover status based on a nominal date of 2001, is widely used as a baseline for national land cover conditions. To enable the updating of this land cover information in a consistent and continuous manner, a prototype method was developed to update land cover by an individual Landsat path and row. This method updates NLCD 2001 to a nominal date of 2006 by using both Landsat imagery and data from NLCD 2001 as the baseline. Pairs of Landsat scenes in the same season in 2001 and 2006 were acquired according to satellite paths and rows and normalized to allow calculation of change vectors between the two dates. Conservative thresholds based on Anderson Level I land cover classes were used to segregate the change vectors and determine areas of change and no-change. Once change areas had been identified, land cover classifications at the full NLCD resolution for 2006 areas of change were completed by sampling from NLCD 2001 in unchanged areas. Methods were developed and tested across five Landsat path/row study sites that contain several metropolitan areas including Seattle, Washington; San Diego, California; Sioux Falls, South Dakota; Jackson, Mississippi; and Manchester, New Hampshire. Results from the five study areas show that the vast majority of land cover change was captured and updated with overall land cover classification accuracies of 78.32%, 87.5%, 88.57%, 78.36%, and 83.33% for these areas. The method optimizes mapping efficiency and has the potential to provide users a flexible method to generate updated land cover at national and regional scales by using NLCD 2001 as the baseline.

  13. 1990 Kansas Land Cover Patterns Update

    Data.gov (United States)

    Kansas Data Access and Support Center — In 2008, an update of the 1990 Kansas Land Cover Patterns (KLCP) database was undertaken. The 1990 KLCP database depicts 10 general land cover classes for the State...

  14. VT National Land Cover Dataset - 2001

    Data.gov (United States)

    Vermont Center for Geographic Information — (Link to Metadata) The NLCD2001 layer available from VCGI is a subset of the the National Land Cover Database 2001 land cover layer for mapping zone 65 was produced...

  15. Weed Control with Cover Crops in Irrigated Potatoes

    OpenAIRE

    G.H. Mehring; J.E. Stenger; H.M. Hatterman-Valenti

    2016-01-01

    Field experiments at Oakes, ND, USA in 2010 and Carrington, ND, USA in 2011 were conducted to evaluate the potential for cover crops grown in the Northern Great Plains, USA in order to reduce weed emergence and density in irrigated potatoes. Treatments included five cover crop treatments and three cover crop termination treatments. Termination of cover crops was done with glyphosate, disk-till, and roto-till. Cover crop biomass accumulation was greatest for rye/canola and triticale at Oakes, ...

  16. Spatio-temporal change in forest cover and carbon storage considering actual and potential forest cover in South Korea.

    Science.gov (United States)

    Nam, Kijun; Lee, Woo-Kyun; Kim, Moonil; Kwak, Doo-Ahn; Byun, Woo-Hyuk; Yu, Hangnan; Kwak, Hanbin; Kwon, Taesung; Sung, Joohan; Chung, Dong-Jun; Lee, Seung-Ho

    2015-07-01

    This study analyzes change in carbon storage by applying forest growth models and final cutting age to actual and potential forest cover for six major tree species in South Korea. Using National Forest Inventory data, the growth models were developed to estimate mean diameter at breast height, tree height, and number of trees for Pinus densiflora, Pinus koraiensis, Pinus rigida, Larix kaempferi, Castanea crenata and Quercus spp. stands. We assumed that actual forest cover in a forest type map will change into potential forest covers according to the Hydrological and Thermal Analogy Groups model. When actual forest cover reaches the final cutting age, forest volume and carbon storage are estimated by changed forest cover and its growth model. Forest volume between 2010 and 2110 would increase from 126.73 to 157.33 m(3) hm(-2). Our results also show that forest cover, volume, and carbon storage could abruptly change by 2060. This is attributed to the fact that most forests are presumed to reach final cutting age. To avoid such dramatic change, a regeneration and yield control scheme should be prepared and implemented in a way that ensures balance in forest practice and yield.

  17. Babes and boobs? analysis of JAMA cover art.

    Science.gov (United States)

    Clark, J P

    To determine the representation of the sexes in JAMA cover art. Review of 50 consecutive issues. JAMA, March 1997-March 1998. Numbers and nature of covers portraying men and women. Of the 50 covers, 34 depicted humans. 15 depicted women, 13 men, and 6 were of mixed or indeterminate sex. 11 pictures of women included a child and five included nudity. One cover showed a man with a child (not as a father) and none depicted nudity. Men were depicted exclusively in authoritative roles. Much of the cover art gives strong messages about sexual stereotypes that are inappropriate in modern society. JAMA should consider reviewing its policy for choosing cover art.

  18. Covering of the electric power service

    International Nuclear Information System (INIS)

    Unidad de Planeacion Minero Energetica, UPME

    2000-01-01

    In this article it is sought to deepen more in the topic of the covering of the electric power service, especially in the related with the mechanisms that could facilitate their amplification. In the new market outline, in the one that the participation of the agents is encouraged in all the activities of the chain of services in which the state is not direct lender of the same one, it is confused the form like a covering will be achieved that is of agreement with the goals that intend in the national plan of development and in the sub sectorial plans. Although the rules of the market one comes consolidating, the process of linking of the private capital, especially in the distribution activity, it evidences the importance of to settle down and to define responsibilities and explicit mechanisms in the topic of expansion of the covering. A first interpretation of the ruled indicates the obligation of the state of extending the covering to 100% and of assuming the projects that don't undertake the matters. This would be the reading from the traditional mentality. However, the regulation of you public services of electricity don't demand a total covering, but rather it covers to the users that have the capacity to assume, with their own resources, the efficient costs of benefit. The service will also be lent to residential users that don't have payment capacity, when there are contribution resources or fiscal resources for subsidiary

  19. Towards realistic Holocene land cover scenarios: integration of archaeological, palynological and geomorphological records and comparison to global land cover scenarios.

    Science.gov (United States)

    De Brue, Hanne; Verstraeten, Gert; Broothaerts, Nils; Notebaert, Bastiaan

    2016-04-01

    Accurate and spatially explicit landscape reconstructions for distinct time periods in human history are essential for the quantification of the effect of anthropogenic land cover changes on, e.g., global biogeochemical cycles, ecology, and geomorphic processes, and to improve our understanding of interaction between humans and the environment in general. A long-term perspective covering Mid and Late Holocene land use changes is recommended in this context, as it provides a baseline to evaluate human impact in more recent periods. Previous efforts to assess the evolution and intensity of agricultural land cover in past centuries or millennia have predominantly focused on palynological records. An increasing number of quantitative techniques has been developed during the last two decades to transfer palynological data to land cover estimates. However, these techniques have to deal with equifinality issues and, furthermore, do not sufficiently allow to reconstruct spatial patterns of past land cover. On the other hand, several continental and global databases of historical anthropogenic land cover changes based on estimates of global population and the required agricultural land per capita have been developed in the past decennium. However, at such long temporal and spatial scales, reconstruction of past anthropogenic land cover intensities and spatial patterns necessarily involves many uncertainties and assumptions as well. Here, we present a novel approach that combines archaeological, palynological and geomorphological data for the Dijle catchment in the central Belgium Loess Belt in order to arrive at more realistic Holocene land cover histories. Multiple land cover scenarios (> 60.000) are constructed using probabilistic rules and used as input into a sediment delivery model (WaTEM/SEDEM). Model outcomes are confronted with a detailed geomorphic dataset on Holocene sediment fluxes and with REVEALS based estimates of vegetation cover using palynological data from

  20. The National Land Cover Database

    Science.gov (United States)

    Homer, Collin G.; Fry, Joyce A.; Barnes, Christopher A.

    2012-01-01

    The National Land Cover Database (NLCD) serves as the definitive Landsat-based, 30-meter resolution, land cover database for the Nation. NLCD provides spatial reference and descriptive data for characteristics of the land surface such as thematic class (for example, urban, agriculture, and forest), percent impervious surface, and percent tree canopy cover. NLCD supports a wide variety of Federal, State, local, and nongovernmental applications that seek to assess ecosystem status and health, understand the spatial patterns of biodiversity, predict effects of climate change, and develop land management policy. NLCD products are created by the Multi-Resolution Land Characteristics (MRLC) Consortium, a partnership of Federal agencies led by the U.S. Geological Survey. All NLCD data products are available for download at no charge to the public from the MRLC Web site: http://www.mrlc.gov.

  1. Land cover changes in central Sonora Mexico

    Science.gov (United States)

    Diego Valdez-Zamudio; Alejandro Castellanos-Villegas; Stuart Marsh

    2000-01-01

    Remote sensing techniques have been demonstrated to be very effective tools to help detect, analyze, and evaluate land cover changes in natural areas of the world. Changes in land cover can generally be attributed to either natural or anthropogenic forces. Multitemporal satellite imagery and airborne videography were used to detect, analyze, and evaluate land cover...

  2. An experimental study on the low-dose radiosensitivity of tumor cell lines

    International Nuclear Information System (INIS)

    Kim, Min Sook; Koh, Kwang Joon

    1994-01-01

    The purpose of this study was to aid in the radiation therapy of head and neck cancer patients. For this study, radiation survival curves were generated for B16, MG-63 and YAC-1 cell lines using semiautomated MTT assay and Dye Exclusion Assay. Irradiation of 2, 4, 6, 8, 10 Gy were delivered at room temperature at a dose rate of 210.2 cGy/min using 60 COγ-ray irradiator ALDORADO 8. The viable cells were determined for each radiation dose and compared to control values. The obtained results were as follows: 1. The was significantly different absorbance at 10 Gy on B16 cell line in MTT assay (P<0.05). 2. There was significantly different absorbance at 4, 6, 8, 10 Gy on MG-63 cell line in MTT assay (P<0.05). 3. YAC-1 cell line was more sensitive than B16 or MG-63 cell line to all doses of radiation (P<0.05). 4. There was significantly different absorbance among all tumor cell lines except between B16 and MG-63 cell line at 2 Gy in MTT assay (P<0.05). 5. Good correlation was obtained between MTT assay and DEA (P<0.05). The efficient of correlation of B16, MG-63 and YAC-1 cell line was 0.845-0.824 and 0.906, respectively.

  3. Enhanced lysis of herpes simplex virus type 1-infected mouse cell lines by NC and NK effectors

    Energy Technology Data Exchange (ETDEWEB)

    Colmenares, C.; Lopez, C.

    1986-05-01

    Spontaneously cytotoxic murine lymphocytes lysed certain cell types infected by herpes simplex virus type 1 (HSV-1) better than uninfected cells. Although HSV-1 adsorbed to the surface of all the target cells, those in which the virus replicated more efficiently were lysed to a greater extent. As targets, the authors used cell lines that, when uninfected, were spontaneously lysed by NK cells (YAC-1) or by NC cells (WEHI-164). They also used a fibroblastoid cell line (M50) and a monocytic tumor line (PU51R), which were not spontaneously killed. NK cells lysed HSV-1-infected YAC cells better than uninfected cells, and an NC-like activity selectively lysed HSV-1-infected WEHI cells. These findings were consistent with the results of experiments performed to define the role of interferon in induction of virus-augmented cytolysis. Increased lysis of YAC-HSV and PU51R-HSV was entirely due to interferon activation and was completely abolished by performing the /sup 51/Cr-release assay in the presence of anti-interferon serum. The data show that HSV-1 infection of NK/NC targets induces increased cytotoxity, but the effector cell responsible for lysis is determined by the uninfected target, or by an interaction between the virus and target cell, rather than by a viral determinant alone.

  4. On the Structure of Covers of Sofic Shifts

    DEFF Research Database (Denmark)

    Johansen, Rune

    2011-01-01

    A canonical cover generalizing the left Fischer cover to arbitrary sofic shifts is introduced and used to prove that the left Krieger cover and the past set cover of a sofic shift can be divided into natural layers. These results are used to find the range of a flow-invariant and to investigate t...

  5. AsMA journal covers, a history.

    Science.gov (United States)

    Day, Pamela C

    2014-01-01

    The cover of our journal has changed quite often over the years. As we look forward to changing the name and design of the journal, it seems appropriate to reflect on the previous journal titles and covers. A brief history follows.

  6. Modeling percent tree canopy cover: a pilot study

    Science.gov (United States)

    John W. Coulston; Gretchen G. Moisen; Barry T. Wilson; Mark V. Finco; Warren B. Cohen; C. Kenneth Brewer

    2012-01-01

    Tree canopy cover is a fundamental component of the landscape, and the amount of cover influences fire behavior, air pollution mitigation, and carbon storage. As such, efforts to empirically model percent tree canopy cover across the United States are a critical area of research. The 2001 national-scale canopy cover modeling and mapping effort was completed in 2006,...

  7. Infinity-Norm Permutation Covering Codes from Cyclic Groups

    OpenAIRE

    Karni, Ronen; Schwartz, Moshe

    2017-01-01

    We study covering codes of permutations with the $\\ell_\\infty$-metric. We provide a general code construction, which uses smaller building-block codes. We study cyclic transitive groups as building blocks, determining their exact covering radius, and showing linear-time algorithms for finding a covering codeword. We also bound the covering radius of relabeled cyclic transitive groups under conjugation.

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB568 (Link to dictyBase) - G23244 DDB0217993 Contig-U02062-1...ary VF (Link to library) Clone ID VFB568 (Link to dictyBase) Atlas ID - NBRP ID G23244 dictyBase ID DDB02179...93 Link to Contig Contig-U02062-1 | Contig-U11831-1 Original site URL http://dict...TELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDRD...STELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDR

  9. Dicty_cDB: SHE365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHE365 (Link to dictyBase) - G23163 DDB0185626 Contig-U11298-1...ary SH (Link to library) Clone ID SHE365 (Link to dictyBase) Atlas ID - NBRP ID G23163 dictyBase ID DDB01856...26 Link to Contig Contig-U11298-1 | Contig-U13252-1 Original site URL http://dict...VEIAFSDKTPSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDE...PSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDEQQQQQISSQ

  10. Liquidity in Government versus Covered Bond Markets

    DEFF Research Database (Denmark)

    Dick-Nielsen, Jens; Gyntelberg, Jacob; Sangill, Thomas

    We present findings on the secondary market liquidity of government and covered bonds in Denmark before, during and after the 2008 financial crisis. The analysis focuses on wholesale trading in the two markets and is based on a complete transaction level dataset covering November 2007 until end...... 2011. Overall, our findings suggest that Danish benchmark covered bonds by and large are as liquid as Danish government bonds - including in periods of market stress. Before the financial crisis of 2008, government bonds were slightly more liquid than covered bonds. During the crisis, trading continued...... in both markets but the government bond market experienced a brief but pronounced decline in market liquidity while liquidity in the covered bond market was more robust - partly reflective of a number of events as well as policy measures introduced in the autumn of 2008. After the crisis, liquidity...

  11. 49 CFR 633.11 - Covered projects.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Covered projects. 633.11 Section 633.11..., DEPARTMENT OF TRANSPORTATION PROJECT MANAGEMENT OVERSIGHT Project Management Oversight Services § 633.11 Covered projects. The Administrator may contract for project management oversight services when the...

  12. Fuel element transport container with a removable cover

    International Nuclear Information System (INIS)

    Dannehl, G.; Fink, W.; Haenle, G.

    1980-01-01

    The cover of the fuel element transport container is removably fixed with screws on a flange as mechanical loads have to be expected during the transfer to the disposal plant. A ring-shaped or star-shaped clamping device grips over the cover. It has a clamp claw to lock the cover and permits unscrewing without unlocking the cover. (DG) [de

  13. Fluorescence in situ hybridization evaluation of chromosome deletion patterns in prostate cancer.

    Science.gov (United States)

    Huang, S F; Xiao, S; Renshaw, A A; Loughlin, K R; Hudson, T J; Fletcher, J A

    1996-11-01

    Various nonrandom chromosomal aberrations have been identified in prostate carcinoma. These aberrations include deletions of several chromosome regions, particularly the chromosome 8 short arm. Large-scale numerical aberrations, reflected in aberrant DNA ploidy, are also found in a minority of cases. However, it is unclear whether prostate carcinomas contain aberrations of certain chromosome regions that are deleted frequently in other common types of cancer. In this study, we performed dual-color fluorescence in situ hybridization on intact nuclei from touch preparations of 16 prostate cancers. Chromosome copy number was determined using pericentromeric probes, whereas potential chromosome arm deletions were evaluated using yeast artificial chromosome (YAC) and P1 probes. Two YAC probes targeted chromosome 8 short arm regions known to be deleted frequently in prostate cancer. Other YACs and P1s were for chromosome regions, including 1p22, 3p14, 6q21, 9p21, and 22q12, that are deletion targets in a variety of cancers although not extensively studied in prostate cancer. Hybridization efficiencies and signal intensities were excellent for both repeat sequence (alpha-satellite) and single, copy (YAC and P1) fluorescence in situ hybridization probes. Of 16 prostate cancers, 11 had clonal aberrations of 1 or more of the 13 chromosome regions evaluated, and 10 cases (62.5%) had 8p deletions, including 4 cases with 8p deletion in virtually all cells and aneuploidy in only a subset of those deleted cells. Deletions at 3p14, 6q21, and 22q12 were identified in 2, 1, and 1 case, respectively, and each of those cases had a similarly sized cell population with 8p deletion. These studies confirm 8p deletion in the majority of prostate carcinomas. 8p deletions appear to be early events in prostate tumorigenesis, often antedating aneuploidy. Fluorescence in situ hybridization strategies incorporating pericentromeric and single-copy regional chromosome probes offer a powerful and

  14. Moisture content analysis of covered uranium mill tailings

    International Nuclear Information System (INIS)

    Mayer, D.W.; Beedlow, P.A.; Cadwell, L.L.

    1981-12-01

    The use of vegetation and rock covers to stabilize uranium mill tailings cover systems is being investigated by Pacific Northwest Laboratory. A modeling study of moisture movement through the tailings and cover layers was initiated to determine the effect of the stabilizing techniques. The cover system was simulated under climatic conditions occurring at Grand Junction, Colorado. The cover consisted of a layer of wet clay/gravel mix followed by a capillary barrier of washed rock and a surface layer of fill soil. Vegetation and rock were used to stabilize the surface layer. The simulation yielded moisture content and moisture storage values for the tailings and cover system along with information about moisture losses due to evaporation, transpiration, and drainage. The study demonstrates that different surface stabilization treatments lead to different degrees of moisture retention in the covered tailings pile. The evapotranspiration from vegetation can result in a relatively stable moisture content. Rock covers, however, may cause drainage to occur because they reduce evaporation and lead to a subsequent increase in moisture content. It is important to consider these effects when designing a surface stabilization treatment. Drainage may contribute to a groundwater pollution problem. A surface treatment that allows the cover system to dry out can increase the risk of atmospheric contamination through elevated radon emission rates

  15. Identification and characterization of a new multigene family in the human MHC: A candidate autoimmune disease susceptibility element (3.8-1)

    Energy Technology Data Exchange (ETDEWEB)

    Harris, J.M.; Venditti, C.P.; Chorney, M.J. [Pennsylvania State Univ. College of Medicine, Hershey, PA (United States)

    1994-09-01

    An association between idiopathic hemochromatosis (HFE) and the HLA-A3 locus has been previously well-established. In an attempt to identify potential HFE candidate genes, a genomic DNA fragment distal to the HLA-A9 breakpoint was used to screen a B cell cDNA library; a member (3.8-1) of a new multigene family, composed of five distinct genomic cross-reactive fragments, was identified. Clone 3.8-1 represents the 3{prime} end of 9.6 kb transcript which is expressed in multiple tissues including the spleen, thymus, lung and kidney. Sequencing and genome database analysis indicate that 3.8-1 is unique, with no homology to any known entries. The genomic residence of 3-8.1, defined by polymorphism analysis and physical mapping using YAC clones, appears to be absent from the genomes of higher primates, although four other cross-reactivities are maintained. The absence of this gene as well as other probes which map in the TNF to HLA-B interval, suggest that this portion of the human HMC, located between the Class I and Class III regions, arose in humans as the result of a post-speciation insertional event. The large size of the 3.8-1 gene and the possible categorization of 3.8-1 as a human-specific gene are significant given the genetic data that place an autoimmune susceptibility element for IDDM and myasthenia gravis in the precise region where this gene resides. In an attempt to isolate the 5{prime} end of this large transcript, we have constructed a cosmid contig which encompasses the genomic locus of this gene and are progressively isolating coding sequences by exon trapping.

  16. Dicty_cDB: SSE149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSE149 (Link to dictyBase) - - - Contig-U01658-1 | Contig-U165... library) Clone ID SSE149 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U016...58-1 | Contig-U16509-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/S...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 64 1e-17 2 AC100496...egans clone T13G4, complete sequence. 36 5.0 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus p

  17. Dicty_cDB: VFB330 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB330 (Link to dictyBase) - G22107 DDB0216429 Contig-U02054-1...ary VF (Link to library) Clone ID VFB330 (Link to dictyBase) Atlas ID - NBRP ID G22107 dictyBase ID DDB02164...29 Link to Contig Contig-U02054-1 | Contig-U16357-1 Original site URL http://dict...d Amino Acid sequence *k*k*NKMKLDPKALRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGY...LRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGYDFLALKTLVSRGVCSYVGNQIGVGKESDIYIVAND

  18. Climatological determinants of woody cover in Africa.

    Science.gov (United States)

    Good, Stephen P; Caylor, Kelly K

    2011-03-22

    Determining the factors that influence the distribution of woody vegetation cover and resolving the sensitivity of woody vegetation cover to shifts in environmental forcing are critical steps necessary to predict continental-scale responses of dryland ecosystems to climate change. We use a 6-year satellite data record of fractional woody vegetation cover and an 11-year daily precipitation record to investigate the climatological controls on woody vegetation cover across the African continent. We find that-as opposed to a relationship with only mean annual rainfall-the upper limit of fractional woody vegetation cover is strongly influenced by both the quantity and intensity of rainfall events. Using a set of statistics derived from the seasonal distribution of rainfall, we show that areas with similar seasonal rainfall totals have higher fractional woody cover if the local rainfall climatology consists of frequent, less intense precipitation events. Based on these observations, we develop a generalized response surface between rainfall climatology and maximum woody vegetation cover across the African continent. The normalized local gradient of this response surface is used as an estimator of ecosystem vegetation sensitivity to climatological variation. A comparison between predicted climate sensitivity patterns and observed shifts in both rainfall and vegetation during 2009 reveals both the importance of rainfall climatology in governing how ecosystems respond to interannual fluctuations in climate and the utility of our framework as a means to forecast continental-scale patterns of vegetation shifts in response to future climate change.

  19. Replacing fallow by cover crops: economic sustainability

    Science.gov (United States)

    Gabriel, José Luis; Garrido, Alberto; Quemada, Miguel

    2013-04-01

    Replacing fallow by cover crops in intensive fertilized systems has been demonstrated as an efficient tool for reducing nitrate leaching. However, despite the evident environmental services provided and the range of agronomic benefits documented in the literature, farmers' adoption of this new technology is still limited because they are either unwilling or unable, although adoption reluctance is frequently rooted in low economic profitability, low water se efficiency or poor knowledge. Economic analyses permit a comparison between the profit that farmers obtain from agricultural products and the cost of adopting specific agricultural techniques. The goal of this study was to evaluate the economic impact of replacing the usual winter fallow with cover crops (barley (Hordeum vulgare L., cv. Vanessa), vetch (Vicia villosa L., cv. Vereda) and rapeseed (Brassica napus L., cv. Licapo)) in irrigated maize systems and variable Mediterranean weather conditions using stochastic Monte-Carlo simulations of key farms' financial performance indicators. The three scenarios studied for each cover crop were: i) just leaving the cover crop residue in the ground, ii) leaving the cover crop residue but reduce following maize fertilization according to the N available from the previous cover crop and iii) selling the cover crop residue for animal feeding. All the scenarios were compared with respect to a typical maize-fallow rotation. With observed data from six different years and in various field trials, looking for different weather conditions, probability distribution functions of maize yield, cover crop biomass production and N fertilizer saving was fitted. Based in statistical sources maize grain price, different forage prices and the cost of fertilizer were fitted to probability distribution functions too. As result, introducing a cover crop involved extra costs with respect to fallow as the initial investment, because new seed, herbicide or extra field operations. Additional

  20. Biocompatibility of a new device of self-expandable covered and non-covered tracheal stent: comparative study in rats

    Directory of Open Access Journals (Sweden)

    Olavo Ribeiro Rodrigues

    2013-01-01

    Full Text Available PURPOSE: To investigate the compatibility of a new model of self-expandable tracheal stent in rats. METHODS: A new device of polyurethane covered and non - covered stent was placed in the trachea of Wistar rats. Animals were distributed in two groups: the polyurethane covered and non-covered group. Macroscopic parameters included position within the tracheal lumen, adherence to the mucosa, degree of dilatation, permeability and internal diameter. Microscopic findings evaluated were: incorporation, inflammatory activity, granulation tissue and epithelial revetment injuries. The observation follow-up was six weeks. All parameters were quantified based on determined score values. Incorporation of the stents was evaluated based on the observation if the stent was fixed into the trachea or if it could be removed. Degree of dilatation was performed by external diameter measurements. Granulation tissue was evaluated by measurements of height of the tissue growing into the tracheal lumen. RESULTS: 100% of non-covered stents had total attachment to mucosa and 100% of polyurethane covered type had adherence only. Regarding dilatation, granulation tissue, inflammatory activity and internal diameter measurements, there were no significant differences between the groups. Pathological tracheal wall injuries were present in both groups. CONCLUSION: Both models of stent demonstrated biocompatibility with the trachea. Rats are suitable for an experimental model of tracheal stent study.

  1. "Lolita": Genealogy of a Cover Girl

    Science.gov (United States)

    Savage, Shari L.

    2015-01-01

    At the publication of Vladimir Nabokov's controversial novel "Lolita" (1958), the author insisted that a girl never appear on the cover. This discourse analysis of 185 "Lolita" book covers, most of which feature a girl, considers the genealogy of "Lolita" in relation to representation, myth, and tacit knowledge…

  2. Percent Forest Cover (Future)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Forests provide economic and ecological value. High percentages of forest cover (FORPCTFuture) generally indicate healthier ecosystems and cleaner surface water....

  3. Covering Materials for Anaerobic Digesters Producing Biogas

    International Nuclear Information System (INIS)

    Itodo, I. N.; Philips, T. K.

    2002-01-01

    The suitability of foam, concrete and clay soil as covering material on anaerobic digesters producing biogas was investigated using four batch-type digesters of 20 litres volume. The methane yield from the digesters was of the order: foam >control> concrete > clay soil. The digester covered with foam had the highest methane yield, best temperature control and most favourable pH conditions. It is most suitable as cover material on anaerobic digesters

  4. THz TDS of substance covered by disordered structure

    Science.gov (United States)

    Trofimov, V. A.; Zagursky, D. Y.; Zakharova, I. G.

    2016-04-01

    Computer simulation of a few-cycle pulse interaction with a substance covered by disordered structure is performed in order to study the effects imposed on spectra of transmitted and reflected pulses by presence of the cover. The substance is described by semi-classic approach and the cover is described by classic electrodynamics equations for linear isotropic medium. The cover consists of a number of layers with different properties which is considered to be the cause of the distortions. The influence of relation between pulse wavelength and cover layer thickness is illustrated. Computer simulation results are compared with those of physical experiments conducted for paper and other common materials.

  5. 19 CFR 212.03 - Proceedings covered.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Proceedings covered. 212.03 Section 212.03 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT General Provisions § 212.03 Proceedings covered. (a) The Act...

  6. GLCF: Landsat GeoCover

    Science.gov (United States)

    satellite imagery provided in a standardized, orthorectified format, covering the entire land surface of the * Orthorectification * Distribution Status * Hard Media Orders * Letters Delivered Quick Links * Create True Color

  7. Multidimensional simulation of radon diffusion through earthen covers

    International Nuclear Information System (INIS)

    Mayer, D.W.; Gee, G.W.

    1983-01-01

    The purpose of this report is to document applications of the RADMD model used at PNL to perform analyses of radon diffusion through uranium mill tailings cover systems. The accuracy of the numerical formulation of the RADMD model was demonstrated through a comparison with a two-dimensional analytic solution to the radon diffusion equation. Excellent agreement was obtained between two-dimensional radon concentration profiles predicted by RADMD and those obtained with the analytic solution. A simulation was made of radon diffusion into a test canister using the two dimensional capabilities of RADMD. The radon flux profile was computed and illustrates the effects of the canister on the surface radon flux. The influence of the canister on the radon flux was shown to be significant under certain circumstances. Defects in earthen cover systems were evaluated using the three dimensional capabilities of RADMD. The results support the expectation that defective covers can increase the surface flux from a covered talings pile. Compared to a cover with no defects, radon flux could be elevated by as much as a factor of three when 20% of the radon control layer area contained pockets of reduced moisture. The effects of temporal and spatial variations in moisture content have been modeled by coupling RADMD with a variable saturated flow model. Two dimensional simulations were made of the time dependence of radon flux from a tailings site before and after cover placement. The results demonstrated the expected flux reduction produced by a thick earthen cover. Time dependence of the radon flux after cover placement was attributed to slight changes in moisture content of the cover material with time. The particular cover studied had a compacted clay layer that effectively attenuated the radon

  8. 77 FR 5317 - Medicaid Program; Covered Outpatient Drugs

    Science.gov (United States)

    2012-02-02

    ... for Medicare & Medicaid Services 42 CFR Part 447 Medicaid Program; Covered Outpatient Drugs; Proposed... Part 447 [CMS-2345-P] RIN 0938-AQ41 Medicaid Program; Covered Outpatient Drugs AGENCY: Centers for... requirements pertaining to Medicaid reimbursement for covered outpatient drugs to implement provisions of the...

  9. Winter cover crop effect on corn seedling pathogens

    Science.gov (United States)

    Cover crops are an excellent management tool to improve the sustainability of agriculture. Winter rye cover crops have been used successfully in Iowa corn-soybean rotations. Unfortunately, winter rye cover crops occasionally reduce yields of the following corn crop. We hypothesize that one potential...

  10. Smart cover glass for automotive applications

    Science.gov (United States)

    Chung, Sang Kug

    2017-11-01

    This paper presents a smart cover glass based on electrowetting-on-dielectric (EWOD) actuation for automotive applications. It can remove water droplets in a wide range of sizes to allow the camera's lens to get clean at any time. The proposed cover glass offers a simple design structure to be easily installed on any device but provides a fast and energy efficient droplet cleaning operation. As proof of concept, a real imaging test is carried out using a mobile smartphone camera and landscape photography. When water droplets with different volumes are on the camera cover glass, the image of landscape photography is distorted with blurred spots. However, the distorted image is restored by removing the droplets through EWOD actuation.

  11. ISLSCP II Historical Croplands Cover, 1700-1992

    Data.gov (United States)

    National Aeronautics and Space Administration — The Historical Croplands Cover data set was developed to understand the consequences of historical changes in land use and land cover for ecosystem goods and...

  12. Watershed impervious cover relative to stream location

    Data.gov (United States)

    U.S. Environmental Protection Agency — Estimates of watershed (12-digit huc) impervious cover and impervious cover near streams and water body shorelines for three dates (2001, 2006, 2011) using NLCD...

  13. ISLSCP II Historical Croplands Cover, 1700-1992

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: The Historical Croplands Cover data set was developed to understand the consequences of historical changes in land use and land cover for ecosystem goods...

  14. Engineered soil covers for management of salt impacted sites

    International Nuclear Information System (INIS)

    Sweeney, D.A.; Tratch, D.J.

    2005-01-01

    The use of engineered soil cover systems to mitigate environmental impacts from tailings and waste rock piles is becoming an accepted practice. This paper presented design concepts for soil covers related to reclamation practices in the mining industry as an effective risk management practice at salt impacted sites. Research and field programs have demonstrated that a layered engineered soil cover can reduce or eliminate infiltration. Key components of the system included re-establishing surface vegetation to balance precipitation fluxes with evapotranspiration potential, and design of a capillary break below the rooting zone to minimize deeper seated infiltration. It was anticipated that the incorporation of a vegetation cover and a capillary break would minimize infiltration into the waste rock or tailing pile and reduce the generation of acid rock drainage (ARD). Design of a layered soil cover requires the incorporation of meteorological data, moisture retention characteristics of the impacted soils, and proposed engineered cover materials. Performance of the soil cover was predicted using a finite element model combined with meteorological data from the site area, unsaturated soil properties of the parent sub-surface soils and potential covered materials. The soil cover design consisted of re-vegetation and a loose clay cover overlying a compacted till layer. The design was conducted for an off site release of salt impacted pasture land adjacent to a former highway maintenance yard. The model predicted minimal infiltration during high precipitation events and no infiltration during low precipitation events. Results indicated that the proposed soil cover would enable re-establishment of a productive agricultural ground cover, as well as minimizing the potential for additional salt migration. It was concluded that further research and development is needed to ensure that the cover system is an acceptable method for long-term risk management. 17 refs., 5 figs

  15. GAP Land Cover - Image

    Data.gov (United States)

    Minnesota Department of Natural Resources — This raster dataset is a simple image of the original detailed (1-acre minimum), hierarchically organized vegetation cover map produced by computer classification of...

  16. GAP Land Cover - Vector

    Data.gov (United States)

    Minnesota Department of Natural Resources — This vector dataset is a detailed (1-acre minimum), hierarchically organized vegetation cover map produced by computer classification of combined two-season pairs of...

  17. Percent of Impervious Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — High amounts of impervious cover (parking lots, rooftops, roads, etc.) can increase water runoff, which may directly enter surface water. Runoff from roads often...

  18. Bioactive Potential of Andean Fruits, Seeds, and Tubers.

    Science.gov (United States)

    Campos, David; Chirinos, Rosana; Gálvez Ranilla, Lena; Pedreschi, Romina

    2018-01-01

    The Andes is considered the longest continental mountain range in the world. It covers 7000km long and about 200-700km wide and an average height of about 4000m. Very unique plant species are endemic of this area including fruits (e.g., lucuma, cherimoya, sweet pepino, sauco), roots and tubers (potatoes, sweet potatoes, yacón, chicuru, mashua, olluco, etc.), and seeds (quinoa, amaranth, tarwi, etc.). These crops have been used for centuries by the native population and relatively recently have gained the world attention due to the wide range of nutrients and/or phytochemicals they possess. In this chapter, main Andean fruits, seeds, and roots and tubers have been selected and detailed nutritional and functional information is provided. In addition, traditional and current uses are provided and their bioactive potential is reported based on published scientific literature. © 2018 Elsevier Inc. All rights reserved.

  19. Clouds cover variability in São Paulo

    Directory of Open Access Journals (Sweden)

    Luciana Machado de Moura

    2016-11-01

    Full Text Available Clouds cover observations are performed by visual inspection which determines the fraction of the sky that is overcast. However, visual observation of clouds cover is a very subjective method, and can vary significantly among observers. This study examined the variability in clouds cover over the city of São Paulo between 1961 and 2013, using clouds cover fraction data observed at the weather station operated by IAG / USP. The study also used two techniques based on visible radiance data observed by the GOES-10 satellite in order to indirectly estimate clouds cover. In order to ensure consistency, the estimated and observed cloudiness was compared with the clearness index, which is the ratio between the total solar radiation observed at the weather station and the incoming solar irradiation at the top of atmosphere. The study found consistency between the various databases that showed similar behavior in all of the seasons of the year. The largest cloudiness values occurred in the summer and lowest in the winter.

  20. 39 CFR 233.3 - Mail covers.

    Science.gov (United States)

    2010-07-01

    .... For purpose of these regulations, the following terms are hereby defined. (1) Mail cover is the... criminal law. (3) When time is of the essence, the Chief Postal Inspector, or designee, may act upon an... furnish information as defined in § 233.3(c)(1) to any person, except as authorized by a mail cover order...

  1. Evaluation of de novo assembly technique in the South African abalone Haliotis midae transcriptome: A comparison from Illumina and 454 systems

    Directory of Open Access Journals (Sweden)

    Barbara Picone

    2016-12-01

    Full Text Available Next generation sequencing platforms have recently been used to rapidly characterize transcriptome sequences from a number of non-model organisms. The present study compares two of the most frequently used platforms, the Roche 454-pyrosequencing and the Illumina sequencing-by-synthesis (SBS, on the same RNA sample obtained from an intertidal gastropod mollusc species, Haliotis midae. All the sequencing reads were deposited in the Short Read Archive (SRA database are retrievable under the accession number [SRR071314 (Illumina Genome Analyzer II] and [SRR1737738, SRR1737737, SRR1737735, SRR1737734 (454 GS FLX] in the SRA database of NCBI. Three transcriptomes, composed of either pure 454 or Illumina reads or a mixture of read types (Hybrid, were assembled using CLC Genomics Workbench software. Illumina assemblies performed the best de novo transcriptome characterization in terms of contig length, whereas the 454 assemblies tended to improve the complete assembly of gene transcripts. Both the Hybrid and Illumina assemblies produced longer contigs covering more of the transcriptome than 454 assemblies. However, the addition of 454 significantly increased the number of genes annotated.

  2. Percent Wetland Cover (Future)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Wetlands act as filters, removing or diminishing the amount of pollutants that enter surface water. Higher values for percent of wetland cover (WETLNDSPCT) may be...

  3. [Cover motifs of the Tidsskrift. A 14-year cavalcade].

    Science.gov (United States)

    Nylenna, M

    1998-12-10

    In 1985 the Journal of the Norwegian Medical Association changed its cover policy, moving the table of contents inside the Journal and introducing cover illustrations. This article provides an analysis of all cover illustrations published over this 14-year period, 420 covers in all. There is a great variation in cover motifs and designs and a development towards more general motifs. The initial emphasis on historical and medical aspects is now less pronounced, while the use of works of art and nature motifs has increased, and the cover now more often has a direct bearing on the specific contents of the issue. Professor of medical history Oivind Larsen has photographed two thirds of the covers and contributed 95% of the inside essay-style reflections on the cover motif. Over the years, he has expanded the role of the historian of medicine disseminating knowledge to include that of the raconteur with a personal tone of voice. The Journal's covers are now one of its most characteristic features, emblematic of the Journal's ambition of standing for quality and timelessness vis-à-vis the news media, and of its aim of bridging the gap between medicine and the humanities.

  4. Dicty_cDB: SSB171 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h

  5. Effect of litter, leaf cover and cover of basal internodes of the dominant species Molinia caerulea on seedling recruitment and established vegetation

    Science.gov (United States)

    Janeček, Štěpán; Lepš, Jan

    2005-09-01

    The effects of litter removal, leaf cover of established plants and cover of basal internodes of a dominant species Molinia caerulea on seedling germination and the dynamics of established plants were studied in a field experiment in an oligotrophic wet meadow. Although the negative influence of litter on total seedling number and seedling species composition was non-significant, litter significantly affected the dynamics of the established vegetation and caused inhibition of total leaf cover development. The effects of total leaf cover of established plants on seedling establishment changed during the vegetation season. Whereas the effect of total leaf cover was positive at the start and in the middle of the vegetation season, at the end the total leaf cover negatively affected seedling establishment. Both total leaf cover and cover of basal internodes affected seedling composition. Effects of these two variables were statistically separable suggesting that they are based on different mechanisms. The response of seedling establishment to these factors was species specific and, consequently, our data support the hypothesis that that biotically generated spatial heterogeneity can promote species co-existence through the differentiation of species regeneration niches.

  6. 21 CFR 1404.200 - What is a covered transaction?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false What is a covered transaction? 1404.200 Section 1404.200 Food and Drugs OFFICE OF NATIONAL DRUG CONTROL POLICY GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Covered Transactions § 1404.200 What is a covered transaction? A covered transaction is a...

  7. Preheating Water In The Covers Of Solar Water Heaters

    Science.gov (United States)

    Bhandari, Pradeep

    1995-01-01

    Solar water heaters that include glass covers over absorber plates redesigned to increase efficiencies according to proposal. Redesign includes modification of single-layer glass cover into double-layer glass cover and addition of plumbing so cool water to be heated made to flow between layers of cover before entering absorber plate.

  8. Validation of Land Cover Products Using Reliability Evaluation Methods

    Directory of Open Access Journals (Sweden)

    Wenzhong Shi

    2015-06-01

    Full Text Available Validation of land cover products is a fundamental task prior to data applications. Current validation schemes and methods are, however, suited only for assessing classification accuracy and disregard the reliability of land cover products. The reliability evaluation of land cover products should be undertaken to provide reliable land cover information. In addition, the lack of high-quality reference data often constrains validation and affects the reliability results of land cover products. This study proposes a validation schema to evaluate the reliability of land cover products, including two methods, namely, result reliability evaluation and process reliability evaluation. Result reliability evaluation computes the reliability of land cover products using seven reliability indicators. Process reliability evaluation analyzes the reliability propagation in the data production process to obtain the reliability of land cover products. Fuzzy fault tree analysis is introduced and improved in the reliability analysis of a data production process. Research results show that the proposed reliability evaluation scheme is reasonable and can be applied to validate land cover products. Through the analysis of the seven indicators of result reliability evaluation, more information on land cover can be obtained for strategic decision-making and planning, compared with traditional accuracy assessment methods. Process reliability evaluation without the need for reference data can facilitate the validation and reflect the change trends of reliabilities to some extent.

  9. Differences in breeding bird assemblages related to reed canary grass cover cover and forest structure on the Upper Mississippi River

    Science.gov (United States)

    Kirsch, Eileen M.; Gray, Brian R.

    2017-01-01

    Floodplain forest of the Upper Mississippi River provides habitat for an abundant and diverse breeding bird community. However, reed canary grass Phalaris arundinacea invasion is a serious threat to the future condition of this forest. Reed canary grass is a well-known aggressive invader of wetland systems in the northern tier states of the conterminous United States. Aided by altered flow regimes and nutrient inputs from agriculture, reed canary grass has formed dense stands in canopy gaps and forest edges, retarding tree regeneration. We sampled vegetation and breeding birds in Upper Mississippi River floodplain forest edge and interior areas to 1) measure reed canary grass cover and 2) evaluate whether the breeding bird assemblage responded to differences in reed canary grass cover. Reed canary grass was found far into forest interiors, and its cover was similar between interior and edge sites. Bird assemblages differed between areas with more or less reed canary grass cover (.53% cover breakpoint). Common yellowthroat Geothlypis trichas, black-capped chickadee Parus atricapillus, and rose-breasted grosbeak Pheucticus ludovicianus were more common and American redstart Setophaga ruticilla, great crested flycatcher Myiarchus crinitus, and Baltimore oriole Icterus galbula were less common in sites with more reed canary grass cover. Bird diversity and abundance were similar between sites with different reed canary grass cover. A stronger divergence in bird assemblages was associated with ground cover ,15%, resulting from prolonged spring flooding. These sites hosted more prothonotary warbler Protonotaria citrea, but they had reduced bird abundance and diversity compared to other sites. Our results indicate that frequently flooded sites may be important for prothonotary warblers and that bird assemblages shift in response to reed canary grass invasion.

  10. Analysis of radon protection cover on uranium tailings pile

    International Nuclear Information System (INIS)

    Zhang Zhe

    1993-01-01

    The average radon emanation rate of the whole surface over one year was used for evaluating the radon release of uranium tailings pile. The effective of radon protection cover depends on the shape and property of the tailings pile, the properties of covering and the control of air vadose in the pile. It was indicated that the covering with low diffusion coefficient, small porosity and bad permeability was suitable to cover the pile. The analytical formula of the covering layer thickness was given

  11. Development of a 30 m Spatial Resolution Land Cover of Canada: Contribution to the Harmonized North America Land Cover Dataset

    Science.gov (United States)

    Pouliot, D.; Latifovic, R.; Olthof, I.

    2017-12-01

    Land cover is needed for a large range of environmental applications regarding climate impacts and adaption, emergency response, wildlife habitat, air quality, water yield, etc. In Canada a 2008 user survey revealed that the most practical scale for provision of land cover data is 30 m, nationwide, with an update frequency of five years (Ball, 2008). In response to this need the Canada Centre for Remote Sensing has generated a 30 m land cover of Canada for the base year 2010 as part of a planned series of maps at the recommended five year update frequency. This land cover is the Canadian contribution to the North American Land Change Monitoring System initiative, which seeks to provide harmonized land cover across Canada, the United States, and Mexico. The methodology developed in this research utilized a combination of unsupervised and machine learning techniques to map land cover, blend results between mapping units, locally optimize results, and process some thematic attributes with specific features sets. Accuracy assessment with available field data shows it was on average 75% for the five study areas assessed. In this presentation an overview of the unique processing aspects, example results, and initial accuracy assessment will be discussed.

  12. Monitoring Areal Snow Cover Using NASA Satellite Imagery

    Science.gov (United States)

    Harshburger, Brian J.; Blandford, Troy; Moore, Brandon

    2011-01-01

    The objective of this project is to develop products and tools to assist in the hydrologic modeling process, including tools to help prepare inputs for hydrologic models and improved methods for the visualization of streamflow forecasts. In addition, this project will facilitate the use of NASA satellite imagery (primarily snow cover imagery) by other federal and state agencies with operational streamflow forecasting responsibilities. A GIS software toolkit for monitoring areal snow cover extent and producing streamflow forecasts is being developed. This toolkit will be packaged as multiple extensions for ArcGIS 9.x and an opensource GIS software package. The toolkit will provide users with a means for ingesting NASA EOS satellite imagery (snow cover analysis), preparing hydrologic model inputs, and visualizing streamflow forecasts. Primary products include a software tool for predicting the presence of snow under clouds in satellite images; a software tool for producing gridded temperature and precipitation forecasts; and a suite of tools for visualizing hydrologic model forecasting results. The toolkit will be an expert system designed for operational users that need to generate accurate streamflow forecasts in a timely manner. The Remote Sensing of Snow Cover Toolbar will ingest snow cover imagery from multiple sources, including the MODIS Operational Snowcover Data and convert them to gridded datasets that can be readily used. Statistical techniques will then be applied to the gridded snow cover data to predict the presence of snow under cloud cover. The toolbar has the ability to ingest both binary and fractional snow cover data. Binary mapping techniques use a set of thresholds to determine whether a pixel contains snow or no snow. Fractional mapping techniques provide information regarding the percentage of each pixel that is covered with snow. After the imagery has been ingested, physiographic data is attached to each cell in the snow cover image. This data

  13. South African National Land-Cover Change Map

    African Journals Online (AJOL)

    Fritz Schoeman

    monitoring land-cover change at a national scale over time using EO data. 2. .... assist with final results reporting and analysis on a sub-national level. ..... South African Land-Cover Characteristics Database: A synopsis of the landscape.

  14. Deriving Snow Cover Metrics for Alaska from MODIS

    Directory of Open Access Journals (Sweden)

    Chuck Lindsay

    2015-09-01

    Full Text Available Moderate Resolution Imaging Spectroradiometer (MODIS daily snow cover products provide an opportunity for determining snow onset and melt dates across broad geographic regions; however, cloud cover and polar darkness are limiting factors at higher latitudes. This study presents snow onset and melt dates for Alaska, portions of western Canada and the Russian Far East derived from Terra MODIS snow cover daily 500 m grid data (MOD10A1 and evaluates our method for filling data gaps caused by clouds or polar darkness. Pixels classified as cloud or no data were reclassified by: spatial filtering using neighboring pixel values; temporal filtering using pixel values for days before/after cloud cover; and snow-cycle filtering based on a time series assessment of a pixel’s position within snow accumulation, cover or melt periods. During the 2012 snow year, these gap-filling methods reduced cloud pixels from 27.7% to 3.1%. A total of 12 metrics (e.g., date of first and last snow, date of persistent snow cover and periods of intermittence for each pixel were calculated by snow year. A comparison of MODIS-derived snow onset and melt dates with in situ observations from 244 weather stations generally showed an early bias in MODIS-derived dates and an effect of increasing cloudiness exacerbating bias. Our results show that mean regional duration of seasonal snow cover is 179–311 days/year and that snow cover is often intermittent, with 41% of the area experiencing ≥2 snow-covered periods during a snow season. Other regional-scale patterns in the timing of snow onset and melt are evident in the yearly 500 m gridded products publically available at http://static.gina.alaska.edu/NPS_products/MODIS_snow/.

  15. Enhanced Cover Assessment Project:Soil Manipulation and Revegetation Tests

    Energy Technology Data Exchange (ETDEWEB)

    Waugh, W. Joseph [Navarro Research and Engineering, Inc.; Albright, Dr. Bill [Desert Research Inst. (DRI), Reno, NV (United States); Benson, Dr. Craig [University of Wisconsin-Madison

    2014-02-01

    The U.S. Department of Energy Office of Legacy Management is evaluating methods to enhance natural changes that are essentially converting conventional disposal cell covers for uranium mill tailings into water balance covers. Conventional covers rely on a layer of compacted clayey soil to limit exhalation of radon gas and percolation of rainwater. Water balance covers rely on a less compacted soil “sponge” to store rainwater, and on soil evaporation and plant transpiration (evapotranspiration) to remove stored water and thereby limit percolation. Over time, natural soil-forming and ecological processes are changing conventional covers by increasing hydraulic conductivity, loosening compaction, and increasing evapotranspiration. The rock armor on conventional covers creates a favorable habitat for vegetation by slowing soil evaporation, increasing soil water storage, and trapping dust and organic matter, thereby providing the water and nutrients needed for plant germination, survival, and sustainable transpiration. Goals and Objectives Our overall goal is to determine if allowing or enhancing these natural changes could improve cover performance and reduce maintenance costs over the long term. This test pad study focuses on cover soil hydrology and ecology. Companion studies are evaluating effects of natural and enhanced changes in covers on radon attenuation, erosion, and biointrusion. We constructed a test cover at the Grand Junction disposal site to evaluate soil manipulation and revegetation methods. The engineering design, construction, and properties of the test cover match the upper three layers of the nearby disposal cell cover: a 1-foot armoring of rock riprap, a 6-inch bedding layer of coarse sand and gravel, and a 2-foot protection layer of compacted fine soil. The test cover does not have a radon barrier—cover enhancement tests leave the radon barrier intact. We tested furrowing and ripping as means for creating depressions parallel to the slope

  16. Tree Cover Mapping Tool—Documentation and user manual

    Science.gov (United States)

    Cotillon, Suzanne E.; Mathis, Melissa L.

    2016-06-02

    The Tree Cover Mapping (TCM) tool was developed by scientists at the U.S. Geological Survey Earth Resources Observation and Science Center to allow a user to quickly map tree cover density over large areas using visual interpretation of high resolution imagery within a geographic information system interface. The TCM tool uses a systematic sample grid to produce maps of tree cover. The TCM tool allows the user to define sampling parameters to estimate tree cover within each sample unit. This mapping method generated the first on-farm tree cover maps of vast regions of Niger and Burkina Faso. The approach contributes to implementing integrated landscape management to scale up re-greening and restore degraded land in the drylands of Africa. The TCM tool is easy to operate, practical, and can be adapted to many other applications such as crop mapping, settlements mapping, or other features. This user manual provides step-by-step instructions for installing and using the tool, and creating tree cover maps. Familiarity with ArcMap tools and concepts is helpful for using the tool.

  17. Statistical Monitoring of Changes to Land Cover

    KAUST Repository

    Zerrouki, Nabil; Harrou, Fouzi; Sun, Ying

    2018-01-01

    Accurate detection of changes in land cover leads to better understanding of the dynamics of landscapes. This letter reports the development of a reliable approach to detecting changes in land cover based on remote sensing and radiometric data

  18. Mathematical Foundation for Plane Covering Using Hexagons

    Science.gov (United States)

    Johnson, Gordon G.

    1999-01-01

    This work is to indicate the development and mathematical underpinnings of the algorithms previously developed for covering the plane and the addressing of the elements of the covering. The algorithms are of interest in that they provides a simple systematic way of increasing or decreasing resolution, in the sense that if we have the covering in place and there is an image superimposed upon the covering, then we may view the image in a rough form or in a very detailed form with minimal effort. Such ability allows for quick searches of crude forms to determine a class in which to make a detailed search. In addition, the addressing algorithms provide an efficient way to process large data sets that have related subsets. The algorithms produced were based in part upon the work of D. Lucas "A Multiplication in N Space" which suggested a set of three vectors, any two of which would serve as a bases for the plane and also that the hexagon is the natural geometric object to be used in a covering with a suggested bases. The second portion is a refinement of the eyeball vision system, the globular viewer.

  19. The Thermal Collector With Varied Glass Covers

    International Nuclear Information System (INIS)

    Luminosu, I.; Pop, N.

    2010-01-01

    The thermal collector with varied glass covers represents an innovation realized in order to build a collector able to reach the desired temperature by collecting the solar radiation from the smallest surface, with the highest efficiency. In the case of the thermal collector with variable cover glasses, the number of the glass plates covering the absorber increases together with the length of the circulation pipe for the working fluid. The thermal collector with varied glass covers compared to the conventional collector better meet user requirements because: for the same temperature increase, has the collecting area smaller; for the same collection area, realizes the highest temperature increase and has the highest efficiency. This works is addressed to researchers in the solar energy and to engineers responsible with air-conditioning systems design or industrial and agricultural products drying.

  20. Vacuum-plasma coverings on the aircraft

    International Nuclear Information System (INIS)

    Shvetsov, V.D.; Teksin, Eh.K.; Lysyak, A.A.

    1998-01-01

    In the article are considered the perspectives of vacuum-plasma coverings using for engine components protection. The influence of operating factors on the durability of components which has the vacuum-plasma coverings is show.Leads in using the concept of informational parameter of quality.The recommendation about organization of engine with abolished components maintenance by methods of flyable conditions or reliability level are given

  1. Analysis of BY-106 pump pit cover plate

    International Nuclear Information System (INIS)

    Coverdell, B.L.

    1994-01-01

    A new cover for the pump pit of Tank 241-BY-106 has been designed to allow the rotary core exhauster to be hooked up without requiring pit entry, riser modification, or equipment removal. The new pit cover is necessary to allow installation of two risers for reducing exposure, contamination, and waste. Computer analysis indicates that the safety margin of the pit cover plate with two risers is adequate. The computer stress model and input files are attached. The pit cover plate is a replacement for an existing plate; therefore seismic and wind loads were considered for the plate only

  2. SNP markers retrieval for a non-model species: a practical approach

    Directory of Open Access Journals (Sweden)

    Shahin Arwa

    2012-01-01

    Full Text Available Abstract Background SNP (Single Nucleotide Polymorphism markers are rapidly becoming the markers of choice for applications in breeding because of next generation sequencing technology developments. For SNP development by NGS technologies, correct assembly of the huge amounts of sequence data generated is essential. Little is known about assembler's performance, especially when dealing with highly heterogeneous species that show a high genome complexity and what the possible consequences are of differences in assemblies on SNP retrieval. This study tested two assemblers (CAP3 and CLC on 454 data from four lily genotypes and compared results with respect to SNP retrieval. Results CAP3 assembly resulted in higher numbers of contigs, lower numbers of reads per contig, and shorter average read lengths compared to CLC. Blast comparisons showed that CAP3 contigs were highly redundant. Contrastingly, CLC in rare cases combined paralogs in one contig. Redundant and chimeric contigs may lead to erroneous SNPs. Filtering for redundancy can be done by blasting selected SNP markers to the contigs and discarding all the SNP markers that show more than one blast hit. Results on chimeric contigs showed that only four out of 2,421 SNP markers were selected from chimeric contigs. Conclusion In practice, CLC performs better in assembling highly heterogeneous genome sequences compared to CAP3, and consequently SNP retrieval is more efficient. Additionally a simple flow scheme is suggested for SNP marker retrieval that can be valid for all non-model species.

  3. Process for assembly and transformation into Saccharomyces cerevisiae of a synthetic yeast artificial chromosome containing a multigene cassette to express enzymes that enhance xylose utilization designed for an automated pla

    Science.gov (United States)

    A yeast artificial chromosome (YAC) containing a multigene cassette for expression of enzymes that enhance xylose utilization (xylose isomerase [XI] and xylulokinase [XKS]) was constructed and transformed into Saccharomyces cerevisiae to demonstrate feasibility as a stable protein expression system ...

  4. EnviroAtlas - Land Cover for the Conterminous United States

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset represents the percentage of land area that is classified as forest land cover, modified forest land cover, and natural land cover using the 2006...

  5. Covered stent placement for the treatment of malignant superior vena cava syndrome: Is unilateral covered stenting and effective?

    International Nuclear Information System (INIS)

    Cho, Young Hoon; Gwon, Dong Il; Ko, Gi Young; Ko, Heung Kyu; Kim, Jin Hyoung; Shin, Ji Hoon; Yoon, Hyun Ki; Sung, Kyu Bo

    2014-01-01

    To evaluate the safety and efficacy of unilateral covered stent placement in patients with malignant superior vena cava (SVC) syndrome. Between October 2008 and November 2012, expanded polytetrafluoroethylene-covered stent placement for malignant SVC syndrome was performed in 40 consecutive patients (35 men and five women; mean age, 61.4 years; range, 35-81 years). All covered stents were unilaterally placed within the SVC or across the venous confluence when needed to relieve venous obstruction and prevent tumor overgrowth, regardless of patency of contralateral brachiocephalic veins. Stent placement was technically successful in all patients. There were no major complications. Of the 37 patients symptomatic prior to stent placement, 34 (92%) experienced complete symptomatic relief 1-8 days after stent placement. Of the 29 patients who underwent covered stent placement across the venous confluence, nine patients had patent contralateral brachiocephalic veins prior to stent placement. However, no sign of SVC obstruction or contralateral upper extremity venous thrombosis was observed during the follow-up period. Kaplan-Meier analysis revealed median patient survival of 163 days. Stent occlusion occurred in four (10%) of 40 patents. Cumulative stent patency rates at 1, 3, 6, and 12 months were 95%, 92%, 86%, and 86%, respectively. Unilateral covered stent placement appears to be a safe and effective method for treating malignant SVC syndrome, despite the location of SVC occlusion.

  6. Covered stent placement for the treatment of malignant superior vena cava syndrome: Is unilateral covered stenting and effective?

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Young Hoon; Gwon, Dong Il; Ko, Gi Young; Ko, Heung Kyu; Kim, Jin Hyoung; Shin, Ji Hoon; Yoon, Hyun Ki; Sung, Kyu Bo [Dept. of Radiology and Research Institute of Radiology, University of Ulsan College of Medicine, Asan Medical Center, Seoul (Korea, Republic of)

    2014-02-15

    To evaluate the safety and efficacy of unilateral covered stent placement in patients with malignant superior vena cava (SVC) syndrome. Between October 2008 and November 2012, expanded polytetrafluoroethylene-covered stent placement for malignant SVC syndrome was performed in 40 consecutive patients (35 men and five women; mean age, 61.4 years; range, 35-81 years). All covered stents were unilaterally placed within the SVC or across the venous confluence when needed to relieve venous obstruction and prevent tumor overgrowth, regardless of patency of contralateral brachiocephalic veins. Stent placement was technically successful in all patients. There were no major complications. Of the 37 patients symptomatic prior to stent placement, 34 (92%) experienced complete symptomatic relief 1-8 days after stent placement. Of the 29 patients who underwent covered stent placement across the venous confluence, nine patients had patent contralateral brachiocephalic veins prior to stent placement. However, no sign of SVC obstruction or contralateral upper extremity venous thrombosis was observed during the follow-up period. Kaplan-Meier analysis revealed median patient survival of 163 days. Stent occlusion occurred in four (10%) of 40 patents. Cumulative stent patency rates at 1, 3, 6, and 12 months were 95%, 92%, 86%, and 86%, respectively. Unilateral covered stent placement appears to be a safe and effective method for treating malignant SVC syndrome, despite the location of SVC occlusion.

  7. Metagenomic insights into the rumen microbial fibrolytic enzymes in Indian crossbred cattle fed finger millet straw.

    Science.gov (United States)

    Jose, V Lyju; Appoothy, Thulasi; More, Ravi P; Arun, A Sha

    2017-12-01

    The rumen is a unique natural habitat, exhibiting an unparalleled genetic resource of fibrolytic enzymes of microbial origin that degrade plant polysaccharides. The objectives of this study were to identify the principal plant cell wall-degrading enzymes and the taxonomic profile of rumen microbial communities that are associated with it. The cattle rumen microflora and the carbohydrate-active enzymes were functionally classified through a whole metagenomic sequencing approach. Analysis of the assembled sequences by the Carbohydrate-active enzyme analysis Toolkit identified the candidate genes encoding fibrolytic enzymes belonging to different classes of glycoside hydrolases(11,010 contigs), glycosyltransferases (6366 contigs), carbohydrate esterases (4945 contigs), carbohydrate-binding modules (1975 contigs), polysaccharide lyases (480 contigs), and auxiliary activities (115 contigs). Phylogenetic analysis of CAZyme encoding contigs revealed that a significant proportion of CAZymes were contributed by bacteria belonging to genera Prevotella, Bacteroides, Fibrobacter, Clostridium, and Ruminococcus. The results indicated that the cattle rumen microbiome and the CAZymes are highly complex, structurally similar but compositionally distinct from other ruminants. The unique characteristics of rumen microbiota and the enzymes produced by resident microbes provide opportunities to improve the feed conversion efficiency in ruminants and serve as a reservoir of industrially important enzymes for cellulosic biofuel production.

  8. Final covering of the Ronneburg uranium mining site

    International Nuclear Information System (INIS)

    Hoepfner, Uwe

    2007-01-01

    The rehabilitation of WISMUT's former Ronneburg uranium mining site involves backfilling of waste rock to the Lichtenberg open pit. The relocation project comprises about 110 million m 3 of sulphide-bearing and AMD-generating waste rock which makes it the most important and most cost-intensive single surface restoration project conducted by WISMUT at the Ronneburg site. The backfilled waste rock has to be covered on an area of about 220 ha to control water infiltration and gas diffusion. Design planning for the final cover placement which began in 2004 had to be based on a comprehensive cost-benefit analysis as well on field tests of alternative cover options which are in compliance with legal requirements. An intensive testing program concerning the vadose zone of soil covers has therefore been started in 2000. The paper presents an overview of the monitoring program and the results of the vadose zone measurements. The water of soil covers have to be predicted for extended evaluation periods. Therefore water balance simulations of single layer covers (storage and evaporation concept) taking current and future soil and climate conditions into account are performed with the HYDRUS 2D code. (author)

  9. Experimental study and simulations of infiltration in evapotranspiration landfill covers

    Directory of Open Access Journals (Sweden)

    Wen-xian Zhang

    2009-09-01

    Full Text Available Various cover systems have been designed for landfill sites in order to minimize infiltration (percolation into the underlying waste. This study evaluated the soil water balance performance of evapotranspiration covers (ET covers and simulated percolation in the systems using the active region model (ARM. Experiments were conducted to measure water flow processes and water balance components in a bare soil cover and different ET covers. Results showed that vegetation played a critical role in controlling the water balance of the ET covers. In soil profiles of 60-cm depth with and without vegetation cover, the maximum soil water storage capacities were 97.2 mm and 62.8 mm, respectively. The percolation amount in the bare soil was 2.1 times that in the vegetation-covered soil. The ARM simulated percolation more accurately than the continuum model because it considered preferential flow. Numerical simulation results also indicated that using the ET cover system was an effective way of removing water through evapotranspiration, thus reducing percolation.

  10. Non-commutative covering spaces and their symmetries

    DEFF Research Database (Denmark)

    Canlubo, Clarisson

    dened and its corresponding Galois theory. Using this and basic concepts from algebraic geometryand spectral theory, we will give a full description of the general structure of non-centralcoverings. Examples of coverings of the rational and irrational non-commutative tori will alsobe studied. Using...... will explain this and relate it to bi-Galois theory.Using the OZ-transform, we will show that non-commutative covering spaces come in pairs.Several categories of covering spaces will be dened and studied. Appealing to Tannaka duality,we will explain how this lead to a notion of an etale fundamental group...

  11. Determinants of woody cover in African savannas

    Science.gov (United States)

    Sankaran, M.; Hanan, N.P.; Scholes, Robert J.; Ratnam, J.; Augustine, D.J.; Cade, B.S.; Gignoux, J.; Higgins, S.I.; Le, Roux X.; Ludwig, F.; Ardo, J.; Banyikwa, F.; Bronn, A.; Bucini, G.; Caylor, K.K.; Coughenour, M.B.; Diouf, A.; Ekaya, W.; Feral, C.J.; February, E.C.; Frost, P.G.H.; Hiernaux, P.; Hrabar, H.; Metzger, K.L.; Prins, H.H.T.; Ringrose, S.; Sea, W.; Tews, J.; Worden, J.; Zambatis, N.

    2005-01-01

    Savannas are globally important ecosystems of great significance to human economies. In these biomes, which are characterized by the co-dominance of trees and grasses, woody cover is a chief determinant of ecosystem properties 1-3. The availability of resources (water, nutrients) and disturbance regimes (fire, herbivory) are thought to be important in regulating woody cover1,2,4,5, but perceptions differ on which of these are the primary drivers of savanna structure. Here we show, using data from 854 sites across Africa, that maximum woody cover in savannas receiving a mean annual precipitation (MAP) of less than ???650 mm is constrained by, and increases linearly with, MAP. These arid and semi-arid savannas may be considered 'stable' systems in which water constrains woody cover and permits grasses to coexist, while fire, herbivory and soil properties interact to reduce woody cover below the MAP-controlled upper bound. Above a MAP of ???650 mm, savannas are 'unstable' systems in which MAP is sufficient for woody canopy closure, and disturbances (fire, herbivory) are required for the coexistence of trees and grass. These results provide insights into the nature of African savannas and suggest that future changes in precipitation 6 may considerably affect their distribution and dynamics. ?? 2005 Nature Publishing Group.

  12. COVERS Neonatal Pain Scale: Development and Validation

    Directory of Open Access Journals (Sweden)

    Ivan L. Hand

    2010-01-01

    Full Text Available Newborns and infants are often exposed to painful procedures during hospitalization. Several different scales have been validated to assess pain in specific populations of pediatric patients, but no single scale can easily and accurately assess pain in all newborns and infants regardless of gestational age and disease state. A new pain scale was developed, the COVERS scale, which incorporates 6 physiological and behavioral measures for scoring. Newborns admitted to the Neonatal Intensive Care Unit or Well Baby Nursery were evaluated for pain/discomfort during two procedures, a heel prick and a diaper change. Pain was assessed using indicators from three previously established scales (CRIES, the Premature Infant Pain Profile, and the Neonatal Infant Pain Scale, as well as the COVERS Scale, depending upon gestational age. Premature infant testing resulted in similar pain assessments using the COVERS and PIPP scales with an r=0.84. For the full-term infants, the COVERS scale and NIPS scale resulted in similar pain assessments with an r=0.95. The COVERS scale is a valid pain scale that can be used in the clinical setting to assess pain in newborns and infants and is universally applicable to all neonates, regardless of their age or physiological state.

  13. Land cover mapping of Greater Mesoamerica using MODIS data

    Science.gov (United States)

    Giri, Chandra; Jenkins, Clinton N.

    2005-01-01

    A new land cover database of Greater Mesoamerica has been prepared using moderate resolution imaging spectroradiometer (MODIS, 500 m resolution) satellite data. Daily surface reflectance MODIS data and a suite of ancillary data were used in preparing the database by employing a decision tree classification approach. The new land cover data are an improvement over traditional advanced very high resolution radiometer (AVHRR) based land cover data in terms of both spatial and thematic details. The dominant land cover type in Greater Mesoamerica is forest (39%), followed by shrubland (30%) and cropland (22%). Country analysis shows forest as the dominant land cover type in Belize (62%), Cost Rica (52%), Guatemala (53%), Honduras (56%), Nicaragua (53%), and Panama (48%), cropland as the dominant land cover type in El Salvador (60.5%), and shrubland as the dominant land cover type in Mexico (37%). A three-step approach was used to assess the quality of the classified land cover data: (i) qualitative assessment provided good insight in identifying and correcting gross errors; (ii) correlation analysis of MODIS- and Landsat-derived land cover data revealed strong positive association for forest (r2 = 0.88), shrubland (r2 = 0.75), and cropland (r2 = 0.97) but weak positive association for grassland (r2 = 0.26); and (iii) an error matrix generated using unseen training data provided an overall accuracy of 77.3% with a Kappa coefficient of 0.73608. Overall, MODIS 500 m data and the methodology used were found to be quite useful for broad-scale land cover mapping of Greater Mesoamerica.

  14. Statistical Monitoring of Changes to Land Cover

    KAUST Repository

    Zerrouki, Nabil

    2018-04-06

    Accurate detection of changes in land cover leads to better understanding of the dynamics of landscapes. This letter reports the development of a reliable approach to detecting changes in land cover based on remote sensing and radiometric data. This approach integrates the multivariate exponentially weighted moving average (MEWMA) chart with support vector machines (SVMs) for accurate and reliable detection of changes to land cover. Here, we utilize the MEWMA scheme to identify features corresponding to changed regions. Unfortunately, MEWMA schemes cannot discriminate between real changes and false changes. If a change is detected by the MEWMA algorithm, then we execute the SVM algorithm that is based on features corresponding to detected pixels to identify the type of change. We assess the effectiveness of this approach by using the remote-sensing change detection database and the SZTAKI AirChange benchmark data set. Our results show the capacity of our approach to detect changes to land cover.

  15. Fluorescence imaging to quantify crop residue cover

    Science.gov (United States)

    Daughtry, C. S. T.; Mcmurtrey, J. E., III; Chappelle, E. W.

    1994-01-01

    Crop residues, the portion of the crop left in the field after harvest, can be an important management factor in controlling soil erosion. Methods to quantify residue cover are needed that are rapid, accurate, and objective. Scenes with known amounts of crop residue were illuminated with long wave ultraviolet (UV) radiation and fluorescence images were recorded with an intensified video camera fitted with a 453 to 488 nm band pass filter. A light colored soil and a dark colored soil were used as background for the weathered soybean stems. Residue cover was determined by counting the proportion of the pixels in the image with fluorescence values greater than a threshold. Soil pixels had the lowest gray levels in the images. The values of the soybean residue pixels spanned nearly the full range of the 8-bit video data. Classification accuracies typically were within 3(absolute units) of measured cover values. Video imaging can provide an intuitive understanding of the fraction of the soil covered by residue.

  16. Tree and impervious cover change in U.S

    Science.gov (United States)

    David J. Nowak; Eric J. Greenfield

    2012-01-01

    Paired aerial photographs were interpreted to assess recent changes in tree, impervious and other cover types in 20 U.S. cities as well as urban land within the conterminous United States. National results indicate that tree cover in urban areas of the United States is on the decline at a rate of about 7900 ha/yr or 4.0 million trees per year. Tree cover in 17 of the...

  17. Fine Mapping Suggests that the Goat Polled Intersex Syndrome and the Human Blepharophimosis Ptosis Epicanthus Syndrome Map to a 100-kb Homologous Region

    OpenAIRE

    Schibler, Laurent; Cribiu, Edmond P.; Oustry-Vaiman, Anne; Furet, Jean-Pierre; Vaiman, Daniel

    2000-01-01

    To clone the goat Polled Intersex Syndrome (PIS) gene(s), a chromosome walk was performed from six entry points at 1q43. This enabled 91 BACs to be recovered from a recently constructed goat BAC library. Six BAC contigs of goat chromosome 1q43 (ICC1–ICC6) were thus constructed covering altogether 4.5 Mb. A total of 37 microsatellite sequences were isolated from this 4.5-Mb region (16 in this study), of which 33 were genotyped and mapped. ICC3 (1500 kb) was shown by genetic analysis to encompa...

  18. 41 CFR 301-11.638 - May we offer a lump sum payment to cover the income tax liability on the covered ITRA?

    Science.gov (United States)

    2010-07-01

    ... payment to cover the income tax liability on the covered ITRA? 301-11.638 Section 301-11.638 Public... Thereafter Agency Responsibilities § 301-11.638 May we offer a lump sum payment to cover the income tax... understands that he/she is responsible for any income taxes without further reimbursement. See the...

  19. 41 CFR 301-11.538 - May we offer a lump sum payment to cover the income tax liability on the covered ITRA?

    Science.gov (United States)

    2010-07-01

    ... payment to cover the income tax liability on the covered ITRA? 301-11.538 Section 301-11.538 Public... 1994 Agency Responsibilities § 301-11.538 May we offer a lump sum payment to cover the income tax... understands that he/she is responsible for any income taxes without further reimbursement. (See the...

  20. The canine sarcoglycan delta gene: BAC clone contig assembly, chromosome assignment and interrogation as a candidate gene for dilated cardiomyopathy in Dobermann dogs.

    Science.gov (United States)

    Stabej, P; Leegwater, P A J; Imholz, S; Versteeg, S A; Zijlstra, C; Stokhof, A A; Domanjko-Petriè, A; van Oost, B A

    2005-01-01

    Dilated cardiomyopathy (DCM) is a common disease of the myocardium recognized in human, dog and experimental animals. Genetic factors are responsible for a large proportion of cases in humans, and 17 genes with DCM causing mutations have been identified. The genetic origin of DCM in the Dobermann dogs has been suggested, but no disease genes have been identified to date. In this paper, we describe the characterization and evaluation of the canine sarcoglycan delta (SGCD), a gene implicated in DCM in human and hamster. Bacterial artificial chromosomes (BACs) containing the canine SGCD gene were isolated with probes for exon 3 and exons 4-8 and were characterized by Southern blot analysis. BAC end sequences were obtained for four BACs. Three of the BACs overlapped and could be ordered relative to each other and the end sequences of all four BACs could be anchored on the preliminary assembly of the dog genome sequence (www. ensembl.org). One of the BACs of the partial contig was localized by fluorescent in situ hybridization to canine chromosome 4q22, in agreement with the dog genome sequence. Two highly informative polymorphic microsatellite markers in intron 7 of the SGCD gene were identified. In 25 DCM-affected and 13 non DCM-affected dogs seven different haplotypes could be distinguished. However, no association between any of the SGCD variants and the disease locus was apparent.

  1. Chromosome breakage in Prader-Willi and Angelman syndrome deletions may involve recombination between a repeat at the proximal and distal breakpoints

    Energy Technology Data Exchange (ETDEWEB)

    Amos-Landgraf J.; Nicholls, R.D. [Case Western Reserve Univ., Cleveland, OH (United States); Gottlieb, W. [Univ. of Florida, Gainesville, FL (United States)] [and others

    1994-09-01

    Prader-Willi (PWS) and Angelman (AS) syndromes most commonly arise from large deletions of 15q11-q13. Deletions in PWS are paternal in origin, while those in AS are maternal in origin, clearly demonstrating genomic imprinting in these clinically distinct neurobehavioural disorders. In at least 90% of PWS and AS deletion patients, the same 4 Mb region within 15q11-q13 is deleted with breakpoints clustering in single YAC clones at the proximal and distal ends. To study the mechanism of chromosome breakage in PWS and AS, we have previously isolated 25 independent clones from these three YACs using Alu-vector PCR. Four clones were selected that appear to detect a low copy repeat that is located in the proximal and distal breakpoint regions of chromosome 15q11-q13. Three clones detect the same 4 HindIII bands in genomic DNA, all from 15q11-q13, with differing intensities for the probes located at the proximal or distal breakpoints region, respectively. This suggests that these probes detect related members of a low-copy repeat at either location. Moreover, the 254RL2 probe detects a novel HindIII band in two unrelated PWS deletion patients, suggesting that this may represent a breakpoint fragment, with recombination occurring within a similar interval in both patients. A fourth clone, 318RL3 detects 5 bands in HindIII-digested genomic DNA, all from 15q11-q13. This YAC endclone itself is not deleted in PWS and AS deletion patients, as seen by an invariant strong band. Two other strong bands are variably intact or deleted in different PWS or AS deletion patients, suggesting a relationship of this sequence to the breakpoints. Moreover, PCR using 318RL3 primers from the distal 93C9 YAC led to the isolation of a related clone with 96% identity, demonstrating the existence of a low-copy repeat with members close to the proximal and distal breakpoints. Taken together, our data suggest a complex, low-copy repeat with members at both the proximal and distal boundaries.

  2. Millennium Ecosystem Assessment: MA Rapid Land Cover Change

    Data.gov (United States)

    National Aeronautics and Space Administration — The Millennium Ecosystem Assessment: MA Rapid Land Cover Change provides data and information on global and regional land cover change in raster format for...

  3. Covering radii are not matroid invariants

    DEFF Research Database (Denmark)

    Britz, Thomas Johann; Rutherford, Carrie G.

    2005-01-01

    We show by example that the covering radius of a binary linear code is not generally determined by the Tutte polynomial of the matroid. This answers Problem 361 (P.J. Cameron (Ed.), Research problems, Discrete Math. 231 (2001) 469–478).......We show by example that the covering radius of a binary linear code is not generally determined by the Tutte polynomial of the matroid. This answers Problem 361 (P.J. Cameron (Ed.), Research problems, Discrete Math. 231 (2001) 469–478)....

  4. Winter rye cover crop effect on corn seedling pathogens

    Science.gov (United States)

    Cover crops have been grown successfully in Iowa, but sometimes a cereal rye cover crop preceding corn can reduce corn yields. Our research examines the effect of a rye cover crop on infections of the succeeding corn crop by soil fungal pathogens. Plant measurements included: growth stage, height, r...

  5. 16 CFR 501.5 - Paper table covers, bedsheets, pillowcases.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Paper table covers, bedsheets, pillowcases... REQUIREMENTS AND PROHIBITIONS UNDER PART 500 § 501.5 Paper table covers, bedsheets, pillowcases. Table covers, bedsheets, and pillowcases, fabricated from paper, are exempt from the requirements of § 500.12 of this...

  6. Automated energy conserving cover for refrigerated cabinet access openings

    International Nuclear Information System (INIS)

    Ibrahim, F.F.

    1984-01-01

    An automatically operated flexible barrier cover for the access openings of refrigerated display cabinets. The barrier cover limits the contact between the refrigerated air within the cabinet and the ambient air. The barrier cover can be moved over the access opening during non-customer use time periods when the retail food outlet is closed. The barrier cover can be arranged as a unitary assembly which can be manufactured and sold separately from the display cabinet as a retrofit device to effect energy savings. The flexible barrier cover can be stored in a reeled-up position or can be arranged as a folded flexible barrier which can be fanned out across the access opening. Various traction means are provided for moving the flexible barrier across the access opening

  7. Nuclear reactor coolant and cover gas system

    International Nuclear Information System (INIS)

    George, J.A.; Redding, A.H.; Tower, S.N.

    1976-01-01

    A core cooling system is disclosed for a nuclear reactor of the type utilizing a liquid coolant with a cover gas above free surfaces of the coolant. The disclosed system provides for a large inventory of reactor coolant and a balanced low pressure cover gas arrangement. A flow restricting device disposed within a reactor vessel achieves a pressure of the cover gas in the reactor vessel lower than the pressure of the reactor coolant in the vessel. The low gas pressure is maintained over all free surfaces of the coolant in the cooling system including a coolant reservoir tank. Reactor coolant stored in the reservoir tank allows for the large reactor coolant inventory provided by the invention

  8. Technical specification for fabrication of HANARO pool cover

    Energy Technology Data Exchange (ETDEWEB)

    Ryu, Jeong Soo; Woo, Sang Ik

    2001-06-01

    This technical specification details the requirements and the acceptance criteria for design, seismic analysis, function test, installation and quality assurance for HANARO pool cover which will be installed at the top of reactor pool. The pool cover is classified as non-nuclear safety, seismic category II and quality class T. The basic design of the pool cover for increasing HANARO applications has been carried out for supporting the driving devices which can load, unload and rotate the irradiation targets in the in-core and out-core vertical irradiation holes under on-power operation. The comments of HANARO user group related with irradiation tests have optimally considered in the process of design. The interference between fuel handling and control absorber units in the reactor pool and activities to load, unload and rotate the irradiation targets at the top of the reactor pool have been minimized. The pool cover can be moved for maintenance and can protect the reactor pool from unexpected drop of foreign materials. It provides the space to vertical access of driving devices for NTD, CT/IR and OR4/OR5 under on-power operation. And the pool cover assembly must maintain its structural integrity under seismic load. Based on the above design concept, the HANARO pool cover has been proposed as supporting structure of driving devices for NTD, fission moly and RI production under on-power operation.

  9. Temporal Land Cover Analysis for Net Ecosystem Improvement

    Energy Technology Data Exchange (ETDEWEB)

    Ke, Yinghai; Coleman, Andre M.; Diefenderfer, Heida L.

    2013-04-09

    We delineated 8 watersheds contributing to previously defined river reaches within the 1,468-km2 historical floodplain of the tidally influenced lower Columbia River and estuary. We assessed land-cover change at the watershed, reach, and restoration site scales by reclassifying remote-sensing data from the National Oceanic and Atmospheric Administration Coastal Change Analysis Program’s land cover/land change product into forest, wetland, and urban categories. The analysis showed a 198.3 km2 loss of forest cover during the first 6 years of the Columbia Estuary Ecosystem Restoration Program, 2001–2006. Total measured urbanization in the contributing watersheds of the estuary during the full 1996-2006 change analysis period was 48.4 km2. Trends in forest gain/loss and urbanization differed between watersheds. Wetland gains and losses were within the margin of error of the satellite imagery analysis. No significant land cover change was measured at restoration sites, although it was visible in aerial imagery, therefore, the 30-m land-cover product may not be appropriate for assessment of early-stage wetland restoration. These findings suggest that floodplain restoration sites in reaches downstream of watersheds with decreasing forest cover will be subject to increased sediment loads, and those downstream of urbanization will experience effects of increased impervious surfaces on hydrologic processes.

  10. CORINE land cover and floristic variation in a Mediterranean wetland.

    Science.gov (United States)

    Giallonardo, Tommaso; Landi, Marco; Frignani, Flavio; Geri, Francesco; Lastrucci, Lorenzo; Angiolini, Claudia

    2011-11-01

    The aims of the present study were to: (1) investigate whether CORINE land cover classes reflect significant differences in floristic composition, using a very detailed CORINE land cover map (scale 1:5000); (2) decompose the relationships between floristic assemblages and three groups of explanatory variables (CORINE land cover classes, environmental characteristics and spatial structure) into unique and interactive components. Stratified sampling was used to select a set of 100-m(2) plots in each land cover class identified in the semi-natural wetland surrounding a lake in central Italy. The following six classes were considered: stable meadows, deciduous oak dominated woods, hygrophilous broadleaf dominated woods, heaths and shrublands, inland swamps, canals or watercourses. The relationship between land cover classes and floristic composition was tested using several statistical techniques in order to determine whether the results remained consistent with different procedures. The variation partitioning approach was applied to identify the relative importance of three groups of explanatory variables in relation to floristic variation. The most important predictor was land cover, which explained 20.7% of the variation in plant distribution, although the hypothesis that each land cover class could be associated with a particular floristic pattern was not verified. Multi Response Permutation Analysis did not indicate a strong floristic separability between land cover classes and only 9.5% of species showed a significant indicator value for a specific land cover class. We suggest that land cover classes linked with hygrophilous and herbaceous communities in a wetland may have floristic patterns that vary with fine scale and are not compatible with a land cover map.

  11. 26 CFR 31.3121(j)-1 - Covered transportation service.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Covered transportation service. 31.3121(j)-1... § 31.3121(j)-1 Covered transportation service. (a) Transportation systems acquired in whole or in part... operation of a public transportation system constitutes covered transportation service if any part of the...

  12. T Tank Farm Interim Cover Test - Design Plan

    International Nuclear Information System (INIS)

    Zhang, Z. F.; Keller, Jason M.

    2006-01-01

    The Hanford Site has 149 underground single-shell tanks that store hazardous radioactive waste. Many of these tanks and their associated infrastructure (e.g., pipelines, diversion boxes) have leaked. Some of the leaked waste has entered the groundwater. The largest known leak occurred from the T-106 Tank in 1973. Many of the contaminants from that leak still reside within the vadose zone beneath the T Tank Farm. CH2M Hill Hanford Group, Inc. seeks to minimize movement of this residual contaminant plume by placing an interim cover on the surface. Such a cover is expected to prevent infiltrating water from reaching the plume and moving it further. Pacific Northwest National Laboratory has prepared a design plan to monitor and determine the effectiveness of the interim cover. A three-dimensional numerical simulation of water movement beneath a cover was conducted to guide the design of the plan. Soil water content, water pressure, and temperature will be monitored using off-the-shelf equipment that can be installed by the hydraulic hammer technique. In fiscal year 2006, two instrument nests will be installed, one inside and one outside of the proposed cover. In fiscal year 2007, two additional instrument nests, both inside the proposed cover, will be installed. Each instrument nest contains a neutron access tube and a capacitance probe (to measure water content), and four heat-dissipation units (to measure pressure head and temperature). A datalogger and a meteorological station will be installed outside of the fence. Two drain gauges will be installed in locations inside and outside the cover for the purpose of measuring soil water flux.

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB882 (Link to dictyBase) - - - Contig-U13884-1 VFB882E (Link...) Clone ID VFB882 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13884-1 Ori... m_ : 1.00 48.0 %: cytoplasmic 44.0 %: nuclear 4.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  14. The Norrie disease gene maps to a 150 kb region on chromosome Xp11.3.

    Science.gov (United States)

    Sims, K B; Lebo, R V; Benson, G; Shalish, C; Schuback, D; Chen, Z Y; Bruns, G; Craig, I W; Golbus, M S; Breakefield, X O

    1992-05-01

    Norrie disease is a human X-linked recessive disorder of unknown etiology characterized by congenital blindness, sensory neural deafness and mental retardation. This disease gene was previously linked to the DXS7 (L1.28) locus and the MAO genes in band Xp11.3. We report here fine physical mapping of the obligate region containing the Norrie disease gene (NDP) defined by a recombination and by the smallest submicroscopic chromosomal deletion associated with Norrie disease identified to date. Analysis, using in addition two overlapping YAC clones from this region, allowed orientation of the MAOA and MAOB genes in a 5'-3'-3'-5' configuration. A recombination event between a (GT)n polymorphism in intron 2 of the MAOB gene and the NDP locus, in a family previously reported to have a recombination between DXS7 and NDP, delineates a flanking marker telomeric to this disease gene. An anonymous DNA probe, dc12, present in one of the YACs and in a patient with a submicroscopic deletion which includes MAOA and MAOB but not L1.28, serves as a flanking marker centromeric to the disease gene. An Alu-PCR fragment from the right arm of the MAO YAC (YMAO.AluR) is not deleted in this patient and also delineates the centromeric extent of the obligate disease region. The apparent order of these loci is telomere ... DXS7-MAOA-MAOB-NDP-dc12-YMAO.AluR ... centromere. Together these data define the obligate region containing the NDP gene to a chromosomal segment less than 150 kb.

  15. Cover crops support ecological intensification of arable cropping systems

    Science.gov (United States)

    Wittwer, Raphaël A.; Dorn, Brigitte; Jossi, Werner; van der Heijden, Marcel G. A.

    2017-02-01

    A major challenge for agriculture is to enhance productivity with minimum impact on the environment. Several studies indicate that cover crops could replace anthropogenic inputs and enhance crop productivity. However, so far, it is unclear if cover crop effects vary between different cropping systems, and direct comparisons among major arable production systems are rare. Here we compared the short-term effects of various cover crops on crop yield, nitrogen uptake, and weed infestation in four arable production systems (conventional cropping with intensive tillage and no-tillage; organic cropping with intensive tillage and reduced tillage). We hypothesized that cover cropping effects increase with decreasing management intensity. Our study demonstrated that cover crop effects on crop yield were highest in the organic system with reduced tillage (+24%), intermediate in the organic system with tillage (+13%) and in the conventional system with no tillage (+8%) and lowest in the conventional system with tillage (+2%). Our results indicate that cover crops are essential to maintaining a certain yield level when soil tillage intensity is reduced (e.g. under conservation agriculture), or when production is converted to organic agriculture. Thus, the inclusion of cover crops provides additional opportunities to increase the yield of lower intensity production systems and contribute to ecological intensification.

  16. Impacts of Land Cover Changes on Climate over China

    Science.gov (United States)

    Chen, L.; Frauenfeld, O. W.

    2014-12-01

    Land cover changes can influence regional climate through modifying the surface energy balance and water fluxes, and can also affect climate at large scales via changes in atmospheric general circulation. With rapid population growth and economic development, China has experienced significant land cover changes, such as deforestation, grassland degradation, and farmland expansion. In this study, the Community Earth System Model (CESM) is used to investigate the climate impacts of anthropogenic land cover changes over China. To isolate the climatic effects of land cover change, we focus on the CAM and CLM models, with prescribed climatological sea surface temperature and sea ice cover. Two experiments were performed, one with current vegetation and the other with potential vegetation. Current vegetation conditions were derived from Moderate Resolution Imaging Spectroradiometer (MODIS) satellite observations, and potential vegetation over China was obtained from Ramankutty and Foley's global potential vegetation dataset. Impacts of land cover changes on surface air temperature and precipitation are assessed based on the difference of the two experiments. Results suggest that land cover changes have a cold-season cooling effect in a large region of China, but a warming effect in summer. These temperature changes can be reconciled with albedo forcing and evapotranspiration. Moreover, impacts on atmospheric circulation and the Asian Monsoon is also discussed.

  17. ON f-EDGE COVER-COLOURING OF SIMPLE GRAPHS

    Institute of Scientific and Technical Information of China (English)

    Song Huimin; Liu Guizhen

    2005-01-01

    An f-edge cover-colouring of a graph G = (V, E) is an assignment of colours to the edges of G such that every colour appears at each vertex υ∈ V at least f(υ) times.The maximum number of colours needed to f-edge cover colour G is called the f-edge cover chromatic index of G, denoted by χfc(G). This paper gives that min[d(ν)-1/f(ν)] ≤χfc(G) ≤min[d(υ)/f(υ)].

  18. MATERIALS FOR THE FINAL COVER OF SANITARY LANDFILLS

    OpenAIRE

    Davorin Kovačić

    1994-01-01

    The paper deals with the selection of materials for the sea¬ling layer in the final cover of sanitary landfills. The sealing la¬yer is the most critical component of the final cover. Its role is to minimize percolation of water through the final cover. Ma¬terials used for the construction of the sealing layer are either of mineral origin (compacted clay) or geosynthetic (geomem¬brane). They are most often used in combination creating com¬posite liners. Recently alternative materials are also ...

  19. Sky cover from MFRSR observations

    Directory of Open Access Journals (Sweden)

    E. Kassianov

    2011-07-01

    Full Text Available The diffuse all-sky surface irradiances measured at two nearby wavelengths in the visible spectral range and their modeled clear-sky counterparts are the main components of a new method for estimating the fractional sky cover of different cloud types, including cumuli. The performance of this method is illustrated using 1-min resolution data from a ground-based Multi-Filter Rotating Shadowband Radiometer (MFRSR. The MFRSR data are collected at the US Department of Energy Atmospheric Radiation Measurement (ARM Climate Research Facility (ACRF Southern Great Plains (SGP site during the summer of 2007 and represent 13 days with cumuli. Good agreement is obtained between estimated values of the fractional sky cover and those provided by a well-established independent method based on broadband observations.

  20. Modeled impact of anthropogenic land cover change on climate

    Science.gov (United States)

    Findell, K.L.; Shevliakova, E.; Milly, P.C.D.; Stouffer, R.J.

    2007-01-01

    Equilibrium experiments with the Geophysical Fluid Dynamics Laboratory's climate model are used to investigate the impact of anthropogenic land cover change on climate. Regions of altered land cover include large portions of Europe, India, eastern China, and the eastern United States. Smaller areas of change are present in various tropical regions. This study focuses on the impacts of biophysical changes associated with the land cover change (albedo, root and stomatal properties, roughness length), which is almost exclusively a conversion from forest to grassland in the model; the effects of irrigation or other water management practices and the effects of atmospheric carbon dioxide changes associated with land cover conversion are not included in these experiments. The model suggests that observed land cover changes have little or no impact on globally averaged climatic variables (e.g., 2-m air temperature is 0.008 K warmer in a simulation with 1990 land cover compared to a simulation with potential natural vegetation cover). Differences in the annual mean climatic fields analyzed did not exhibit global field significance. Within some of the regions of land cover change, however, there are relatively large changes of many surface climatic variables. These changes are highly significant locally in the annual mean and in most months of the year in eastern Europe and northern India. They can be explained mainly as direct and indirect consequences of model-prescribed increases in surface albedo, decreases in rooting depth, and changes of stomatal control that accompany deforestation. ?? 2007 American Meteorological Society.

  1. Stakes and modalities of the climatic risk covering

    International Nuclear Information System (INIS)

    Marteau, D.

    2006-01-01

    Several econometric works show that climatic volatility is at the first rank of the risk factors in several economic sectors like energy, textile, agriculture and food, tourism, leisure, building industries etc. However, climate remains an underestimated economic factor for several reasons: lack of awareness about the comparative stakes of climate risks management and market risks management, difficulties in the measurement of climate risk exposure, weak knowledge of covering techniques for private contract and organized markets, and unsolved question of risk sharing between shareholders and managers. This document analyzes the sensitivity of companies with respect to climate risk and describes the 5 steps of implementation of a climate covering policy: risk exposure measurement, risk bearing or transfer decision, definition of the optimum covering profile, choice of markets and covering instruments, efficiency measurement. A practical example is shown with its related questions. (J.S.)

  2. Design and Installation of a Disposal Cell Cover Field Test

    Energy Technology Data Exchange (ETDEWEB)

    Benson, C.H. [University of Wisconsin–Madison, Madison, Wisconsin; Waugh, W.J. [S.M. Stoller Corporation, Grand Junction, Colorado; Albright, W.H. [Desert Research Institute, Reno, Nevada; Smith, G.M. [Geo-Smith Engineering, Grand Junction, Colorado; Bush, R.P. [U.S. Department of Energy, Grand Junction, Colorado

    2011-02-27

    The U.S. Department of Energy’s Office of Legacy Management (LM) initiated a cover assessment project in September 2007 to evaluate an inexpensive approach to enhancing the hydrological performance of final covers for disposal cells. The objective is to accelerate and enhance natural processes that are transforming existing conventional covers, which rely on low-conductivity earthen barriers, into water balance covers, that store water in soil and release it as soil evaporation and plant transpiration. A low conductivity cover could be modified by deliberately blending the upper layers of the cover profile and planting native shrubs. A test facility was constructed at the Grand Junction, Colorado, Disposal Site to evaluate the proposed methodology. The test cover was constructed in two identical sections, each including a large drainage lysimeter. The test cover was constructed with the same design and using the same materials as the existing disposal cell in order to allow for a direct comparison of performance. One test section will be renovated using the proposed method; the other is a control. LM is using the lysimeters to evaluate the effectiveness of the renovation treatment by monitoring hydrologic conditions within the cover profile as well as all water entering and leaving the system. This paper describes the historical experience of final covers employing earthen barrier layers, the design and operation of the lysimeter test facility, testing conducted to characterize the as-built engineering and edaphic properties of the lysimeter soils, the calibration of instruments installed at the test facility, and monitoring data collected since the lysimeters were constructed.

  3. Soybean growth and yield under cover crops

    Directory of Open Access Journals (Sweden)

    Priscila de Oliveira

    2013-04-01

    Full Text Available The use of cover crops in no-tillage systems can provide better conditions for the development of soybean plants with positive effects on grain yield and growth analysis techniques allow researchers to characterize and understand the behavior of soybean plants under different straw covers. Thus, the aim of this study was to characterize, using growth analysis, yield components and agronomic performance of soybean under common bean, Brachiaria brizantha and pearl millet straws. The experiment was performed on a soil under cerrado in the municipality of Santo Antônio de Goiás, GO. The experiment was arranged in a randomized complete block design with three treatments (cover crops and five replications. Soybean grain yield was lower in the B. brizantha straw treatment (3,708 kg ha-1 than both in the pearl millet (4.772 kg ha-1 and common bean straw treatments (5,200 kg ha-1. The soybean growth analysis in B. brizantha, pearl millet and common bean allowed characterizing the variation in the production of dry matter of leaves, stems, pods and total and leaf area index that provided different grain yields. The cover crop directly affects the soybean grain yield.

  4. Dicty_cDB: SHA665 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT

  5. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB595 (Link to dictyBase) - - - Contig-U09552-1 VFB595E (Link...) Clone ID VFB595 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Ori...KLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEENKTL EDIIKVVDDFCKILPAAYKTDCVA...A: VEGSGECLVCEFISEKIVTYLEANQTETQILQYLDNDCKLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT... Sequences producing significant alignments: (bits) Value N U66367 |U66367.1 Dictyostelium discoideum SapA (

  7. Dicty_cDB: VHJ417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHJ417 (Link to dictyBase) - G23450 DDB0202154 Contig-U12507-1...brary) Clone ID VHJ417 (Link to dictyBase) Atlas ID - NBRP ID G23450 dictyBase ID DDB0202154 Link to Contig ...Contig-U12507-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHJ4-...LLSAVSDSSVQSLSSSI--- ---IDEIKQSVFGATAIIGQSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN...QSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN YQKDGSNNNNNNNNNNSNNSNSNSSSNNSGSNNSSNNNSPNNLTPKKQTFKSLSTSSSTP NNLSQ

  8. Dicty_cDB: CHK172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHK172 (Link to dictyBase) - - - Contig-U11104-1 - (Link to Or...iginal site) CHK172F 626 - - - - - - Show CHK172 Library CH (Link to library) Clone ID CHK172 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11104-1 Original site URL http://dictycdb.b...HEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYTRASKAYIHLAQYDQAASII VRGLVFDPRN...KMDHEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYT

  9. Dicty_cDB: VFH641 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH641 (Link to dictyBase) - - - Contig-U16151-1 VFH641E (Link... Clone ID VFH641 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16151-1 Original site URL http://dict...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...nificant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum

  10. Dicty_cDB: CHA557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA557 (Link to dictyBase) - - - Contig-U15635-1 - (Link to Or...iginal site) CHA557F 620 - - - - - - Show CHA557 Library CH (Link to library) Clone ID CHA557 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15635-1 Original site URL http://dictycdb.b...HSIEIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGTGTDLPLL KWLEKYTFPVESKFKD...EIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGT

  11. Dicty_cDB: SLA117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

  12. Dicty_cDB: SHE695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHE695 (Link to dictyBase) - G22060 DDB0217012 Contig-U12072-1...brary) Clone ID SHE695 (Link to dictyBase) Atlas ID - NBRP ID G22060 dictyBase ID DDB0217012 Link to Contig ...Contig-U12072-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHE6-...CPISDCSDHGYCDTSIGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMN...IGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMNFVSCPTPNRSVCSGWGTCNNQTGICT

  13. Cover gases in nuclear reactors with special reference to argon

    International Nuclear Information System (INIS)

    Jose, C.J.; Shah, G.C.; Prabhu, L.H.; Vartak, D.G.

    1975-01-01

    The report describes the specifications of an ideal cover gas for the smooth operation of a nuclear reactor. The advantages of using helium as cover gas, the sources of impurities in helium cover gas and the methods of purification of helium are given in detail. Various problems associated with the use of argon as cover gas and methods to purify and decontaminate argon cover gas are discussed on the basis of experimental data collected. A laboratory model of the system which can be used to evaluate the performance of the gas purification adsorbents is also described. (author)

  14. A physical map of the heterozygous grapevine 'Cabernet Sauvignon' allows mapping candidate genes for disease resistance

    Directory of Open Access Journals (Sweden)

    Scalabrin Simone

    2008-06-01

    Full Text Available Abstract Background Whole-genome physical maps facilitate genome sequencing, sequence assembly, mapping of candidate genes, and the design of targeted genetic markers. An automated protocol was used to construct a Vitis vinifera 'Cabernet Sauvignon' physical map. The quality of the result was addressed with regard to the effect of high heterozygosity on the accuracy of contig assembly. Its usefulness for the genome-wide mapping of genes for disease resistance, which is an important trait for grapevine, was then assessed. Results The physical map included 29,727 BAC clones assembled into 1,770 contigs, spanning 715,684 kbp, and corresponding to 1.5-fold the genome size. Map inflation was due to high heterozygosity, which caused either the separation of allelic BACs in two different contigs, or local mis-assembly in contigs containing BACs from the two haplotypes. Genetic markers anchored 395 contigs or 255,476 kbp to chromosomes. The fully automated assembly and anchorage procedures were validated by BAC-by-BAC blast of the end sequences against the grape genome sequence, unveiling 7.3% of chimerical contigs. The distribution across the physical map of candidate genes for non-host and host resistance, and for defence signalling pathways was then studied. NBS-LRR and RLK genes for host resistance were found in 424 contigs, 133 of them (32% were assigned to chromosomes, on which they are mostly organised in clusters. Non-host and defence signalling genes were found in 99 contigs dispersed without a discernable pattern across the genome. Conclusion Despite some limitations that interfere with the correct assembly of heterozygous clones into contigs, the 'Cabernet Sauvignon' physical map is a useful and reliable intermediary step between a genetic map and the genome sequence. This tool was successfully exploited for a quick mapping of complex families of genes, and it strengthened previous clues of co-localisation of major NBS-LRR clusters and

  15. Study on the inside gas flow visualization of oxygen sensor cover; Kashika ni yoru O2 sensor cover nai no gas nagare hyoka

    Energy Technology Data Exchange (ETDEWEB)

    Hocho, S; Mitsuishi, Y; Inagaki, M [Nippon Soken, Inc., Tokyo (Japan); Hamaguchi, S; Mizusawa, K [Toyota Motor Corp., Aichi (Japan)

    1997-10-01

    In order to make clear the difference of the response time between the oxygen sensors with different protection covers, we visualized gas flow inside of sensor covers by means of two experimental methods: One is `Smoke Suspension Method` using liquid paraffin vapor as the smoke. With smoke suspension method, we detected the streamlines inside of the covers. The other is `Color Reaction Method` using the reaction of phenolphthalein and NH3 gas. With color reaction method, we confirmed the streamline inside of the cover and furthermore detected the difference of the response time of each sensor. 3 refs., 7 figs., 1 tab.

  16. 49 CFR 192.327 - Cover.

    Science.gov (United States)

    2010-10-01

    ... locations 36 (914) 24 (610) Drainage ditches of public roads and railroad crossings 36 (914) 24 (610) (b... least 24 inches (610 millimeters) of cover. (c) Where an underground structure prevents the installation...

  17. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jian-Ying; Ibragimov, Rashid

    2013-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting ...

  18. Oxygen diffusion through soil covers on sulphidic mine tailings

    International Nuclear Information System (INIS)

    Yanful, E.K.

    1993-01-01

    Engineered soil covers are being evaluated under Canada's Mine Environment Neutral Drainage (MEND) program for their effectiveness in preventing and controlling acid generation in sulfidic mill tailings. A critical parameter for predicting the performance of these covers is the diffusion coefficient of gaseous oxygen in the cover materials. Laboratory experiments conducted to determine the effective diffusion coefficient of a candidate cover material, a glacial till from an active mine site, are described. The diffusion coefficient is determined by fitting a semianalytic solution of the one-dimensional, transient diffusion equation to experimental gaseous oxygen concentration versus time graphs. Effective diffusion coefficients determined at high water saturations (85%--95%) were of the order of 8 x 10 -8 m 2 /s. The diffusion coefficients decreased with increase in water saturation as a result of the low diffusivity of gaseous oxygen in water relative to that in air and the low solubility of oxygen in water. Placement of soil covers in high saturation conditions would ensure that the flux of oxygen into tailings underneath such covers is low, resulting in low acid flux. This is confirmed by combined laboratory, field, and modeling studies

  19. Interfacial stability of soil covers on lined surface impoundments

    International Nuclear Information System (INIS)

    Mitchell, D.H.; Gates, T.E.

    1986-04-01

    The factors affecting the interfacial stability of soil covers on geomembranes were examined to determine the maximum stable slopes for soil cover/geomembrane systems. Several instances of instability of soil covers on geomembranes have occurred at tailings ponds, leaving exposed geomembranes with the potential for physical ddamage and possibly chemical and ultraviolet degradation. From an operator's viewpoint, it is desirable to maximize the slope of lined facilities in order to maximize the volume-to-area ratio; however, the likelihood for instability also increases with increasing slope. Frictional data obtained from direct shear tests are compared with stability data obtained using a nine-square-meter (m 2 ) engineering-scale test stand to verify that direct shear test data are valid in slope design calculations. Interfacial frictional data from direct shear tests using high-density polyethylene and a poorly graded sand cover agree within several degrees with the engineering-scale tests. Additional tests with other soils and geomembranes are planned. The instability of soil covers is not always an interfacial problem; soil erosion and limited drainage capacity are additional factors that must be considered in the design of covered slopes. 7 refs., 5 figs., 2 tabs

  20. Cover Image, Volume 233, Number 7, July 2018.

    Science.gov (United States)

    Yin, Chong; Zhang, Yan; Hu, Lifang; Tian, Ye; Chen, Zhihao; Li, Dijie; Zhao, Fan; Su, Peihong; Ma, Xiaoli; Zhang, Ge; Miao, Zhiping; Wang, Liping; Qian, Airong; Xian, Cory J

    2018-07-01

    Cover: The cover image, by Yin et al., is based on the Original Research Article, Mechanical unloading reduces microtubule actin crosslinking factor 1 expression to inhibit β-Catenin Signaling and osteoblast proliferation, DOI: 10.1002/jcp.26374. © 2018 Wiley Periodicals, Inc.

  1. Cover song identification by sequence alignment algorithms

    Science.gov (United States)

    Wang, Chih-Li; Zhong, Qian; Wang, Szu-Ying; Roychowdhury, Vwani

    2011-10-01

    Content-based music analysis has drawn much attention due to the rapidly growing digital music market. This paper describes a method that can be used to effectively identify cover songs. A cover song is a song that preserves only the crucial melody of its reference song but different in some other acoustic properties. Hence, the beat/chroma-synchronous chromagram, which is insensitive to the variation of the timber or rhythm of songs but sensitive to the melody, is chosen. The key transposition is achieved by cyclically shifting the chromatic domain of the chromagram. By using the Hidden Markov Model (HMM) to obtain the time sequences of songs, the system is made even more robust. Similar structure or length between the cover songs and its reference are not necessary by the Smith-Waterman Alignment Algorithm.

  2. UMTRAP research on cover design for uranium mill tailings

    International Nuclear Information System (INIS)

    Rogers, V.C.; Nielson, K.K.

    1984-01-01

    As a result of the UMTRAP research on radon attenuation and tailings cover design, the basis and general procedures are available for designing covers for uranium tailings piles to meet present criteria for radon emissions. The general procedures involve assessment of the radon source strength of the tailings, definition of candidate cover materials, assessment of their moisture retention and radon diffusion properties, computing the required thicknesses of these materials, comparing costs, and evaluating long-term performance criteria. Final selection of the cover design must assure adequate long-term performance and radon retention as first priority, and keep costs to a minimum in achieving this goal

  3. Integration of multiple, excess, backup, and expected covering models

    OpenAIRE

    M S Daskin; K Hogan; C ReVelle

    1988-01-01

    The concepts of multiple, excess, backup, and expected coverage are defined. Model formulations using these constructs are reviewed and contrasted to illustrate the relationships between them. Several new formulations are presented as is a new derivation of the expected covering model which indicates more clearly the relationship of the model to other multi-state covering models. An expected covering model with multiple time standards is also presented.

  4. Estimation of snow cover distribution in Beas basin, Indian Himalaya ...

    Indian Academy of Sciences (India)

    In the present paper, a methodology has been developed for the mapping of snow cover in Beas ... Different snow cover mapping methods using snow indices are compared to find the suitable ... cover are important factors for human activities,.

  5. Development of 2010 national land cover database for the Nepal.

    Science.gov (United States)

    Uddin, Kabir; Shrestha, Him Lal; Murthy, M S R; Bajracharya, Birendra; Shrestha, Basanta; Gilani, Hammad; Pradhan, Sudip; Dangol, Bikash

    2015-01-15

    Land cover and its change analysis across the Hindu Kush Himalayan (HKH) region is realized as an urgent need to support diverse issues of environmental conservation. This study presents the first and most complete national land cover database of Nepal prepared using public domain Landsat TM data of 2010 and replicable methodology. The study estimated that 39.1% of Nepal is covered by forests and 29.83% by agriculture. Patch and edge forests constituting 23.4% of national forest cover revealed proximate biotic interferences over the forests. Core forests constituted 79.3% of forests of Protected areas where as 63% of area was under core forests in the outside protected area. Physiographic regions wise forest fragmentation analysis revealed specific conservation requirements for productive hill and mid mountain regions. Comparative analysis with Landsat TM based global land cover product showed difference of the order of 30-60% among different land cover classes stressing the need for significant improvements for national level adoption. The online web based land cover validation tool is developed for continual improvement of land cover product. The potential use of the data set for national and regional level sustainable land use planning strategies and meeting several global commitments also highlighted. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. Cover technology demonstration for low-level radioactive sites

    International Nuclear Information System (INIS)

    Barnes, F.J.; Warren, J.L.

    1988-01-01

    The performance of a shallow land burial site in isolating low-level radioactive and mixed waste is strongly influenced by the behavior of the precipitation falling on the site. Predicting the long-term integrity of a cover design requires a knowledge of the water balance dynamics, and the use of predictive models. The multiplicity of factors operating on a site in the years post-closure (precipitation intensity and duration, soil conditions, vegetation seasonality and variability) have made it extremely difficult to predict the effects of natural precipitation with accuracy. Preliminary results are presented on a three-year field demonstration at Los Alamos National Laboratory to evaluate the influence of different waste trench cap designs on water balance under natural precipitation. Erosion plots having two different vegetative covers (shrubs and grasses) and with either gravel-mulched or unmulched soil surface treatments have been established on three different soil profiles on an inactive waste site. Total runoff and soil loss from each plot are measured biweekly while plant canopy cover is measured seasonally. Preliminary results from the first year show that the application of a gravel mulch reduced runoff by 73 to 90%. Total soil loss was reduced by 83 to 93% by the mulch treatment. On unmulched plots, grass cover reduced both runoff and soil loss by about 50% compared to the shrub plots. Soil moisture reduction during the growing season was more pronounced on the shrub plots. This indicates that a more complex vegetative cover provides greater soil moisture storage capacity for winter precipitation than the usual grass cover

  7. Land-cover change in the Ozark Highlands, 1973-2000

    Science.gov (United States)

    Karstensen, Krista A.

    2010-01-01

    Led by the Geographic Analysis and Monitoring Program of the U.S. Geological Survey (USGS) in collaboration with the U.S. Environmental Protection Agency (EPA) and the National Aeronautics and Space Administration (NASA), the Land-Cover Trends Project was initiated in 1999 and aims to document the types, geographic distributions, and rates of land-cover change on a region by region basis for the conterminous United States, and to determine some of the key drivers and consequences of the change (Loveland and others, 2002). For 1973, 1980, 1986, 1992, and 2000 land-cover maps derived from the Landsat series are classified by visual interpretation, inspection of historical aerial photography and ground survey, into 11 land-cover classes. The classes are defined to capture land cover that is discernable in Landsat data. A stratified probability-based sampling methodology undertaken within the 84 Omernik Level III Ecoregions (Omernik, 1987) was used to locate the blocks, with 9 to 48 blocks per ecoregion. The sampling was designed to enable a statistically robust 'scaling up' of the sample-classification data to estimate areal land-cover change within each ecoregion (Loveland and others, 2002; Stehman and others, 2005). At the time of writing, approximately 90 percent of the 84 conterminous United States ecoregions have been processed by the Land-Cover Trends Project. Results from these completed ecoregions illustrate that across the conterminous United States there is no single profile of land-cover/land-use change, rather, there are varying pulses affected by clusters of change agents (Loveland and others, 2002). Land-Cover Trends Project results for the conterminous United States to-date are being used for collaborative environmental change research with partners such as; the National Science Foundation, the National Oceanic and Atmospheric Administration, and the U.S. Fish and Wildlife Service. The strategy has also been adapted for use in a NASA global

  8. MATERIALS FOR THE FINAL COVER OF SANITARY LANDFILLS

    Directory of Open Access Journals (Sweden)

    Davorin Kovačić

    1994-12-01

    Full Text Available The paper deals with the selection of materials for the sea¬ling layer in the final cover of sanitary landfills. The sealing la¬yer is the most critical component of the final cover. Its role is to minimize percolation of water through the final cover. Ma¬terials used for the construction of the sealing layer are either of mineral origin (compacted clay or geosynthetic (geomem¬brane. They are most often used in combination creating com¬posite liners. Recently alternative materials are also used like paper mill sludge or discarded swelling clay.

  9. Land Cover Classification Using ALOS Imagery For Penang, Malaysia

    International Nuclear Information System (INIS)

    Sim, C K; Abdullah, K; MatJafri, M Z; Lim, H S

    2014-01-01

    This paper presents the potential of integrating optical and radar remote sensing data to improve automatic land cover mapping. The analysis involved standard image processing, and consists of spectral signature extraction and application of a statistical decision rule to identify land cover categories. A maximum likelihood classifier is utilized to determine different land cover categories. Ground reference data from sites throughout the study area are collected for training and validation. The land cover information was extracted from the digital data using PCI Geomatica 10.3.2 software package. The variations in classification accuracy due to a number of radar imaging processing techniques are studied. The relationship between the processing window and the land classification is also investigated. The classification accuracies from the optical and radar feature combinations are studied. Our research finds that fusion of radar and optical significantly improved classification accuracies. This study indicates that the land cover/use can be mapped accurately by using this approach

  10. Dicty_cDB: SFH450 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH450 (Link to dictyBase) - - - Contig-U13857-1 SFH450F (Link... to Original site) SFH450F 623 - - - - - - Show SFH450 Library SF (Link to library) Clone ID SFH450 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13857-1 Original site URL http://dict...IMIIFLCLEATFDQPYHSIGGFIIVCSGYQLGQGIAGGAFSGIIPDVVHPSQSGI ASGWLGVGFSLGLLIGTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICT...GTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICTMHEDSND EWSFDGSLPSFFKSLHLPSSIYFNFYWVLITRFFNTLGIYMIFSFLLYFATDIIGQTNLM T

  11. Dicty_cDB: SFH236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC

  12. Dicty_cDB: SFC488 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC488 (Link to dictyBase) - - - Contig-U10843-1 SFC488F (Link... to Original site) SFC488F 556 - - - - - - Show SFC488 Library SF (Link to library) Clone ID SFC488 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...ETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLLLDPMVKLPLITRMRMAKD...yhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQAQ SASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICT

  13. Dicty_cDB: CFH353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH353 (Link to dictyBase) - - - Contig-U16205-1 CFH353Z (Link... to Original site) - - CFH353Z 625 - - - - Show CFH353 Library CF (Link to library) Clone ID CFH353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dict...RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIRVELKP...: ---RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIR

  14. Dicty_cDB: SFF779 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFF779 (Link to dictyBase) - - - Contig-U16255-1 SFF779Z (Link... to Original site) - - SFF779Z 731 - - - - Show SFF779 Library SF (Link to library) Clone ID SFF779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...NATCSSLNCNAQQMSCKYVXQACHETSCCPDIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLA...DIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSH

  15. Dicty_cDB: SHL605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL605 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) SHL605F 632 - - - - - - Show SHL605 Library SH (Link to library) Clone ID SHL605 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...VDLIRGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQK LTYIQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICT...KRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL RPAFPKLREKLDDPE

  16. Dicty_cDB: CHD753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD753 (Link to dictyBase) - - - Contig-U15579-1 - (Link to Or...iginal site) - - CHD753Z 650 - - - - Show CHD753 Library CH (Link to library) Clone ID CHD753 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dictycdb.b...---IQACGPDNNYQCEFVDKICNTTNDKCLVESCEIGFGCLAIPKNCNDNDPCTTDHCDP AIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICT...NPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVPPRPTP TPLPADPPPYDLEEGCLV

  17. Dicty_cDB: CFG115 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFG115 (Link to dictyBase) - - - Contig-U03237-1 CFG115E (Link...) Clone ID CFG115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03237-1 Ori...k*NNMNGFLKSQLENKTNATTTTTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICT...TTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICTDNNDCTMDWCNQLTGECVYQ...ng significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 256

  18. Dicty_cDB: SSA581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  19. Dicty_cDB: SFI222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT

  20. Dicty_cDB: SLE232 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE232 (Link to dictyBase) - - - Contig-U16255-1 SLE232F (Link... to Original site) SLE232F 614 - - - - - - Show SLE232 Library SL (Link to library) Clone ID SLE232 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...PSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST ...CHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST TGSHTTTGGSTTGSHTTTGGSTTGSHTTTGGSA

  1. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC278 (Link to dictyBase) - - - Contig-U13504-1 VFC278E (Link... Clone ID VFC278 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13504-1 Original site URL http://dict...0.0 %: mitochondrial 4.0 %: plasma membrane >> prediction for VFC278 is cyt 5' end seq. ID VFC278F 5' end se

  2. Dicty_cDB: VFJ144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFJ144 (Link to dictyBase) - - - Contig-U12576-1 - (Link to Or...iginal site) - - VFJ144Z 698 - - - - Show VFJ144 Library VF (Link to library) Clone ID VFJ144 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dictycdb.b...IGIDDELGPQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Translated A...PQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Frame B: ---givrkyl*

  3. 12 CFR 207.6 - Disclosure of covered agreements.

    Science.gov (United States)

    2010-01-01

    ... DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS (REGULATION G) § 207.6 Disclosure of covered agreements... CRA public file by insured depository institution or affiliate. An insured depository institution and...) by placing a copy of the covered agreement in the insured depository institution's CRA public file if...

  4. "(Un)covering" in the Classroom: Managing Stigma beyond the Closet

    Science.gov (United States)

    Branfman, Jonathan

    2017-01-01

    While many instructors closet stigmatized identities, others "downplay" them--a tactic that sociologist Erving Goffman terms "covering." What are the personal, ethical, and pedagogical costs of covering? What are the gains? How can feminist university instructors cover stigmatized identities without fueling oppressive…

  5. Estimating pinyon and juniper cover across Utah using NAIP imagery

    Directory of Open Access Journals (Sweden)

    Darrell B. Roundy

    2016-11-01

    Full Text Available Expansion of Pinus L. (pinyon and Juniperus L. (juniper (P-J trees into sagebrush (Artemisia L. steppe communities can lead to negative effects on hydrology, loss of wildlife habitat, and a decrease in desirable understory vegetation. Tree reduction treatments are often implemented to mitigate these negative effects. In order to prioritize and effectively plan these treatments, rapid, accurate, and inexpensive methods are needed to estimate tree canopy cover at the landscape scale. We used object based image analysis (OBIA software (Feature AnalystTM for ArcMap 10.1®, ENVI Feature Extraction®, and Trimble eCognition Developer 8.2® to extract tree canopy cover using NAIP (National Agricultural Imagery Program imagery. We then compared our extractions with ground measured tree canopy cover (crown diameter and line point intercept on 309 plots across 44 sites in Utah. Extraction methods did not consistently over- or under-estimate ground measured P-J canopy cover except where tree cover was >45%. Estimates of tree canopy cover using OBIA techniques were strongly correlated with estimates using the crown diameter method (r = 0.93 for ENVI, 0.91 for Feature AnalystTM, and 0.92 for eCognition. Tree cover estimates using OBIA techniques had lower correlations with tree cover measurements using the line-point intercept method (r = 0.85 for ENVI, 0.83 for Feature AnalystTM, and 0.83 for eCognition. All software packages accurately and inexpensively extracted P-J canopy cover from NAIP imagery when the imagery was not blurred, and when P-J cover was not mixed with Amelanchier alnifolia (Utah serviceberry and Quercus gambelii (Gambel’s oak, which had similar spectral values as P-J.

  6. Emerging Infectious Diseases Cover Art

    Centers for Disease Control (CDC) Podcasts

    2017-07-26

    Byron Breedlove, managing editor of the EID Journal, discusses his approach to cover art.  Created: 7/26/2017 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 7/26/2017.

  7. Soil cover by natural trees in agroforestry systems

    Science.gov (United States)

    Diaz-Ambrona, C. G. H.; Almoguera Millán, C.; Tarquis Alfonso, A.

    2009-04-01

    The dehesa is common agroforestry system in the Iberian Peninsula. These open oak parklands with silvo-pastoral use cover about two million hectares. Traditionally annual pastures have been grazed by cows, sheep and also goats while acorns feed Iberian pig diet. Evergreen oak (Quercus ilex L.) has other uses as fuelwood collection and folder after tree pruning. The hypothesis of this work is that tree density and canopy depend on soil types. We using the spanish GIS called SIGPAC to download the images of dehesa in areas with different soil types. True colour images were restoring to a binary code, previously canopy colour range was selected. Soil cover by tree canopy was calculated and number of trees. Processing result was comparable to real data. With these data we have applied a dynamic simulation model Dehesa to determine evergreen oak acorn and annual pasture production. The model Dehesa is divided into five submodels: Climate, Soil, Evergreen oak, Pasture and Grazing. The first three require the inputs: (i) daily weather data (maximum and minimum temperatures, precipitation and solar radiation); (ii) the soil input parameters for three horizons (thickness, field capacity, permanent wilting point, and bulk density); and (iii) the tree characterization of the dehesa (tree density, canopy diameter and height, and diameter of the trunk). The influence of tree on pasture potential production is inversely proportional to the canopy cover. Acorn production increase with tree canopy cover until stabilizing itself, and will decrease if density becomes too high (more than 80% soil tree cover) at that point there is competition between the trees. Main driving force for dehesa productivity is soil type for pasture, and tree cover for acorn production. Highest pasture productivity was obtained on soil Dystric Planosol (Alfisol), Dystric Cambisol and Chromo-calcic-luvisol, these soils only cover 22.4% of southwest of the Iberian peninssula. Lowest productivity was

  8. Towards Seamless Validation of Land Cover Data

    Science.gov (United States)

    Chuprikova, Ekaterina; Liebel, Lukas; Meng, Liqiu

    2018-05-01

    This article demonstrates the ability of the Bayesian Network analysis for the recognition of uncertainty patterns associated with the fusion of various land cover data sets including GlobeLand30, CORINE (CLC2006, Germany) and land cover data derived from Volunteered Geographic Information (VGI) such as Open Street Map (OSM). The results of recognition are expressed as probability and uncertainty maps which can be regarded as a by-product of the GlobeLand30 data. The uncertainty information may guide the quality improvement of GlobeLand30 by involving the ground truth data, information with superior quality, the know-how of experts and the crowd intelligence. Such an endeavor aims to pave a way towards a seamless validation of global land cover data on the one hand and a targeted knowledge discovery in areas with higher uncertainty values on the other hand.

  9. Is Eurasian October snow cover extent increasing?

    International Nuclear Information System (INIS)

    Brown, R D; Derksen, C

    2013-01-01

    A number of recent studies present evidence of an increasing trend in Eurasian snow cover extent (SCE) in the October snow onset period based on analysis of the National Oceanic and Atmospheric Administration (NOAA) historical satellite record. These increases are inconsistent with fall season surface temperature warming trends across the region. Using four independent snow cover data sources (surface observations, two reanalyses, satellite passive microwave retrievals) we show that the increasing SCE is attributable to an internal trend in the NOAA CDR dataset to chart relatively more October snow cover extent over the dataset overlap period (1982–2005). Adjusting the series for this shift results in closer agreement with other independent datasets, stronger correlation with continentally-averaged air temperature anomalies, and a decrease in SCE over 1982–2011 consistent with surface air temperature warming trends over the same period. (letter)

  10. Research on clay covering experiment in a abandoned uranium mining area

    International Nuclear Information System (INIS)

    Zhang Xueli; Xu Lechang; Zhang Wei

    2014-01-01

    The clay covering experiment was designed in a abandoned uranium mining area, including experiment principle, determining size of experimental site, experiment method, choosing cover materials and determining cover thickness. According to the experiment results, the relationship between the radon exhalation rate and cover thickness, the diffusion coefficient of radon in clay were fully discussed. Also, the corresponding function expressions were established. The linear correlation coefficient test results showed that the relationship between the radon exhalation rate and cover thickness was significantly correlated. According to the correlation function expression between the radon exhalation rate and the cover thickness, the cover thickness of the decommissioning sites can be determined, in order to provide a scientific basis for the design and environmental impact assessment on decommissioning disposal project of a uranium mine. (authors)

  11. 12 CFR 35.2 - Definition of covered agreement.

    Science.gov (United States)

    2010-01-01

    ... the interest rate on the loan or whether the organization intends or is authorized to re-loan the... covered agreement. A covered agreement is any contract, arrangement, or understanding that meets all of... arrangements or understandings—(1) Example 1. A NGEP meets with an insured depository institution and states...

  12. 12 CFR 533.2 - Definition of covered agreement.

    Science.gov (United States)

    2010-01-01

    ... the interest rate on the loan or whether the organization intends or is authorized to re-loan the... covered agreement. A covered agreement is any contract, arrangement, or understanding that meets all of... arrangements or understandings—(1) Example 1. A NGEP meets with an insured depository institution and states...

  13. Covered by lines and Conic connected varieties

    Directory of Open Access Journals (Sweden)

    Alex Massarenti

    2011-12-01

    Full Text Available We study some properties of an embedded variety covered by lines and give a numerical criterion ensuring the existence of a singular conic through two of its general points. We show that our criterion is sharp. Conic-connected, covered by lines, QEL, LQEL, prime Fano, defective, and dual defective varieties are closely related. We study some relations between the above mentioned classes of objects using basic results by Ein and Zak.

  14. Fractional cover data retrieval using eCognition

    OpenAIRE

    Wellens, Joost; Denis, Antoine

    2012-01-01

    For the overall calibration and validation of the AquaCrop model decent information on the development of the canopy cover is crucial. Throughout the growing season overhead canopy pictures were taken. Different image treatment programs have been evaluated on their capacity to retrieve the fractional cover data from these images. The findings are presented in this technical note. The objectives (and/or constraints) were manifold: - determine for each image the percentage of can...

  15. Natural attenuation of biogas in landfill covers

    International Nuclear Information System (INIS)

    Cossu, R.; Privato, A.; Raga, R.

    2005-01-01

    In the risk evaluation of uncontrolled biogas emissions from landfills, the process of natural attenuation in landfill covers assumes a very important role. The capacity of biogas oxidation in the cover soils seems to be the most important control to mitigate the biogas emission during the aftercare period when the biogas collection system might fail. In the present paper laboratory experiences on lab columns to study the biogas oxidation are discussed [it

  16. LMFBR technology. FFTF cover-gas leakage calculation

    International Nuclear Information System (INIS)

    Deboi, H.

    1974-01-01

    The FFTF LMFBR is intended to have a near zero release of radioactive gases during normal reactor operation with 1% failed fuel. This report presents calculations which provide an approximation of these cover gas leakages. Data from ongoing static and dynamic seal leak tests at AI are utilized. Leakage through both elastomeric and metallic seals in all sub-assemblies and penetrations comprising the reactor cover gas containment during reactor operation system are included

  17. Forest Cover Mapping in Iskandar Malaysia Using Satellite Data

    Science.gov (United States)

    Kanniah, K. D.; Mohd Najib, N. E.; Vu, T. T.

    2016-09-01

    Malaysia is the third largest country in the world that had lost forest cover. Therefore, timely information on forest cover is required to help the government to ensure that the remaining forest resources are managed in a sustainable manner. This study aims to map and detect changes of forest cover (deforestation and disturbance) in Iskandar Malaysia region in the south of Peninsular Malaysia between years 1990 and 2010 using Landsat satellite images. The Carnegie Landsat Analysis System-Lite (CLASlite) programme was used to classify forest cover using Landsat images. This software is able to mask out clouds, cloud shadows, terrain shadows, and water bodies and atmospherically correct the images using 6S radiative transfer model. An Automated Monte Carlo Unmixing technique embedded in CLASlite was used to unmix each Landsat pixel into fractions of photosynthetic vegetation (PV), non photosynthetic vegetation (NPV) and soil surface (S). Forest and non-forest areas were produced from the fractional cover images using appropriate threshold values of PV, NPV and S. CLASlite software was found to be able to classify forest cover in Iskandar Malaysia with only a difference between 14% (1990) and 5% (2010) compared to the forest land use map produced by the Department of Agriculture, Malaysia. Nevertheless, the CLASlite automated software used in this study was found not to exclude other vegetation types especially rubber and oil palm that has similar reflectance to forest. Currently rubber and oil palm were discriminated from forest manually using land use maps. Therefore, CLASlite algorithm needs further adjustment to exclude these vegetation and classify only forest cover.

  18. Cover gas purification experience at KNK

    Energy Technology Data Exchange (ETDEWEB)

    Richard, H; Stade, K Ch [Kernkraftwerk-Betriebsgesellschaft m.b.H., Eggenstein-Leopoldshafen (Germany); Stamm, H H [Institute of Radiochemistry, Nuclear Research Center, Karsruhe (Germany)

    1987-07-01

    KNK II is an experimental, sodium cooled fast breeder reactor. The reactor was operated until 1974 with a thermal core (KNK I). The plant was converted into a fast breeder reactor (KNK II) from 1974 to 1977. The commissioning of KNK II was started in October 1977 with the first fast core KNK 11/1. After 400 effective full power days (EFPD) the reactor was shut down in August 1982. After replacing the complete core by the second fast core KNK 11/2, the plant went into operation again in August 1983. In August 1986 nearly 400 EFPD were achieved with the second fast core. Argon is used as cover gas in the primary and secondary sodium systems of KNK. In former times fresh argon was supplied by a bundle of gas cylinders. Later on a liquid argon supply was installed. Purification of cover gas is done by flushing only. During KNK I operation no fuel failures occurred. The primary cover gas activity was characterized by the formation of Ar-41, only small quantities of fission gas were measured, released from 'tramp uranium'. Therefore, no problems existed during KNK I operation with regard to radioactive gas disposal. However, after start-up of KNK II, several fuel elements failed. Until August 1986, five fuel failures were observed, two in KNK 11/1, and three in KNK 11/2. Sometimes, operation with defective fuel pins caused problems when fission gases leaked into the containment atmosphere, and the access had to be restricted. The purging rate of the primary cover gas was limited by the capacity of the charcoal filters in the delay line. Of all non-radioactive impurities, hydrogen (H{sub z}) and nitrogen (N{sub 2}) were of most importance in the primary cover gas. Main source of both impurities was the ingress of air and atmospheric moisture during handling operations in shutdown periods. An other possible source for hydrogen might be a release from the steel-clad zirconium hydride, used as moderator in the moderated driver fuel elements. Additional nitrogen may diffuse

  19. Seepage through a hazardous-waste trench cover

    Science.gov (United States)

    Healy, R.W.

    1989-01-01

    Water movement through a waste-trench cover under natural conditions at a low-level radioactive waste disposal site in northwestern Illinois was studied from July 1982 to June 1984, using tensiometers, a moisture probe, and meteorological instruments. Four methods were used to estimate seepage: the Darcy, zero-flux plane, surface-based water-budget, and groundwater-based water-budget methods. Annual seepage estimates ranged from 48 to 216 mm (5-23% of total precipitation), with most seepage occurring in spring. The Darcy method, although limited in accuracy by uncertainty in hydraulic conductivity, was capable of discretizing seepage in space and time and indicated that seepage varied by almost an order of magnitude across the width of the trench. Lowest seepage rates occurred near the center of the cover, where seepage was gradual. Highest rates occurred along the edge of the cover, where seepage was highly episodic, with 84% of the total there being traced to wetting fronts from 28 individual storms. Limitations of the zero-flux-plane method were severe enough for the method to be judged inappropriate for use in this study.Water movement through a waste-trench cover under natural conditions at a low-level radioactive waste disposal site in northwestern Illinois was studied from July 1982 to June 1984, using tensiometers, a moisture probe, and meteorological instruments. Four methods were used to estimate seepage: the Darcy, zero-flux plane, surface-based water-budget, and groundwater-based water-budget methods. Annual seepage estimates ranged from 48 to 216mm (5-23% of total precipitation), with most seepage occurring in spring. The Darcy method, although limited in accuracy by uncertainty in hydraulic conductivity, was capable of discretizing seepage in space and time and indicated that seepage varied by almost an order of magnitude across the width of the trench. Lowest seepage rates occurred near the center of the cover, where seepage was gradual. Highest

  20. Systematic approach to designing surface covers for uranium-mill tailings

    International Nuclear Information System (INIS)

    Beedlow, P.A.; Cadwell, L.L.; McShane, M.C.

    1982-01-01

    The wide range of environmental conditions present at uranium mill tailings sites precludes the use of a single type of surface cover. Surface covers must be designed on a site-specific basis. To facilitate site specific designs the UMTRA program is developing guidelines for designing surface covers. This paper presents a systematic approach to designing surface covers for tailings that can be applied under any site condition. The approach consists of three phases: (1) An assessment during which the degree of surface protection is determined. (2) A preliminary design that facilitates interaction with those designing other containment system elements. (3) A final design where the cost and effectiveness of the surface cover are determined. The types of information required to apply this approach are discussed

  1. Impacts of Cover Crops on Water and Nutrient Dynamics in Agroecosystems

    Science.gov (United States)

    Williard, K.; Swanberg, S.; Schoonover, J.

    2013-05-01

    Intensive cropping systems of corn (Zea Mays L.) and soybeans (Glycine max) are commonly leaky systems with respect to nitrogen (N). Reactive N outputs from agroecosystems can contribute to eutrophication and hypoxic zones in downstream water bodies and greenhouse gas (N2O) emissions. Incorporating cover crops into temperate agroecosystem rotations has been promoted as a tool to increase nitrogen use efficiency and thus limit reactive N outputs to the environment. Our objective was determine how cereal rye (Secale cereal L.) and annual ryegrass (Lolium multiflorum) cover crops impact nutrient and soil water dynamics in an intensive corn and soybean cropping rotation in central Illinois. Cover crops were planted in mid to late October and terminated in early April prior to corn or soybean planting. In the spring just prior to cover crop termination, soil moisture levels were lower in the cover crop plots compared to no cover plots. This can be a concern for the subsequent crop in relatively dry years, which the Midwestern United States experienced in 2012. No cover plots had greater nutrient leaching below the rooting zone compared to cover crop areas, as expected. The cover crops were likely scavenging nutrients during the fall and early spring and should provide nutrients to the subsequent crop via decomposition and mineralization of the cover crop residue. Over the long term, cover crop systems should produce greater inputs and cycling of carbon and N, increasing the productivity of crops due to the long-term accumulation of soil organic matter. This study demonstrates that there may be short term trade-offs in reduced soil moisture levels that should be considered alongside the long term nutrient scavenging and recycling benefits of cover crops.

  2. Designing of plant artificial chromosome (PAC) by using the Chlorella smallest chromosome as a model system.

    Science.gov (United States)

    Noutoshi, Y; Arai, R; Fujie, M; Yamada, T

    1997-01-01

    As a model for plant-type chromosomes, we have been characterizing molecular organization of the Chlorella vulgaris C-169 chromosome I. To identify chromosome structural elements including the centromeric region and replication origins, we constructed a chromosome I specific cosmid library and aligned each cosmid clones to generate contigs. So far, more than 80% of the entire chromosome I has been covered. A complete clonal physical reconstitution of chromosome I provides information on the structure and genomic organization of plant genome. We propose our strategy to construct an artificial chromosome by assembling the functional chromosome structural elements identified on Chrorella chromosome I.

  3. Estimating Snow Cover from Publicly Available Images

    OpenAIRE

    Fedorov, Roman; Camerada, Alessandro; Fraternali, Piero; Tagliasacchi, Marco

    2016-01-01

    In this paper we study the problem of estimating snow cover in mountainous regions, that is, the spatial extent of the earth surface covered by snow. We argue that publicly available visual content, in the form of user generated photographs and image feeds from outdoor webcams, can both be leveraged as additional measurement sources, complementing existing ground, satellite and airborne sensor data. To this end, we describe two content acquisition and processing pipelines that are tailored to...

  4. FP 6 EU - COVERS. Coordination action - VVER safety research

    International Nuclear Information System (INIS)

    Vasa, I.

    2008-01-01

    In this work research program of the European Union FP 6 - COVERS coordinated by the NRI Rez is presented. COVERS is designed to improve professional and communication environment in the specific area covering all aspects of safe and reliable operation of nuclear power plants with VVER-440 and VVER-1000 reactors. Project Consortium is composed of 26 research and development, engineering and technical support organisations of European VVER-operating and other EU and non-EU countries.

  5. Cover Crop (Rye) and No-Till System in Wisconsin

    OpenAIRE

    Alföldi, Thomas

    2014-01-01

    Erin Silva, University of Wisconsin, describes an organic no-till production technique using rye as cover crop to suppress weeds in the following production season. Using a roller-crimper, the overwintering rye is terminated at the time of cash crop planting, leaving a thick mat of plant residue on the soil surface. Soybeans are sown directly into the cover crop residue, allowing the cash crop to emerge through the terminated cover crop while suppressing weeds throughout the season. W...

  6. Molecular cloning of the papillary renal cell carcinoma-associated translocation (X;1)(p11;q21) breakpoint

    NARCIS (Netherlands)

    Weterman, MAJ; Janssen, [No Value; Janssen, HAP; vandenBerg, E; Fisher, SE; Craig, [No Value; vanKessel, AG

    1996-01-01

    A combination of Southern blot analysis on a panel of tumor-derived somatic cell hybrids and fluorescence in situ hybridization techniques was used to map YACs, cosmids and DNA markers from the Xp11.2 region relative to the X chromosome breakpoint of the renal cell carcinoma-associated

  7. 29 CFR 4.110 - What contracts are covered.

    Science.gov (United States)

    2010-07-01

    ...'Hara Service Contract Act Covered Contracts Generally § 4.110 What contracts are covered. The Act... mean that the contract is not within the coverage of the Act. The amount of the contract is not determinative of the Act's coverage, although the requirements are different for contracts in excess of $2,500...

  8. Building a Continental Scale Land Cover Monitoring Framework for Australia

    Science.gov (United States)

    Thankappan, Medhavy; Lymburner, Leo; Tan, Peter; McIntyre, Alexis; Curnow, Steven; Lewis, Adam

    2012-04-01

    Land cover information is critical for national reporting and decision making in Australia. A review of information requirements for reporting on national environmental indicators identified the need for consistent land cover information to be compared against a baseline. A Dynamic Land Cover Dataset (DLCD) for Australia has been developed by Geoscience Australia and the Australian Bureau of Agriculture and Resource Economics and Sciences (ABARES) recently, to provide a comprehensive and consistent land cover information baseline to enable monitoring and reporting for sustainable farming practices, water resource management, soil erosion, and forests at national and regional scales. The DLCD was produced from the analysis of Enhanced Vegetation Index (EVI) data at 250-metre resolution derived from the Moderate Resolution Imaging Spectroradiometer (MODIS) for the period from 2000 to 2008. The EVI time series data for each pixel was modelled as 12 coefficients based on the statistical, phenological and seasonal characteristics. The time series were then clustered in coefficients spaces and labelled using ancillary information on vegetation and land use at the catchment scale. The accuracy of the DLCD was assessed using field survey data over 25,000 locations provided by vegetation and land management agencies in State and Territory jurisdictions, and by ABARES. The DLCD is seen as the first in a series of steps to build a framework for national land cover monitoring in Australia. A robust methodology to provide annual updates to the DLCD is currently being developed at Geoscience Australia. There is also a growing demand from the user community for land cover information at better spatial resolution than currently available through the DLCD. Global land cover mapping initiatives that rely on Earth observation data offer many opportunities for national and international programs to work in concert and deliver better outcomes by streamlining efforts on development and

  9. Dicty_cDB: SHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  10. Dicty_cDB: FC-AJ15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT

  11. Dicty_cDB: SSI339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

  12. Dicty_cDB: SLB394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB394 (Link to dictyBase) - G24120 DDB0184167BP Contig-U13982... (Link to library) Clone ID SLB394 (Link to dictyBase) Atlas ID - NBRP ID G24120 dictyBase ID DDB0184167BP L...ink to Contig Contig-U13982-1 Original site URL http://dictycdb.biol.tsukuba.ac.j...2 Translated Amino Acid sequence TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT...e B: TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT

  13. Dicty_cDB: SHI777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  14. Dicty_cDB: VHB478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB478 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHB478Z 556 - - - - Show VHB478 Library VH (Link to library) Clone ID VHB478 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...cid sequence ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITT...xxcxlf*trknp*kyfrkkmdsqqkrfxr*xfn*vhlsl sgxy Frame C: ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT

  15. Dicty_cDB: SHF448 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF448 (Link to dictyBase) - - - Contig-U11503-1 SHF448E (Link...) Clone ID SHF448 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Ori...quence qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKD...mnvnlkimrigltqlxisyrfy Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAV...nts: (bits) Value N AC115680 |AC115680.3 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB533 (Link to dictyBase) - G02515 DDB0218082 Contig-U10369-1...brary) Clone ID VFB533 (Link to dictyBase) Atlas ID - NBRP ID G02515 dictyBase ID DDB0218082 Link to Contig ...Contig-U10369-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB5-... %: cytoskeletal 4.0 %: extracellular, including cell wall 4.0 %: peroxisomal >> predict

  17. Dicty_cDB: SFC123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

  18. Dicty_cDB: SHL102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk

  19. Fully covered stents versus partially covered stents for palliative treatment of esophageal cancer: Is there a difference?

    Science.gov (United States)

    Alonso Lárraga, J O; Flores Carmona, D Y; Hernández Guerrero, A; Ramírez Solís, M E; de la Mora Levy, J G; Sánchez Del Monte, J C

    2018-02-26

    Malignant dysphagia is difficulty swallowing resulting from esophageal obstruction due to cancer. The goal of palliative treatment is to reduce the dysphagia and improve oral dietary intake. Self-expandable metallic stents are the current treatment of choice, given that they enable the immediate restoration of oral intake. The aim of the present study was to describe the results of using totally covered and partially covered esophageal stents for palliating esophageal cancer. A retrospective study was conducted on patients with inoperable esophageal cancer treated with self-expandable metallic stents. The 2 groups formed were: group A, which consisted of patients with a fully covered self-expandable stent (SX-ELLA ® ), and group B, which was made up of patients with a partially covered self-expandable stent (Ultraflex ® ). Of the 69-patient total, 50 were included in the study. Group A had 19 men and 2 women and their mean age was 63.6 years (range 41-84). Technical success was achieved in 100% (n=21) of the cases and clinical success in 90.4% (n=19). Group B had 24 men and 5 women and their mean age was 67.5 years (range 43-92). Technical success was achieved in 100% (n=29) of the cases and clinical success in 89.6% (n=26). Complications were similar in both groups (33.3 vs. 51.7%). There was no difference between the 2 types of stent for the palliative treatment of esophageal cancer with respect to technical success, clinical success, or complications. Copyright © 2018 Asociación Mexicana de Gastroenterología. Publicado por Masson Doyma México S.A. All rights reserved.

  20. Land-cover change and avian diversity in the conterminous United States

    Science.gov (United States)

    Chadwick D. Rittenhouse; Anna M. Pidgeon; Thomas P. Albright; Patrick D. Culbert; Murray K. Clayton; Curtis H. Flather; Jeffrey G. Masek; Volker C. Radeloff

    2012-01-01

    Changes in land use and land cover have affected and will continue to affect biological diversity worldwide. Yet, understanding the spatially extensive effects of land-cover change has been challenging because data that are consistent over space and time are lacking. We used the U.S. National Land Cover Dataset Land Cover Change Retrofit Product and North American...

  1. Validation of MODIS snow cover images over Austria

    Directory of Open Access Journals (Sweden)

    J. Parajka

    2006-01-01

    Full Text Available This study evaluates the Moderate Resolution Imaging Spectroradiometer (MODIS snow cover product over the territory of Austria. The aims are (a to analyse the spatial and temporal variability of the MODIS snow product classes, (b to examine the accuracy of the MODIS snow product against in situ snow depth data, and (c to identify the main factors that may influence the MODIS classification accuracy. We use daily MODIS grid maps (version 4 and daily snow depth measurements at 754 climate stations in the period from February 2000 to December 2005. The results indicate that, on average, clouds obscured 63% of Austria, which may significantly restrict the applicability of the MODIS snow cover images to hydrological modelling. On cloud-free days, however, the classification accuracy is very good with an average of 95%. There is no consistent relationship between the classification errors and dominant land cover type and local topographical variability but there are clear seasonal patterns to the errors. In December and January the errors are around 15% while in summer they are less than 1%. This seasonal pattern is related to the overall percentage of snow cover in Austria, although in spring, when there is a well developed snow pack, errors tend to be smaller than they are in early winter for the same overall percent snow cover. Overestimation and underestimation errors balance during most of the year which indicates little bias. In November and December, however, there appears to exist a tendency for overestimation. Part of the errors may be related to the temporal shift between the in situ snow depth measurements (07:00 a.m. and the MODIS acquisition time (early afternoon. The comparison of daily air temperature maps with MODIS snow cover images indicates that almost all MODIS overestimation errors are caused by the misclassification of cirrus clouds as snow.

  2. Land Use and Land Cover Change Analysis along the Coastal ...

    African Journals Online (AJOL)

    Agribotix GCS 077

    are carried out on the land usually effect changes in its cover. ... The FAO document on land cover classification systems, (2000) partly answers this ... over the surface land, including water, vegetation, bare soils and or artificial structures. ... diseases may occur more readily in areas exposed by Land Use and Land Cover ...

  3. Minimum Covers of Fixed Cardinality in Weighted Graphs.

    Science.gov (United States)

    White, Lee J.

    Reported is the result of research on combinatorial and algorithmic techniques for information processing. A method is discussed for obtaining minimum covers of specified cardinality from a given weighted graph. By the indicated method, it is shown that the family of minimum covers of varying cardinality is related to the minimum spanning tree of…

  4. Comparisons of micrometeorology, growth of leather-fern [Rumohra adiantiformis, pteridophyta] and comfortable working environment between PO-film-covered and net-covered greenhouses in summer

    International Nuclear Information System (INIS)

    Yokoyama, H.; Harazono, Y.

    2004-01-01

    Protected cultivation of leather-fern in Hachijo-Island has been urged to prevent the Mottled Yellowing Syndrome (MYS) damage and to reduce the production costs. The purpose of the study was to reveal greenhouse environments that would provide good plant growth, a comfortable working environment and low-cost management, by comparing the micrometeorology and leatherfern productivity between Poly-Olefin (PO) film-covered greenhouses and the conventional netcovered greenhouses. Both greenhouses were fully covered by the same net. Field studies of leather-fern cultivation in Hachijo-Island showed that better productivity and quality of leather-fern have been provided by farmer's net-covered greenhouses than by farmer's PO-covered greenhouses. The light transmittance in the net-covered greenhouse was higher and the air temperature was lower than those in the PO-covered greenhouse. The comparative experiments using PO-covered greenhouses (PO), and net-covered greenhouses (NET), were conducted at the Hachijojima Horticultural Research Center. Air temperature and its vertical gradient in NET were lower than those in PO. Irrigation in PO was 225 mm during August and September in 1999, but 507 mm of precipitation in addition to the irrigation was supplied in NET. Air temperature and its vertical gradient in PO increased with solar radiation increase. Heat disorder in working environments for farmers did not occur in the NET, but several warning hours of heat disorder occurred in the PO as a dangerous working environment. The NET was thought to be a better system of leather-fern cultivation bringing about low costs and comfortable working environments. However, further application of fully rolled-up PO-film greenhouse system was recommended to control the soil water condition

  5. Minimum triplet covers of binary phylogenetic X-trees.

    Science.gov (United States)

    Huber, K T; Moulton, V; Steel, M

    2017-12-01

    Trees with labelled leaves and with all other vertices of degree three play an important role in systematic biology and other areas of classification. A classical combinatorial result ensures that such trees can be uniquely reconstructed from the distances between the leaves (when the edges are given any strictly positive lengths). Moreover, a linear number of these pairwise distance values suffices to determine both the tree and its edge lengths. A natural set of pairs of leaves is provided by any 'triplet cover' of the tree (based on the fact that each non-leaf vertex is the median vertex of three leaves). In this paper we describe a number of new results concerning triplet covers of minimum size. In particular, we characterize such covers in terms of an associated graph being a 2-tree. Also, we show that minimum triplet covers are 'shellable' and thereby provide a set of pairs for which the inter-leaf distance values will uniquely determine the underlying tree and its associated branch lengths.

  6. Ground cover in old-growth forests of the central hardwood region

    Science.gov (United States)

    Martin A. Spetich; Stephen R. Shifley; George R. Parker; Felix, Jr. Ponder

    1997-01-01

    Differences in ground cover (percent cover of litter, percent cover of vegetation and litter weight) in old-growth forests across this region are not well understood. We initiated a long-term study in a three-state region to enhance knowledge in this area. We present baseline results for ground cover and compare these data across productivity regions. Thirty 0.25-ac (0...

  7. Optimization of composite sandwich cover panels subjected to compressive loadings

    Science.gov (United States)

    Cruz, Juan R.

    1991-01-01

    An analysis and design method is presented for the design of composite sandwich cover panels that include the transverse shear effects and damage tolerance considerations. This method is incorporated into a sandwich optimization computer program entitled SANDOP. As a demonstration of its capabilities, SANDOP is used in the present study to design optimized composite sandwich cover panels for for transport aircraft wing applications. The results of this design study indicate that optimized composite sandwich cover panels have approximately the same structural efficiency as stiffened composite cover panels designed to satisfy individual constraints. The results also indicate that inplane stiffness requirements have a large effect on the weight of these composite sandwich cover panels at higher load levels. Increasing the maximum allowable strain and the upper percentage limit of the 0 degree and +/- 45 degree plies can yield significant weight savings. The results show that the structural efficiency of these optimized composite sandwich cover panels is relatively insensitive to changes in core density. Thus, core density should be chosen by criteria other than minimum weight (e.g., damage tolerance, ease of manufacture, etc.).

  8. Characteristics of snow cover duration across the northeast United States of America

    Science.gov (United States)

    Leathers, Daniel J.; Luff, Barbara L.

    1997-11-01

    The presence or absence of a snow cover affects a myriad of environmental and societal systems through its modification of the surface radiation balance and its ultimate impact on near-surface air temperatures. Daily snow cover data were collected for a network of 91 stations covering the northeast USA from Maine, south through to West Virginia. The snow cover data along with ancillary temperature, snowfall and precipitation data were used to investigate the characteristics of snow cover duration in this region and the effects of the snow cover on boundary layer climate variables for the snow cover seasons 1948-1949 through to 1987-1988.Results indicate that snow cover duration is variable in both space and time. The duration of a snow cover of 2.5 cm or greater varies from greater than 100 days in northern New England to less than 20 days across areas of Delaware, Maryland and West Virginia. Temporally, snow cover duration for the region as a whole was very short from the late 1940s through to the mid-1950s. From the late 1950s to the end of the period snow cover duration has varied around a consistent mean value. No long-term trends in snow cover duration are apparent in the record for the northeast USA.Principal components analysis and clustering techniques were utilized to isolate spatially coherent regions in which snow cover duration has varied similarly over the period of record. This analysis resulted in the identification of four snow-cover-duration regions across the northeast USA: including (i) the West Virginia area, (ii) the mid-Atlantic from southern New England through to western Pennsylvania, (iii) western and central New York and (iv) northern New England. Snow cover duration is shown to be highly associated with snowfall and temperature but not strongly related to total liquid precipitation. The intra-annual variability of snow cover duration is also investigated for each region.

  9. Next generation of global land cover characterization, mapping, and monitoring

    Science.gov (United States)

    Giri, Chandra; Pengra, Bruce; Long, J.; Loveland, Thomas R.

    2013-01-01

    Land cover change is increasingly affecting the biophysics, biogeochemistry, and biogeography of the Earth's surface and the atmosphere, with far-reaching consequences to human well-being. However, our scientific understanding of the distribution and dynamics of land cover and land cover change (LCLCC) is limited. Previous global land cover assessments performed using coarse spatial resolution (300 m–1 km) satellite data did not provide enough thematic detail or change information for global change studies and for resource management. High resolution (∼30 m) land cover characterization and monitoring is needed that permits detection of land change at the scale of most human activity and offers the increased flexibility of environmental model parameterization needed for global change studies. However, there are a number of challenges to overcome before producing such data sets including unavailability of consistent global coverage of satellite data, sheer volume of data, unavailability of timely and accurate training and validation data, difficulties in preparing image mosaics, and high performance computing requirements. Integration of remote sensing and information technology is needed for process automation and high-performance computing needs. Recent developments in these areas have created an opportunity for operational high resolution land cover mapping, and monitoring of the world. Here, we report and discuss these advancements and opportunities in producing the next generations of global land cover characterization, mapping, and monitoring at 30-m spatial resolution primarily in the context of United States, Group on Earth Observations Global 30 m land cover initiative (UGLC).

  10. Dicty_cDB: FC-BR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BR21 (Link to dictyBase) - - - Contig-U15384-1 | Contig-U16443-1 FC-BR2...1P (Link to Original site) FC-BR21F 551 FC-BR21Z 122 FC-BR21P 673 - - Show FC-BR21 Library FC (L...ink to library) Clone ID FC-BR21 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Cont...ig-U15384-1 | Contig-U16443-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR2...1Q.Seq.d/ Representative seq. ID FC-BR21P (Link to Original site) Representative DNA sequence >FC-BR21 (FC-BR2

  11. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  12. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  13. Exact Cover Problem in Milton Babbitt's All-partition Array

    OpenAIRE

    Bemman, Brian; Meredith, David

    2015-01-01

    One aspect of analyzing Milton Babbitt’s (1916–2011) all- partition arrays requires finding a sequence of distinct, non-overlapping aggregate regions that completely and exactly covers an irregular matrix of pitch class integers. This is an example of the so-called exact cover problem. Given a set, A, and a collection of distinct subsets of this set, S, then a subset of S is an exact cover of A if it exhaustively and exclu- sively partitions A. We provide a backtracking algorithm for solving ...

  14. Dicty_cDB: AFJ353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ353 (Link to dictyBase) - - - Contig-U10972-1 AFJ353P (Link... to Original site) AFJ353F 592 AFJ353Z 580 AFJ353P 1172 - - Show AFJ353 Library AF (Link to library) Clone ID AFJ353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...SISTGLPNLSGGKINTNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICT...TNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICTHKVGCTVVNRCIDNANP

  15. Dicty_cDB: SFA408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFA408 (Link to dictyBase) - - - Contig-U10972-1 SFA408P (Link... to Original site) SFA408F 509 SFA408Z 686 SFA408P 1195 - - Show SFA408 Library SF (Link to library) Clone ID SFA408 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...YLSXDQVESIIASIKGKVIQLSKDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYVVQHL ...KDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYV

  16. Dicty_cDB: SLG821 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLG821 (Link to dictyBase) - - - Contig-U15540-1 SLG821P (Link... to Original site) SLG821F 638 SLG821Z 554 SLG821P 1192 - - Show SLG821 Library SL (Link to library) Clone ID SLG821 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...MSPSSPICLPESPMGAQHWESGL--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT...*--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB866 (Link to dictyBase) - - - Contig-U16349-1 VFB866Z (Link... to Original site) - - VFB866Z 631 - - - - Show VFB866 Library VF (Link to library) Clone ID VFB866 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...ce ---SSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMP DMSQCANWTKMCSSSGQLYNSQITSDYCVASVADAVPIMRMYFH...RGCLHAIELTCSYALMLVAMTFNVALFFAV Translated Amino Acid sequence (All Frames) Frame A: ---SSVDSISNLPTTMQLFAGIKSICT

  18. Dicty_cDB: VHL364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHL364 (Link to dictyBase) - - - Contig-U16205-1 - (Link to Or...iginal site) - - VHL364Z 668 - - - - Show VHL364 Library VH (Link to library) Clone ID VHL364 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dictycdb.b...mino Acid sequence ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN GGDASTDGVQRDLLPIVEGCMVSTKYGQ...itwyh*tyrrgykf*lxys*r*nscfrysrh*ktfk Frame B: ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN G

  19. Dicty_cDB: VHK472 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK472 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHK472Z 392 - - - - Show VHK472 Library VH (Link to library) Clone ID VHK472 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b....10 Translated Amino Acid sequence ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT...wstlqlsnhirllcrlcc*rrsnhenvlshwylglypl*ilgtk n*psicwfmv Frame B: ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSP

  20. Dicty_cDB: CFJ816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFJ816 (Link to dictyBase) - - - Contig-U16255-1 CFJ816P (Link... to Original site) CFJ816F 562 CFJ816Z 721 CFJ816P 1263 - - Show CFJ816 Library CF (Link to library) Clone ID CFJ816 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTT...PATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTTG GSTTGSHTTTGGSTTGSHTTTGGS

  1. Dicty_cDB: CFI686 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFI686 (Link to dictyBase) - - - Contig-U15579-1 CFI686P (Link... to Original site) CFI686F 185 CFI686Z 445 CFI686P 610 - - Show CFI686 Library CF (Link to library) Clone ID CFI686 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT PTVTPT...LVXXCXIGFGCXAIXKNCNXNDPXXXDXCDXXIGCYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT

  2. Dicty_cDB: VHA365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA365 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHA365Z 352 - - - - Show VHA365 Library VH (Link to library) Clone ID VHA365 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...TTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTT sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...wfmv Frame C: ---QLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS SSGQLY

  3. Dicty_cDB: VFF110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv

  4. Dicty_cDB: SLE110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL

  5. Dicty_cDB: SSB322 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E

  6. Dicty_cDB: AHB126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT

  7. Dicty_cDB: VHC776 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHC776 (Link to dictyBase) - - - Contig-U15722-1 VHC776P (Link... to Original site) VHC776F 593 VHC776Z 895 VHC776P 1468 - - Show VHC776 Library VH (Link to library) Clone ID VHC776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...CDNNTGNCTCHNEXFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDN...XFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDNEHIGN GCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTK

  8. Dicty_cDB: VHK477 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK477 (Link to dictyBase) - - - Contig-U11536-1 VHK477P (Link... to Original site) VHK477F 685 VHK477Z 794 VHK477P 1459 - - Show VHK477 Library VH (Link to library) Clone ID VHK477 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11536-1 Original site URL http://dict...QIGTYSFEGKFIKKAIINGNRIVTINN KLLNENQLNSNSTITKEKDSSNQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAI...NQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAIVIVSVVFVIILALFIIVKFSKS

  9. Dicty_cDB: SFD793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFD793 (Link to dictyBase) - - - Contig-U16255-1 SFD793P (Link... to Original site) SFD793F 660 SFD793Z 689 SFD793P 1349 - - Show SFD793 Library SF (Link to library) Clone ID SFD793 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATCSSLNCNAQQMSCKYVQQACHETSC CPDIPQCQIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTT...TGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTTGSHTTTGGSTTG

  10. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  11. Dicty_cDB: VHI141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

  12. Dicty_cDB: VFL117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFL117 (Link to dictyBase) - G22229 DDB0204982 Contig-U10461-1... - (Link to Original site) - - VFL117Z 591 - - - - Show VFL117 Library VF (Link to library) Clone ID VFL117 (Link to dict...yBase) Atlas ID - NBRP ID G22229 dictyBase ID DDB0204982 Link to Contig Contig-U10461-1 Original site URL http://dict...GMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICTVIEEGIYQFAFEEFSTSTSVQSNFITYLIDTTQMIVVMYILANGKFS NYILFRKVKTTSFNSNEK...k**ytkfkynn**hw Frame B: ---TSMLMDIKFGQAVGFLILLAIYCAMVIGFGMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICT

  13. Dicty_cDB: VHC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHC263 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHC263Z 429 - - - - Show VHC263 Library VH (Link to library) Clone ID VHC263 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ATGG ACTCCCAAC sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...kyfrkkmdsq Frame B: ---QLFAGIKSICTXMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS

  14. Dicty_cDB: VHO201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

  15. Dicty_cDB: AFI379 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFI379 (Link to dictyBase) - - - Contig-U08795-1 AFI379P (Link... to Original site) AFI379F 645 AFI379Z 836 AFI379P 1471 - - Show AFI379 Library AF (Link to library) Clone ID AFI379 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGL...KIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGLMSGKIMGEYL

  16. Dicty_cDB: SFH459 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH459 (Link to dictyBase) - - - Contig-U16336-1 SFH459P (Link... to Original site) SFH459F 606 SFH459Z 728 SFH459P 1334 - - Show SFH459 Library SF (Link to library) Clone ID SFH459 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...KTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKT...TVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTH

  17. Dicty_cDB: CHR591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR591 (Link to dictyBase) - - - Contig-U11865-1 CHR591P (Link... to Original site) CHR591F 557 CHR591Z 706 CHR591P 1243 - - Show CHR591 Library CH (Link to library) Clone ID CHR591 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11865-1 Original site URL http://dict... IDPYEIQQNKQSNNSNSNSNRNLTPNSSSPTNQRKNKQEDDDDESKLDDESDLNERFQKV VLRFREFPSLDTNLYRLQEICT...DLNERFQKV VLRFREFPSLDTNLYRLQEICTDLLHISQDFIHTVKTYGRIIIEERYLKEKTIQSRSIGG H--- ---RK

  18. Dicty_cDB: SFF125 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT

  19. Dicty_cDB: VHL434 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHL434 (Link to dictyBase) - - - Contig-U16336-1 VHL434P (Link... to Original site) VHL434F 546 VHL434Z 778 VHL434P 1304 - - Show VHL434 Library VH (Link to library) Clone ID VHL434 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...EVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPES-- - --...GFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFL

  20. Dicty_cDB: CHN802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHN802 (Link to dictyBase) - - - Contig-U16336-1 CHN802P (Link... to Original site) CHN802F 543 CHN802Z 788 CHN802P 1311 - - Show CHN802 Library CH (Link to library) Clone ID CHN802 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...ASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL...NETKFINQCINEIKEELKGDMQKKTVAVQKLTY IQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICT

Some links on this page may take you to non-federal websites. Their policies may differ from this site.