WorldWideScience

Sample records for wsr n-10 polyox

  1. WSR-88D observations of volcanic ash

    Science.gov (United States)

    Wood, J.; Scott, C.; Schneider, D.

    2007-01-01

    Conclusions that may impact operations are summarized below: ??? Current VCPs may not be optimal for the scharacterization of volcanic events. Therefore, the development of a new VCP that combines the enhanced low level elevation density and increased temporal resolution of VCP 12 with the enhanced sensitivity of VCP 31. ??? Given currently available scan strategies, this preliminary investigation would suggest that it is advisable to use VCP 12 during the initial explosive phase of an eruptive event. Once the maximum reflectivity has dropped below 30 dBZ, VCP 31 should be used. ??? This study clearly indicates that WSR-88D Level II data offers many advantages over Level III data currently available in Alaska. The ability to access this data would open up greater opportunities for research. Given the proximity of WSR-88D platforms to active volcanoes in Alaska, as well as in the western Lower 48 states and Hawaii, radar data will likely play a major operational role when volcanic eruptions again pose a threat to life and property. The utilization of this tool to its maximum capability is vital.

  2. Polyox and carrageenan based composite film dressing containing anti-microbial and anti-inflammatory drugs for effective wound healing.

    Science.gov (United States)

    Boateng, Joshua S; Pawar, Harshavardhan V; Tetteh, John

    2013-01-30

    Polyethylene oxide (Polyox) and carrageenan based solvent cast films have been formulated as dressings for drug delivery to wounds. Films plasticised with glycerol were loaded with streptomycin (30%, w/w) and diclofenac (10%, w/w) for enhanced healing effects in chronic wounds. Blank and drug loaded films were characterised by texture analysis (for mechanical and mucoadhesive properties), scanning electron microscopy, differential scanning calorimetry, X-ray diffraction and Fourier transform infrared spectroscopy. In addition, swelling, in vitro drug release and antibacterial studies were conducted to further characterise the films. Both blank and drug loaded films showed a smooth, homogeneous surface morphology, excellent transparency, high elasticity and acceptable tensile (mechanical) properties. The drug loaded films showed a high capacity to absorb simulated wound fluid and significant mucoadhesion force which is expected to allow effective adherence to and protection of the wound. The films showed controlled release of both streptomycin and diclofenac for 72 h. These drug loaded films produced higher zones of inhibition against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli compared to the individual drugs zones of inhibition. Incorporation of streptomycin can prevent and treat chronic wound infections whereas diclofenac can target the inflammatory phase of wound healing to relieve pain and swelling. Copyright © 2012 Elsevier B.V. All rights reserved.

  3. CLUJ-NAPOCA PRECIPITATION FORECAST USING WSR-98D DOPPLER RADAR

    Directory of Open Access Journals (Sweden)

    Narcis MAIER

    2011-11-01

    Full Text Available CLUJ-NAPOCA precipitation forecast using WSR-98D Doppler radar. Forecasting inundations requires accurate spatial and temporal estimation of rainfalls in an area. Depending on the Z-R relationship (reflectivity-precipitation rate, the thresholds, maximum reflectivity data processing, VIL, cloud height or speed, provided by the WSR-98D affects the estimated precipitation used in the prediction of inundations. How much precipitation receives a watershed during an extreme event and what response will result depends on the basin hydrographic characteristics. A study of summer weather events between the years 2004-2008 and a new method in establishing relations between the radar estimated and recorded precipitations led to the determination of new relations between them which will balance the connections between them.

  4. Research and Measurement of Software Complexity Based on Wuli, Shili, Renli (WSR and Information Entropy

    Directory of Open Access Journals (Sweden)

    Rong Jiang

    2015-04-01

    Full Text Available Complexity is an important factor throughout the software life cycle. It is increasingly difficult to guarantee software quality, cost and development progress with the increase in complexity. Excessive complexity is one of the main reasons for the failure of software projects, so effective recognition, measurement and control of complexity becomes the key of project management. At first, this paper analyzes the current research situation of software complexity systematically and points out existing problems in current research. Then, it proposes a WSR framework of software complexity, which divides the complexity of software into three levels of Wuli (WL, Shili (SL and Renli (RL, so that the staff in different roles may have a better understanding of complexity. Man is the main source of complexity, but the current research focuses on WL complexity, and the research of RL complexity is extremely scarce, so this paper emphasizes the research of RL complexity of software projects. This paper not only analyzes the composing factors of RL complexity, but also provides the definition of RL complexity. Moreover, it puts forward a quantitative measurement method of the complexity of personnel organization hierarchy and the complexity of personnel communication information based on information entropy first and analyzes and validates the scientificity and rationality of this measurement method through a large number of cases.

  5. A Study of the Drag Characteristics and Polymer Diffusion in the Boundary Layer of an Axisymmetric Body

    Science.gov (United States)

    1976-03-12

    Reduction in Pipe Flow at R =14xl03 (from Hoyt (1972)) Guar Gum Karaya Polyox WSR 301 400 850 10 Polyacrylamide, Polyhall-250 20 21 ■.I...shown to be effec- tive drag reducers. Polysaccharides ( Guar ), polyethylene oxide, polyacrylamides, and sodium carboxymethyl...sifting the premeasured polyox powder onto the surface of the carefully weighed water which was being slowly stirred by a magnetic mixing bar. After a

  6. Tribocorrosion behaviour of 08CH18N10T steel

    International Nuclear Information System (INIS)

    Kubecka, P.; Tvrdy, M.; Wenger, F.; Ponthiaux, P.

    2000-01-01

    Tribocorrosion of the 08CH18N10T austenitic stainless steel in a potassium sulphate solution was investigated with the help of pin-on-disk tribometer and polarisation curves method. The results indicate the occurrence of synergetic interactions between electrochemical and mechanical conditions: the damaging of the passive film by friction was pointed out, leading to an increase in the dissolution rate of the metal and simultaneously, the occurrence of electrochemical reactions (gas evolution, dissolution, passivation) was found to modify the tribological conditions (friction coefficient). (author)

  7. Comptia Network+ review guide exam N10-006

    CERN Document Server

    Ferguson, Bill

    2015-01-01

    Be prepared for the Network+ exam CompTIA Network+ Review Guide is your ideal study companion for preparing for the CompTIA Network+ exam (N10-006). This concise review is the perfect companion to the CompTIA Network+ Study Guide and the CompTIA Network+ Deluxe Study Guide, with full exam coverage organized by objective for quick review and reinforcement of key topics. Each of the book's five parts is devoted to a specific domain area of the exam, providing a focused review to bolster areas of weak understanding. You get access to the Sybex test engine, which includes two bonus practice tests

  8. Eleventh Hour Network+ Exam N10-004 Study Guide

    CERN Document Server

    Alpern, Naomi

    2009-01-01

    The 11th Hour Network+ Study Guide is keyed to the N10-004 revision of the CompTIA Network+ exam. This book is streamlined to include only core certification information and is presented for ease of last-minute studying. Main objectives of the exam are covered with key concepts highlighted. ..: ..; Fast Facts quickly review fundamentals ..; Exam Warnings highlight particularly tough sections of the exam ..; Crunch Time sidebars point out key concepts to remember ..; Did You Know? sidebars cover sometimes forgotten details ..; Top Five Toughest Questions and answers help you to prepare ..

  9. PA01.81. Impact of globalisation on health w.s.r. metabolic syndrome and its ayurvedic management)

    Science.gov (United States)

    Layeeq, Shaizi; Srivastava, Alok K

    2012-01-01

    Purpose: According to WHO report 2002,Cardiovacular diseases (CVD) will be the largest cause of death and disability in India by 2012. Metabolic Syndrome (MetS), a constellation of dyslipidemia, elevated blood glucose, hypertension and obesity is emerging as the most common risk factor for CVD. The rising prevalence of individual components of Metabolic Syndrome is mainly attributed to globalisation which has made available cheap, unhealthy food on the main menu & also brought with it sedentary lifestyle. It is a need of time to pay due consideration on the problem and search for alternative medicine. So the aim of the study is: 1. To study the impact of globalisation on health w.s.r Metabolic Syndrome. 2. To assess the clinical efficacy of Panchakarma in its management. Method: For the study large-scale survey, other documented data and published articles were studied. For clinical contrieve 20 patients were registered and were given Virechana Karma followed by administration of Shuddha Guggulu as palliative measure. Result: The results show that globalisation has a great impact on all the components of Metabolic Syndrome. However on management with Panchakarma (Virechana Karma) followed by Shuddha Guggulu encouraging results were found. The overall effect of therapy was found to be 82.5%. Conclusion: There is a high prevalence of metabolic syndrome in India and it is a need of time to consider alternative treatment for its management alongwith change in lifestyle to reduce the risk of cardiovascular disease.

  10. Influence of local microplastic strains on stress corrosion of 08Kh18N10T steel

    International Nuclear Information System (INIS)

    Moskvin, L.N.; Efimov, A.A.; Sherman, Ya.I.; Fedorova, T.I.

    1987-01-01

    Study on specific features of microhomogeneous strain in the process of plastic strain development and their role in stress corrosion of 08Kh18N10T steel sheet specimens subject to preliminary strain by 1, 3, 6, 16 and 23% and subsequent tests of stress corrosion in magnesium chloride solution at 150 deg C 140 MPa has been carried out. Analysis of test results has shown that microplastic strain is distributed over a specimen nonuniformly and is accompanied with the slip bands formation which are sources of corrosion crack origination and development. 08Kh18N10T steel manifests the highest trend to stress corrosion under 1% microplastic strain

  11. CompTIA Network+ Review Guide Exam N10-005

    CERN Document Server

    Ferguson, Bill

    2012-01-01

    Fast, focused review for the latest CompTIA Network+ Exam N10-005 CompTIA's Network+ certification is the leading non-vendor networking certification in the world and has become the standard certification for networking professionals. Make sure you're ready for CompTIA's new Network+ certification (exam N10-005) with this new edition of Sybex's CompTIA Network+ Review Guide. This concise guide is efficiently organized by exam objectives and covers all five exam domains. The book also includes 50 chapter review questions, as well as access to two online practice exams, and much more. It's the p

  12. CompTIA network+ study guide exam N10-006

    CERN Document Server

    Lammle, Todd

    2015-01-01

    All-star N10-006 prep, fully updated for the new exam The CompTIA Network+ Study Guide is your one-stop comprehensive resource in preparing for exam N10-006 Bestselling author and networking Guru Todd Lammle guides you through 100% of all exam objectives detailing the fundamental concepts you will need to know to prepare for the exam. Coverage includes network technologies, installation and configuration, media and topologies, security, and much more, plus practical examples drawn from real-world situations. You also gain access to practice exams and electronic flashcards that facilitate info

  13. Structural changes in surface layer of steel 08Kh18N10T during machining

    International Nuclear Information System (INIS)

    Palenik, J.; Vodarek, V.

    1989-01-01

    The results are reported of a study of the surface layer of steel 08Kh18N10T affected by machining. Structural changes were studied caused by finish turning and by additional roller burnishing. Multiple deformation bands were observed to occur under the given cutting conditions; they mainly consisted of deformation doublets and only in isolated cases of ε-martensite. The presence of α'-martensite was not shown in the specimen surface layer following finish turning. The deformation shear bands in the roller-burnished specimen consisted of both ε-martensite and of deformation doublets. The amount of ε-martensite in the structure was significantly higher than in the specimen worked by turning. Local presence of α'-martensite formations was observed inside the deformation bands. It thus follows that roller burnishing is unsuitable as part of the manufacture of components from steel 08Kh18N10T. (J.B.). 5 figs., 1 tab., 9 refs

  14. Welding of high-strength stainless steel 03Kh12N10MT for cryogenic engineering

    International Nuclear Information System (INIS)

    Pustovit, A.I.

    1989-01-01

    Consideration is being given to weld resistance to cold and hot cracking at 93 and 77K and to mechanical properties of welded joints of high-strength stainless steel 03Kh12N10MT, produced under the fluxes AN-17M, AN-18, AN-26, AN-45, ANF-5, 48-OF-6, ANK-45 and ANK-49 in combination with various welding wires. It is shown that welds on 03Kh12N10MT steel meet the requirements only when using 48-OF-6 or ANK-49 flux. It is noted that impact strength of welds at 77K is sufficiently affected by the volume fraction of non-metallic inclusions in weld metal

  15. Effect of rolling temperature on 12Kh18N10T steel tube hardening

    International Nuclear Information System (INIS)

    Yushkevich, P.M.; Stepanovich, V.E.; Manankova, L.V.; Usenko, V.N.; Semenov, I.A.

    1984-01-01

    Mechanical properties and substructure of tubes at the constant reduction degree k(the ratio of deformation over wall thickness to deformation over diameter), depending on strain degree during cold and hot tube rolling, have been studied. The investigations are carried out using hot-rolled tubes with the dimensions 88x8 mm of 12Kh1hN10T steel. With the decrease of strain over the wall of the tube, produced of 12Kh18N10T steel as to strain over diameter the values of yield strength and ultimate strength increase with simultaneous decrease in ductility during warm rolling and yield strength and ultimate strength decrease with the increase in ductility-during cold rolling. During warm rolling of the tubes at 250 deg C the hardening of 12Kh18N10T steel is higher, than at the rolling temperature 150 deg C. The optimum temperature range of warm rolling is 120-150 deg C. Grain orientation in the metal of the tubes and degree of texture perfection increase with the temperature increase of the tube warm drolling as compared with col rolli

  16. CompTIA Network+ Certification Study Guide, Exam N10-004

    CERN Document Server

    Shimonski, Robert

    2009-01-01

    CompTIA's Network+ certification is a globally-recognized, vendor neutral exam that has helped over 235,000 IT professionals reach further and higher in their careers. The 2009 Network+ exam (N10-004) is a major update with more focus on security and wireless aspects of networking. Our new study guide has been updated accordingly with focus on network, systems, and WAN security and complete coverage of today's wireless networking standards. As always this companion covers the core Network+ material including basic design principles, management and operation of a network infrastructure, and tes

  17. CompTIA Network+ Study Guide Exam N10-005

    CERN Document Server

    Lammle, Todd

    2012-01-01

    Todd Lammle's latest CompTIA Network+ Study Guide, now updated for the new exam! CompTIA's Network+ certification tells the world you have the skills to install, configure, and troubleshoot today's basic networking hardware peripherals and protocols. But first, you have to pass the exam! This detailed CompTIA Authorized study guide by networking guru Todd Lammle has everything you need to prepare for the CompTIA's new Network+Exam N10-005. All exam objectives are covered. He thoroughly explains key topics, offers plenty of practical examples, and draws upon his own invaluable 25+ years of netw

  18. 14N + 10B fusion and elastic scattering cross section measurements near the interaction barrier

    International Nuclear Information System (INIS)

    Wu, S.C.; Overley, J.C.; Barnes, C.A.; Switkowski, Z.E.

    1979-01-01

    The 14 N + 10 B fusion reactions were studied at c.m. energies between 2.9 and 7.5 MeV by measuring the yields of γ-rays from the residual nuclei formed by particle evaporation from the compound system. Cross sections for formation of the evaporation residues 16 O, 19 F, 19 Ne, 20 Ne, 21 Ne, 22 Ne, 22 Na, 23 Na and 23 Mg, as well as the total cross section, were deduced from these yields with the aid of statistical model calculations. 14 N + 10 B elastic scattering differential cross sections were measured from 4.3 to 9.1 MeV at THETA 74.4 degrees, and from 3.3 to 8.3 MeV at THETA = 90.0 degrees. The elastic scattering cross sections were analyzed within the framework of the incoming-wave boundary condition (IWBC) model. The fusion cross sections calculated for the real ion-ion potential deduced from the IWBC model fit to the elastic scattering are in good agreement with the measured values

  19. 9Be(d,n)10B-based neutron sources for BNCT

    International Nuclear Information System (INIS)

    Capoulat, M.E.; Herrera, M.S.; Minsky, D.M.; González, S.J.; Kreiner, A.J.

    2014-01-01

    In the frame of accelerator-based BNCT, the 9 Be(d,n) 10 B reaction was investigated as a possible source of epithermal neutrons. In order to determine the configuration in terms of bombarding energy, target thickness and Beam Shaping Assembly (BSA) design that results in the best possible beam quality, a systematic optimization study was carried out. From this study, the optimal configuration resulted in tumor doses ≥40 Gy-Eq, with a maximum value of 51 Gy-Eq at a depth of about 2.7 cm, in a 60 min treatment. The optimal configuration was considered for the treatment planning assessment of a real Glioblastoma Multiforme case. From this, the resulted dose performances were comparable to those obtained with an optimized 7 Li(p,n)-based neutron source, under identical conditions and subjected to the same clinical protocol. - Highlights: • Study of the 9 Be(d,n) 10 B reaction as a source of epithermal neutrons for BNCT. • Evaluation of the optimal configuration of target thickness, deuteron energy and BSA design. • Computational dose assessment for brain tumor treatments using the MCNP code. • Treatment planning assessment of a particular clinical Glioblastoma Multiforme case. • Dose performances were comparable to those obtained with an optimized 7 Li(p,n)-based source

  20. Degradation of the metal-cyano complex tetracyanonickelate (II) by Fusarium oxysporum N-10.

    Science.gov (United States)

    Yanase, H; Sakamoto, A; Okamoto, K; Kita, K; Sato, Y

    2000-03-01

    A fungus with the ability to utilize a metalcyano compound, tetracyanonickelate (II) ¿K2[Ni (CN)4]; TCN¿, as its sole source of nitrogen was isolated from soil and identified as Fusarium oxysporum N-10. Both intact mycelia and cell-free extract of the strain catalyzed hydrolysis of TCN to formate and ammonia and produced formamide as an intermediate, thereby indicating that a hydratase and an amidase sequentially participated in the degradation of TCN. The enzyme catalyzing the hydration of TCN was purified approximately ten-fold from the cell-free extract of strain N-10 with a yield of 29%. The molecular mass of the active enzyme was estimated to be 160 kDa. The enzyme appears to exist as a homotetramer, each subunit having a molecular mass of 40 kDa. The enzyme also catalyzed the hydration of KCN, with a cyanide-hydrating activity 2 x 10(4) times greater than for TCN. The kinetic parameters for TCN and KCN indicated that hydratase isolated from F. oxysporum was a cyanide hydratase able to utilize a broad range of cyano compounds and nitriles as substrates.

  1. Metallographical procedure for detecting carburized layer in the 12Kh18N10T steel tubes

    International Nuclear Information System (INIS)

    Najmark, S.I.; Shmalenyuk, R.P.

    1977-01-01

    The various causes of the tendency to intercrystalline corrosion of stainless steel tubing were studied. 12Kh18N10T steel tube specimens were metallographically investigated to reveal the presence and depth of the carburized layer. Unlubricated specimens and specimens with the graphite-saltpeter lubrication applied on them were austenized in the temperature range from 950 to 1250 deg C and then exposed to a provoking anneal at 650 deg C for 24 h. All the lubricated specimens showed a carbide network along grain boundaries and intercrystalline cracks. The specimens treated without lubrication had no cracks. The method offered can differentiate poor tube cleaning and the undesirable effect of other processing steps on the tubes

  2. New software methods in radar ornithology using WSR-88D weather data and potential application to monitoring effects of climate change on bird migration

    Science.gov (United States)

    Mead, Reginald; Paxton, John; Sojda, Richard S.; Swayne, David A.; Yang, Wanhong; Voinov, A.A.; Rizzoli, A.; Filatova, T.

    2010-01-01

    Radar ornithology has provided tools for studying the movement of birds, especially related to migration. Researchers have presented qualitative evidence suggesting that birds, or at least migration events, can be identified using large broad scale radars such as the WSR-88D used in the NEXRAD weather surveillance system. This is potentially a boon for ornithologists because such data cover a large portion of the United States, are constantly being produced, are freely available, and have been archived since the early 1990s. A major obstacle to this research, however, has been that identifying birds in NEXRAD data has required a trained technician to manually inspect a graphically rendered radar sweep. A single site completes one volume scan every five to ten minutes, producing over 52,000 volume scans in one year. This is an immense amount of data, and manual classification is infeasible. We have developed a system that identifies biological echoes using machine learning techniques. This approach begins with training data using scans that have been classified by experts, or uses bird data collected in the field. The data are preprocessed to ensure quality and to emphasize relevant features. A classifier is then trained using this data and cross validation is used to measure performance. We compared neural networks, naive Bayes, and k-nearest neighbor classifiers. Empirical evidence is provided showing that this system can achieve classification accuracies in the 80th to 90th percentile. We propose to apply these methods to studying bird migration phenology and how it is affected by climate variability and change over multiple temporal scales.

  3. Ultrasound surface treatment of Kh18N10T steel with different structural state. Ul'trazvukovaya poverkhnostnaya obrabotka stali Kh18N10T s razlichnym strukturnym sostoyaniem

    Energy Technology Data Exchange (ETDEWEB)

    Aksenov, V K; Danilov, P A; Mats, A V; Netesov, V M; Yaes, A A [AN Ukrainskoj SSR, Kharkov (Ukrainian SSR). Fiziko-Tekhnicheskij Inst.

    1989-09-01

    Ultrasound surface treatment (USST) is studied for its effect on the structure and mechanical-and-physical properties of Kh18N10T steel with different prehistory. It is shown that surface treatment may both increase and decrease steel microhardness.

  4. Manufacture of rings of 08Kh18N10T sheet for internal structures of WWER type reactors

    International Nuclear Information System (INIS)

    Fojta, A.; Nitka, B.

    1984-01-01

    Technology is presented of the manufacture of rings for the jacket, shaft, core catcher and shaft bottom of WWER-440 reactors produced by Vitkovice Steel Works. The rings are manufactured from sheets of austenitic steel 08Kh18N10T. The materials and technology problems are discussed of sheet production, ring welding technology and annealing following welding. The plastic properties are assessed of the welded joints and problems are outlined of ring production for WWER-1000 reactors. (B.S.)

  5. Effect of partial oxygen pressure on physicochemical properties of Kh18N10T steel at isothermal oxidation. Vliyanie partsial'nogo davleniya kisloroda na fiziko-khimicheskie svojstva poverkhnosti stali Kh18N10T pri izotermicheskom okislenii

    Energy Technology Data Exchange (ETDEWEB)

    Alekseev, V N; Oshe, E K; Fokin, M N; Bogdanova, S V; Loskutov, A I [AN SSSR, Moscow (USSR). Inst. Fizicheskoj Khimii

    1990-10-01

    Auger-electron spectroscopy, photoelectric polarization, conductometry methods have been used to analyze chemical and defect composition of surface oxide layers, formed on stainless steel Kh18N10T in vacuum (10{sup -9} - 10{sup -2} torr) and at temperatures 593-673 K. The boundary conditions of manifestation of extermal behaviour of the dependence of the surface oxide growth rate at isothermal oxidation of this steel are determined. The relation between passivation properties of the surface oxide and the magnitude of the edge angle of the surface wetting with molten tin is revealed.

  6. Effect of partial oxygen pressure on physicochemical properties of Kh18N10T steel at isothermal oxidation

    International Nuclear Information System (INIS)

    Alekseev, V.N.; Oshe, E.K.; Fokin, M.N.; Bogdanova, S.V.; Loskutov, A.I.

    1990-01-01

    Auger-electron spectroscopy, photoelectric polarization, conductometry methods have been used to analyze chemical and defect composition of surface oxide layers, formed on stainless steel Kh18N10T in vacuum (10 -9 - 10 -2 torr) and at temperatures 593-673 K. The boundary conditions of manifestation of extermal behaviour of the dependence of the surface oxide growth rate at isothermal oxidation of this steel are determined. The relation between passivation properties of the surface oxide and the magnitude of the edge angle of the surface wetting with molten tin is revealed

  7. The 9Be(d,n)10B reaction as a source of polarized neutrons from a low energy accelerator

    International Nuclear Information System (INIS)

    Bains, B.S.; Galloway, R.B.

    1977-01-01

    The 9 Be(d,n) 10 B reaction leading to the ground state of 10 B is found to provide a neutron beam with a polarization of 0.35 +- 0.06 at a reaction angle of 45 0 to a 400 keV deuteron beam. The suitability of such a polarized 4.5 MeV neutron beam for elastic scattering experiments is discussed. The polarization of the neutrons leading to the first excited state of 10 B is found to be - 0.08 +- 0.07 under the same conditions. (Auth.)

  8. Effect of agressive medium movement of local corrosion of the steel - 12Kh18N10T

    International Nuclear Information System (INIS)

    Makartsev, V.V.; Pakhomov, V.S.; Abramova, I.M.

    1980-01-01

    The effect of agressive medium movement on the formation of pitting corrosion of the 12Kh18N10T stainless steel in the acidic chloride-nitrate solution at room temperature is studied. It is established that the agressive medium movement hinders the formation of pitting corrosion at potentials more negative than +0.4 V and practically does not affect it at more positive potentials. The investigations have been carried out on a disc electrode rotating at a speed from 0 to 2000 rot./min

  9. Features of argon-arc welding of aluminium alloy AD1 to stainless steel 12Kh18N10T

    International Nuclear Information System (INIS)

    Sadov, I.I.

    1982-01-01

    Welding of pipes made of the 12Kh18N10T stainless steel and the AD1 aluminium alloy is proposed to perform using one-sided aluminizing. It is recommended to use shields in order to protect internal and external surfaces of pipes, aluminizing of which is impossible. It is shown that developed technological process for welded joints made of aluminium and stainless steel for cryogenic apparatus permits to create light-duty cryostat assembly using aluminium alloys instead of copper alloys, to increase reliability of apparatus (usage of welded joints instead of soldered ones), and to improve labour conditions

  10. Development of plastic deformations in 12Kh18N10T steel under cyclic symmetrical bending of specimens of various length

    Energy Technology Data Exchange (ETDEWEB)

    Pisarenko, G.S.; Leonets, V.A.; Bega, N.D. (AN Ukrainskoj SSR, Kiev. Inst. Problem Prochnosti)

    1983-08-01

    Effect of specimen length on intensity of plastic deformation development and cyclic strength is studied for annealed 12Kh18N10T steel under cyclic symmetrical bending. The intensity of microplastic deformations and cyclic strength of annealed 12Kh18N10T steel in the considered case is due to self-heating.

  11. Cluster correlation effects in 12C+12C and 14N+10B fusion-evaporation reactions

    Directory of Open Access Journals (Sweden)

    Morelli L.

    2015-01-01

    Full Text Available The decay of highly excited states of 24Mg is studied in fusion evaporation events completely detected in charge in the reactions 12C+12C and 14N+10B at 95 and 80 MeV incident energy respectively. The comparison of light charged particles measured spectra with statistical model predictions suggests that the dominant reaction mechanism is compound nucleus (CN formation and decay. However, in both reactions, a discrepancy with statistical expectations is found for α particles detected in coincidence with Carbon, Oxigen and Neon residues. The comparison between the two reactions shows that this discrepancy is only partly explained by an entrance channel effect. Evidence for cluster correlations in excited 24Mg CN is suggested by the comparison between the measured and calculated branching ratios for the channels involving α particles.

  12. Effect of some additives on mass transfer coefficient at a vibrating horizontal screen

    Energy Technology Data Exchange (ETDEWEB)

    Nosier, S.A.; El-Abd, M.Z. [Chemical Engineering Dept., Faculty of Engineering, Alexandria Univ. (Egypt); Zaki, M.M. [Environmental Engineering Dept., Faculty of Engineering, Zagazig Univ. (Egypt)

    1998-01-01

    The addition of small amounts of high molecular weight substances, such as polymers and surface-active agents, to fluids can produce significant reduction of friction in turbulent flow. The objectiv of the present work is to study the effect of drag-reducing additives such as Polyox WSR 301 and sodium lauryl sulfate (anionic surfactant) on the rate of mass transfer at a vibrating horizontal screen. The variables studied were the concentration of polymer and surfactant, frequency of vibration and amplitude of vibration. (orig.)

  13. Probing the Statistical Decay and α-clustering effects in 12C + 12C and 14N + 10B reactions

    Directory of Open Access Journals (Sweden)

    Morelli L.

    2014-03-01

    Full Text Available An experimental campaign has been undertaken at Laboratori Nazionali di Legnaro (LNL INFN, Italy, in order to progress in our understanding of the statistical properties of light nuclei at excitation energies above particle emission threshold, by measuring exclusive data from fusion-evaporation reactions. On the experimental side, a first reaction: 12C+12C at 95 MeV beam energy has been measured, using the GARFIELD + Ring Counter (RCo apparatuses. Fusion-evaporation events have been exclusively selected out of the entire data set. The comparison to a dedicated Hauser-Feshbach calculation allows us to give constraints on the nuclear level density at high excitation energy for light systems ranging from C up to Mg. Out-of-equilibrium aα emission has been evidenced and attributed both to an entrance channel effect (favoured by the cluster nature of reaction partners, and, in more dissipative events, to the persistence of cluster correlations well above the 24Mg threshold for 6 α’s decay. In order to study the same 24Mg compound nucleus at similar excitation energy with respect to this first reaction a new measurement, 14N + 10B at 5.7 A.MeV, was performed at LNL laboratories with the same experimental setup. The comparison between the two systems would allow us to further constrain the level density of light nuclei in the mass-excitation energy range of interest. In this perspective, deviations from a statistical behaviour can be used as a tool to get information on nuclear clustering, both in the ground-state for projectile and target and in the hot source formed in the collision.

  14. A model for the ethylene and acetylene adsorption on the surface of Cu{sub n}(n = 10–15) nanoclusters: A theoretical study

    Energy Technology Data Exchange (ETDEWEB)

    Farmanzadeh, Davood, E-mail: d.farmanzad@umz.ac.ir; Abdollahi, Tahereh

    2016-11-01

    Highlights: • The most stable structures of Cu{sub n} (n = 10–15) were structures with C{sub S} symmetry. • It is expected that even clusters are better electron donors than the odd clusters. • Acetylene and ethylene adsorb molecularly on the Cu nanoclusters surface. • Acetylene never orient toward di-σ mode for Cu−Cu bond in odd copper nanoclusters. • For di- σ-Cu{sub n}C{sub 2}H{sub 4}, no stable structure is identified. - Abstract: In this work, we report the results of density functional theory calculations of ethylene and acetylene adsorption on the most stable Cu{sub n} (n = 10–15) nanoclusters, in two π and di- σ adsorption modes. Both the hydrocarbons molecularly adsorbed on the surface. Our results show that the quality of interaction of ethylene and acetylene with odd copper nanoclusters (n = 11, 13, 15) is different from what is found on even copper nanoclusters (n = 10, 12, 14). One of the interesting features of this adsorption is that acetylene never orient toward di-σ mode for Cu−Cu bond in odd copper nanoclusters. Also, for di- σ-Cu{sub n}C{sub 2}H{sub 4}, no stable structure is identified. The highest interaction and deformation energies are seen for the adsorption of acetylene and ethylene on Cu{sub 11} in π-mode.

  15. Influence of structure and properties of tubular billets of the 12 Kh 18N10T steel on deformability of tubes at cold-rolling mills

    International Nuclear Information System (INIS)

    Vil'yams, O.S.; Bol'shova, N.M.; Olejnik, O.V.; Velikotnaya, E.S.

    1979-01-01

    Metallographic analysis of the defects of the ''oblique cracks'' type on the surface of hot-rolled tubes of the 12Kh18N10T steel has been carried out. Recommended is the complex of mechanical properties and the structure factors (grain size) of conversion hot-rolled tubes, providing the combination of ductility and high rapture strength during rolling at pilger mills. At a grain size not coarser than number 5, a billet must have σsub(T) 5 >=40 %. Hot-rolled coarse-grained billet is not recommended for warm rolng because of high strain hardening

  16. Revisit the landscape of protonated water clusters H+(H2O)n with n = 10-17: An ab initio global search

    Science.gov (United States)

    Shi, Ruili; Li, Keyao; Su, Yan; Tang, Lingli; Huang, Xiaoming; Sai, Linwei; Zhao, Jijun

    2018-05-01

    Using a genetic algorithm incorporated with density functional theory, we explore the ground state structures of protonated water clusters H+(H2O)n with n = 10-17. Then we re-optimize the isomers at B97-D/aug-cc-pVDZ level of theory. The extra proton connects with a H2O molecule to form a H3O+ ion in all H+(H2O)10-17 clusters. The lowest-energy structures adopt a monocage form at n = 10-16 and core-shell structure at n = 17 based on the MP2/aug-cc-pVTZ//B97-D/aug-cc-pVDZ+ZPE single-point-energy calculation. Using second-order vibrational perturbation theory, we further calculate the infrared spectra with anharmonic correction for the ground state structures of H+(H2O)10-17 clusters at the PBE0/aug-cc-pVDZ level. The anharmonic correction to the spectra is crucial since it reproduces the experimental results quite well. The extra proton weakens the O-H bond strength in the H3O+ ion since the Wiberg bond order of the O-H bond in the H3O+ ion is smaller than that in H2O molecules, which causes a red shift of the O-H stretching mode in the H3O+ ion.

  17. Effects of Benzalkonium Chloride, Proxel LV, P3 Hypochloran, Triton X-100 and DOWFAX 63N10 on anaerobic digestion processes

    DEFF Research Database (Denmark)

    Flores, German Antonio Enriquez; Fotidis, Ioannis; Karakashev, Dimitar Borisov

    2015-01-01

    In this study, the individual and synergistic toxicity of the following xenobiotics: Benzalkonium Chloride (BKC), Proxel LV (PRX), P3 Hypochloran (HPC), Triton X-100 (TRX), and DOWFAX 63N10 (DWF), on anaerobic digestion (AD) process, was assessed. The experiments were performed in batch and conti......In this study, the individual and synergistic toxicity of the following xenobiotics: Benzalkonium Chloride (BKC), Proxel LV (PRX), P3 Hypochloran (HPC), Triton X-100 (TRX), and DOWFAX 63N10 (DWF), on anaerobic digestion (AD) process, was assessed. The experiments were performed in batch...... and continuous (up-flow anaerobic sludge blanket, UASB) reactors with biochemical-industrial wastewater, as substrate. In batch experiments, half-maximal inhibitory concentrations (IC50) for the tested xenobiotics were found to be 13.1, 1003, 311.5 and 24.3 mg L1 for BKC, PRX, DWF and TRX, respectively while HPC...... observed from the batch reactors. Oppositely, TRX showed no inhibition in continuous mode, while inhibition was detected at batch mode....

  18. Validación del modelo de modernización para la gestión de las organizaciones (MMGO versión 10

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Plaza Cárdenas

    2016-02-01

    Full Text Available El modelo de modernización para la gestión de las organizaciones (MMGO se hizo público, de manera amplia, en el año 2011. Es necesario refrescar sus componentes y actualizarlo, para que se adecúe al siempre cambiante entorno de las pyme en Colombia, sin perder su esencia y sin desconocer los resultados de investigaciones anteriores relativas al mismo. De esto da cuenta la investigación que aquí se presenta. El grupo G3Pymes de la Universidad EAN, en el que se inscribe este proyecto, innova constantemente para desarrollar el modelo, que se encuentra en la versión 10, con la actualización de tres de sus componentes: análisis del entorno, comunicación e información y responsabilidad social.

  19. Microstructure evolution and mechanical properties of X12CrMoWVNbN10-1-1 steel during quenching and tempering process

    Directory of Open Access Journals (Sweden)

    Xingang Tao

    2016-01-01

    Full Text Available The effect of heat treatments was investigated on the microstructure evolution and mechanical properties of X12CrMoWVNbN10-1-1 steel. The as-received steel was austenitized at 1080 °C for 16 h and cooled in furnace, following tempered in two steps, i.e. at 570 °C for 18 h and then at 690 °C for 24 h. The austenitized sample had a typical lath martensite structure with some retained austenite and no delta ferrite was observed after austenitization. After the first tempering at 570 °C, there was no retained austenite remained but it resulted in the forming of precipitates, such as Cr-rich M7C3, Cr-rich M23C6, Cr-rich M2N, Nb-rich MN, and the subgrain, as well as the reduction in dislocation density. However, microstructure observation after secondary tempering proved the further arrangement of dislocation, subgrain growth and the coarsening of precipitates. Hardness and impact tests were carried out for establishing a correlation between microstructure and mechanical properties. Finally, a careful fractographic analysis of impact samples had been done using SEM and EDS.

  20. A two-stage constitutive model of X12CrMoWVNbN10-1-1 steel during elevated temperature

    Science.gov (United States)

    Zhu, Luobei; He, Jianli; Zhang, Ying

    2018-02-01

    In order to clarify the competition between work hardening (WH) caused by dislocation movements and the dynamic softening result from dynamic recovery (DRV) and dynamic recrystallization (DRX), a new two-stage flow stress model of X12CrMoWVNbN10-1-1 (X12) ferrite heat-resistant steel was established to describe the whole hot deformation behavior. And the parameters were determined by the experimental data operated on a Gleeble-3800 thermo- mechanical simulation. In this constitutive model, a single internal variable dislocation density evolution model is used to describe the influence of WH and DRV to flow stress. The DRX kinetic dynamic model can express accurately the contribution of DRX to the decline of flow stress, which was established on the Avrami equation. Furthermore, The established new model was compared with Fields-Bachofen (F-B) model and experimental data. The results indicate the new two-stage flow stress model can more accurately represent the hot deformation behavior of X12 ferrite heat-resistant steel, and the average error is only 0.0995.

  1. A study of the 10, 11B(p,n)10, 11C reactions between Ep=13,7 and 14,7 MeV

    International Nuclear Information System (INIS)

    Schelin, H.R.

    1985-01-01

    Using time-of-flight facilities of the Sao Paulo 8UD Pelletron Accelerator, absolute differential cross sections for the n 0 , n 1 , n 2 , n 3 , (n 4 +n 5 ), n 6 and n 7 groups for the reaction 11 B(p,n) 11 C and the n 0 and n 1 neutron groups for the reaction 10 B(p,n) 10 C have been measured at incident proton energies of 14.0, 14.3 and 14.6 MeV in the angular interval of 20 to 160 degrees. Excitation functions at θ lab =20 deg from Ep=13.7 to 14.7 MeV in intervals of 100 KeV were also measured. The theoretical analysis was conducted to determine relative contributions of the diret and compound nucleus processes in the differential cross sections. To this end, a two couple channel model model for the reactions was assumed. The DWBA model for the direct and the Hauser-Feshbch for the compound nucleus processes were in such a way as to simulate the exact coupled channels calculation through an appropriate choice of the absorption term W in the optical potential. The results indicate that about half of the cross section is due to the compound nucleus mechanism. The theoretical analysis aimed at obtaining the elastic enhancement factor for the channel 11 B(p,n 0 ) 11 C at Ep=14.3 MeV. This has been demonstrated to appear in compound nucleus charge reactions by Harney, Weidemueller and Richter and predicted to attain the value 2 when isospin is conserved. Our results show an enhancement factor larger than 1 indicating that isospin mixing is weak in this reaction. (Author) [pt

  2. A fast chemoenzymatic synthesis of [11C]-N5,N10-methylenetetrahydrofolate as a potential PET tracer for proliferating cells

    International Nuclear Information System (INIS)

    Saeed, Muhammad; Tewson, Timothy J.; Erdahl, Colbin E.; Kohen, Amnon

    2012-01-01

    Introduction: Thymidylate synthase and folate receptors are well-developed targets of cancer therapy. Discovery of a simple and fast method for the conversion of 11 CH 3 Ito[ 11 C]-formaldehyde ( 11 CH 2 O) encouraged us to label the co-factor of this enzyme. Preliminary studies conducted on cell lines have demonstrated a preferential uptake of [11- 14 C]-(R)-N 5 ,N 10 -methylene-5,6,7,8-tetrahydrofolate ( 14 CH 2 H 4 folate) by cancerous cell vs. normal cells from the same organ (Saeed M., Sheff D. and Kohen A. Novel positron emission tomography tracer distinguishes normal from cancerous cells. J Biol Chem 2011;286:33872–33878), pointing out 11 CH 2 H 4 folate as a positron emission tomography (PET) tracer for cancer imaging. Herein we report the synthesis of 11 CH 2 H 4 folate, which may serve as a potential PET tracer. Methods: In a remotely controlled module, methyl iodide ( 11 CH 3 I) was bubbled into a reaction vial containing trimethylamine N-oxide in N,N-Dimethylformamide (DMF) and heated to 70°C for 2 min. Formaldehyde ( 11 CH 2 O) formed after the completion of reaction was then mixed with a solution of freshly prepared tetrahydrofolate (H 4 folate) by using a fast chemoenzymatic approach to accomplish synthesis of 11 CH 2 H 4 folate. Purification of the product was carried out by loading the crude reaction mixture on a SAX cartridge, washing with water to remove unbound impurities and finally eluting with a saline solution. Results: The synthesis and purification of 11 CH 2 H 4 folate were completed within 5 min. High-performance liquid chromatography analysis of the product after SAX purification indicates that more than 90% of the radioactivity that was retained on the SAX cartridge was in 11 CH 2 H 4 folate, with minor ( 11 CH 2 O. Conclusion: We present a fast (∼5 min) synthesis and purification of 11 CH 2 H 4 folate as a potential PET tracer. The final product is received in physiologically compatible buffer (100 mM sodium phosphate, pH 7

  3. Using Common Spatial Distributions of Atoms to Relate Functionally Divergent Influenza Virus N10 and N11 Protein Structures to Functionally Characterized Neuraminidase Structures, Toxin Cell Entry Domains, and Non-Influenza Virus Cell Entry Domains

    Science.gov (United States)

    Weininger, Arthur; Weininger, Susan

    2015-01-01

    The ability to identify the functional correlates of structural and sequence variation in proteins is a critical capability. We related structures of influenza A N10 and N11 proteins that have no established function to structures of proteins with known function by identifying spatially conserved atoms. We identified atoms with common distributed spatial occupancy in PDB structures of N10 protein, N11 protein, an influenza A neuraminidase, an influenza B neuraminidase, and a bacterial neuraminidase. By superposing these spatially conserved atoms, we aligned the structures and associated molecules. We report spatially and sequence invariant residues in the aligned structures. Spatially invariant residues in the N6 and influenza B neuraminidase active sites were found in previously unidentified spatially equivalent sites in the N10 and N11 proteins. We found the corresponding secondary and tertiary structures of the aligned proteins to be largely identical despite significant sequence divergence. We found structural precedent in known non-neuraminidase structures for residues exhibiting structural and sequence divergence in the aligned structures. In N10 protein, we identified staphylococcal enterotoxin I-like domains. In N11 protein, we identified hepatitis E E2S-like domains, SARS spike protein-like domains, and toxin components shared by alpha-bungarotoxin, staphylococcal enterotoxin I, anthrax lethal factor, clostridium botulinum neurotoxin, and clostridium tetanus toxin. The presence of active site components common to the N6, influenza B, and S. pneumoniae neuraminidases in the N10 and N11 proteins, combined with the absence of apparent neuraminidase function, suggests that the role of neuraminidases in H17N10 and H18N11 emerging influenza A viruses may have changed. The presentation of E2S-like, SARS spike protein-like, or toxin-like domains by the N10 and N11 proteins in these emerging viruses may indicate that H17N10 and H18N11 sialidase-facilitated cell

  4. Climate mission study n.10, january 2007

    International Nuclear Information System (INIS)

    Delbosc, A.; Keppler, J.H.; Leseur, A.

    2007-01-01

    This note aims to explain the evolution of the intensity of the the developed economies of the greenhouse gases emission. This study concerns only the countries called industrialized without the developing countries and those of the old east soviet bloc. In the first part the authors aim to know if the carbon intensity evolution of the economies go with convergence or divergence phenomena. The second part is more devoted to the impacts of the energetic choices on the adopted policies of the countries. Finally a particular attention is given to the characteristics of the european union countries which present a unique policy among the developed countries. (A.L.B.)

  5. Tendances Carbone n. 10 Jan. 2007

    International Nuclear Information System (INIS)

    2007-01-01

    This newsletter makes first a status of the emissions volume traded between 2005 and 2006 and of the values of traded allowances. Then it makes a synthesis of the European CO 2 market over the last 13 months: traded volumes, spot prices, climate indexes (temperature, precipitations), economic activity indicators (industrial production index, business leaders' confidence index, changes in energy prices, CO 2 quotas allocated to European Union countries, and detailed indicators of CO 2 market, climate, economic activity and energy prices. (J.S.)

  6. [A novel gene (Aa-accA ) encoding acetyl-CoA carboxyltransferase alpha-subunit of Alkalimonas amylolytica N10 enhances salt and alkali tolerance of Escherichia coli and tobacco BY-2 cells].

    Science.gov (United States)

    Xian, Mingjie; Zhai, Lei; Zhong, Naiqin; Ma, Yiwei; Xue, Yanfen; Ma, Yanhe

    2013-08-04

    Acetyl-CoA carboxylase (ACC) catalyzes the first step of fatty acid synthesis. In most bacteria, ACC is composed of four subunits encoded by accA, accB, accC, and accD. Of them, accA encodes acetyl-CoA carboxyltransferase alpha-subunit. Our prior work on proteomics of Alkalimonas amylolytica N10 showed that the expression of the Aa-accA has a remarkable response to salt and alkali stress. This research aimed to find out the Aa-accA gene contributing to salt and alkali tolerance. The Aa-accA was amplified by PCR from A. amylolytica N10 and expressed in E. coli K12 host. The effects of Aa-accA expression on the growth of transgenic strains were examined under different NaCl concentration and pH conditions. Transgenic tobacco BY-2 cells harboring Aa-accA were also generated via Agrobacterium-mediated transformation. The viability of BY-2 cells was determined with FDA staining method after salt and alkali shock. The Aa-accA gene product has 318 amino acids and is homologous to the carboxyl transferase domain of acyl-CoA carboxylases. It showed 76% identity with AccA (acetyl-CoA carboxylase carboxyltransferase subunit alpha) from E. coli. Compared to the wild-type strains, transgenic E. coli K12 strain containing Aa-accA showed remarkable growth superiority when grown in increased NaCl concentrations and pH levels. The final cell density of the transgenic strains was 2.6 and 3.5 times higher than that of the control type when they were cultivated in LB medium containing 6% (W/V) NaCl and at pH 9, respectively. Complementary expression of Aa-accA in an accA-depletion E. coli can recover the tolerance of K12 delta accA to salt and alkali stresses to some extent. Similar to the transgenic E. coli, transgenic tobacco BY-2 cells showed higher percentages of viability compared to the wild BY-2 cells under the salt or alkali stress condition. We found that Aa-accA from A. amylolytica N10 overexpression enhances the tolerance of both transgenic E. coli and tobacco BY-2 cells to

  7. Ductile fracture of two-phase welds under 77K. [Steel-EhP810, steel-EhP666, steel-08Kh18N10T, steel-EhP659-VI, steel-chP810

    Energy Technology Data Exchange (ETDEWEB)

    Yushchenko, K.A.; Voronin, S.A.; Pustovit, A.I.; Shavel' , A.V.

    The effect of the type of welding and fillers on crack resistance of welded joints high-strength steel EhP810 and its various compounds with steels EhP666, 08Kh18N10T has been studied. For the welding of steel EhP810 with steels EhP810, EhP666, 08Kh18N10T electron-beam, automatic, argon tungsten arc with non-consumable electrode with various fillers, as well as argon metal-arc welding with consumable electrode, were used. It is shown, that for a joint, made by electron-beam welding, parameters sigmasub(u), Ksub(IcJ), KCV are higher than for a joint of a similar phase structure made using filler wire EhP659-VI. It is explained by the fact, that during electron-beam welding joint metal refining takes place, which removes gases. In welded joints of chP810 steel, having joints with austenitic structure, characteristic of crack resistance Ssub(c) increases by more than 0.2 mm in contrast to two-phase joints, which conventional yield strength at 77 K exceeds 1000 MPa. It is worth mentioning, that for other classes of steels formation of two-phase structure of joint increases welded joint resistance to brittle fracture. It is possible to obtain the required structure of joint with assigned level of resistance to brittle fracture by means of the use of different fillers, optimum and welding procedure, regulating the part of the basic metal in joint content.

  8. Theoretical exploration of the nanoscale host-guest interactions between [n]cycloparaphenylenes (n = 10, 8 and 9) and fullerene C₆₀: from single- to three-potential well.

    Science.gov (United States)

    Yuan, Kun; Zhou, Cai-Hua; Zhu, Yuan-Cheng; Zhao, Xiang

    2015-07-28

    The nanoscale host-guest interactions between [n]cycloparaphenylene ([n]CPP; n = 10, 8 and 9) nano-ring and fullerene C60 were explored theoretically. It is found that relatively small variations in the sizes of the [n]CPP host lead to very significant changes in encapsulation property toward the fullerene C60 guest. Expectedly, one stable inclusion-configuration of [10]CPP⊃C60 and one floating-configuration of [8]CPP⊃C60 are located on the potential surfaces of the two complexes, respectively. Unexpectedly, besides a floating-configuration (F-[9]CPP⊃C60), another stable inclusion-configuration (I-[9]CPP⊃C60) is also located on the potential surface of [9]CPP⊃C60 host-guest complex. Interaction energies and natural steric analysis show that these complexes are stabilized by balancing concave-convex π-π attractive and steric repulsive host-guest interactions. In contrast, the steric repulsive energy (Es) between host and guest of I-[9]CPP⊃C60 is as high as 233.12 kJ mol(-1), which is much larger than those in other complexes. The movements of C60 guest through the cavities of [n]CPP host (n = 10, 8 and 9) are simulated by calculating the energy profile, and the results interestingly reveal that the encapsulation of C60 by [10]CPP is in the manner of a single-potential well, by [8]CPP in the manner of a double-potential well, and by [9]CPP in the special manner of a three-potential well. We predict that the movement of C60 guest through the cavity of [9]CPP host should be experimentally observable owing to the relatively low energy barrier (<50 kJ mol(-1), M06-2X/6-31G(d)). Charge population analysis shows that an obvious charge transfer between host and guest takes place during the formation of I-[9]CPP⊃C60, which is different from those during the formation of [8]CPP⊃C60, [10]CPP⊃C60 and F-[9]CPP⊃C60. Additionally, the host-guest interaction regions were detected and visualized in real space based on the electron density and reduced density

  9. Tendances Carbone n. 10 Jan. 2007; Tendances Carbone n. 10 janvier 2007

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This newsletter makes first a status of the emissions volume traded between 2005 and 2006 and of the values of traded allowances. Then it makes a synthesis of the European CO{sub 2} market over the last 13 months: traded volumes, spot prices, climate indexes (temperature, precipitations), economic activity indicators (industrial production index, business leaders' confidence index, changes in energy prices, CO{sub 2} quotas allocated to European Union countries, and detailed indicators of CO{sub 2} market, climate, economic activity and energy prices. (J.S.)

  10. Ateneo de Castellon, ANUARIO 1996-97 • N.10

    OpenAIRE

    Castell Alonso, Vicente (Presidente)

    1998-01-01

    SUMARIO: Memoria de actividades del curso. José TRULLÉN. Conferencia de apertura del curso 1997-98, del Dr. Javier Tusell, sobre "Tuñón de Lara y la historiografía contemporánea española". José TRULLÉN. Ciclo de Conferencias sobre la generación del 98. Hacia el 98, Literatura e Historia. (Carlos Bousoño, Poesía y generaciones. Andrés Amorós, El individualismo agónico de Unamuno. Francisco Javier Díez de Revenga, Azorín y el noventa y ocho. Jesús Rubio, Valle Inclán ¿excéntrico del 98?. ...

  11. Relación de la transición A G en la posición –21 del intrón 10 del gen NCF-2 con la expresión de la proteína p67-phox

    Directory of Open Access Journals (Sweden)

    Pablo Patiño

    2001-04-01

    Full Text Available

    El sistema NADPH oxidasa de las células fagocíticas es esencial
    para la producción de metabolitos reactivos de oxígeno que tienen
    acción microbicida importante. La proteína p67-phox, codificada por
    el gen NCF-2, tiene un papel importante en este sistema (1. Previamente nuestro grupo reportó algunos cambios nucleotídicos en regiones no codificadoras del gen NCF-2. Uno de estos corresponde a la
    transición de una adenina (A por una guanina (G en el intrón 10, 21
    nucleótidos antes del inicio del exón 11, sitio importante para la eliminación de este intrón y unión de los exones 10 y 11 durante el procesamiento del ARNm.
    En este proyecto se pretende determinar si existe alguna modificación
    en la expresión de p67-phox inducida por la transición A -►G en la posición -21 del intrón 10 en el gen NCF-2.

     

     

  12. Climate mission study n.10, january 2007; Mission climat note d'etude n. 10, janvier 2007

    Energy Technology Data Exchange (ETDEWEB)

    Delbosc, A.; Keppler, J.H.; Leseur, A

    2007-07-01

    This note aims to explain the evolution of the intensity of the the developed economies of the greenhouse gases emission. This study concerns only the countries called industrialized without the developing countries and those of the old east soviet bloc. In the first part the authors aim to know if the carbon intensity evolution of the economies go with convergence or divergence phenomena. The second part is more devoted to the impacts of the energetic choices on the adopted policies of the countries. Finally a particular attention is given to the characteristics of the european union countries which present a unique policy among the developed countries. (A.L.B.)

  13. Concept of Sukha (comfort) mentioned in Dhatusarata (tissue excellence) w.s.r. to vocational guidance

    Science.gov (United States)

    Waghulade, Hemangini; Harit, Mahesh Kumar

    2014-01-01

    Agni (digestive fire), Prakruti (constitution), Dhatusarata (tissue excellence), Dosha (bio–energies) are the specialties of Ayurveda on which diagnosis, treatment and research are based. The description of Dhatusarata (tissue excellence) has been given under Dashavidha Pariksha (tenfold examination) in Charak Samhita, Viman Sthana, 8th chapter. Some qualities, which are mentioned in Dhatusarata are difficult to assess, e.g. Sukha, Aishwarya, Upabhoga, Bala, etc., There is a need to develop some quantitative parameters to measure these qualities according to tissue excellence i.e. Dhatusarata. By assessing Dhatu Sarata, one can judge the true strength of a particular Dhatu but only the ability or strength is not enough to get success; the liking or interest is also essential to achieve success. The purpose of this study is to elaborate the concept of Dhatusarata and reveal different aspects of Sukha according to the quality of that particular Dhatu in context of vocational guidance. It will help to establish interrelationship between Dhatusarata and vocational guidance. It will be assessed whether this Sukha quality is merely happiness or having different shades according to the excellence of Dhatus and whether this study is useful in guiding the person to choose appropriate profession, which will be according to his liking and ability. It has been concluded that shades of Sukha quality varies with particular Dhatusaras, which may be helpful in guiding a suitable profession to an individual which will be according to his ability and liking i.e. Sukha for intimate success. PMID:26195895

  14. Enhanced superconductivity at the interface of W/Sr2RuO4 point contact

    Science.gov (United States)

    Wei, Jian; Wang, He; Lou, Weijian; Luo, Jiawei; Liu, Ying; Ortmann, J. E.; Mao, Z. Q.

    Differential resistance measurements are conducted for point contacts (PCs) between the Sr2RuO4 (SRO) single crystal and the tungsten tip. Since the tungsten tip is hard enough to penetrate through the surface layer, consistent superconducting features are observed. Firstly, with the tip pushed towards the crystal, the zero bias conductance peak (ZBCP) due to Andreev reflection at the normal-superconducting interface increases from 3% to more than 20%, much larger than previously reported, and extends to temperature higher than the bulk transition temperature. Reproducible ZBCP within 0.2 mV may also help determine the gap value of SRO, on which no consensus has been reached. Secondly, the logarithmic background can be fitted with the Altshuler-Aronov theory of electron-electron interaction for tunneling into quasi two dimensional electron system. Feasibility of such fitting confirms that spectroscopic information like density of states is probed, and electronic temperature retrieved from such fitting can be important to analyse the PC spectra. Third, at bias much higher than 0.2 mV there are conductance dips due to the critical current effect and these dips persist up to 6.2 K. For more details see. National Basic Research Program of China (973 Program) through Grant No. 2011CBA00106 and No. 2012CB927400.

  15. Development of Multiple-Unit Floating Drug Delivery System of Clarithromycin: Formulation, in vitro Dissolution by Modified Dissolution Apparatus, in vivo Radiographic Studies in Human Volunteers.

    Science.gov (United States)

    Reddy, Arun B; Reddy, Narendar D

    2017-07-01

    Clarithromycin (CM), a broad spectrum macrolide antibiotic used to eradicate H. pylori in peptic ulcer. Clarithromycin (CM) is well absorbed from the gastrointestinal tract, but has a bioavailability of 50% due to rapid biodegradation. The aim of this investigation was to increase the gastric residence time, and to control the drug release of clarithromycin by formulating into multiple unit floating mini-tablets. Floating tablets were prepared by using direct compression method with HPMC K 4 M and Polyox WSR 1105 as release retarded polymers and sodium bicarbonate as gas generating agent. The prepared mini-tablets were evaluated for thickness, weight variation, friability, hardness, drug content, in vitro buoyancy, swelling studies, in vitro dissolution studies by using modified Rossett-Rice test and in vivo radiographic studies in healthy human volunteers in fasting conditions. DSC analysis revealed that no interaction between drug and excipients. All the physical parameters of the tablets were within the acceptable limits. The optimized formulation (F6) had showed controlled drug release of 99.16±3.22% in 12 h, by zero-order release kinetics, along with floating lag time of 9.5±1.28 s and total floating time of 12±0.14 h. X-ray imaging studies revealed that in vivo gastric residence time of clarithromycin floating mini-tablet in the stomach was about 3.5 h. The results demonstrated that the developed floating mini-tablets of clarithromycin caused significant enhancement in gastric retention time along with sustained effect and increased oral bioavailability. © Georg Thieme Verlag KG Stuttgart · New York.

  16. Helder Macedo, por outras palavrasdoi:10.5007/2176-8552.2010n10p105

    Directory of Open Access Journals (Sweden)

    Margarida Calafate Ribeiro

    2010-01-01

    Full Text Available Neste artigo oferece-se uma leitura ampla da obra de Helder Macedo a partir de uma linha que cruza as várias formas de escrita do autor e as suas obsessões temáticas, principalmente os grandes fantasmas da história portuguesa remota e recente – o sebastianismo, o colonialismo português, África, a ditadura salazarista, o 25 de Abril e a democracia portuguesa.

  17. On the eletronic structure of Be sub(n) (3 < = n < = 10) clusters

    International Nuclear Information System (INIS)

    Camargo, F.P.; Vianna, J.D.M.

    The electronic configurations, bonding energies and molecular orbital energies of Be(sub n) (n = 3, 4, 6, 10) have been calculated by the SCF-MO-CNDO theory parametrized by Boyd and Whitehead (CNDO/BW). Comparisons are made with the theoretical results which are available. (Author) [pt

  18. Exercise book n.10: the nuclear deterrence has to be thought again

    International Nuclear Information System (INIS)

    2002-06-01

    Numerous questions about nuclear deterrence are tackled in this part. Some definitions are given (what is deterrence, nuclear winter). In practice what it means, lack of credibility, prevention between nuclear powers, hostility, suspicion, escalation. Ethical aspect and legality are tackled too. Toward a strategy giving a real security: the example of the New Zealand, a non nuclear strategy for O.T.A.N., the importance of checking. (N.C.)

  19. Influence of ion implanted helium on deuterium trapping in Kh18N10T stainless steel

    International Nuclear Information System (INIS)

    Tolstolutskaya, G.D.; Ruzhitskij, V.V.; Kopanets, I.E.

    2004-01-01

    The results are presented on evolution of distribution profiles and helium and deuterium thermal desorption ion implanted in steel 18Cr10NiTi. Accumulation, trapping, retention and microstructure evolution are studied; effect helium and hydrogen simultaneous implantation on these processes is also studied

  20. CompTIA Network+ Review Guide (Exam N10-004)

    CERN Document Server

    Ferguson, Bill

    2009-01-01

    Serving as a concise, focused study aid to help you prepare for the leading non-vendor-specific networking certification exam, this book features more review questions and study review features than any other guide, with over 120 review questions, two bonus exams, and electronic Flashcard, as well as a searchable Glossary of Terms database on CD-ROM. Fully updated for the first revision of the CompTIA Network+ exam since 2005, the book is organized by exam objectives and broken into six parts corresponding to the six domain areas of the Network+ exam: technologies, media and topologies, device

  1. IDEA papers no 10; Les cahiers d'I.D.E.A. n.10

    Energy Technology Data Exchange (ETDEWEB)

    Ricard, M. [Bordeaux-3 Univ., 33 (France)

    2004-07-01

    The Information network on the Economic Development in Aquitaine (IDEA) aims to collect and spread the environmental information concerning the Aquitaine, in order to implement an observatory of the regional environment and of the sustainable development. The IDEA paper no.10 is devoted to the sustainable development education. Examples of actions in agriculture schools and colleges are presented. (A.L.B.)

  2. Neutron energy spectra from the thick target 9Be(d,n)10B reaction

    International Nuclear Information System (INIS)

    Whittlestone, S.

    1976-12-01

    The energy spectrum of neutrons emitted when deuterons impinge on a thick beryllium target has been measured using an NE213 scintillation detector and the time-of-flight technique. Spectra were measured at angles of 0, 30, 45, 60, 90, 120 and 150 0 for deuteron energies of 1.4, 1.8, 2.3 and 2.8 MeV. Tables are presented of these angle-dependent energy spectra, the angle-integrated energy dependent yeidls, and the total neutron yield as a function of deuteron energy. (author)

  3. Endoscopic evaluation of therapeutic effects of “Anuloma-Viloma Pranayama” in Pratishyaya w.s.r. to mucociliary clearance mechanism and Bernoulli's principle

    Science.gov (United States)

    Bhardwaj, Atul; Sharma, Mahendra Kumar; Gupta, Manoj

    2013-01-01

    The current endeavor intended to evaluate the effectiveness and mode of action of Anuloma-Viloma Pranayama (AVP), i.e., alternate nasal breathing exercise, in resolving clinical features of Pratishyaya, i.e., rhinosinusitis. The present study was directed to validate the use of classical “saccharin test” in measuring the nasal health by measuring mucociliary clearance time. This study also highlights the effects of AVP by application of Bernoulli principle in ventilation of paranasal sinuses and surface oxygenation of nasal and paranasal sinuses ciliary epithelium. Clinically, endoscopically and radiologically diagnosed patients of Pratishyaya, i.e., rhinosinusitis, satisfying the inclusion criteria were selected to perform AVP as a breathing exercise regularly for 30 min every day in order to evaluate the effectiveness of AVP in resolving features of rhinosinusitis. Saccharin test was performed before and after completion of 40 days trial to assess the nasal ciliary activity, which has been proved to be directly related to the health of ciliary epithelium and nasal health overall as well. AVP may be regarded as a catalyst to conspicuously enhance ventilation and oxygenation of the paranasal sinuses and the positively effect the nasal respiratory epithelium by increasing better surface availability of oxygen and negative pressure in the nasal cavity itself. PMID:24696572

  4. Equipment of the metallographic cell n. 10 in the irradiated fuel element laboratories (L.E.C.L); Equipement de la cellule de metallographie n. 10 du L.E.C.I

    Energy Technology Data Exchange (ETDEWEB)

    Roussel, E; Vignesoult, N [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1963-07-01

    A conventional metallographic apparatus has been adapted for work in a protected cell. The small size of the apparatus and the placing of this apparatus simply on a working bench which can easily be dismantled make it possible on the one hand to repair the apparatus easily in the event of a breakdown, and on the other hand to decontaminate it fairly easily without the presence of a technician in the cell. (authors) [French] Une installation de metallographie classique a ete adaptee au travail en cellule blindee. Le faible encombrement des appareils, le simple positionnement de ces derniers sur un plan de travail facilement demontable permettent, d'une part un demontage aise en cas de panne, d'autre part une decontamination qui peut se faire pratiquement sans intervention d'un agent dans la cellule. (auteurs)

  5. Assessment of Pseudomonas aeruginosa N5,N10-methylenetetrahydrofolate dehydrogenase-cyclohydrolase as a potential antibacterial drug target.

    Directory of Open Access Journals (Sweden)

    Thomas C Eadsforth

    Full Text Available The bifunctional enzyme methylenetetrahydrofolate dehydrogenase - cyclohydrolase (FolD is identified as a potential drug target in Gram-negative bacteria, in particular the troublesome Pseudomonas aeruginosa. In order to provide a comprehensive and realistic assessment of the potential of this target for drug discovery we generated a highly efficient recombinant protein production system and purification protocol, characterized the enzyme, carried out screening of two commercial compound libraries by differential scanning fluorimetry, developed a high-throughput enzyme assay and prosecuted a screening campaign against almost 80,000 compounds. The crystal structure of P. aeruginosa FolD was determined at 2.2 Å resolution and provided a template for an assessment of druggability and for modelling of ligand complexes as well as for comparisons with the human enzyme. New FolD inhibitors were identified and characterized but the weak levels of enzyme inhibition suggest that these compounds are not optimal starting points for future development. Furthermore, the close similarity of the bacterial and human enzyme structures suggest that selective inhibition might be difficult to attain. In conclusion, although the preliminary biological data indicates that FolD represents a valuable target for the development of new antibacterial drugs, indeed spurred us to investigate it, our screening results and structural data suggest that this would be a difficult enzyme to target with respect to developing the appropriate lead molecules required to underpin a serious drug discovery effort.

  6. Equipment of the metallographic cell n. 10 in the irradiated fuel element laboratories (L.E.C.L)

    International Nuclear Information System (INIS)

    Roussel, E.; Vignesoult, N.

    1963-01-01

    A conventional metallographic apparatus has been adapted for work in a protected cell. The small size of the apparatus and the placing of this apparatus simply on a working bench which can easily be dismantled make it possible on the one hand to repair the apparatus easily in the event of a breakdown, and on the other hand to decontaminate it fairly easily without the presence of a technician in the cell. (authors) [fr

  7. Treinamento agroindustrial de pequenos produtores do sul da BahiaDOI:10.5007/1807-0221.2010v7n10p150

    Directory of Open Access Journals (Sweden)

    Antonio Fábio Reis Figueirêdo

    2010-12-01

    Full Text Available The family agriculture activity produces the most of Brazilian food production. However, the technical assistance for these farmers is almost inexistence. So your social economic development is limited. The production agricultural industrialization is the alternatives to provide social economic family farmers. Believing in family agriculture as a way to ensure income and quality of life and understanding of world agriculture production and social economic development of family farmers in Southern Bahia,tThe Universidade Estadual de Santa Cruz implemented in 2009, the Agribusines Extension Project Program. The objective of this work was show technical training on Agribusines Program in 2009.

  8. Luís de Camões então e agoradoi:10.5007/2176-8552.2010n10p15

    Directory of Open Access Journals (Sweden)

    Helder Macedo

    2010-01-01

    Full Text Available Luís de Camões viveu num mundo em transição entre verdades recebidas e certezas ainda por conhecer. Esta leitura analítica da sua obra visa a caracterizar a arrojada modernidade da sua demanda de uma significação universal para a sua experiência pessoal.

  9. EPE analysis of sub-N10 BEoL flow with and without fully self-aligned via using Coventor SEMulator3D

    Science.gov (United States)

    Franke, Joern-Holger; Gallagher, Matt; Murdoch, Gayle; Halder, Sandip; Juncker, Aurelie; Clark, William

    2017-03-01

    During the last few decades, the semiconductor industry has been able to scale device performance up while driving costs down. What started off as simple geometrical scaling, driven mostly by advances in lithography, has recently been accompanied by advances in processing techniques and in device architectures. The trend to combine efforts using process technology and lithography is expected to intensify, as further scaling becomes ever more difficult. One promising component of future nodes are "scaling boosters", i.e. processing techniques that enable further scaling. An indispensable component in developing these ever more complex processing techniques is semiconductor process modeling software. Visualization of complex 3D structures in SEMulator3D, along with budget analysis on film thicknesses, CD and etch budgets, allow process integrators to compare flows before any physical wafers are run. Hundreds of "virtual" wafers allow comparison of different processing approaches, along with EUV or DUV patterning options for defined layers and different overlay schemes. This "virtual fabrication" technology produces massively parallel process variation studies that would be highly time-consuming or expensive in experiment. Here, we focus on one particular scaling booster, the fully self-aligned via (FSAV). We compare metal-via-metal (mevia-me) chains with self-aligned and fully-self-aligned via's using a calibrated model for imec's N7 BEoL flow. To model overall variability, 3D Monte Carlo modeling of as many variability sources as possible is critical. We use Coventor SEMulator3D to extract minimum me-me distances and contact areas and show how fully self-aligned vias allow a better me-via distance control and tighter via-me contact area variability compared with the standard self-aligned via (SAV) approach.

  10. Polarity of semipolar wurtzite crystals: X-ray photoelectron diffraction from GaN{10-11} and GaN{20-21} surfaces

    Czech Academy of Sciences Publication Activity Database

    Romanyuk, Olexandr; Jiříček, Petr; Paskova, T.; Bartoš, Igor

    2014-01-01

    Roč. 116, č. 10 (2014), "104909-1"-"104909-6" ISSN 0021-8979 Grant - others:AVČR(CZ) M100101201 Institutional support: RVO:68378271 Keywords : nitride compounds * XPD * low-energy electron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2014

  11. Thin films of molecular materials synthesized from C32H20N10M (M Co, Pb, Fe): Film formation, electrical and optical properties

    International Nuclear Information System (INIS)

    Rodriguez, A.; Sanchez Vergara, M.E.; Garcia Montalvo, V.; Ortiz, A.; Alvarez, J.R.

    2010-01-01

    In this work, the synthesis of molecular materials formed from metallic phthalocyanines and 1,4-phenylenediamine is reported. The powder and thin film (∼80-115 nm thickness) samples of the synthesized materials, deposited by vacuum thermal evaporation, show the same intra-molecular bonds in the IR spectroscopy studies, which suggests that the thermal evaporation process does not alter these bonds. The morphology of the deposited films was studied using scanning electron microscopy (SEM) and atomic force microscopy (AFM) and their optical and electrical properties were studied as well. The optical parameters have been investigated using spectrophotometric measurements of transmittance in the wavelength range 200-1200 nm. The absorption spectra recorded in the UV-vis region for the deposited samples showed two bands, namely the Q and Soret bands. The optical activation energy was calculated and found to be 3.41 eV for the material with cobalt, 3.34 eV for the material including lead and 3.5 eV for the material with iron. The effect of temperature on conductivity was measured for the thin films and the corresponding conduction processes are discussed in this work.

  12. A study of the higher excitation levels of 11B via the 10B(n,n)10B and 10B(n,n')10B*(0.72, 1.74, 2.15, 3.59, 4.77 MeV) reactions

    International Nuclear Information System (INIS)

    Sadowski, E.T.

    1988-11-01

    As part of the study of the higher energy-level structure of 11 B, cross sections for elastic and inelastic scattering of neutrons from isotopically enriched 10 B samples have been measured for incident neutron energies from 3.03 MeV to 6.45 MeV in 250 keV increments and from 7.02 MeV to 12.01 MeV in 500 keV increments. Inelastic angular distributions for scattering to the states in parentheses in 10 B have been measured from the indicated energy up to 12.01 MeV; (0.718) from 3.02 MeV; (1.74) from 3.27 MeV; (2.15) from 3.77 MeV; (3.59) from 5.52 MeV; (4.77) from 7.02 MeV. The measurements at 3.02, 3.51, 4.02, and 4.51 MeV were done at nine laboratory angles from 20/degree/ to 158/degree/ in 17.5/degree/ increments with a sample that is isotopically 95.86% 10 B. All other distributions measured scattering at 11 laboratory angles from 18/degree/ to 158/degree/ in 15/degree/ increments from a sample that is isotopically 99.49% 10 B. The data are corrected for air scattering, sample attenuation, minor isotope impurity, multiple scattering, and elastic and inelastic scattering from the sample of the neutron source continuum and contaminants. An eight-channel, multilevel R-matrix analysis was performed on the data. Level energies, spins, and parities were deduced for twelve levels above 13 MeV excitation in 11 B. Only two definite and three tentative assignments for T = /1/2/ levels had been made previously above 13 MeV. The two definite levels were confirmed. Good agreement between the data and the R-matrix calculation in all analyzed channels was obtained for the proposed structure. 122 refs., 40 figs., 7 tabs

  13. 40 CFR Table 1 to Subpart W of... - General Provisions Applicability to Subpart W

    Science.gov (United States)

    2010-07-01

    ... Subpart W 1 Table 1 to Subpart W of Part 63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Polyamides Production Pt. 63, Subpt. W, Table 1 Table 1 to Subpart W of Part 63—General Provisions Applicability to Subpart W Reference Applies to subpart W BLR WSR WSR alternative standard, and BLR equipment...

  14. UNIVERSITIES WORLDSKILLS RUSSIA COMPETITIONS AS A MEANS OF DEVELOPING BACHELOR’S COMPETENCIES ON SPECIALTY “TOURISM”

    Directory of Open Access Journals (Sweden)

    Olga Victorovna Kandyba

    2018-01-01

    Full Text Available The relevance of the inclusion of the universities competitions in accordance with WorldSkills Russia standards (hereinafter – WSR is determined by the problematic situation that has developed in the higher education system and the modern requirements of the tourist industry labor market for graduates. Universities competitions in accordance with international standards are a new direction in the WSR movement, which can enhance the status of vocational education. This is the first experience in Russia, which, first, requires reflection, understanding and, accordingly, acceptance by the university teaching community of the WSR movement itself. Secondly, the conducted competitions have revealed a number of problems that must be solved on the way to effective implementation of WSR standards in the educational process. The article presents the matrix of professional competencies, compiled on the basis of the Federal State Educational Standard of the Higher Professional Education in “Tourism” training area 43.03.02 and the Skill WSR “Tourism” standards. On the basis of the developed matrix of competences, the correlation between the professional competencies of HPE FSES and competencies shown in the modules of the Skill WSR “Tourism” is revealed. Purpose Conducting a comparative analysis of the competencies of the HPE FSES in “Tourism” training area with competencies based on the modules of the competition task of the WSR Championship. Methodology In the article methods of included observation, peer review and comparative analysis were used. Results A comparative analysis of the competencies of the HPE FSES in “Tourism” training area with competencies necessary to complete the modules of the competition task of the WSR competition is conducted, recommendations on the expansion of the elements of the competition tasks for the university championship WSR are given. Practical implications The results obtained should be used to

  15. Powerful infrared emitting diodes

    Directory of Open Access Journals (Sweden)

    Kogan L. M.

    2012-02-01

    Full Text Available Powerful infrared LEDs with emission wavelength 805 ± 10, 870 ± 20 and 940 ± 10 nm developed at SPC OED "OPTEL" are presented in the article. The radiant intensity of beam diode is under 4 W/sr in the continuous mode and under 100 W/sr in the pulse mode. The radiation power of wide-angle LEDs reaches 1 W in continuous mode. The external quantum efficiency of emission IR diodes runs up to 30%. There also has been created infrared diode modules with a block of flat Fresnel lenses with radiant intensity under 70 W/sr.

  16. Crystal structure of trans-(1,8-dibutyl-1,3,6,8,10,13-hexaazacyclotetradecane-κ4N3,N6,N10,N13bis(isonicotinato-κOcopper(II from synchrotron data

    Directory of Open Access Journals (Sweden)

    Jong Won Shin

    2015-02-01

    Full Text Available The title compound, [Cu(C6H4NO22(C16H38N6] has been synthesized and characterized by structure analysis based on synchrotron data and by FT–IR spectroscopy. The asymmetric unit consists of half of the CuII complex, the other half being completed by inversion symmetry. The CuII ion has a tetragonally distorted octahedral coordination sphere with four secondary N atoms of the azamacrocyclic ligand in the equatorial plane [Cu—Neq = 2.018 (12 Å] and two O atoms of the isonicotinate anions at the axial positions [Cu—Oax = 2.4100 (11 Å]. Intramolecular N—H...O hydrogen bonds between one of the secondary amine N—H groups of the azamacrocyclic ligand and the non-coordinating O atom of the isonicotinate ions stabilize the molecular structure. Intermolecular N—H...N hydrogen bonds between the other macrocyclic N—H group and the pyridine N atom of an adjacent isonicotinate anion as well as π–π interactions [centroid-to-centroid distance 3.711 (2 Å] lead to the formation of rods parallel to [001].

  17. Um mundo à beira mar, curso de capacitação e alternativas didáticas, uma parceria com a escola do marDOI:10.5007/1807-0221.2010v7n10p1

    Directory of Open Access Journals (Sweden)

    Alessandra Larissa Fonseca

    2010-12-01

    Full Text Available The project was carried out between May and December 2009 with the goal of providing teachers from the elementary school of Florianópolis City information on marine science, coastal ecosystems of the Santa Catarina island and the human impacts that occur in these environments, offering practical activities to share this knowledge through ludic activity with their students. A course in Distance Learning, available by Moodle UFSC, being developed in five themes: Origin of the Oceans, Oceanography like a Science, The Marine Ecosystem, Santa Catarina Island - Environment and Ecosystem. Each theme had the theoretical content of the subject, description of practical activities to be developed in the classroom and in the ecosystems of SC Island and quiz to assess the participants of the course, as well as, references of text and audiovisual materials. The course was offered in November 2009 for the participant to study 16 hours of theory by EAD and 4 hours of practical activity visiting some ecosystems of the Santa Catarina Island. Participants took more than 90% of the content offered and made a positive assessment on the content and materials available on the course. The practical activity allowed us to assess the participants’ involvement with their training, as well as discuss some themes related to exchange experiences among people. It is expected to continue the project, extending it to other municipalities in the coastal region of SC and clumping the suggestions made by teachers who participated in the course.

  18. Results obtained so far with the production of turbine and valve casings made of the new 9% Cr cast steel types G-X 12 CrMoWVNbN 10 11 and G-X 12 CrMoVNbN 91; Erfahrungsbericht ueber die Herstellung von Turbinen- und Ventilgehaeusen aus den neuen 9% Cr-Stahlgusssorten G-X 12 CrMoWVNbN 10 1 1 und G-X 12 CrMoVNbN 91

    Energy Technology Data Exchange (ETDEWEB)

    Schuster, F.; Buberl, A.; Hanus, R. [VOEST-ALPINE STAHL LINZ GmbH, Linz (Austria); Cerjak, H. [Technische Univ., Graz (Austria)

    1996-12-31

    In the course of production start-up of new 9-10% Cr cast steel types, and application of R and D results to practice, the following examinations and modifications have been performed: 1. Reduction of average chromium content from 10.5 to 9.5% in order to suppress delta ferrite segregation, and adjustment of austenite and ferrite stabilizing alloying constituents. 2. Analysis of typical defects in castings, and modification of casting and feeding techniques in compliance with the saturation behaviour of the new 9-10% Cr steels. These measures achieved a reduction of feeding-based flaws (shrinkage) in the last few cast pieces. 3. The good weldability was proven of the new 9-10% Cr steels by means of welding tests and crack-free production and construction welds made in cast pieces. (orig./MM) [Deutsch] Im Zuge der Produktionsaufnahme neuer 9-10% Cr-Stahlgusssorten und der Ueberleitung der F and E Ergebnisse in die betriebliche Praxis wurden folgende Untersuchungen und Anpassungen vorgenommen: 1. Um die Deltaferritausscheidung zu unterdruecken, wurde der mittlere Chromgehalt von 10,5 auf 9,5% abgesenkt und die austenit- und ferritstabilisierenden Legierungselemente besser angepasst. 2. Die Analyse typischer Fehlererscheinungen an Gussstuecken machten eine Anpassung der Giess- und Speisungstechnik an das Saettigungsverhalten der neuen 9-10% Cr-Staehle erforderlich. Diese Massnahmen fuehrten zu einer Verringerung der Speisungsfehler (Lunker) bei den zuletzt abgegossenen Gussstuecken. 3. Bei Schweissversuchen und an Gussstuecken rissfrei ausgefuehrten Fertigungs- und Konstruktionsschweissungen konnte die gute Schweisseignung der neuen 9-10% Cr-Staehle nachgewiesen werden. (orig./MM)

  19. TOR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A tornado warning is issued by the local NWS Weather Forecast Office (WFO) when a tornado is indicated by the WSR-88D radar or sighted by spotters.

  20. NEXRAD Rainfall Data: Eureka, California

    Data.gov (United States)

    National Aeronautics and Space Administration — Next-Generation Radar (NEXRAD) Weather Surveillance Radar 1988 (WSR-88D) measurements were used to support AMSR-E rainfall validation efforts in Eureka, California,...

  1. Thinking Inside the Box: Simple Methods to Evaluate Complex Treatments

    Directory of Open Access Journals (Sweden)

    J. Michael Menke

    2011-10-01

    Full Text Available We risk ignoring cheaper and safer medical treatments because they cannot be patented, lack profit potential, require too much patient-contact time, or do not have scientific results. Novel medical treatments may be difficult to evaluate for a variety of reasons such as patient selection bias, the effect of the package of care, or the lack of identifying the active elements of treatment. Whole Systems Research (WSR is an approach designed to assess the performance of complete packages of clinical management. While the WSR method is compelling, there is no standard procedure for WSR, and its implementation may be intimidating. The truth is that WSR methodological tools are neither new nor complicated. There are two sequential steps, or boxes, that guide WSR methodology: establishing system predictability, followed by an audit of system element effectiveness. We describe the implementation of WSR with a particular attention to threats to validity (Shadish, Cook, & Campbell, 2002; Shadish & Heinsman, 1997. DOI: 10.2458/azu_jmmss.v2i1.12365

  2. Effects of repository conditions on environmental impact reduction by recycling

    International Nuclear Information System (INIS)

    Ahn, Joonhong

    2010-01-01

    The environmental impacts (EI) of high-level wastes (HLW) disposed of in a water-saturated repository (WSR) and in the Yucca Mountain Repository (YMR) for various fuel cycle cases have been evaluated and compared to observe the difference in the recycling effects for differing repository conditions. With the impacts of direct spent fuel disposal in each repository as the reference level, separation of actinides by Urex+ and borosilicate vitrification clearly reduces the environmental impacts of YMR, while separation by Purex and borosilicate vitrification would not necessarily reduce the environmental impact of WSR. (authors)

  3. Testing of wet scrap recovery equipment for mixed oxide scrap reprocessing

    International Nuclear Information System (INIS)

    Demiter, J.A.; Klem, M.J.; Owen, T.J.

    1984-08-01

    The Wet Scrap Recovery (WSR) program was initiated at the Hanford Engineering Development Laboratory (HEDL) by Westinghouse Hanford Company in Richland, Washington to demonstrate fuel fabrication scrap recovery and reconversion to fuel grade oxide powder using the continuous coprecipitation-calcination (COPRECAL) conversion process. Advancements in process control equipment and instrumentation were also developed and demonstrated

  4. In vitro antibacterial effect of Withania somnifera root extract on Escherichia coli

    Science.gov (United States)

    Kumari, Mamta; Gupta, R. P.

    2015-01-01

    Aim: The aim was to investigate antibacterial activity of Withania somnifera (Ashwagandha), an Indian traditional medicinal plant against Escherichia coli O78, a pathogenic strain. Materials and Methods: Two-fold serial dilutions of 20% aqueous W. somnifera root (WSR) extract were inoculated with E. coli O78 @ 1*107 colony forming units grown in nutrient broth. Following inoculation, turbidity optical density was measured by spectrophotometer at 600 nm in all the tubes at 0, 2, 4, 6 and 8 h of incubation at 37°C. Result: The results revealed that the maximum inhibition of bacterial growth was observed at 1:8 dilution of WSR extract. The highest dilution of the extract that showed inhibited growth of the test organism when compared with control was 1:16. Therefore, the minimum inhibitory concentration of aqueous extract of WSR is 1:16. Conclusion: It is concluded that WSR possessed good antibacterial activity, confirming the great potential of bioactive compounds and its rationalizing use in health care. PMID:27046997

  5. Total Lightning as an Indicator of Mesocyclone Behavior

    Science.gov (United States)

    Stough, Sarah M.; Carey, Lawrence D.; Schultz, Christopher J.

    2014-01-01

    Apparent relationship between total lightning (in-cloud and cloud to ground) and severe weather suggests its operational utility. Goal of fusion of total lightning with proven tools (i.e., radar lightning algorithms. Preliminary work here investigates circulation from Weather Suveilance Radar- 1988 Doppler (WSR-88D) coupled with total lightning data from Lightning Mapping Arrays.

  6. Weighted Sum-Rate Maximization Using Weighted MMSE for MIMO-BC Beamforming Design

    DEFF Research Database (Denmark)

    Christensen, Søren; De Carvalho, Elisabeth; Agarwal, Rajiv

    2009-01-01

    This paper studies linear transmit filter design for weighted sum-rate (WSR) maximization in the multiple input multiple output broadcast channel (MIMO-BC). The problem of finding the optimal transmit filter is non-convex and intractable to solve using low complexity methods. Motivated by recent ...

  7. 77 FR 72439 - Residential, Business, and Wind and Solar Resource Leases on Indian Land

    Science.gov (United States)

    2012-12-05

    ... to streamline and expedite the leasing process, advance economic development, and spur renewable... entities; however, many tribes requested clarification regarding other taxation arising in the context of... residential, business, and WSR leasing subparts to subpart A. This section now addresses not only taxation of...

  8. Water Dancer II-a: a Non-tethered Telecontrollable Water Strider Robot

    Directory of Open Access Journals (Sweden)

    Licheng Wu

    2011-09-01

    Full Text Available Water Strider Robot (WSR is a kind of bio‐ inspired micro robot that can stand and move on water surface via surface tension. In this paper, a design method is presented with algorithms for designing driving leg. Structure, control system and software of the robot are also discussed in details. A prototype Water Dancer II‐a that is driven with two electric motors is presented as successfully tested in lab. The proposed WSR is tele‐controlled with infrared signals and has the capability of turning and speed regulation with features of light tiny volume and low power consumption. Experimental results are reported and discussed to show practical feasibility of the presented WSR prototype. The new results in the paper are related also to the WSR prototype design with a robot body of less than 30 x 30 mm size and with ten leg rods of 90 mm length and 0.2 diameter that are able to provide lifting force for a water walk of the 6.0 grams robot at a forward speed of 20 cm/s or angular velocity of 9 degree/s with two micro DC motors (RoomFlight 4 x 8 mm, 28 Ohm.

  9. Water Dancer II-A: A Non-Tethered Telecontrollable Water Strider Robot

    Directory of Open Access Journals (Sweden)

    Licheng Wu

    2011-09-01

    Full Text Available Water Strider Robot (WSR is a kind of bio-inspired micro robot that can stand and move on water surface via surface tension. In this paper, a design method is presented with algorithms for designing driving leg. Structure, control system and software of the robot are also discussed in details. A prototype Water Dancer II-a that is driven with two electric motors is presented as successfully tested in lab. The proposed WSR is tele-controlled with infrared signals and has the capability of turning and speed regulation with features of light tiny volume and low power consumption. Experimental results are reported and discussed to show practical feasibility of the presented WSR prototype. The new results in the paper are related also to the WSR prototype design with a robot body of less than 30 × 30 mm size and with ten leg rods of 90 mm length and 0.2 diameter that are able to provide lifting force for a water walk of the 6.0 grams robot at a forward speed of 20 cm/s or angular velocity of 9 degree/s with two micro DC motors(RoomFlight 4 × 8 mm, 28 Ohm.

  10. 76 FR 46149 - Financial Assistance: Wildlife Restoration, Sport Fish Restoration, Hunter Education and Safety

    Science.gov (United States)

    2011-08-01

    ... these regulations on June 10, 2010, to address changes in law, regulation, policy, technology, and... Service 50 CFR Part 80 Financial Assistance: Wildlife Restoration, Sport Fish Restoration, Hunter... 80 [Docket No. FWS-R9-WSR-2009-0088; 91400-5110-POLI-7B; 91400-9410-POLI- 7B] RIN 1018-AW65 Financial...

  11. 78 FR 77699 - Information Collection Request Sent to the Office of Management and Budget (OMB) for Approval...

    Science.gov (United States)

    2013-12-24

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-HQ-WSR-2013-N292]; [FVWF941009000007B-XXX-FF09W10000; FVWF51100900000-XXX-FF09W10000] Information Collection Request Sent to the Office of... technology constraints. We expanded to a cloud-computing environment in October 2012, and, effective January...

  12. Changes in soil water availability in vineyards can be traced by the carbon and nitrogen isotope composition of dried wines.

    Science.gov (United States)

    Spangenberg, Jorge E; Zufferey, Vivian

    2018-04-13

    The grapevine is one of the most important edible fruit plants cultivated worldwide, and it is highly sensitive to changes in the soil water content. We studied the total carbon and nitrogen contents and stable isotope compositions (C/N WSR , δ 13 C WSR and δ 15 N WSR values) of the solid residues obtained by freeze-drying wines produced from two white grapevine cultivars (Vitis vinifera L. cv Chasselas and Petite Arvine) field grown under different soil water regimes while maintaining other climatic and ecopedological conditions identical. These experiments simulated the more frequent and extended climate change-induced periods of soil water shortage. The wines were from the 2009-2014 vintages, produced using the same vinification procedure. The plant water status, reflecting soil water availability, was assessed by the predawn leaf water potential (Ψ pd ), monitored in the field during the growing seasons. For both wine varieties, the δ 13 C WSR values are highly correlated with Ψ pd values and record the soil water availability set by soil water holding capacity, rainfall and irrigation water supply. These relationships were the same as those observed for the carbon isotope composition of fruit sugars (i.e., must sugars) and plant water status. In Chasselas wines, the nitrogen content and δ 15 N WSR values decreased with soil water deficit, indicating control of the flux of soil-water soluble nutrients into plants by soil water availability. Such a correlation was not found for Petite Arvine, probably due to different N-metabolism processes in this genetically atypical cultivar. The results presented in this study confirm and generalize what was previously found for red wine (Pinot noir); the carbon isotope composition of wine solid residues is a reliable indicator of the soil and the plant water status and thus can be used to trace back local climatic conditions in the vineyard's region. In most wines (except Petite Arvine) the C/N WSR and δ 15 N WSR

  13. Raman spectroscopic studies on single supersaturated droplets of sodium and magnesium acetate.

    Science.gov (United States)

    Wang, Liang-Yu; Zhang, Yun-Hong; Zhao, Li-Jun

    2005-02-03

    Raman spectroscopy was used to study structural changes, in particular, the formation of contact-ion pairs in supersaturated aqueous NaCH(3)COO and Mg(CH(3)COO)(2) droplets at ambient temperatures. The single droplets levitated in an electrodynamic balance (EDB), lost water, and became supersaturated when the relative humidity (RH) decreased. For NaCH(3)COO droplet the water-to-solute molar ratio (WSR) was 3.87 without solidification when water molecules were not enough to fill in the first hydration layer of Na(+), in favor of the formation of contact-ion pairs. However, the symmetric stretching vibration band (nu(3) mode) of free -COO(-) constantly appeared at 1416 cm(-1), and no spectroscopic information related to monodentate, bidentate, or bridge bidentate contact-ion pairs was observed due to the weak interactions between the Na(+) and acetate ion. On the other hand, the band of methyl deformation blue shifted from 1352 to 1370 cm(-1) (at RH = 34.2%, WSR = 2.43), corresponding to the solidification process of a novel metastable phase in the highly supersaturated solutions. With further decreasing RH, a small amount of supersaturated solution still existed and was proposed to be hermetically covered by the metastable phase of the particle. In contrast, the interaction between Mg(2+) and acetate ion is much stronger. When WSR decreased from 21.67 to 2.58 for the Mg(CH(3)COO)(2) droplet, the band of C-C-symmetric stretching (nu(4) mode) had a blue shift from 936 to 947 cm(-1). The intensity of the two new shoulders (approximately 1456 and approximately 1443 cm(-1)) of the nu(3) band of free -COO(-) at 1420 cm(-1) increased with the decrease of WSR. These changes were attributed to the formation of contact-ion pairs with bidentate structures. In particular, the small frequency difference between the shoulder at approximately 1443 cm(-1) and the nu(3) band of the free -COO(-) group (approximately 1420 cm(-1)) was proposed to be related to the formation of a chain

  14. Bilayer tablets of Paliperidone for Extended release osmotic drug delivery

    Science.gov (United States)

    Chowdary, K. Sunil; Napoleon, A. A.

    2017-11-01

    The purpose of this study is to develop and optimize the formulation of paliperidone bilayer tablet core and coating which should meet in vitro performance of trilayered Innovator sample Invega. Optimization of core formulations prepared by different ratio of polyox grades and optimization of coating of (i) sub-coating build-up with hydroxy ethyl cellulose (HEC) and (ii).enteric coating build-up with cellulose acetate (CA). Some important influence factors such as different core tablet compositions and different coating solution ingredients involved in the formulation procedure were investigated. The optimization of formulation and process was conducted by comparing different in vitro release behaviours of Paliperidone. In vitro dissolution studies of Innovator sample (Invega) with formulations of different release rate which ever close release pattern during the whole 24 h test is finalized.

  15. Markers of visceral obesity and cardiovascular risk in patients with polycystic ovarian syndrome.

    Science.gov (United States)

    Gateva, Antoaneta Trifonova; Kamenov, Zdravko Asenov

    2012-10-01

    Polycystic ovarian syndrome (PCOS) is one of most common endocrine disturbances in women of reproductive age. Besides its well known effects on reproductive health, it is also linked to increased cardiovascular risk in later life. The aim of this study was to investigate the link between some anthropometric indices of visceral obesity and surrogate markers of cardiovascular risk according to the Androgen Excess and Polycystic Ovary Syndrome (AE-PCOS) Society consensus. The study included 36 normal weight (BMIcardiometabolic profile and composite cardiovascular risk factors as defined by the AE-PCOS consensus. Both waist-to-stature ratio (WSR) (area under the curve 0.75, p=0.002) and waist circumference (WC) (area under the curve 0.77, p=0.001) but not waist-to-hip ratio (WHR) (area under the curve 0.62, p=0.143) were shown to be good markers of increased cardiovascular risk, insulin resistance and dislipidemia in PCOS patients. The cut-off point for WSR of 0.50 is useful and the cut-off of 80 cm for WC is more appropriate than 88 cm in detecting cardiovascular risk in PCOS patients. Androgen levels and immunoreactive insulin during an oral glucose tolerance test had lower power for predicting increased cardiovascular risk than WC and WSR. The study indicates that WSR and WC are better associated with composite cardiovascular risk factors as defined by the AE-PCOS consensus than WHR, and that the commonly used cut-off for WSR of 0.5 is useful for detecting cardiovascular risk in PCOS patients. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  16. Development and evaluation of a chronotherapeutic drug delivery system of torsemide

    Directory of Open Access Journals (Sweden)

    Songa Ambedkar Sunil

    2011-09-01

    Full Text Available The objective of this study was to prepare and evaluate chronotherapeutic drug delivery systems (ChrDDs of torsemide. Compression coated tablets (CCT containing torsemide in the core tablet were prepared by the compression coating technique with different grades of polyethylene oxide (PEO WSR 301 & 1105. The optimized formulations were characterised for tabletting parameters and drug polymer interaction by Fourier-Transform Infrared Spectroscopy (FTIR.The hardness of all the CCT using PEO WSR 301 & PEO WSR 1105 were in the range 6-8 kg/cm² & 5.5 to 7 kg/cm² respectively. Their friability values were 99%. The FTIR studies showed no interaction throughout the process of development. Formulations of F7 and of P7 were considered optimized formulations since they yielded a predetermined lag time of 6h before burst release. Hence, these formulations can be exploited to achieve chronotherapeutic drug delivery systems of Torsemide for the treatment of hypertension at the time the patient needs it.O objetivo deste estudo foi preparar e avaliar sistemas cronoterapêuticos de liberação de fármacos (ChrDDs de torsemida. Comprimidos revestidos por compressão (CCT contendo torsemida no (núcleo foram preparados pela técnica de revestimento por compressão, com diferentes categorias de óxido de polietileno (PEO WSR 301 & 1105. As formulações otimizadas foram caracterizadas por parâmetros de compressão e interação fármaco polímero por Infravermelho com Transformada de Fourier (FTIR. A dureza dos CCT utilizando PEO WSR 301 e PEO WSR 1105 foi entre 6-8 kg/cm² e 5,5 a 7 kg/cm², respectivamente. Os valores de friabilidade foram 99%. Os estudos de FTIR mostraram que não h[a interação durante o processo de desenvolvimento. As formulações F7 e P7 foram consideradas otimizadas, uma vez que resultaram em tempo de retardo pré-determinado de 6 h antes da liberação por meio de explosão. Dessa forma, estas formulações podem ser exploradas para

  17. 化疗方案及疗程对乳腺癌患者体成分的影响%Effects of chemotherapy regimen and course of treatment on body composition of breast cancer patients

    Institute of Scientific and Technical Information of China (English)

    梁振华; 齐路霞; 寇小格; 王晶晶; 温有锋

    2017-01-01

    目的:研究不同方案和疗程对乳腺癌患者体成分的影响.方法:利用前瞻性研究,间接计算出患者的腰臀比、腰围身高比(WSR)、身体质量指数(BMI)、体脂率、体脂肪和瘦体质量等体质指标、体成分的含量.结果:不同疗程的WSR、BMI、体脂、体脂率差异有统计学意义,BMI、体脂、体脂率与疗程间的两两比较差异有统计学意义;WSR在表柔比星+环磷酰胺(EC)方案疗程间(第一、二次化疗比较除外)的两两比较差异有统计学意义,和多柔比星+环磷酰胺(AC)方案疗程间(第一次与化疗前,第二、三次疗程比较除外)的两两比较差异有统计学意义.结论:EC方案中,BMI、WSR、体脂肪、体脂率随疗程进展而增加;AC方案中,BMI、体脂肪、体脂率随疗程进展先减少后增加,WSR随疗程进展而增加.%Objective: To study the effect of different chemotherapy regimens on body composition in different courses of breast cancer patients. Methods: Prospective research methods were used to calculate the waist-to-hip ratio, waist height ratio (WSR), body mass index (BMI), body fat rate, body fat and lean body weight. Results: In the epirubicin+cyclophosphamide (EC) program, BMI, WSR, body fat and body fat rate of different courses of treatment had statistically significant differences. Differences among BMI, WSR (except for the comparison of the second chemotherapy and the first chemotherapy), body fat, body fat rate were statistically significant. In the doxorubicin+cyclophosphamide (AC) program, the differences of BMI, WSR, body fat and body fat rate of different courses of treatment were statistically significant, WSR (except for the comparison of the first and before chemotherapy, the second and third chemotherapy) had statistically significant difference between the two groups. The differences of BMI, body fat, body fat rate in the different courses of treatment between the two groups were statistically significant

  18. Advanced Integrated Fuel/Combustion Systems

    Science.gov (United States)

    2004-01-01

    ineffective in the T63, even at concentrations up to 40 times the recommended value. Additive companies were informed about the performance of their...M. (1996): NASA RP- 1385. • Toepke, S. (1999): Boeing Company , Personal Correspondence. • Ulrich, G.D. (1971): Comb. Sci. Tech., Vol. 4, pp. 47-58...temperature (K) THC = total hydrocarbons UNICORN = UNsteady Ignition and COmbustion with ReactioNs V = reactor volume (mL) WSR = well-stirred reactor

  19. Dynamic Water Surface Detection Algorithm Applied on PROBA-V Multispectral Data

    Directory of Open Access Journals (Sweden)

    Luc Bertels

    2016-12-01

    Full Text Available Water body detection worldwide using spaceborne remote sensing is a challenging task. A global scale multi-temporal and multi-spectral image analysis method for water body detection was developed. The PROBA-V microsatellite has been fully operational since December 2013 and delivers daily near-global synthesis with a spatial resolution of 1 km and 333 m. The Red, Near-InfRared (NIR and Short Wave InfRared (SWIR bands of the atmospherically corrected 10-day synthesis images are first Hue, Saturation and Value (HSV color transformed and subsequently used in a decision tree classification for water body detection. To minimize commission errors four additional data layers are used: the Normalized Difference Vegetation Index (NDVI, Water Body Potential Mask (WBPM, Permanent Glacier Mask (PGM and Volcanic Soil Mask (VSM. Threshold values on the hue and value bands, expressed by a parabolic function, are used to detect the water bodies. Beside the water bodies layer, a quality layer, based on the water bodies occurrences, is available in the output product. The performance of the Water Bodies Detection Algorithm (WBDA was assessed using Landsat 8 scenes over 15 regions selected worldwide. A mean Commission Error (CE of 1.5% was obtained while a mean Omission Error (OE of 15.4% was obtained for minimum Water Surface Ratio (WSR = 0.5 and drops to 9.8% for minimum WSR = 0.6. Here, WSR is defined as the fraction of the PROBA-V pixel covered by water as derived from high spatial resolution images, e.g., Landsat 8. Both the CE = 1.5% and OE = 9.8% (WSR = 0.6 fall within the user requirements of 15%. The WBDA is fully operational in the Copernicus Global Land Service and products are freely available.

  20. Psychological and Unconventional Warfare, 1941-1952: Origins of a Special Warfare Capability for the United States Army

    Science.gov (United States)

    1979-11-01

    nic -,L-dant orer unconventional wsr:fare? In shnrt, wfiat were-the pre-1952 roots of tbe’ P9ych𔃺rg1.ca1 WArfArPg Contme" artx], cMocom~tant y, the...General Robert A. McClure, 30 March 1948, from Co’.onel William S. Biddle , Assistant Chief, Plans and Policy Group, 1, 319, Plans and Operations Division

  1. Analysis of Groundwater Resources Vulnerability from Agricultural Activities in the Large Irrigation District along the Yellow River

    OpenAIRE

    He, Bin; Oki, Taikan; Kanae, Shinjiro; Runkle, Benjamin; Liang, Xu; Zeng, Ayan; Hao, Fanghua

    2008-01-01

    Groundwater forms an important source of water supply in arid and semi-arid region. Optimum conjunctive utilization of surface and groundwater resources has become extremely important to fill the gap between water demand and supply. Hetao Irrigation District (HID) is the largest irrigation district along the Yellow River and its groundwater table is shallow. The project of Water Saving Reconstruction (WSR) has been conducted for the purpose of keeping the Yellow River free from drying up. The...

  2. Effect of water-sediment regulation and its impact on coastline and suspended sediment concentration in Yellow River Estuary

    Directory of Open Access Journals (Sweden)

    Hai-bo Yang

    2017-10-01

    Full Text Available Implementation of the water-sediment regulation (WSR scheme, mainly focused on solving the sedimentation problems of reservoirs and the lower reaches of the Yellow River, has inevitably influenced the sediment distribution and coastal morphology of the Yellow River Estuary. Using coastline delineation and suspended sediment concentration (SSC retrieval methods, this study investigated water and sediment changes, identified detailed inter-annual and intra-annual variations of the coastline and SSC in the normal period (NP: 1986–2001, before and after the flood season and WSR period (WSRP: 2002–2013, before and after WSR. The results indicate that (1 the sedimentation in the low reaches of the Yellow River turned into erosion from 2002 onward; (2 the inter-annual coastline changes could be divided into an accretion stage (1986–1996, a slow erosion stage (1996–2002, and a slow accretion stage (2002–2013; (3 an intra-annual coastline extension occurred in the river mouth in most years of the WSRP; and (4 the mean intra-annual accretion area was 0.789 km2 in the NP and 4.73 km2 in the WSRP, and the mean SSC increased from 238 mg/L to 293 mg/L in the NP and from 192 mg/L to 264 mg/L in the WSRP.

  3. Soot and Spectral Radiation Modeling for a High-Pressure Turbulent Spray Flame

    Energy Technology Data Exchange (ETDEWEB)

    Ferreryo-Fernandez, Sebastian [Pennsylvania State Univ., University Park, PA (United States); Paul, Chandan [Pennsylvania State Univ., University Park, PA (United States); Sircar, Arpan [Pennsylvania State Univ., University Park, PA (United States); Imren, Abdurrahman [Pennsylvania State Univ., University Park, PA (United States); Haworth, Daniel C [Pennsylvania State Univ., University Park, PA (United States); Roy, Somesh P [Marquette University (United States); Modest, Michael F [University of California Merced (United States)

    2017-04-26

    Simulations are performed of a transient high-pressure turbulent n-dodecane spray flame under engine-relevant conditions. An unsteady RANS formulation is used, with detailed chemistry, a semi-empirical two-equation soot model, and a particle-based transported composition probability density function (PDF) method to account for unresolved turbulent fluctuations in composition and temperature. Results from the PDF model are compared with those from a locally well-stirred reactor (WSR) model to quantify the effects of turbulence-chemistry-soot interactions. Computed liquid and vapor penetration versus time, ignition delay, and flame lift-off height are in good agreement with experiment, and relatively small differences are seen between the WSR and PDF models for these global quantities. Computed soot levels and spatial soot distributions from the WSR and PDF models show large differences, with PDF results being in better agreement with experimental measurements. An uncoupled photon Monte Carlo method with line-by-line spectral resolution is used to compute the spectral intensity distribution of the radiation leaving the flame. This provides new insight into the relative importance of molecular gas radiation versus soot radiation, and the importance of turbulent fluctuations on radiative heat transfer.

  4. The development of a combined b-mode, ARFI, and spectral Doppler ultrasound imaging system for investigating cardiovascular stiffness and hemodynamics

    Science.gov (United States)

    Doherty, Joshua R.; Dumont, Douglas M.; Trahey, Gregg E.

    2011-03-01

    The progression of atherosclerotic disease, caused by the formation of plaques within arteries, is a complex process believed to be a function of the localized mechanical properties and hemodynamic loading associated with the arterial wall. It is hypothesized that measurements of vascular stiffness and wall-shear rate (WSR) may provide important information regarding vascular remodeling, endothelial function, and the growth of soft-lipid filled plaques that could help a clinician better diagnose a patient's risk of clinical events such as stroke. To that end, the approach taken in this work was to combine conventional B-mode, Acoustic Radiation Force Impulse (ARFI), Shear Wave Elasticity Imaging (SWEI), and spectral Doppler techniques into a single imaging system capable of simultaneously measuring the tissue displacements and WSR throughout the cardiac cycle and over several heartbeats. Implemented on a conventional scanner, the carotid arteries of human subjects were scanned to demonstrate the initial in vivo feasibility of the method. Two non-invasive ultrasound based imaging methods, SAD-SWEI and SAD-Gated Imaging, were developed that measure ARF-induced on-axis tissue displacements, off-axis transverse wave velocities, and WSR throughout the cardiac cycle. Human carotid artery scans were performed in vivo on 5 healthy subjects. Statistical differences were observed in both on-axis proximal wall displacements and transverse wave velocities during diastole compared to systole.

  5. Multifunctional medicated lyophilised wafer dressing for effective chronic wound healing.

    Science.gov (United States)

    Pawar, Harshavardhan V; Boateng, Joshua S; Ayensu, Isaac; Tetteh, John

    2014-06-01

    Wafers combining weight ratios of Polyox with carrageenan (75/25) or sodium alginate (50/50) containing streptomycin and diclofenac were prepared to improve chronic wound healing. Gels were freeze-dried using a lyophilisation cycle incorporating an annealing step. Wafers were characterised for morphology, mechanical and in vitro functional (swelling, adhesion, drug release in the presence of simulated wound fluid) characteristics. Both blank (BLK) and drug-loaded (DL) wafers were soft, flexible, elegant in appearance and non-brittle in nature. Annealing helped to improve porous nature of wafers but was affected by the addition of drugs. Mechanical characterisation demonstrated that the wafers were strong enough to withstand normal stresses but also flexible to prevent damage to newly formed skin tissue. Differences in swelling, adhesion and drug release characteristics could be attributed to differences in pore size and sodium sulphate formed because of the salt forms of the two drugs. BLK wafers showed relatively higher swelling and adhesion than DL wafers with the latter showing controlled release of streptomycin and diclofenac. The optimised dressing has the potential to reduce bacterial infection and can also help to reduce swelling and pain associated with injury due to the anti-inflammatory action of diclofenac and help to achieve more rapid wound healing. © 2014 Wiley Periodicals, Inc. and the American Pharmacists Association.

  6. Comparative Study Between Different Ready-Made Orally Disintegrating Platforms for the Formulation of Sumatriptan Succinate Sublingual Tablets.

    Science.gov (United States)

    Tayel, Saadya A; El Nabarawi, Mohamed A; Amin, Maha M; AbouGhaly, Mohamed H H

    2017-02-01

    Sumatriptan succinate (SS) is a selective serotonin receptor agonist used for the treatment of migraine attacks, suffering from extensive first-pass metabolism and low oral bioavailability (∼14%). The aim of this work is to compare the performance of different ready-made co-processed platforms (Pharmaburst®, Prosolv ODT®, Starlac®, Pearlitol Flash®, or Ludiflash®) in the formulation of SS sublingual orodispersible tablets (ODTs) using direct compression technique. The prepared SS ODT formulae were evaluated regarding hardness, friability, simulated wetting time, and in vitro disintegration and dissolution tests. Different mucoadhesive polymers-HPMC K4M, Carbopol®, chitosan, or Polyox®-were tested aiming to increase the residence time in the sublingual area. A pharmacokinetic study on healthy human volunteers was performed, using LC/MS/MS assay, to compare the optimum sublingual formula (Ph25/HPMC) with the conventional oral tablet Imitrex®. Results showed that tablets prepared using Pharmaburst® had significantly (p disintegration times of 17.17 and 23.50 s, respectively, with Q 5 min of 83.62%. HPMC showed a significant (p tablet Imitrex®. In conclusion, Pharmaburst® was chosen as the optimum ready-made co-processed platform that can be successfully used in the preparation of SS sublingual tablets for the rapid relief of migraine attacks.

  7. Doppler Radar and Lightning Network Observations of a Severe Outbreak of Tropical Cyclone Tornadoes

    Science.gov (United States)

    Mccaul, Eugene W., Jr.; Buechler, Dennis E.; Goodman, Steven J.; Cammarata, Michael

    2004-01-01

    Data from a single Weather Surveillance Radar-1988 Doppler (WSR-88D) and the National Lightning Detection Network are used to examine the characteristics of the convective storms that produced a severe tornado outbreak, including three tornadoes that reached F3 intensity, within Tropical Storm Beryl s remnants on 16 August 1994. Comparison of the radar data with reports of tornadoes suggests that only 13 cells produced the 29 tornadoes that were documented in Georgia and the Carolinas on that date. Six of these cells spawned multiple tornadoes, and the radar data confirm the presence of miniature supercells. One of the cells was identifiable on radar for 11 h. spawning tornadoes over a time period spanning approximately 6.5 h. Several other tornadic cells also exhibited great longevity, with cell lifetimes longer than ever previously documented in a landfalling tropical cyclone (TC) tornado event. This event is easily the most intense TC tornado outbreak yet documented with WSR-88Ds. Time-height analyses of the three strongest tornadic supercells are presented in order to document storm kinematic structure and to show how these storms appear at different ranges from a WSR-88D. In addition, cloud-to-ground (CG) lightning data are examined in Beryl s remnants. Although the tornadic cells were responsible for most of Beryl's CG lightning, their flash rates were only weak to moderate, and in all the tornadic storms the lightning flashes were almost entirely negative in polarity. A few of the single-tornado storms produced no detectable CG lightning at all. There is evidence that CG lightning rates decreased during the tornadoes, compared to 30-min periods before the tornadoes. A number of the storms spawned tornadoes just after producing their final CG lightning flashes. Contrary to the findings for flash rates, both peak currents and positive flash percentages were larger in Beryl's nontornadic storms than in the tornadic ones.

  8. Resting heart rate and its relationship with general and abdominal obesity in young male Saudi university students

    International Nuclear Information System (INIS)

    Yar, T.

    2010-01-01

    An elevated resting heart rate (Rhr) has been linked with adverse cardiovascular outcomes. Obese people have altered autonomic balance that could lead to elevated Rhr and altered responses to postural changes. As no comparative data are available on Rhr in young normal weight (NW) and obese (OB) adults in Saudi Arabia, the present study was aimed at finding out the effect of adiposity on RHR and RHR response to change in posture. Methods: Second-year male students (n=231; age:19-20 years), were recruited from the Dammam University, Dammam, Saudi Arabia, during the period September 2008 to October 2009. Anthropometric measures were obtained and indices of obesity (body mass index [EMI], waist circumference [WC], waist-to-hip ratio [WHR], waist-to-stature ratio [WSR]) were calculated. RHR in standing and supine positions were obtained from radial pulse. Pearson's correlation (r) between obesity indices and RHR as well as the differences between RHR in NW and OB groups were calculated. Results: General obesity (BMI greater or equal to 25.0 kg/m1 was found in 45.5% students. Central obesity (WC>85 cm or WSR>50.0) was found in 36.8% students. RHR was significantly correlated with BMI, WC and WSR (r=O.305, 0.300, 0.299 respectively, p< O.01) . Subjects above the obesity indices cut-off points had significantly higher values of RHR in both standing and supine positions compared to NW individuals (p<0.05). There was a greater reduction in RHR on changing the posture to supine state in OB group. Conclusion: A significantly higher RHR and a greater change in RHR on changing the posture point towards an altered autonomic balance in OB group of young adolescent males. This underscores the need to implement health education program to combat obesity at school and college levels. (author)

  9. The performance of obesity screening tools among young Thai adults.

    Science.gov (United States)

    Limpawattana, Panita; Kengkijkosol, Thepkhachi; Assantachai, Prasert; Krairit, Orapitchaya; Pimporm, Jiraporn

    2014-12-01

    Obesity is a worldwide medical condition that leads to physical and psychological impairment. Specific ethnicity, gender and age group are related to different performances of anthropometric indices to predict obesity. The objectives of this study were to estimate the performance of the anthropometric indices for detecting obesity based on percentage of body fat (PBF), to study the correlation among those indices, and to determine the optimal cut-off point of the indices among young Thai adults. This is a cross-sectional study of healthy urban subjects in Khon Kaen, Thailand who were aged 20-39 years. Baseline characteristics and anthropometric measures were collected. PBF was determined using bioelectrical impedance analysis. Demographic data and anthropometric variables were analyzed using descriptive statistics. Receiver-operating characteristic (ROC) curves were used to compare the performance of anthropometric measures as predictors of obesity. One-hundred men and 100 women were recruited for this study. Body mass index (BMI), waist circumference (WC), waist-to-hip ratio (WHR) and waist-to-stature ratio (WSR) were significantly correlated to PBF. BMI demonstrated the best performance according to the area under the ROC curves in both sexes at cut-off points of 22.5 in women or 25 kg/m(2) in men. WC and WSR showed better performance than WHR to detect obesity. In conclusion, anthropometric indices in young Thai adults were correlated well with PBF to predict obesity as shown in prior reports. Different cut-off points of these indices to define obesity in young Thai adults are recommended. The global cut-off points of WSR in women regardless of ethnicity are supported.

  10. Value of a dual-polarized gap-filling radar in support of southern California post-fire debris-flow warnings

    Science.gov (United States)

    Jorgensen, David P.; Hanshaw, Maiana N.; Schmidt, Kevin M.; Laber, Jayme L; Staley, Dennis M.; Kean, Jason W.; Restrepo, Pedro J.

    2011-01-01

    A portable truck-mounted C-band Doppler weather radar was deployed to observe rainfall over the Station Fire burn area near Los Angeles, California, during the winter of 2009/10 to assist with debris-flow warning decisions. The deployments were a component of a joint NOAA–U.S. Geological Survey (USGS) research effort to improve definition of the rainfall conditions that trigger debris flows from steep topography within recent wildfire burn areas. A procedure was implemented to blend various dual-polarized estimators of precipitation (for radar observations taken below the freezing level) using threshold values for differential reflectivity and specific differential phase shift that improves the accuracy of the rainfall estimates over a specific burn area sited with terrestrial tipping-bucket rain gauges. The portable radar outperformed local Weather Surveillance Radar-1988 Doppler (WSR-88D) National Weather Service network radars in detecting rainfall capable of initiating post-fire runoff-generated debris flows. The network radars underestimated hourly precipitation totals by about 50%. Consistent with intensity–duration threshold curves determined from past debris-flow events in burned areas in Southern California, the portable radar-derived rainfall rates exceeded the empirical thresholds over a wider range of storm durations with a higher spatial resolution than local National Weather Service operational radars. Moreover, the truck-mounted C-band radar dual-polarimetric-derived estimates of rainfall intensity provided a better guide to the expected severity of debris-flow events, based on criteria derived from previous events using rain gauge data, than traditional radar-derived rainfall approaches using reflectivity–rainfall relationships for either the portable or operational network WSR-88D radars. Part of the reason for the improvement was due to siting the radar closer to the burn zone than the WSR-88Ds, but use of the dual-polarimetric variables

  11. Management of Radioactive Waste from the Mining and Milling of Ores. Safety Guide (Spanish ed.)

    International Nuclear Information System (INIS)

    2010-01-01

    This Safety Guide provides recommendations and guidance on the safe management of radioactive waste resulting from the mining and milling of ores, with the purpose of protecting workers, the public and the environment from the consequences of these activities. It supplements Safety Standards Series No. WS-R-1, Near Surface Disposal of Radioactive Waste. Contents: 1. Introduction; 2. Administrative, legal and regulatory framework; 3. Protection of human health and the environment; 4. Strategy for waste management; 5. Safety considerations in different phases of operations; 6. Safety assessment; 7. Quality assurance; 8. Monitoring and surveillance; 9. Institutional control for the post-closure phase.

  12. Reduced PM2.5 Emissions for Military Gas Turbine Engines using Fuel Additives

    Science.gov (United States)

    2006-08-12

    COMPUTATIONAL 72 2.2.1 CHEMKIN 72 2.2.2 WSR MODELING USING CHEMKIN 74 2.2.3 UNICORN CODE 78 2.2.4 REACTION MECHANISMS 84 3. RESULTS 86 3.1 OXYGENATED...PREMIXED FLAME 275 3.5.5 COFLOW DIFFUSION FLAME 278 3.5.6 OPPOSED-FLOW DIFFUSION FLAME 284 3.5.7 CFM COMBUSTOR 294 3.5.8 JET-FLAMES, UNICORN ...constituents in the commercial additive, were identified as the likely constituents leading to soot reduction. Consequently , these compounds were investigated

  13. ANTHROPOMETRIC INDICES IN ASSOCIATION WITH CARDIOMETABOLIC RISK FACTORS: FINDINGS OF THE ISFAHAN HEALTHY HEART PROGRAM

    Directory of Open Access Journals (Sweden)

    Nizal Sarrafzadegan

    2010-11-01

    Full Text Available Abstract    BACKGROUND: Obesity is increasing worldwide, but the debate about the most valid index associated with its health hazards remains unresolved. This study aimed to compare four main anthropometric indices by gender, to determine the best index in predicting cardiometabolic risk factors and to find their cutoff values in the population studied.    METHODS: This study was a cross-sectional community-based study performed on a representative sample of 12,514 adults (aged ≥19 years selected via 2-stage random cluster sampling from 3 cities in Iran. Partial correlation and ROC curve analyzes were used to determine the best anthropometric indices and their cutoff values.    RESULTS: The study population comprised 6123 males and 6391 females. In both genders, waist circumference (WC had the highest correlation with cardiometabolic risk factors (6 of 8 risk factors in men and 7 of 8 risk factors in women. ROC analyses showed that in males, the largest area under curve (AUC was obtained for waist-to-stature ration (WSR in most risk factors (6 of the 10 followed by body mass index (BMI and waist-to-height ratio (WHR with largest AUC (3 of the 10. The corresponding figure for females was obtained for WSR (9 of the 10 followed by BMI and WHR (1 of 10. Optimal cutoff values computed for combination of 3 major risk factors (including diabetes mellitus, hypertension and dyslipidemia revealed that in males and females, respectively, the cutoff values were 21.9 and 23.5 kg/m2 for BMI, 80.70 and 84.70 cm for WC, 0.85 and 0.86 for WHR and 0.47 and 0.53 for WSR.    CONCLUSION: WSR could be a valid anthropometric index for predicting cardiometabolic risk factors, and it has less variation than other indices among populations with ethnic differences in body size and fat distribution.      Keywords: Anthropometry, Cardiovascular Risk Factors, Iran, Obesity.

  14. Hanford inventory program user's manual

    International Nuclear Information System (INIS)

    Hinkelman, K.C.

    1994-01-01

    Provides users with instructions and information about accessing and operating the Hanford Inventory Program (HIP) system. The Hanford Inventory Program is an integrated control system that provides a single source for the management and control of equipment, parts, and material warehoused by Westinghouse Hanford Company in various site-wide locations. The inventory is comprised of spare parts and equipment, shop stock, special tools, essential materials, and convenience storage items. The HIP replaced the following systems; ACA, ASP, PICS, FSP, WSR, STP, and RBO. In addition, HIP manages the catalog maintenance function for the General Supplies inventory stocked in the 1164 building and managed by WIMS

  15. Effect of biosurfactants on the aqueous solubility of PCE and TCE.

    Science.gov (United States)

    Albino, John D; Nambi, Indumathi M

    2009-12-01

    The effect of biosurfactants on the solubility of tetrachloroethylene (PCE) and trichloroethylene (TCE) was studied in batch experiments pertaining to their use for solubilization and mobilization of such contaminants in surfactant enhanced aquifer remediation. Biosurfactants, rhamnolipid and surfactin used in solubility studies were synthesized in our laboratory by Pseudomonas aeruginosa (MTCC 2297) and Bacillus subtilis (MTCC 2423), respectively. The efficiency of the biosurfactants in solubilizing the chlorinated solvents was compared to that of synthetic surfactants. The Weight Solubilization Ratio (WSR) values for solubilization of PCE and TCE by biosurfactants were very high compared to the values obtained for synthetic surfactants. Surfactin proved to be a better surfactant over rhamnolipid. The WSR of surfactin on solubilization of PCE and TCE were 3.83 and 12.5, respectively, whereas the values obtained for rhamnolipid were 2.06 and 8.36. The solubility of the chlorinated solvents by biosurfactants was considerably affected by the changes in pH. The aqueous solubility of PCE and TCE increased tremendously with decrease in pH. The solubility of biosurfactants was observed to decrease with the pH, favoring partitioning of surfactants into the chlorinated solvents in significant amounts at lower pH. The excessive accumulation of biosurfactants at the interface facilitated interfacial tension reductions resulting in higher solubility of the chlorinated solvents at pH less than 7.

  16. Water absorption and mechanical properties of water-swellable natural rubber

    Directory of Open Access Journals (Sweden)

    Diew Saijun

    2009-11-01

    Full Text Available Water-swellable rubber (WSR was prepared by blending superabsorbent polymer (SAP of crosslinked poly(acrylamide-co-sodium acrylate with natural rubber in latex condition. The crosslinked poly(acrylamide-co-sodium acrylate was first prepared by inverse suspension polymerization from acrylamide and sodium acrylate monomers with potassiumpersulfate initiator and N,N-methylenebisacrylamide crosslinker. The reaction was carried out at 60oC for 40 mins. Water absorption properties, such as the degree of water absorption, water absorption rate, degree of weight loss, and mechanicalproperties of WSR were then investigated. It was found that the degree of water absorption, water absorption rate, and thedegree of weight loss increased, while tensile strength and elongation at break decreased with increasing quantity of SAP inthe blends. However, the degree of water absorption, degree of weight loss, and elongation at break decreased, but tensilestrength increased with increasing quantity of the N-tert-butyl-2-benzothiazyl sulphenamide (TBBS accelerator used in thecompounds formulation.

  17. International incidence of childhood cancer, 2001-10: a population-based registry study.

    Science.gov (United States)

    Steliarova-Foucher, Eva; Colombet, Murielle; Ries, Lynn A G; Moreno, Florencia; Dolya, Anastasia; Bray, Freddie; Hesseling, Peter; Shin, Hee Young; Stiller, Charles A

    2017-06-01

    Cancer is a major cause of death in children worldwide, and the recorded incidence tends to increase with time. Internationally comparable data on childhood cancer incidence in the past two decades are scarce. This study aimed to provide internationally comparable local data on the incidence of childhood cancer to promote research of causes and implementation of childhood cancer control. This population-based registry study, devised by the International Agency for Research on Cancer in collaboration with the International Association of Cancer Registries, collected data on all malignancies and non-malignant neoplasms of the CNS diagnosed before age 20 years in populations covered by high-quality cancer registries with complete data for 2001-10. Incidence rates per million person-years for the 0-14 years and 0-19 years age groups were age-adjusted using the world standard population to provide age-standardised incidence rates (WSRs), using the age-specific incidence rates (ASR) for individual age groups (0-4 years, 5-9 years, 10-14 years, and 15-19 years). All rates were reported for 19 geographical areas or ethnicities by sex, age group, and cancer type. The regional WSRs for children aged 0-14 years were compared with comparable data obtained in the 1980s. Of 532 invited cancer registries, 153 registries from 62 countries, departments, and territories met quality standards, and contributed data for the entire decade of 2001-10. 385 509 incident cases in children aged 0-19 years occurring in 2·64 billion person-years were included. The overall WSR was 140·6 per million person-years in children aged 0-14 years (based on 284 649 cases), and the most common cancers were leukaemia (WSR 46·4), followed by CNS tumours (WSR 28·2), and lymphomas (WSR 15·2). In children aged 15-19 years (based on 100 860 cases), the ASR was 185·3 per million person-years, the most common being lymphomas (ASR 41·8) and the group of epithelial tumours and melanoma (ASR 39·5

  18. Intermittent suckling improves post-weaning feed uptake but does not change functional gut characteristics of piglets

    DEFF Research Database (Denmark)

    Thymann, Thomas; Gudbergsen, C.; Bresson, Sven

    2007-01-01

    Suckling pigs were separated from their dam for 24 h on day 21 (1x24 h fasting, n=10) or day 21 and 24 (2x24 h fasting, n=10). Pigs in the control group (n=10) were not fasted before weaning.......Suckling pigs were separated from their dam for 24 h on day 21 (1x24 h fasting, n=10) or day 21 and 24 (2x24 h fasting, n=10). Pigs in the control group (n=10) were not fasted before weaning....

  19. Ecology of fall-migrating ducks in central Illinois: A radar perspective

    Science.gov (United States)

    O'Neal, Benjamin J.

    Research from the last two decades has elucidated the importance of migration in the annual cycle of ducks, but many aspects of migration ecology remain poorly understood due to the difficulty of investigating movements that occur over large spatial scales, at substantial heights and at night. Weather surveillance radar (WSR) offers a unique tool for observing movements of birds aloft, but until now has been used primarily to address questions only relevant to broad taxonomic groups. Using thermal infrared imaging, portable radar, and natural history, I ground-truthed WSR echoes originating from a complex of wetlands in the central Illinois River valley to develop a technique for identifying and enumerating ducks as they emigrated from this important stopover area. With this technique, I quantified duck emigrations during 7 falls (1996, 1997, 2003, and 2005-2008). I used WSR-derived estimates of annual turnover in combination with aerial inventory estimates of duck use to estimate the average amount of time ducks spent at my study site during fall (stopover duration). The mean stopover duration estimate of 11 days (SD = 4 days) was much shorter than a historical estimate (28 days) that has been use for regional waterfowl conservation planning. I also regressed average annual stopover duration estimates against an index of annual foraging habitat quality and found a strong, positive relationship (r2 = 0.71), suggesting ducks assessed local habitat conditions and adjusted time spent at the site. Weather influences the timing of migration in many avian taxa, but this relationship is poorly understood for ducks. An evaluation of competing models including 15 years of data indicated following winds aloft, no precipitation, less cloud cover, decreasing temperatures, increasing barometric pressure and date best predicted emigration (R2 = 0.52). Based on this model, the odds of a duck emigration occurring when winds were following and precipitation was absent were 13.2 to

  20. Improving Radar Quantitative Precipitation Estimation over Complex Terrain in the San Francisco Bay Area

    Science.gov (United States)

    Cifelli, R.; Chen, H.; Chandrasekar, V.

    2017-12-01

    A recent study by the State of California's Department of Water Resources has emphasized that the San Francisco Bay Area is at risk of catastrophic flooding. Therefore, accurate quantitative precipitation estimation (QPE) and forecast (QPF) are critical for protecting life and property in this region. Compared to rain gauge and meteorological satellite, ground based radar has shown great advantages for high-resolution precipitation observations in both space and time domain. In addition, the polarization diversity shows great potential to characterize precipitation microphysics through identification of different hydrometeor types and their size and shape information. Currently, all the radars comprising the U.S. National Weather Service (NWS) Weather Surveillance Radar-1988 Doppler (WSR-88D) network are operating in dual-polarization mode. Enhancement of QPE is one of the main considerations of the dual-polarization upgrade. The San Francisco Bay Area is covered by two S-band WSR-88D radars, namely, KMUX and KDAX. However, in complex terrain like the Bay Area, it is still challenging to obtain an optimal rainfall algorithm for a given set of dual-polarization measurements. In addition, the accuracy of rain rate estimates is contingent on additional factors such as bright band contamination, vertical profile of reflectivity (VPR) correction, and partial beam blockages. This presentation aims to improve radar QPE for the Bay area using advanced dual-polarization rainfall methodologies. The benefit brought by the dual-polarization upgrade of operational radar network is assessed. In addition, a pilot study of gap fill X-band radar performance is conducted in support of regional QPE system development. This paper also presents a detailed comparison between the dual-polarization radar-derived rainfall products with various operational products including the NSSL's Multi-Radar/Multi-Sensor (MRMS) system. Quantitative evaluation of various rainfall products is achieved

  1. Management of waste from the use of radioactive material in medicine, industry, agriculture, research and education safety guide

    CERN Document Server

    2005-01-01

    This Safety Guide provides recommendations and guidance on the > fulfilment of the safety requirements established in Safety Standards > Series No. WS-R-2, Predisposal Management of Radioactive Waste, > Including Decommissioning. It covers the roles and responsibilities of > different bodies involved in the predisposal management of radioactive > waste and in the handling and processing of radioactive material. It > is intended for organizations generating and handling radioactive > waste or handling such waste on a centralized basis for and the > regulatory body responsible for regulating such activities.  > Contents: 1. Introduction; 2. Protection of human health and the > environment; 3. Roles and responsibilities; 4. General safety > considerations; 5. Predisposal management of radioactive waste; 6. > Acceptance of radioactive waste in disposal facilities; 7. Record > keeping and reporting; 8. Management systems; Appendix I: Fault > schedule for safety assessment and environmental impact assessment; > Ap...

  2. Integrating Satellite, Radar and Surface Observation with Time and Space Matching

    Science.gov (United States)

    Ho, Y.; Weber, J.

    2015-12-01

    The Integrated Data Viewer (IDV) from Unidata is a Java™-based software framework for analyzing and visualizing geoscience data. It brings together the ability to display and work with satellite imagery, gridded data, surface observations, balloon soundings, NWS WSR-88D Level II and Level III RADAR data, and NOAA National Profiler Network data, all within a unified interface. Applying time and space matching on the satellite, radar and surface observation datasets will automatically synchronize the display from different data sources and spatially subset to match the display area in the view window. These features allow the IDV users to effectively integrate these observations and provide 3 dimensional views of the weather system to better understand the underlying dynamics and physics of weather phenomena.

  3. Intimal hyperplasia and wall shear in arterial bypass graft distal anastomoses: an in vivo model study.

    Science.gov (United States)

    Keynton, R S; Evancho, M M; Sims, R L; Rodway, N V; Gobin, A; Rittgers, S E

    2001-10-01

    The observation of intimal hyperplasia at bypass graft anastomoses has suggested a potential interaction between local hemodynamics and vascular wall response. Wall shear has been particularly implicated because of its known effects upon the endothelium of normal vessels and, thus, was examined as to its possible role in the development of intimal hyperplasia in arterial bypass graft distal anastomoses. Tapered (4-7 mm I.D.) e-PTFE synthetic grafts 6 cm long were placed as bilateral carotid artery bypasses in six adult, mongrel dogs weighing between 25 and 30 kg with distal anastomotic graft-to-artery diameter ratios (DR) of either 1.0 or 1.5. Immediately following implantation, simultaneous axial velocity measurements were made in the toe and artery floor regions in the plane of the anastomosis at radial increments of 0.35 mm, 0.70 mm, and 1.05 mm using a specially designed 20 MHz triple crystal ultrasonic wall shear rate transducer Mean, peak, and pulse amplitude wall shear rates (WSRs), their absolute values, the spatial and temporal wall shear stress gradients (WSSG), and the oscillatory shear index (OSI) were computed from these velocity measurements. All grafts were harvested after 12 weeks implantation and measurements of the degree of intimal hyperplasia (IH) were made along the toe region and the artery floor of the host artery in 1 mm increments. While some IH occurred along the toe region (8.35+/-23.1 microm) and was significantly different between DR groups (p<0.003), the greatest amount occurred along the artery floor (81.6+/-106.5 microm, mean +/- S.D.) (p < 0.001) although no significant differences were found between DR groups. Linear regressions were performed on the paired IH and mean, peak, and pulse amplitude WSR data as well as the absolute mean, peak, and pulse amplitude WSR data from all grafts. The mean and absolute mean WSRs showed a modest correlation with IH (r = -0.406 and -0.370, respectively) with further improvements seen (r = -0

  4. Formulation of gastroretentive floating drug delivery system using hydrophilic polymers and its in vitro characterization

    Directory of Open Access Journals (Sweden)

    Venkata Srikanth Meka

    2014-04-01

    Full Text Available The aim of the present research is to formulate and evaluate the gastroretentive floating drug delivery system of antihypertensive drug, propranolol HCl. Gastroretentive floating tablets (GRFT were prepared by using a synthetic hydrophilic polymer polyethylene oxide of different grades such as PEO WSR N-12 K and PEO 18 NF as release retarding polymers and calcium carbonate as gas generating agent. The GRFT were compressed by direct compression strategy and the tablets were evaluated for physico-chemical properties, in vitro buoyancy, swelling studies, in vitro dissolution studies and release mechanism studies. From the dissolution and buoyancy studies, F 9 was selected as an optimized formulation. The optimized formulation followed zero order rate kinetics with non-Fickian diffusion mechanism. The optimized formulation was characterised with FTIR studies and observed no interaction between the drug and the polymers.

  5. Development of a field-suitable test method to evaluate the danger of hydrogen embrittlement due to hydrochloric acid pickling bathes and comparison of the effectiveness of pickling inhibitors; Entwicklung eines praxisgeeigneten Pruefverfahrens zur Bewertung des Wasserstoffgefaehrdungspotenzials von Salzsaeurebeizen und zum Vergleich der Wirksamkeit von Inhibitoren

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder-Rentrop, I.; Landgrebe, R.; Berger, C.; Hasselmann, U. [Institut fuer Werkstoffkunde, Staatliche Materialpruefungsanstalt Darmstadt, TU Darmstadt, Grafenstrasse 2, 64283 Darmstadt (Germany)

    2005-11-01

    Qualitaetssicherung beherrschbarer zu machen und moeglichst zu verbessern. Es wurde ein praxistaugliches Versuchsverfahren zur Prozessueberwachung inhibierter Beizen entwickelt. Bei dem Verfahren handelt es sich um einen Verspannversuch, der an Wellensicherungsringen (WSR) nach DIN 471 in einer hierfuer entwickelten Aufweitvorrichtung durchgefuehrt wird. Die Indikationssicherheit des Versuchsverfahrens wurde durch den Vergleich der Ergebnisse des Verspannversuches mit WSR mit den Ergebnissen aus anderen Untersuchungsverfahren, die mit den gleichen Salzsaeurebeizen erzielt wurden, belegt. Die ''Wiederholpraezision'' des Verspannversuches mit Wellensicherungsringen wurde durch uebereinstimmende Ergebnisse, die mit WSR aus unterschiedlichen Fertigungslosen und Waermebehandlungslosen erzielt wurden, belegt. Die Verspannversuche mit WSR eignen sich als praxistaugliches Pruefverfahren und zeichnen sich darueber hinaus durch einen geringen zeitlichen und materiellen Pruefaufwand, eine einfache Handhabung sowie einen robusten und fehlertoleranten Versuchsaufbau aus. Das im Rahmen des Projektes entwickelte, aus verschiedenen Versuchsfuehrungen bestehende Untersuchungsprogramm, ermoeglicht darueber hinaus die umfassende Bewertung geeigneter Inhibitoren fuer die Beizvorbehandlung hochfester vergueteter Verbindungselemente. (Abstract Copyright [2005], Wiley Periodicals, Inc.)

  6. Meteorological environment of a tornado outbreak in Southern Romania

    Directory of Open Access Journals (Sweden)

    I. C. Oprea

    2009-04-01

    Full Text Available On 7 May 2005, a squall line with an embedded bow echo formed over Southern Romania causing severe wind damage. The length of the wind damage was around 150 km. Three tornadoes have been reported, two of them being recorded by video camera. One of the tornadoes occurred in Buftea (near Bucharest, the second in Ciobanu village (near Medgidia radar site and the third in Movilita village, 40 km to the northeast of Bucharest. The site surveys confirmed wind damage associated with these tornadoes. Based on damage, the Movilita village tornado was classified as an F1 type on the Fujita scale, and the Buftea and Ciobanu village tornadoes were classified as F0. Large scale forcing was provided by a vigorous upper level trough. The squall line developed in the warm sector of a low, ahead of the cold front. The Bucharest EEC-DWSR-2500C Doppler velocity depicted cyclonically rotational structures associated with the left end of the bow echo. In two hours this squall line traversed the southern part of the country. The northern end of the line preserved the bowed structures and high reflectivity gradient in front of them. The dry air associated with the descending rear inflow jet was evident as rear inflow notches in the reflectivity field of the Bucharest C-band radar and the Medgidia S-band WSR-98 D radar. The synoptic and mesoscale environment associated with 7 May 2005 bow echo had many similarities to the "dynamic" pattern described by John and Hirt (1987. Herein are analyzed the combined effects of synoptic and mesoscale circulations, together with the data provided by C-band EEC-DWSR-2500C and S-band WSR-98D radars, and the ECMWF and ALADIN model output data. Some operational aspects of the warning process are also discussed.

  7. Verification of Rapid Focused-Recharge in Depressions of Kuwait and the Arabian Peninsula Using Thermal and VNIR Remote Sensing

    Science.gov (United States)

    Rotz, R. R.; Milewski, A.

    2013-12-01

    In the Arabian Peninsula, freshwater recharge from rainfall is infrequent. Recharge is typically focused in small depressions that fill with seasonal runoff and potentially form freshwater lenses. This phenomenon has been verified in the Raudhatain watershed in Kuwait. This study aims to substantiate previously hypothesized lens locations and detect water in the subsurface by using thermal remote sensing and rainfall data. Potential freshwater lenses (~142) have been previously postulated throughout Kuwait and Saudi Arabia, but lack verification due to inadequate monitoring networks. We hypothesize that due to water's unique heat capacity, recharge zones can be detected by identifying areas with lower changes in surface radiance values than neighboring dry areas between day and night after peak or sustained rainfall. If successful, recharge zones and freshwater lenses can be identified and verified in remote hyper-arid regions. We collected 320 high-resolution (15m - 90m), low cloud cover (lens locations, runoff channels, agricultural regions, and wetlands were detected in areas where radiance values change between 0.067 - 2.25 Wsr-1m-2 from day to night scenes and verified by Google Earth (15m), Landsat (30m), and ASTER VNIR (15m) images. Additionally, two seasonal peak rainfall (~35mm/day) events positively correlate with the surface radiance difference values. Surface radiance values for dry areas adjacent to the postulated lens locations range between 2.25 - 12.2 Wsr-1m-2. Results demonstrate the potential for shallow groundwater detection through the presence of ephemeral water bodies in hyper-arid regions en masse; however, the absence of comparable diurnal images limits data in these regions. Linking high rainfall events with low diurnal surface radiance images is ideal for capturing the presence of temporary surface runoff and recharge zones. Expanded research on hyper-arid regions including thermal values, proposed lens locations, and in-situ data will

  8. Lightning and radar observations of hurricane Rita landfall

    Energy Technology Data Exchange (ETDEWEB)

    Henderson, Bradley G [Los Alamos National Laboratory; Suszcynsky, David M [Los Alamos National Laboratory; Hamlin, Timothy E [Los Alamos National Laboratory; Jeffery, C A [Los Alamos National Laboratory; Wiens, Kyle C [TEXAS TECH U.; Orville, R E [TEXAS A& M

    2009-01-01

    Los Alamos National Laboratory (LANL) owns and operates an array of Very-Low Frequency (VLF) sensors that measure the Radio-Frequency (RF) waveforms emitted by Cloud-to-Ground (CG) and InCloud (IC) lightning. This array, the Los Alamos Sferic Array (LASA), has approximately 15 sensors concentrated in the Great Plains and Florida, which detect electric field changes in a bandwidth from 200 Hz to 500 kHz (Smith et al., 2002). Recently, LANL has begun development of a new dual-band RF sensor array that includes the Very-High Frequency (VHF) band as well as the VLF. Whereas VLF lightning emissions can be used to deduce physical parameters such as lightning type and peak current, VHF emissions can be used to perform precise 3d mapping of individual radiation sources, which can number in the thousands for a typical CG flash. These new dual-band sensors will be used to monitor lightning activity in hurricanes in an effort to better predict intensification cycles. Although the new LANL dual-band array is not yet operational, we have begun initial work utilizing both VLF and VHF lightning data to monitor hurricane evolution. In this paper, we present the temporal evolution of Rita's landfall using VLF and VHF lightning data, and also WSR-88D radar. At landfall, Rita's northern eyewall experienced strong updrafts and significant lightning activity that appear to mark a transition between oceanic hurricane dynamics and continental thunderstorm dynamics. In section 2, we give a brief overview of Hurricane Rita, including its development as a hurricane and its lightning history. In the following section, we present WSR-88D data of Rita's landfall, including reflectivity images and temporal variation. In section 4, we present both VHF and VLF lightning data, overplotted on radar reflectivity images. Finally, we discuss our observations, including a comparison to previous studies and a brief conclusion.

  9. Preparation, optimisation and characterisation of novel wound healing film dressings loaded with streptomycin and diclofenac.

    Science.gov (United States)

    Pawar, H V; Tetteh, J; Boateng, J S

    2013-02-01

    Streptomycin (STP) and diclofenac (DLF) loaded film dressings were prepared by blending Polyox(®) (POL) with four hydrophilic polymers [hydroxypropylmethylcellulose (HPMC), carrageenan (CAR), sodium alginate (SA) or chitosan (CS)] using glycerol (GLY) as plasticiser. The films were characterised by scanning electron microscopy (SEM), differential scanning calorimetry (DSC), X-ray diffraction (XRD) and Fourier transform infrared (FTIR) spectroscopy, texture analysis (tensile and swelling characteristics) and in vitro dissolution profiles using Franz diffusion cell. SEM showed homogeneous morphology for both blank (BLK) and drug loaded (DL) films. Films prepared by blending of POL with the other polymers showed a reduction in the crystallisation of POL in descending order of SA>CS>HPMC>CAR respectively. DSC and XRD showed no crystalline peaks of STP and DLF suggesting molecular dispersion of both drugs as well as possible drug interaction with negatively charged sulphate ions present in CAR. The DL films did not show any IR bands of both drugs, confirming the DSC and XRD results. POL-CAR-BLK films showed higher tensile strength (12.32±1.40 MPa) than the POL-CAR-DL films (9.52±1.12 MPa). DL films plasticised with 25%w/w GLY revealed soft and tough (tensile strength 1.02±0.28 MPa, % elongation 1031.33±16.23) formulations. The swelling capacities of POL-CAR-BLK and POL-CAR-DL films were (733.17±25.78%) and (646.39±40.39%), increasing to (1072.71±80.30%) and (1051±86.68%) for POL-CAR-BLK-25% GLY and POL-CAR-DL-25% GLY respectively. POL-CAR-DL films showed significantly (n=3, p<0.0318) lower cumulative release of STP and DLF (52.11±1.34, 55.26±2.25) compared to POL-CAR-DL-25% GLY films (60.07±1.56, 63.39±1.92) respectively. Copyright © 2012 Elsevier B.V. All rights reserved.

  10. Quality of austenite chrome-nickel steel made by gas-oxygen refining

    International Nuclear Information System (INIS)

    Fel'dgandler, Eh.G.; Levin, F.L.; Moshkevich, E.A.; Shifrin, Eh.V.; Movshovich, V.S.; Pargamonov, E.A.

    1991-01-01

    Properties and structure were investigated of austenitic 03Kh18N11 and 08KhN10T steels melted at gas oxygen refining aggregates. It was established that mechanical and corrosion properties of rolling of such steels were in agreement with standard properties of metal of open melting. Sheet 08Kh18N10T steel has the level of strength and plasticity regulated for 12Kh18N10T steel. As steel of 08Kh18N10T holds the complex of high mechanical and corrosion properties, 08Kh18N10T is recommended to be replace by 12Kh18N10T with the aim of decrease of titanium usage and increase of process efficiency

  11. The development of soliton physics: an analysis based on information retrieval

    International Nuclear Information System (INIS)

    Ichikawa, Y.H.; Ohe, Takeru; Kanada, Yasumasa.

    1978-01-01

    This paper uses information retrieval from available data bases such as INSPEC tapes in an attempt to quantify and demonstrate trends in the recent development of Soliton physics research. The date shows that Soliton physics research may be classified into three stages according to the annual numbers of published scientific papers (N): Stage 1: N - 10 0 Gestation (up to 1965) Stage 2: N - 10 1 Introduction (1966 - 1971) Stage 3: N - 10 2 Growth (1971 - present) (author)

  12. Therapeutic Effects of Oligonol, Acupuncture, and Quantum Light Therapy in Chronic Nonbacterial Prostatitis.

    Science.gov (United States)

    Öztekin, İlhan; Akdere, Hakan; Can, Nuray; Aktoz, Tevfik; Arda, Ersan; Turan, Fatma Nesrin

    2015-01-01

    This research aimed to compare anti-inflammatory effects of oligonol, acupuncture, and quantum light therapy in rat models of estrogen-induced prostatitis. Adult male Wistar albino rats were grouped as follows: Group I, control (n = 10); Group II, chronic prostatitis (n = 10); Group III, oligonol (n = 10); Group IV, acupuncture (n = 10); Group V, quantum (n = 10); Group VI, oligonol plus quantum (n = 10); Group VII, acupuncture plus oligonol (n = 10); Group VIII, quantum plus acupuncture (n = 10); and Group IX, acupuncture plus quantum plus oligonol (n = 10). Chronic prostatitis (CP) was induced by the administration of 17-beta-estradiol (E2) and dihydrotestosterone (DHT). Oligonol was given for 6 weeks at a dose of 60 mg/day. Acupuncture needles were inserted at CV 3/4 and bilaterally B 32/35 points with 1-hour manual stimulation. Quantum therapy was administered in 5-minute sessions three times weekly for 6 weeks. Lateral lobes of prostates were dissected for histopathologic evaluation. Although all of the treatment modalities tested in this study showed anti-inflammatory effects in the treatment of CP in male rats, a synergistic effect was observed for oligonol plus quantum light combination. Monotherapy with oligonol showed a superior anti-inflammatory efficacy as compared to quantum light and acupuncture monotherapies.

  13. Corn-Soy-Blend Fortified with Phosphorus to Prevent Refeeding Hypophosphatemia in Undernourished Piglets

    DEFF Research Database (Denmark)

    Hother, Anne-Louise; Lykke, Mikkel; Martinussen, Torben

    2017-01-01

    Background Phosphorus (P) levels in refeeding diets are very important as undernourished children are at risk of hypophosphatemia during refeeding. For this reason, conventional corn-soyblends (CSB) have been reformulated by the World Food Programme to obtain a mono-calcium-phosphate fortified...... and undernutrition was induced with a nutritionally inadequate pure maize diet for 7 weeks, after which they were refed for 3 weeks with either CSB+ (n = 10), CSB++ (n = 10) or CSB+/wp (n = 10). For reference, a fourth group continued on the maize diet (REF, n = 10). Results Following induction of undernutrition...

  14. ORF Alignment: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n BE0003N10.2 [Caenorhabditis elegans] ... Length = 74 ... Query: 51 ... FHGLIDRNEAEKMLLEAGEGSYLVRESNRSRDACTLCMIF...DAKVMNYKLYYDGQFYVGEK 110 ... FHGLIDRNEAEKMLLEAGEGSYLVRESNRSRDACTLCMIFDAKVMNYKLYYDGQFYVGEK Sbjct: 1 ... FHGLIDRNEAEKMLLEAGEGSYLVRESNRSRDACTLCMIFDAKVMNYKLYYDGQFYVGEK 60 ...

  15. Therapeutic Effects of Oligonol, Acupuncture, and Quantum Light Therapy in Chronic Nonbacterial Prostatitis

    Directory of Open Access Journals (Sweden)

    İlhan Öztekin

    2015-01-01

    Full Text Available This research aimed to compare anti-inflammatory effects of oligonol, acupuncture, and quantum light therapy in rat models of estrogen-induced prostatitis. Adult male Wistar albino rats were grouped as follows: Group I, control (n = 10; Group II, chronic prostatitis (n = 10; Group III, oligonol (n = 10; Group IV, acupuncture (n = 10; Group V, quantum (n = 10; Group VI, oligonol plus quantum (n = 10; Group VII, acupuncture plus oligonol (n = 10; Group VIII, quantum plus acupuncture (n = 10; and Group IX, acupuncture plus quantum plus oligonol (n = 10. Chronic prostatitis (CP was induced by the administration of 17-beta-estradiol (E2 and dihydrotestosterone (DHT. Oligonol was given for 6 weeks at a dose of 60 mg/day. Acupuncture needles were inserted at CV 3/4 and bilaterally B 32/35 points with 1-hour manual stimulation. Quantum therapy was administered in 5-minute sessions three times weekly for 6 weeks. Lateral lobes of prostates were dissected for histopathologic evaluation. Although all of the treatment modalities tested in this study showed anti-inflammatory effects in the treatment of CP in male rats, a synergistic effect was observed for oligonol plus quantum light combination. Monotherapy with oligonol showed a superior anti-inflammatory efficacy as compared to quantum light and acupuncture monotherapies.

  16. The IAEA Safety Regime for Decommissioning

    International Nuclear Information System (INIS)

    Bell, M.J.

    2002-01-01

    Full text of publication follows: The International Atomic Energy Agency is developing an international framework for decommissioning of nuclear facilities that consists of the Joint Convention on the Safety of Spent Fuel Management and the Safety of Radioactive Waste Management, and a hierarchy of Safety Standards applicable to decommissioning. The Joint Convention entered into force on 18 June 2001 and as of December 2001 had been ratified by 27 IAEA Member States. The Joint Convention contains a number of articles dealing with planning for, financing, staffing and record keeping for decommissioning. The Joint Convention requires Contracting Parties to apply the same operational radiation protection criteria, discharge limits and criteria for controlling unplanned releases during decommissioning that are applied during operations. The IAEA has issued Safety Requirements document and three Safety Guides applicable to decommissioning of facilities. The Safety Requirements document, WS-R-2, Pre-disposal Management of Radioactive Waste, including Decommissioning, contains requirements applicable to regulatory control, planning and funding, management of radioactive waste, quality assurance, and environmental and safety assessment of the decommissioning process. The three Safety Guides are WS-G-2.1, Decommissioning of Nuclear Power Plants and Research Reactors, WS-G-2.2, Decommissioning of Medical, Industrial and Research Facilities, an WS-G-2.4, Decommissioning of Nuclear Fuel Cycle Facilities. They contain guidance on how to meet the requirements of WS-R-2 applicable to decommissioning of specific types of facilities. These Standards contain only general requirements and guidance relative to safety assessment and do not contain details regarding the content of the safety case. More detailed guidance will be published in future Safety Reports currently in preparation within the Waste Safety Section of the IAEA. Because much material arising during the decommissioning

  17. Winter QPF Sensitivities to Snow Parameterizations and Comparisons to NASA CloudSat Observations

    Science.gov (United States)

    Molthan, Andrew; Haynes, John M.; Jedlovec, Gary J.; Lapenta, William M.

    2009-01-01

    Steady increases in computing power have allowed for numerical weather prediction models to be initialized and run at high spatial resolution, permitting a transition from larger scale parameterizations of the effects of clouds and precipitation to the simulation of specific microphysical processes and hydrometeor size distributions. Although still relatively coarse in comparison to true cloud resolving models, these high resolution forecasts (on the order of 4 km or less) have demonstrated value in the prediction of severe storm mode and evolution and are being explored for use in winter weather events . Several single-moment bulk water microphysics schemes are available within the latest release of the Weather Research and Forecast (WRF) model suite, including the NASA Goddard Cumulus Ensemble, which incorporate some assumptions in the size distribution of a small number of hydrometeor classes in order to predict their evolution, advection and precipitation within the forecast domain. Although many of these schemes produce similar forecasts of events on the synoptic scale, there are often significant details regarding precipitation and cloud cover, as well as the distribution of water mass among the constituent hydrometeor classes. Unfortunately, validating data for cloud resolving model simulations are sparse. Field campaigns require in-cloud measurements of hydrometeors from aircraft in coordination with extensive and coincident ground based measurements. Radar remote sensing is utilized to detect the spatial coverage and structure of precipitation. Here, two radar systems characterize the structure of winter precipitation for comparison to equivalent features within a forecast model: a 3 GHz, Weather Surveillance Radar-1988 Doppler (WSR-88D) based in Omaha, Nebraska, and the 94 GHz NASA CloudSat Cloud Profiling Radar, a spaceborne instrument and member of the afternoon or "A-Train" of polar orbiting satellites tasked with cataloguing global cloud

  18. A Multi-Faceted View of GPM GV in the Post-Launch Era

    Science.gov (United States)

    Petersen, W. A.

    2015-12-01

    NASA GPM Ground Validation (GV) activities in the early post-launch era have focused on: a) intercomparison of early version satellite products to GV data originating from NOAA Q3, WSR-88D, and Tier-1 research ground radar (GR) and instrument networks; b) continued physical validation of GPM algorithms using recent field campaign and site-specific datasets (warm and cold season); and c) development and use of rainfall products for hydrologic validation and bridging-validation of Level II and Level III satellite products (IMERG). Intercomparisons of GPM products with Q3 rainfall and WSR-88D ground-radar (GR) data over CONUS exhibit reasonable agreement. For example, DPR radar reflectivities geo-matched to reflectivity profiles from ~60 GRs generally differ by 2 dB or less. Occasional low-biases do appear in the rainwater portion of DPR Ku-Band convective reflectivity profiles. In stratiform precipitation, DPR-diagnosed reflectivity and rain drop size distributions are frequently very similar to those retrieved from GR products. DPR and Combined algorithm rainrate products compare reasonably well to each other and to Q3 at CONUS scales. GPROF2014 radiometer-based rain rates compare well to Q3 in a spatial sense (correlations of ~0.6); but, GMI estimates appear to be slightly low-biased relative to Q3 and to DPR and Combined algorithm products. The last NASA GPM GV-led field effort, OLYMPEX, will occur in Nov 2015 to Jan 2016. OLYMPEX is designed to study cold-season precipitation processes and hydrology in the orographic and oceanic domains of western Washington State. In addition to occasional field campaigns like OLYMPEX, continuous field measurements using multi-parameter radar and instrument networks targeted to direct validation and specific problems in physical validation (e.g., path-integrated attenuation and the impacts of drop size distribution, non-uniform beam filling and multiple scattering) are also being collected under coincident GPM core overpasses at

  19. Impact of Eclipse of 21 August 2017 ON the Atmospheric Boundary Layer

    Science.gov (United States)

    Knupp, K.

    2017-12-01

    The (total) solar eclipse of 21 August 2017 presents a prodigious opportunity to improve our understanding of the physical response of decreases in turbulence within the ABL produced by a rapid reduction in solar radiation, since the transition in this eclipse case, close to local solar noon, is more rapid than at natural sunset. A mesoscale network of three UAH atmospheric profiling systems will be set up around Clarksville, TN, and Hopkinsville, KY, to document the details of the physical response of the ABL to the rapid decrease in solar radiation. The region offers a heterogeneous surface, including expansive agricultural and forested regions. Data from the following mobile systems will be examined: Mobile Integrated Profiling System (MIPS) with a 915 MHz Doppler wind profiler, X-band Profiling Radar (XPR), Microwave Profiling Radiometer (MPR), lidar ceilometer, and Doppler mini-sodar, Rapidly Deployable Atmospheric Profiling System (RaDAPS) with a 915 MHz Doppler wind profiler, MPR, lidar ceilometer, Doppler mini-sodar, Mobile Doppler Lidar and Sounding system (MoDLS) with a Doppler Wind Lidar and MPR. A tethered balloon will provide high temporal and vertical resolution in situ sampling of the surface layer temperature and humidity vertical profiles over the lowest 120 m AGL. Two of the profiling systems (MIPS and MoDLS) will include 20 Hz sonic anemometer measurements for documentation of velocity component (u, v, w) variance, buoyancy flux, and momentum flux. The Mobile Alabama X-band (MAX) dual polarization radar will be paired with the Ft. Campbell WSR-88D radar, located 29 km east of the MAX, to provide dual Doppler radar coverage of flow within the ABL over the profiler domain. The measurements during this eclipse will also provide information on the response of insects to rapidly changing lighting conditions. During the natural afternoon-to-evening transition, daytime insect concentrations decrease rapidly, and stronger-flying nighttime flyers emerge

  20. Cross-validation Methodology between Ground and GPM Satellite-based Radar Rainfall Product over Dallas-Fort Worth (DFW) Metroplex

    Science.gov (United States)

    Chen, H.; Chandrasekar, V.; Biswas, S.

    2015-12-01

    Over the past two decades, a large number of rainfall products have been developed based on satellite, radar, and/or rain gauge observations. However, to produce optimal rainfall estimation for a given region is still challenging due to the space time variability of rainfall at many scales and the spatial and temporal sampling difference of different rainfall instruments. In order to produce high-resolution rainfall products for urban flash flood applications and improve the weather sensing capability in urban environment, the center for Collaborative Adaptive Sensing of the Atmosphere (CASA), in collaboration with National Weather Service (NWS) and North Central Texas Council of Governments (NCTCOG), has developed an urban radar remote sensing network in DFW Metroplex. DFW is the largest inland metropolitan area in the U.S., that experiences a wide range of natural weather hazards such as flash flood and hailstorms. The DFW urban remote sensing network, centered by the deployment of eight dual-polarization X-band radars and a NWS WSR-88DP radar, is expected to provide impacts-based warning and forecasts for benefit of the public safety and economy. High-resolution quantitative precipitation estimation (QPE) is one of the major goals of the development of this urban test bed. In addition to ground radar-based rainfall estimation, satellite-based rainfall products for this area are also of interest for this study. Typical example is the rainfall rate product produced by the Dual-frequency Precipitation Radar (DPR) onboard Global Precipitation Measurement (GPM) Core Observatory satellite. Therefore, cross-comparison between ground and space-based rainfall estimation is critical to building an optimal regional rainfall system, which can take advantages of the sampling differences of different sensors. This paper presents the real-time high-resolution QPE system developed for DFW urban radar network, which is based upon the combination of S-band WSR-88DP and X

  1. Portfolio Assessment: Does It Really Give the Benefits That It Purports to Offer? Views of Early Childhood and First-Grade Teachers

    Science.gov (United States)

    Alaçam, Nur; Olgan, Refika

    2016-01-01

    Early childhood (n = 10) and first-grade teachers' (n = 10) views concerning portfolio usage were investigated in the current research. After collecting the data, six themes were constituted regarding the teachers' opinions about portfolio use concerning "portfolio conception," "advantages, disadvantages and challenges of…

  2. Effect of regional muscle location but not adiposity on mitochondrial biogenesis-regulating proteins

    DEFF Research Database (Denmark)

    Ponce-González, Jesús Gustavo; Ara, Ignacio; Larsen, Steen

    2016-01-01

    PURPOSE: The aim of this study was to determine if the expression of the mitochondrial biogenesis-regulating proteins SIRT1, SIRT3 and PGC-1alpha in human skeletal muscle is influenced by adiposity. METHOD: Twenty-nine male subjects were recruited into three groups: control (n = 10), obese (n = 10...

  3. Exploring Similarities and Differences in Personal Epistemologies of U.S. and German Elementary School Teachers

    Science.gov (United States)

    Feucht, Florian C.; Bendixen, Lisa D.

    2010-01-01

    The current study examines the personal epistemology of fourth-grade elementary school teachers from Germany (n = 10) and the United States (n = 10) to gain a more nuanced understanding of teachers' beliefs about knowledge and knowing through a cross-cultural lens. Analyses of semi-structured interviews reveal similarities and differences in the…

  4. Comparison of two different loading doses of milrinone for weaning from cardiopulmonary bypass

    NARCIS (Netherlands)

    de Hert, S. G.; Moens, M. M.; Jorens, P. G.; Delrue, G. L.; DePaep, R. J.; Vermeyen, K. M.

    1995-01-01

    OBJECTIVE: To compare the hemodynamic effects, pharmacokinetic profiles, and the need for vasoactive agents between a low (20 micrograms/kg during 15 minutes [group 1; n = 10]) and a high (40 micrograms/kg during 15 minutes [group 2; n = 10]) loading dose of milrinone. DESIGN: Prospective,

  5. Morphology and function of dog arterial grafts preserved in UW-solution

    NARCIS (Netherlands)

    Vischjager, M.; van Gulik, T. M.; Pfaffendorf, M.; van Zwieten, P. A.; van Marle, J.; Kromhout, J. G.; Klopper, P. J.; Jacobs, M. J.

    1995-01-01

    To assess the function of arterial grafts after prolonged preservation in the University of Wisconsin solution (UW), in vitro and in vivo. Carotid arteries were harvested from dogs and stored for 1-21 days at 4 degrees C in UW (n = 10) or in PBS (0.9% NaCl, pH 7.4), (PBS) (n = 10). Slices were

  6. Effects of extradural bupivacaine on the haemostatic system

    NARCIS (Netherlands)

    Henny, C. P.; Odoom, J. A.; ten Cate, H.; ten Cate, J. W.; Oosterhoff, R. J.; Dabhoiwala, N. F.; Sih, I. L.

    1986-01-01

    Twenty consecutive patients undergoing elective transurethral resection of the prostate were allocated randomly to one of two groups. Group I (n = 10) received lumbar extradural analgesia with 0.5% bupivacaine. Group II (n = 10) received general anaesthesia with spontaneous respiration, using 60%

  7. A characterization of verb use in Turkish agrammatic narrative speech

    NARCIS (Netherlands)

    Arslan, Seçkin; Bamyacı, Elif; Bastiaanse, Roelien

    2016-01-01

    This study investigates the characteristics of narrative-speech production and the use of verbs in Turkish agrammatic speakers (n = 10) compared to non-brain-damaged controls (n = 10). To elicit narrative-speech samples, personal interviews and storytelling tasks were conducted. Turkish has a large

  8. Relationships among red-cockaded woodpecker group density, nestling provisioning rates, and habitat

    Science.gov (United States)

    Richard N. Conner; D. Craig Rudolph; Richard R. Schaefer; Daniel Saenz; Clifford E. Shackelford

    1999-01-01

    We examined Red-cockaded Woodpecker (Picoides borealis) food provisioning rates of nestlings during the 1992 and 1993 breeding seasons on the Vernon Ranger District of the Kisatchie National Forest in Louisiana. Provisioning rates were monitored at nest trees in moderate (9.8 groups/2 km radius, n=10) and low (5.9 groups/2 km radius, n=10) density...

  9. The design of a purpose-built nuclear medicine department

    International Nuclear Information System (INIS)

    Dixon, J.; Walker, B.

    1999-01-01

    Full text: In December 1997, the Department of Nuclear Medicine relocated to new purpose-built premises. Two years of detailed planning preceded this move. Several innovative features were incorporated in the design. The 6 gamma camera rooms are arranged in pairs with shared shielded console areas, around a central 'staff-only' corridor with the radiopharmacy dispensing room (RP) at one end. This allows for direct staff access between these rooms while preserving the privacy of the patients. Hatches from the RP to the stress lab and procedures rooms allow for minimal carrying of doses. A separate hotlab adjoining the RP with a dedicated dose calibrator is used for preparations of all therapy doses and 18 F. A 'no return' policy was adopted for the RP. A separate isolated radioactive waste storage room (WSR) has an easily accessible anteroom used only for 99 Tc m , which allows efficient management of this short-lived waste. The nurses' station visualizes all waiting facilities, which include separate areas for trolley and ambulant patients as well as a playroom for the paediatric patients. An area for resting 18 F patients is located away from the general waiting areas and close to the coincidence detection camera room. After 1 year of operation, these specific design features have proved successful. They have led to improvement in the efficiency of operation of the department for the staff and increased comfort for the patients

  10. Education effect of solar car for technical high school student; Kogyo kokosei ni taisuru solar car no kyoiku koka

    Energy Technology Data Exchange (ETDEWEB)

    Inoue, T.

    1998-09-30

    The solar car race which technical high school students can join in was determined to be held at Ogata village, Akita prefecture. To join in the solar bicycle race, the author working in Ofuna technical high school called on 3 schools of Yokosuka, Fujisawa and Kanagawa technical high schools which joined in World Solar-Car Rally in Akita (WSR) in 1997, before fabrication of a racing bicycle. This paper describes the survey results at the above technical high schools, and the spirit as the teacher of Ofuna technical high school on joining in the race and fabrication of the solar bicycle, and the past, current and future situations. Club activities of high school students incline too toward sports such as soccer, baseball, volleyball and rugby, and are apt to keep honest cultural events and technical events at a distance. The author says that the challenge spirit to the solar car race using environment-friendly solar energy by both dedicated teachers and students of technical high schools summoned up the author`s courage. 15 figs.

  11. Cardiovascular Risk Factors in Bulgarian Patients with Polycystic Ovary Syndrome and/or Obesity

    Directory of Open Access Journals (Sweden)

    Antoaneta Gateva

    2012-01-01

    Full Text Available Polycystic ovarian syndrome (PCOS is one of the most common endocrine disturbances in women of reproductive age. Besides its well-known effects on reproductive health, it is also linked to increased cardiovascular risk in later life. The aim of this study is to investigate some classical cardiovascular risk factors in a crossectional study of Bulgarian women with PCOS and/or obesity. We performed a retrospective medical chart review of 375 women from an university endocrine clinic. We found significant differences in the indices of carbohydrate metabolism, blood pressure, lipid profile, rate of liver steatosis, and the levels liver enzymes and hematological results between the lean and obese PCOS women. Obese women without PCOS did not show significantly different results in their OGGT form obese PCOS women. Waist-to-stature-ratio (WSR correlated better with the baseline IRI levels and lipid profile than waist-to-hip-ratio (WHR that makes it a better marker for unfavorable metabolic profile.

  12. Verification and implementation of microburst day potential index (MDPI) and wind INDEX (WINDEX) forecasting tools at Cape Canaveral Air Station

    Science.gov (United States)

    Wheeler, Mark

    1996-01-01

    This report details the research, development, utility, verification and transition on wet microburst forecasting and detection the Applied Meteorology Unit (AMU) did in support of ground and launch operations at Kennedy Space Center (KSC) and Cape Canaveral Air Station (CCAS). The unforecasted wind event on 16 August 1994 of 33.5 ms-1 (65 knots) at the Shuttle Landing Facility raised the issue of wet microburst detection and forecasting. The AMU researched and analyzed the downburst wind event and determined it was a wet microburst event. A program was developed for operational use on the Meteorological Interactive Data Display System (MIDDS) weather system to analyze, compute and display Theta(epsilon) profiles, the microburst day potential index (MDPI), and wind index (WINDEX) maximum wind gust value. Key microburst nowcasting signatures using the WSR-88D data were highlighted. Verification of the data sets indicated that the MDPI has good potential in alerting the duty forecaster to the potential of wet microburst and the WINDEX values computed from the hourly surface data do have potential in showing a trend for the maximum gust potential. WINDEX should help in filling in the temporal hole between the MDPI on the last Cape Canaveral rawinsonde and the nowcasting radar data tools.

  13. Simultaneous Radar and Satellite Data Storm-Scale Assimilation Using an Ensemble Kalman Filter Approach for 24 May 2011

    Science.gov (United States)

    Jones, Thomas A.; Stensrud, David; Wicker, Louis; Minnis, Patrick; Palikonda, Rabindra

    2015-01-01

    Assimilating high-resolution radar reflectivity and radial velocity into convection-permitting numerical weather prediction models has proven to be an important tool for improving forecast skill of convection. The use of satellite data for the application is much less well understood, only recently receiving significant attention. Since both radar and satellite data provide independent information, combing these two sources of data in a robust manner potentially represents the future of high-resolution data assimilation. This research combines Geostationary Operational Environmental Satellite 13 (GOES-13) cloud water path (CWP) retrievals with Weather Surveillance Radar-1988 Doppler (WSR-88D) reflectivity and radial velocity to examine the impacts of assimilating each for a severe weather event occurring in Oklahoma on 24 May 2011. Data are assimilated into a 3-km model using an ensemble adjustment Kalman filter approach with 36 members over a 2-h assimilation window between 1800 and 2000 UTC. Forecasts are then generated for 90 min at 5-min intervals starting at 1930 and 2000 UTC. Results show that both satellite and radar data are able to initiate convection, but that assimilating both spins up a storm much faster. Assimilating CWP also performs well at suppressing spurious precipitation and cloud cover in the model as well as capturing the anvil characteristics of developed storms. Radar data are most effective at resolving the 3D characteristics of the core convection. Assimilating both satellite and radar data generally resulted in the best model analysis and most skillful forecast for this event.

  14. Statistics-based optimization of the polarimetric radar hydrometeor classification algorithm and its application for a squall line in South China

    Science.gov (United States)

    Wu, Chong; Liu, Liping; Wei, Ming; Xi, Baozhu; Yu, Minghui

    2018-03-01

    A modified hydrometeor classification algorithm (HCA) is developed in this study for Chinese polarimetric radars. This algorithm is based on the U.S. operational HCA. Meanwhile, the methodology of statistics-based optimization is proposed including calibration checking, datasets selection, membership functions modification, computation thresholds modification, and effect verification. Zhuhai radar, the first operational polarimetric radar in South China, applies these procedures. The systematic bias of calibration is corrected, the reliability of radar measurements deteriorates when the signal-to-noise ratio is low, and correlation coefficient within the melting layer is usually lower than that of the U.S. WSR-88D radar. Through modification based on statistical analysis of polarimetric variables, the localized HCA especially for Zhuhai is obtained, and it performs well over a one-month test through comparison with sounding and surface observations. The algorithm is then utilized for analysis of a squall line process on 11 May 2014 and is found to provide reasonable details with respect to horizontal and vertical structures, and the HCA results—especially in the mixed rain-hail region—can reflect the life cycle of the squall line. In addition, the kinematic and microphysical processes of cloud evolution and the differences between radar-detected hail and surface observations are also analyzed. The results of this study provide evidence for the improvement of this HCA developed specifically for China.

  15. Particle-size distribution and phosphorus forms as a function of hydrological forcing in the Yellow River.

    Science.gov (United States)

    Yao, Qing-Zhen; Du, Jun-Tao; Chen, Hong-Tao; Yu, Zhi-Gang

    2016-02-01

    Samples were collected monthly from January to December in 2010, and daily observations were made during the water-sediment regulation event in June-July 2010. Sequential extractions were applied to determine the forms of P in different particle-size fractions and to assess the potential bioavailability of particulate phosphorus (PP). The results indicated that exchangeable phosphorus, organic phosphorus, authigenic phosphorus, and refractory phosphorus increased with the decreasing of particulate size; conversely, detrital phosphorus decreased with the decreasing of particulate size. The content of bioavailable particulate phosphorus (BAPP) varied greatly in different sizes of particles. In general, the smaller the particle size, the higher the content of bioavailable phosphorus and its proportion in total phosphorous was found in these particles. Hydrological forcing controlled the variability in the major P phases found in the suspended sediments via changes in the sources and the particle grain-size distribution. The variation of particle sizes can be attributed also to different total suspended sediment (TSS) sources. Water-sediment regulation (WSR) mobilized only particulate matter from the riverbed, while during the rainstorm soil erosion and runoff were the main source. The BAPP fluxes associated with the "truly suspended" fraction was approximately 200 times larger than the dissolved inorganic phosphorus (DIP) flux. Thus, the transfer of fine particles to the open sea is most probably accompanied by BAPP release to the DIP and can support greater primary and secondary production.

  16. Adsorption Property and Mechanism of Oxytetracycline onto Willow Residues

    Directory of Open Access Journals (Sweden)

    Di Wang

    2017-12-01

    Full Text Available To elucidate the adsorption property and the mechanism of plant residues to reduce oxytetracycline (OTC, the adsorption of OTC onto raw willow roots (WR-R, stems (WS-R, leaves (WL-R, and adsorption onto desugared willow roots (WR-D, stems (WS-D, and leaves (WL-D were investigated. The structural characterization was analyzed by scanning electron microscopy, Fourier-transform infrared spectra, and an elemental analyzer. OTC adsorption onto the different tissues of willow residues was compared and correlated with their structures. The adsorption kinetics of OTC onto willow residues was found to follow the pseudo-first-order model. The isothermal adsorption process of OTC onto the different tissues of willow residues followed the Langmuir and Freundlich model and the process was also a spontaneous endothermic reaction, which was mainly physical adsorption. After the willow residues were desugared, the polarity decreased and the aromaticity increased, which explained why the adsorption amounts of the desugared willow residues were higher than those of the unmodified residues. These observations suggest that the raw and modified willow residues have great potential as adsorbents to remove organic pollutants.

  17. Satellite passive microwave rain measurement techniques for land and ocean

    Science.gov (United States)

    Spencer, R. W.

    1985-01-01

    Multiseasonal rainfall was found to be measurable over land with satellite passive microwave data, based upon comparisons between Nimbus 7 Scanning Multichannel Microwave Radiometer (SMME) brightness temperatures (T sub B) and operational WSR-57 radar rain rates. All of the SMMR channels (bipolarized 37, 21, 18, 10.7, and 6.6. GHz T sub B) were compared to radar reflectivities for 25 SMMR passes and 234 radar scans over the U.S. during the spring, summer, and fall of 1979. It was found that the radar rain rates were closely related to the difference between 37 and 21 GHz T sub B. This result is due to the volume scattering effects of precipitation which cause emissivity decreases with frequency, as opposed to emissive surfaces (e.g., water) whose emissivities increase with frequency. Two frequencies also act to reduce the effects of thermometric temperature variations on T sub B to a miminum. During summer and fall, multiple correlation coefficients of 0.80 and 0.75 were obtained. These approach the limit of correlation that can be expected to exist between two very different data sources, especially in light of the errors attributable to manual digitization of PPI photographs of variable quality from various operational weather radar not calibrated for research purposes. During the spring, a significantly lower (0.63) correlation was found. This poorer performance was traced to cases of wet, unvegetated soil being sensed at the lower frequencies through light rain, partly negating the rain scattering signal.

  18. Assessment of Bias in the National Mosaic and Multi-Sensor QPE (NMQ/Q2) Reanalysis Radar-Only Estimate

    Science.gov (United States)

    Nelson, B. R.; Prat, O. P.; Stevens, S. E.; Seo, D. J.; Zhang, J.; Howard, K.

    2014-12-01

    The processing of radar-only precipitation via the reanalysis from the National Mosaic and Multi-Sensor QPE (NMQ/Q2) based on the WSR-88D Next-generation Radar (NEXRAD) network over Continental United States (CONUS) is nearly completed for the period covering from 2001 to 2012. Reanalysis data are available at 1-km and 5-minute resolution. An important step in generating the best possible precipitation data is to assess the bias in the radar-only product. In this work, we use data from a combination of rain gauge networks to assess the bias in the NMQ reanalysis. Rain gauge networks such as the Hydrometeorological Automated Data System (HADS), the Automated Surface Observing Systems (ASOS), the Climate Reference Network (CRN), and the Global Historical Climatology Network Daily (GHCN-D) are combined for use in the assessment. These rain gauge networks vary in spatial density and temporal resolution. The challenge hence is to optimally utilize them to assess the bias at the finest resolution possible. For initial assessment, we propose to subset the CONUS data in climatologically representative domains, and perform bias assessment using information in the Q2 dataset on precipitation type and phase.

  19. Radar-Derived Quantitative Precipitation Estimation Based on Precipitation Classification

    Directory of Open Access Journals (Sweden)

    Lili Yang

    2016-01-01

    Full Text Available A method for improving radar-derived quantitative precipitation estimation is proposed. Tropical vertical profiles of reflectivity (VPRs are first determined from multiple VPRs. Upon identifying a tropical VPR, the event can be further classified as either tropical-stratiform or tropical-convective rainfall by a fuzzy logic (FL algorithm. Based on the precipitation-type fields, the reflectivity values are converted into rainfall rate using a Z-R relationship. In order to evaluate the performance of this rainfall classification scheme, three experiments were conducted using three months of data and two study cases. In Experiment I, the Weather Surveillance Radar-1988 Doppler (WSR-88D default Z-R relationship was applied. In Experiment II, the precipitation regime was separated into convective and stratiform rainfall using the FL algorithm, and corresponding Z-R relationships were used. In Experiment III, the precipitation regime was separated into convective, stratiform, and tropical rainfall, and the corresponding Z-R relationships were applied. The results show that the rainfall rates obtained from all three experiments match closely with the gauge observations, although Experiment II could solve the underestimation, when compared to Experiment I. Experiment III significantly reduced this underestimation and generated the most accurate radar estimates of rain rate among the three experiments.

  20. Lightning characteristics of derecho producing mesoscale convective systems

    Science.gov (United States)

    Bentley, Mace L.; Franks, John R.; Suranovic, Katelyn R.; Barbachem, Brent; Cannon, Declan; Cooper, Stonie R.

    2016-06-01

    Derechos, or widespread, convectively induced wind storms, are a common warm season phenomenon in the Central and Eastern United States. These damaging and severe weather events are known to sweep quickly across large spatial regions of more than 400 km and produce wind speeds exceeding 121 km h-1. Although extensive research concerning derechos and their parent mesoscale convective systems already exists, there have been few investigations of the spatial and temporal distribution of associated cloud-to-ground lightning with these events. This study analyzes twenty warm season (May through August) derecho events between 2003 and 2013 in an effort to discern their lightning characteristics. Data used in the study included cloud-to-ground flash data derived from the National Lightning Detection Network, WSR-88D imagery from the University Corporation for Atmospheric Research, and damaging wind report data obtained from the Storm Prediction Center. A spatial and temporal analysis was conducted by incorporating these data into a geographic information system to determine the distribution and lightning characteristics of the environments of derecho producing mesoscale convective systems. Primary foci of this research include: (1) finding the approximate size of the lightning activity region for individual and combined event(s); (2) determining the intensity of each event by examining the density and polarity of lightning flashes; (3) locating areas of highest lightning flash density; and (4) to provide a lightning spatial analysis that outlines the temporal and spatial distribution of flash activity for particularly strong derecho producing thunderstorm episodes.

  1. Fusion of multisource and multiscale remote sensing data for water availability assessment in a metropolitan region

    Science.gov (United States)

    Chang, N. B.; Yang, Y. J.; Daranpob, A.

    2009-09-01

    Recent extreme hydroclimatic events in the United States alone include, but are not limited to, the droughts in Maryland and the Chesapeake Bay area in 2001 through September 2002; Lake Mead in Las Vegas in 2000 through 2004; the Peace River and Lake Okeechobee in South Florida in 2006; and Lake Lanier in Atlanta, Georgia in 2007 that affected the water resources distribution in three states - Alabama, Florida and Georgia. This paper provides evidence from previous work and elaborates on the future perspectives that will collectively employ remote sensing and in-situ observations to support the implementation of the water availability assessment in a metropolitan region. Within the hydrological cycle, precipitation, soil moisture, and evapotranspiration can be monitored by using WSR-88D/NEXRAD data, RADARSAT-1 images, and GEOS images collectively to address the spatiotemporal variations of quantitative availability of waters whereas the MODIS images may be used to track down the qualitative availability of waters in terms of turbidity, Chlorophyll-a and other constitutes of concern. Tampa Bay in Florida was selected as a study site in this analysis, where the water supply infrastructure covers groundwater, desalination plant, and surface water at the same time. Research findings show that through the proper fusion of multi-source and multi-scale remote sensing data for water availability assessment in metropolitan region, a new insight of water infrastructure assessment can be gained to support sustainable planning region wide.

  2. Values of Deploying a Compact Polarimetric Radar to Monitor Extreme Precipitation in a Mountainous Area: Mineral County, Colorado

    Science.gov (United States)

    Cheong, B. L.; Kirstetter, P. E.; Yu, T. Y.; Busto, J.; Speeze, T.; Dennis, J.

    2015-12-01

    Precipitation in mountainous regions can trigger flash floods and landslides especially in areas affected by wildfire. Because of the small space-time scales required for observation, they remain poorly observed. A light-weighted X-band polarimetric radar can rapidly respond to the situation and provide continuous rainfall information with high resolution for flood forecast and emergency management. A preliminary assessment of added values to the operational practice in Mineral county, Colorado was performed in Fall 2014 and Summer 2015 with a transportable polarimetric radar deployed at the Lobo Overlook. This region is one of the numerous areas in the Rocky Mountains where the WSR-88D network does not provide sufficient weather coverage due to blockages, and the limitations have impeded forecasters and local emergency managers from making accurate predictions and issuing weather warnings. High resolution observations were collected to document the precipitation characteristics and demonstrate the added values of deploying a small weather radar in such context. The analysis of the detailed vertical structure of precipitation explain the decreased signal sampled by the operational radars. The specific microphysics analyzed though polarimetry suggest that the operational Z-R relationships may not be appropriate to monitor severe weather over this wildfire affected region. Collaboration with the local emergency managers and the National Weather Service shows the critical value of deploying mobile, polarimetric and unmanned radars in complex terrain. Several selected cases are provided in this paper for illustration.

  3. Effect of various tooth-whitening products on enamel microhardness.

    Science.gov (United States)

    Grobler, S R; Majeed, A; Moola, M H

    2009-11-01

    The purpose of this in vitro study was to evaluate the effect of various tooth-whitening products containing carbamide peroxide (CP) or hydrogen peroxide (HP), on enamel microhardness. Enamel blocks were exposed to: Nite White ACP 10% CP (Group 2, n=10); Yotuel Patient 10% CP (Group 3, n=10); Opalescence PF 10% CP (Group 4, n=10); Opalescence PF 20% CP (Group 5, n=10); Opalescence Treswhite Supreme 10% HP (Group 6, n=10); Yotuel 10 Minutes 30% CP (Group 7, n=10); Opalescence Quick 45% CP (Group 8, n=10), Yotuel Special 35% HP (Group 9, n=10), Opalescence Boost 38% HP (Group 10, n=10) according to the instructions of the manufacturers. The control (Group 1, n=10) was enamel blocks kept in artificial saliva at 37 degrees C without any treatment. The microhardness values were obtained before exposure and after a 14-day treatment period. Specimens were kept in artificial saliva at 37 degrees C between treatments. Data were analysed using Kruskal-Wallis one-way ANOVA and Tukey-Kramer Multiple Comparison Test. Indent marks on the enamel blocks were also examined under the Scanning Electron Microscope. All whitening products decreased enamel microhardness except group 10 but only Groups 2, 3, 4, 5 and 7 showed significant decrease in enamel microhardness as compared to the control group (p enamel. All products tested in this study decreased enamel microhardness except Opalescence Boost 38% HP. The products containing carbamide peroxide were more damaging to enamel because of the longer application times. Nite White ACP 10% CP showed the highest reduction in enamel microhardness as compared to other products tested.

  4. Cadence Feedback With ECE PEDO to Monitor Physical Activity Intensity

    OpenAIRE

    Ardic, Fusun; G?cer, Esra

    2016-01-01

    Abstract The purpose of this study was to examine the monitoring capabilities of the equipment for clever exercise pedometer (ECE PEDO) that provides audible feedback when the person exceeds the upper and lower limits of the target step numbers per minute and to compare step counts with Yamax SW-200 (YX200) as the criterion pedometer. A total of 30 adult volunteers (15 males and 15 females) were classified as normal weight (n?=?10), overweight (n?=?10), and obese (n?=?10). After the submaxima...

  5. Chromosomes of parasitic wasps of the genus Metaphycus (Hymenoptera: Chalcidoidea: Encyrtidae

    Directory of Open Access Journals (Sweden)

    Vladimir Gokhman

    2010-07-01

    Full Text Available Karyotypes of four species of the genus Metaphycus Mercet, 1917, namely, M. flavus (Howard, 1881 and M. luteolus (Timberlake, 1916 (both have n = 10 and 2n = 20, M. angustifrons Compere, 1957 (n = 9 and 2n = 18 and M. stanleyi Compere, 1940 (n = 5 and 2n = 10 were studied. The latter chromosome number, n = 5, is the lowest known one for the family Encyrtidae. A karyotype with n = 10 is considered ancestral for the genus Metaphycus. Karyotype evolution in this genus is likely to have occurred through chromosomal fusions.

  6. Simvastatin effects on skeletal muscle

    DEFF Research Database (Denmark)

    Larsen, Steen; Stride, Nis; Hey-Mogensen, Martin

    2013-01-01

    Glucose tolerance and skeletal muscle coenzyme Q(10) (Q(10)) content, mitochondrial density, and mitochondrial oxidative phosphorylation (OXPHOS) capacity were measured in simvastatin-treated patients (n = 10) and in well-matched control subjects (n = 9)....

  7. Airway inflammation in nonobstructive and obstructive chronic bronchitis with chronic haemophilus influenzae airway infection. Comparison with noninfected patients with chronic obstructive pulmonary disease

    NARCIS (Netherlands)

    Bresser, P.; Out, T. A.; van Alphen, L.; Jansen, H. M.; Lutter, R.

    2000-01-01

    Nonencapsulated Haemophilus influenzae often causes chronic infections of the lower respiratory tract in both nonobstructive and obstructive chronic bronchitis. We assessed airway inflammation in clinically stable, chronically H. influenzae-infected patients with nonobstructive (CB-HI, n = 10) and

  8. HEAVY METALS IN THE ECOSYSTEM COMPONENTS AT "DEGELEN" TESTING GROUND OF THE FORMER SEMIPALATINSK TEST SITE

    Directory of Open Access Journals (Sweden)

    A.B. Yankauskas

    2012-06-01

    Full Text Available The ecological situation in the former Semipalatinsk test site is characterized by a combination of both radiative and "nonradiative" factors. There were investigated near-portal areas of the tunnels with water seepage at "Degelen" site. All the tunnel waters are characterized by higher concentrations of uranium, beryllium, and molybdenum. The watercourse of the tunnel # 504 is unique for its elemental composition, in particular, the content of rare earth elements, whose concentration in the water is in the range n*10-5 – n*10-7 %. Of all the rare earth elements in the samples were found 13, the concentrations of aluminum, manganese, zinc are comparable to the concentrations of macro-components. Concentration of 238U in the studied waters lie in the range of n*10-4 – n*10-6 %, which suggests the influence of uranium, not only as a toxic element, but its significance as the radiation factor.

  9. Long term treatment with gabapentin in an animal model of chronic neuropathic pain

    DEFF Research Database (Denmark)

    Baastrup, C. S.; Andrews, N.; Wegener, Gregers

    2013-01-01

    . Daily treatment with gabapentin 30 mg/kg sc. or saline for 6 consecutive weeks. Mechanical sensitivity thresholds (MST) to von Frey stimulation of hindpaws and thorax measured by both reflex withdrawal and supra-spinal responses. Anxiety-like behaviour using the openfield paradigm. Drug effect...... was measured after initial dose, 1 and 6 weeks of treatment. Preliminary results show that saline-treated SCC animals (N=10) have significantly lower MST with supra-spinal responses on the thorax compared to saline-treated shams (N=10), and gabapentin-treated SCC (N=10) and sham animals (N=10) throughout...... the study. The SCC animals had significantly decreased MST with reflex responses on the hindpaws in the two first time points compared with gabapentin-treated SCC animals (and both sham groups). There was no effect of injury on the MST with supra-spinal responses on the hindpaws and thus no effect...

  10. Therapeutic effects of Jiaotai pill on rat insomnia via regulation of ...

    African Journals Online (AJOL)

    Methods: Rats with PCPA-induced insomnia were divided into 5 groups (n = 10), made up .... carefully excised and stored at -80 °C prior to .... Treatment for Insomnia: A Systematic Review. ... infusion of vigabatrin into the subthalamic nucleus:.

  11. bipyridinium dichloride-induced hepatic and renal toxicity in Swiss

    African Journals Online (AJOL)

    Pharmacotherapy Group, Faculty of Pharmacy, University of Benin, Benin City, 300001 Nigeria. ... Methods: Three groups of Swiss albino mice (n = 10), i.e., control, paraquat (15 mg/kg) ... Control and vitamin C-treated mice .... Tokyo, Japan).

  12. Combination Therapy for Radiation-Induced Bone Marrow Aplasia in Nonhuman Primates Using Synthokine SC-55494 and Recombinant Human Granulocyte Colony-Stimulating Factor

    National Research Council Canada - National Science Library

    MacVittle, Thomas J; Farese, Ann M; Herodin, Francis; Grab, Lisa B; Baum, Charles M; McKearn, John P

    1996-01-01

    .... After irradiation on day (d) 0, cohorts of animals subcutaneously received single-agent protocols of either human serum albumin (HSA; every day [OD], 15 microng/kg/d. n = 10). Synthokine (twice daily [BID...

  13. The Child's Demystification of Psychological Defense Mechanisms: A Structural and Developmental Analysis.

    Science.gov (United States)

    Chandler, Michael J.; And Others

    1978-01-01

    Explored the relationships between the cognitive developmental level of preoperational, concrete operational, and formal operational children (N=10) and their success in interpreting and explaining each of eight commonly described mechanisms of psychological defense. (JMB)

  14. land- and water-based exercises in rheumatoid arthritis patients: a ...

    African Journals Online (AJOL)

    Apart from the direct consequences of the disease on the function ... stiffness of the joints, muscle weakness and cardiorespiratory de- ... Methods. Patients with RA Functional Class I and II (N=10) were randomly assigned to a land-based ...

  15. CT diagnosis and differential diagnosis of malignant pleural mesothelioma

    International Nuclear Information System (INIS)

    Xiong Juxin; Yang Zenian; Luo Zhongyao

    2008-01-01

    Objective: To study the CT features of malignant pleural mesothelioma and improve diagnostic accuracy. Methods: The CT findings of 14 patients with malignant pleural mesothelioma proven by surgery or histopathology were analyzed retrospectively. CT plain scan was performed in all cases, 9 cases received both CT plain scan and contrast CT scan. Results: All the cases demonstrated various pleural thickening including diffuse pleural thickening (n=10). Among all the cases, there were nodular pleural thickening (n=4), lumpy pleural thickening (n=7), ring-like pleural thickening (n=3). Pleural thickness which was more than 1.0 cm was found in 12 cases. Pleural effusion (n=10), mediastinum immobilization (n=10) and thoracic cavity stricture in the trouble side (n=10) were also revealed. Conclusion: Obvious characteristics in cases with malignant pleural mesothelioma was showed in CT examination, which plays an important role in the diagnosis and differential diagnosis of this disease. (authors)

  16. Role of Mutations in Dihydrofolate Reductase DfrA (Rv2763c) and Thymidylate Synthase ThyA (Rv2764c) in Mycobacterium tuberculosis Drug Resistance

    KAUST Repository

    Koser, C. U.; Veerapen-Pierce, R. N.; Summers, D. K.; Archer, John A.C.

    2010-01-01

    note that the mutational loss of ThyA leads to TMP resistance in other organisms. Under these circumstances, tetrahydrofolate, the product of DHFR, is no longer required to regenerate N5,N10-methylenetetrahydrofolate, which would otherwise be oxidized

  17. International guidance, evolution and trends

    International Nuclear Information System (INIS)

    Ruiz Lopez, C.

    2010-01-01

    Carmen Ruiz Lopez, (CSN) addressed the evolution of some of the fundamental concepts related to the objective of protecting future generations, with the intention of encouraging the discussion, and to determine whether the recent international guidance implied any change in philosophy and approach regarding the practical interpretation and implementation of such fundamental concepts. C. Ruiz presented a general overview of the ICRP and IAEA guidance developments as well as the major changes or reorientations introduced by the latest ICRP Recommendations and IAEA Safety Standards that are relevant to long-term issues of geological disposal, namely, ICRP 103 (2009), ICRP 101 (2006), IAEA Safety Fundamentals SF-1(2006) and WS-R-4. As for the ICRP developments, ICRP 103 confirms the validity of ICRP 81(1998) as the main ICRP reference for long-lived waste disposal. C. Ruiz then noted the extension of the scope of ICPR 81 mentioning some of the principles and recommendations related to the objective of protecting future generations and the view of the Commission for demonstrating compliance. ICRP 103 and ICRP 101 reinforce the importance of transparency in the decision-making process and in the demonstration of confidence in situations of increasing uncertainties about time, giving more weight to the process itself and strengthening the need for an open dialogue between regulator and implementer. In both recommendations the Commission recognises the influence of societal values in the final decision on the level of radiological protection, as well as the influence of social concerns and political aspects in the decision-making process. The evolution of internationally agreed safety fundamental objectives and principles can be observed in the changes from the IAEA's Waste Safety Fundamentals of 1995 to the new Safety Fundamentals of 2006. C Ruiz presented a comparison of both documents focussing on the differences in dealing with fundamental concepts related to the

  18. Radar Observations of Convective Systems from a High-Altitude Aircraft

    Science.gov (United States)

    Heymsfield, G.; Geerts, B.; Tian, L.

    1999-01-01

    . Both TEFLUN-A and B were amply supported by surface data, in particular a dense raingauge network, a polarization radar, wind profilers, a mobile radiosonde system, a cloud physics aircraft penetrating the overflown storms, and a network of 10 cm Doppler radars(WSR-88D). This presentation will show some preliminary comparisons between TRMM, EDOP, and WSR-88D reflectivity fields in the case of an MCS, a hurricane, and less organized convection in central Florida. A validation of TRMM reflectivity is important, because TRMM's primary objective is to estimate the rainfall climatology with 35 degrees of the equator. Rainfall is estimated from the radar reflectivity, as well from TRMM's Microwave Imager, which measures at 10.7, 19.4, 21.3, 37, and 85.5 GHz over a broader swath (78 km). While the experiments lasted about three months the cumulative period of near simultaneous observations of storms by ground-based, airborne and space borne radars is only about an hour long. Therefore the comparison is case-study-based, not climatological. We will highlight fundamental differences in the typical reflectivity profiles in stratiform regions of MCS's, Florida convection and hurricanes and will explain why Z-R relationships based on ground-based radar data for convective systems over land should be different from those for hurricanes. These catastrophically intense rainfall from hurricane Georges in Hispaniola and from Mitch in Honduras highlights the importance of accurate Z-R relationships, It will be shown that a Z-R relationship that uses the entire reflectivity profile (rather than just a 1 level) works much better in a variety of cases, making an adjustment of the constants for different precipitation system categories redundant.

  19. [One-time effects of drinking mineral water and tap water enriched with silver nanoparticles on the biochemical markers of liver condition and metabolic parameters in healthy rats].

    Science.gov (United States)

    Efimenko, N V; Frolkov, V K; Kozlova, V V; Kaisinova, A S; Chalaya, E N

    2017-12-05

     The objective of the present research was to study the influence of tap water enriched with silver nanoparticles (NP) as well as that of «Krasnoarmeysky» and «Essentuki №17» mineral waters after their single administration through the oral gavage to the rats on the metabolism of carbohydrates and lipids, the biochemical markers of the liver condition, and the endocrine profile in the healthy animals.  The laboratory animals (130 male Wistar rats) were allocated to thirteen groups comprised of 10 rats each as follows: 1st group (n=10) intact animals, 2nd group (5 minutes after the administration of silver NP (n=10), 3rd group (15 minutes after the of silver NP), 4th group (60 minutes after the administration of silver NP), 5th group (n=10) (5 minutes after the introduction of the «Krasnoarmeysky» mineral water), 6th group (n=10) (15 min after the introduction of the «Krasnoarmeysky» mineral water), 7th group (n=10), (60 minutes after the introduction of the «Krasnoarmeysky» mineral water) 8th group (n=10) (5 minutes after the introduction of the «Essentuki № 17» mineral water), 9th group (n=10) (15 min after the introduction of the «Essentuki № 7» mineral water) , 10th group (n=10) (60 minutes after the introduction of the «Essentuki №17» mineral water), 11th group (n=10) (5 minutes after administration of tap water (control),12th group (n=10) (15 minutes after administration of tap water (control), and 13th (n=10) group 60 minutes after administration of tap water (control).  The study has demonstrated that the tap water enriched with silver nanoparticles similar to the mineral waters caused stress reactions that are inferior to those induced by «Essentuki №17» mineral water in terms of the magnitude; however, the effect provoked by the tap water was of longer duration. Moreover, the tap water enriched with silver nanoparticles stimulates prooxidant reactions, and inhibit the activity of antioxidant protection. Silver nanoparticles

  20. Program Evaluation for U.S. Army Lifelong Learning Centers (LLCs): Extension to Military Operational Speciality (MOS)-Based LLCs

    Science.gov (United States)

    2008-05-01

    groups, coordination, classroom observation , fact- checking, and discussion. The author is especially grateful for the assistance of Mr. Pat Baker, Mr... classroom observation , archival data analysis, and system analysis. Data collection alternatives to surveys were emphasized in order to explore the...groups, classroom observation , and survey was used. Specifically, two focus groups were conducted, one with 25N10 students (N= 16) and one with 25N 10

  1. 77 FR 64348 - Land Acquisitions: Mississippi Band of Choctaw Indians

    Science.gov (United States)

    2012-10-19

    ..., as amended by Public Law 93-599 dated January 2, 1975 (88 Stat. 1954), the below described property....00 ac). 10/27/97 11N 13E 2 Conehatta NEWTON 52/206....... 6/29/27 (5.40 ac).. 10/27/97 07N 10E 15 Conehatta NEWTON 70/101....... 6/12/39 (0.88 ac).. 10/27/97 07N 10E 10 Conehatta NEWTON 114/377...... 5/3/57...

  2. Local corrosion of high alloy steels under biodeposits

    International Nuclear Information System (INIS)

    Korovyakova, M.D.; Nikitin, V.M.; Speshneva, N.V.

    1999-01-01

    Impact of the bacteriozenosis different structural-functional state under biodeposits on corrosion resistance of the 12Kh18N10T and Kh18N10T high-alloy steels in the natural seawater is studied. It is shown that saturation of natural micro communities by separate aerobic and facultative-anaerobic bacterial monocultures increases corrosion resistance of these steels by their overgrow with biodeposits [ru

  3. Does aerobic exercises induce mtDNA mutation in human blood ...

    African Journals Online (AJOL)

    The aim of this study was to determine the effect of eight weeks aerobic training on mitochondrial DNA (mtDNA) mutation in human blood leucocytes. Twenty untrained healthy students (training group: n =10, age = 20.7±1.5 yrs, weight = 67.7±10 kg, BF% = 17.5±7.35 & control group: n =10, age = 21±1.3 yrs, weight ...

  4. Quantum-chemical studies on the favored and rare tautomers of neutral and redox adenine.

    Science.gov (United States)

    Raczyńska, Ewa D; Makowski, Mariusz; Zientara-Rytter, Katarzyna; Kolczyńska, Katarzyna; Stępniewski, Tomasz M; Hallmann, Małgorzata

    2013-02-21

    All possible twenty-three prototropic tautomers of neutral and redox adenine (nine amine and fourteen imine forms, including geometric isomerism of the exo ═NH group) were examined in vacuo {DFT(B3LYP)/6-311+G(d,p)}. The NH → NH conversions as well as those usually omitted, NH → CH and CH → CH, were considered. An interesting change of the tautomeric preference occurs when proceeding from neutral to reduced adenine. One-electron reduction favors the nonaromatic amine C8H-N10H tautomer. This tautomeric preference is similar to that (C2H) for reduced imidazole. Water molecules (PCM model) seem to not change this trend. They influence solely the relative energies. The DFT vertical detachment energy in the gas phase is positive for each tautomer, e.g., 0.03 eV for N9H-N10H and 1.84 eV for C8H-N10H. The DFT adiabatic electron affinity for the favored process, neutral N9H-N10H → reduced C8H-N10H (ground states), is equal to 0.18 eV at 0 K (ZPE included). One-electron oxidation does not change the tautomeric preference in the gas phase. The aromatic amine N9H-N10H tautomer is favored for the oxidized molecule similarly as for the neutral one. The DFT adiabatic ionization potential for the favored process, neutral N9H-N10H → oxidized N9H-N10H (ground states), is equal to 8.12 eV at 0 K (ZPE included). Water molecules (PCM model) seem to influence solely the composition of the tautomeric mixture and the relative energies. They change the energies of the oxidation and reduction processes by ca. 2 eV.

  5. The Effects of Aerobic and Anaerobic Training Programs Applied to Elite Wrestlers on Body Mass Index (BMI) and Blood Lipids

    Science.gov (United States)

    Demirel, Nurcan; Özbay, Serhat; Kaya, Fatih

    2018-01-01

    The purpose of this study is to analyse the effects of aerobic and anaerobic training programs applied to elite wrestlers on body mass index (BMI) and blood lipids. 20 elite wrestlers, whose average age is (experimental group; 15.20 ± 4.61, n = 10), control group; 15.90 ± 2.08, n = 10), participated in the study and they were randomly divided into…

  6. Metabolic Evidence of Diminished Lipid Oxidation in Women With Polycystic Ovary Syndrome

    OpenAIRE

    Whigham, Leah D.; Butz, Daniel E.; Dashti, Hesam; Tonelli, Marco; Johnson, LuAnn K.; Cook, Mark E.; Porter, Warren P.; Eghbalnia, Hamid R.; Markley, John L.; Lindheim, Steven R.; Schoeller, Dale A.; Abbott, David H.; Assadi-Porter, Fariba M.

    2014-01-01

    Polycystic ovary syndrome (PCOS), a common female endocrinopathy, is a complex metabolic syndrome of enhanced weight gain. The goal of this pilot study was to evaluate metabolic differences between normal (n=10) and PCOS (n=10) women via breath carbon isotope ratio, urinary nitrogen and nuclear magnetic resonance (NMR)-determined serum metabolites. Breath carbon stable isotopes measured by cavity ring down spectroscopy (CRDS) indicated diminished (p

  7. Examining the Interplay Among Family, Culture, and Latina Teen Suicidal Behavior

    OpenAIRE

    Gulbas, Lauren E.; Zayas, Luis H.

    2014-01-01

    In this article, we explored the relationships among culture, family, and attempted suicide by U.S. Latinas. We analyzed qualitative interviews conducted with Latina teen suicide attempters (n = 10) and their parents. We also incorporated data collected from adolescents with no reported history of self-harm (n = 10) and their parents to examine why some individuals turned to suicide under similar experiences of cultural conflict. Our results revealed that Latina teens who attempted suicide la...

  8. Effect of aquatic dual-task training on balance and gait in stroke patients

    OpenAIRE

    Kim, Kyoung; Lee, Dong-Kyu; Kim, Eun-Kyung

    2016-01-01

    [Purpose] The purpose of this study was to determine the effect of aquatic dual-task training on balance and gait in stroke patients. [Subjects and Methods] Twenty stroke patients were divided into the experimental (n=10) and control (n=10) groups. Both groups underwent neurodevelopmental treatment. The experimental group additionally underwent aquatic dual-task training for 30 minutes a day, 5 days a week, for 6 weeks. Balance was measured using the Berg balance scale, Five Times Sit-to Stan...

  9. Effects of aquatic PNF lower extremity patterns on balance and ADL of stroke patients

    OpenAIRE

    Kim, Eun-Kyung; Lee, Dong-Kyu; Kim, Young-Mi

    2015-01-01

    [Purpose] This study investigated the effect of aquatic proprioceptive neuromuscular facilitation (PNF) patterns in the lower extremity on balance and activities of daily living (ADL) in stroke patients. [Subjects] Twenty poststroke participants were randomly assigned to an experimental group (n = 10) or a control group (n = 10). The experimental group performed lower extremity patterns in an aquatic environment, and the control group performed lower extremity patterns on the ground. Both exe...

  10. checkCIF/PLATON report Datablock: complex1

    Indian Academy of Sciences (India)

    Moiety formula C16 H20 N10 O8 U, 2(H2 O) C16 H20 N10 O8 U, 2(H2 O) ... PLAT250_ALERT_2_C Large U3/U1 Ratio for Average U(i,j) Tensor .... 2.7 ... outliers and unusual parameters, but every test has its limitations and alerts that are not ...

  11. The use of matrigel has no influence on tumor development or PET imaging in FaDu human head and neck cancer xenografts

    DEFF Research Database (Denmark)

    Fliedner, Frederikke P.; Hansen, Anders Elias; Jorgensen, Jesper T.

    2016-01-01

    Background: In preclinical research MatrixgelTM Basement Membrane Matrix (MG) is used frequently for the establishment of syngeneic and xenograft cancer models. Limited information on its influence on parameters including; tumor growth, vascularization, hypoxia and imaging characteristics....... In sub study II ten mice from each group (+MG, n = 10; -MG, n = 10) were included and tumors collected for immunohistochemistry (IHC) analysis of tumor microenvironment including; proliferation ratio, micro vessel density, average vessel area, hypoxia, nuclear density, and necrosis. Tumors for IHC were...

  12. The effects of an aerobic exercise program on the mood states of premenopausal women

    OpenAIRE

    Almudena Ramírez Balas; Rafael Timón Andrada; Guillermo J. Olcina Camacho; Diego Muñoz Marín; María Concepción Robles Gil; Marcos Maynar Mariño

    2012-01-01

    The relationship between physical activity and psychological health has been stated in recent investigations. Nevertheless, most studies report the physical health benefits, but not the benefits on mood states. Therefore, this research tries to observe the changes on parameters of mood in premenopausal women after an aerobic training. The study included 20 premenopausal women, separated into two groups: younger than 35 years (n = 10) and over 35 years (n = 10). The experimental subjects under...

  13. Doppler Radar and Cloud-to-Ground Lightning Observations of a Severe Outbreak of Tropical Cyclone Tornadoes

    Science.gov (United States)

    McCaul, Eugene W., Jr.; Buechler, Dennis; Cammarata, Michael; Arnold, James E. (Technical Monitor)

    2002-01-01

    Data from a single WSR-88D Doppler radar and the National Lightning Detection Network are used to examine the characteristics of the convective storms that produced a severe tornado outbreak within Tropical Storm Beryl's remnants on 16 August 1994. Comparison of the radar data with reports of tornadoes suggests that only 12 cells produced the 29 tornadoes that were documented in Georgia and the Carolinas on that date. Six of these cells spawned multiple tornadoes, and the radar data confirm the presence of miniature supercells. One of the cells was identifiable on radar for 11 hours, spawning tornadoes over a time period spanning approximately 6.5 hours. Time-height analyses of the three strongest supercells are presented in order to document storm kinematic structure and evolution. These Beryl mini-supercells were comparable in radar-observed intensity but much more persistent than other tropical cyclone-spawned tornadic cells documented thus far with Doppler radars. Cloud-to-ground lightning data are also examined for all the tornadic cells in this severe swarm-type tornado outbreak. These data show many of the characteristics of previously reported heavy-precipitation supercells. Lightning rates were weak to moderate, even in the more intense supercells, and in all the storms the lightning flashes were almost entirely negative in polarity. No lightning at all was detected in some of the single-tornado storms. In the stronger cells, there is some evidence that lightning rates can decrease during tornadogenesis, as has been documented before in some midlatitude tornadic storms. A number of the storms spawned tornadoes just after producing their final cloud-to-ground lightning flashes. These findings suggest possible benefits from implementation of observing systems capable of monitoring intracloud as well as cloud-to-ground lightning activity.

  14. Acquisition Of Rainfall Dataset And The Application For The Automatic Harvester In The Chesapeake Bay Region

    Science.gov (United States)

    Choi, Y.; Piasecki, M.

    2008-12-01

    The objective of this study is the preparation and indexing of rainfall data products for ingestion into the Chesapeake Bay Environmental Observatory (CBEO) node of the CUAHSI/WATERs network. Rainfall products (which are obtained and then processed based on the WSR-88D NEXRAD network) are obtained from the NOAA/NWS Advanced Hydrologic Prediction Service that combines the Multi-sensor Precipitation Estimate (MPE) data generated by the Regional River Forecast Centers and Hydro-NEXRAD rainfall data generated as a service by the University of Iowa. The former is collected on 4*4 km grid (HRAP) with a daily average temporal resolution and the latter on a 1minute*1minute degree grid with hourly values. We have generated a cut-out for the Chesapeake Bay Basin that contains about 9,300 nodes (sites) for the MPE data and about 300,000 nodes (sites) for the Hydro-NEXRAD product. Automated harvesting services have been implemented for both data products. The MPE data is harvested from its download site using ArcGIS which in turn is used to extract the data for the Chesapeake Bay watershed before a scripting program is used to scatter the data into the ODM. The Hydro-NEXRAD is downloaded from a web-based system at the University of Iowa which permits downloads for large scale watersheds organized by Hydraulic Unit Codes (HUC). The resulting ASCII is then automatically parsed and the information stored alongside the MPE data. The two data products stored side-by-side then allows a comparison between them addressing the accuracy and agreement between the methods used to arrive at rainfall data as both use the raw reflectivity data from the WSD-88D system.

  15. Microphysical Structures of Hurricane Irma Observed by Polarimetric Radar

    Science.gov (United States)

    Didlake, A. C.; Kumjian, M. R.

    2017-12-01

    This study examines dual-polarization radar observations of Hurricane Irma as its center passed near the WSR-88D radar in Puerto Rico, capturing needed microphysical information of a mature tropical cyclone. Twenty hours of observations continuously sampled the inner core precipitation features. These data were analyzed by annuli and azimuth, providing a bulk characterization of the primary eyewall, secondary eyewall, and rainbands as they varied around the storm. Polarimetric radar variables displayed distinct signatures of convective and stratiform precipitation in the primary eyewall and rainbands that were organized in a manner consistent with the expected kinematic asymmetry of a storm in weak environmental wind shear but with moderate low-level storm-relative flow. In the front quadrants of the primary eyewall, vertical profiles of differential reflectivity (ZDR) exhibit increasing values with decreasing height consistent with convective precipitation processes. In particular, the front-right quadrant exhibits a signature in reflectivity (ZH) and ZDR indicating larger, sparser drops, which is consistent with a stronger updraft present in this quadrant. In the rear quadrants, a sharply peaked ZDR maximum occurs within the melting layer, which is attributed of stratiform processes. In the rainbands, the convective to stratiform transition can be seen traveling from the front-right to the front-left quadrant. The front-right quadrant exhibits lower co-polar correlation coefficient (ρHV) values in the 3-8 km altitude layer, suggesting larger vertical spreading of various hydrometeors that occurs in convective vertical motions. The front-left quadrant exhibits larger ρHV values, suggesting less diversity of hydrometeor shapes, consistent with stratiform processes. The secondary eyewall did not exhibit a clear signature of processes preferred in a specific quadrant, and a temporal analysis of the secondary eyewall revealed a complex evolution of its structure

  16. Satellite passive microwave rain rate measurement over croplands during spring, summer and fall

    International Nuclear Information System (INIS)

    Spencer, R.W.

    1984-01-01

    Rain rate algorithms for spring, summer and fall that have been developed from comparisons between the brightness temperatures measured by the Nimbus-7 Scanning Multichannel Microwave Radiometer (SMMR) and rain rates derived from operational WSR-57 radars over land are described. Data were utilized from a total of 25 SMMR passes and 234 radars, resulting in ∼12 000 observations of ∼1600 km 2 areas. Multiple correlation coefficients of 0.63, 0.80 and 0.75 are achieved for the spring, summer and fall algorithms, respectively. Most of this information is in the form of multifrequency contrast in brightness temperature, which is interpreted as a measurement of the degree to which the land-emitted radiation is attenuated by the rain systems. The SMMR 37 GHz channel has more information on rain rate than any other channel. By combining the lower frequency channels with the 37 GHz observations, variations in land and precipitation thermometric temperatures can be removed, leaving rain attenuation as the major effect on brightness temperature. Polarization screening at 37 GHz is found to be sufficient to screen out cases of wet ground, which is only important when the ground is relatively vegetation free. Heavy rain cases are found to be a significant part of the algorithms' success, because of the strong microwave signatures (low brightness temperatures) that result from the presence of precipitation-sized ice in the upper portions of heavily precipitating storms. If IR data are combined with the summer microwave data, an improved (0.85) correlation with radar rain rates is achieved

  17. Measurements of DSD Second Moment Based on Laser Extinction

    Science.gov (United States)

    Lane, John E.; Jones, Linwood; Kasparis, Takis C.; Metzger, Philip

    2013-01-01

    Using a technique recently developed for estimating the density of surface dust dispersed during a rocket landing, measuring the extinction of a laser passing through rain (or dust in the rocket case) yields an estimate of the 2nd moment of the particle cloud, and rainfall drop size distribution (DSD) in the terrestrial meteorological case. With the exception of disdrometers, instruments that measure rainfall make in direct measurements of the DSD. Most common of these instruments are the rainfall rate gauge measuring the 1 1/3 th moment, (when using a D(exp 2/3) dependency on terminal velocity). Instruments that scatter microwaves off of hydrometeors, such as the WSR-880, vertical wind profilers, and microwave disdrometers, measure the 6th moment of the DSD. By projecting a laser onto a target, changes in brightness of the laser spot against the target background during rain, yield a measurement of the DSD 2nd moment, using the Beer-Lambert law. In order to detect the laser attenuation within the 8-bit resolution of most camera image arrays, a minimum path length is required, depending on the intensity of the rainfall rate. For moderate to heavy rainfall, a laser path length of 100 m is sufficient to measure variations in optical extinction using a digital camera. A photo-detector could replace the camera, for automated installations. In order to spatially correlate the 2nd moment measurements to a collocated disdrometer or tipping bucket, the laser's beam path can be reflected multiple times using mirrors to restrict the spatial extent of the measurement. In cases where a disdrometer is not available, complete DSD estimates can be produced by parametric fitting of DSD model to the 2nd moment data in conjunction with tipping bucket data. In cases where a disdrometer is collocated, the laser extinction technique may yield a significant improvement to insitu disdrometer validation and calibration strategies

  18. Dual-Polarimetric Radar-Based Tornado Debris Paths Associated with EF-4 and EF-5 Tornadoes over Northern Alabama During the Historic Outbreak of 27 April 2011

    Science.gov (United States)

    Carey, Lawrence D.; Schultz, Chrstopher J.; Schultz, Elise V.; Petersen, Walter A.; Gatlin, Patrick N.; Knupp, Kevin R.; Molthan, Andrew L.; Jedlovec, Gary J.; Darden, Christopher B.

    2012-01-01

    An historic tornado and severe weather outbreak devastated much of the southeastern United States between 25 and 28 April 2011. On 27 April 2011, northern Alabama was particularly hard hit by a large number of tornadoes, including several that reached EF-4 and EF-5 on the Enhanced Fujita damage scale. In northern Alabama alone, there were approximately 100 fatalities and hundreds of more people who were injured or lost their homes during the havoc caused by these violent tornadic storms. Two long-track and violent (EF-4 and EF-5) tornadoes occurred within range of the University of Alabama in Huntsville (UAHuntsville) Advanced Radar for Meteorological and Operational Research (ARMOR, C-band dual-polarimetric). A unique capability of dual-polarimetric radar is the near-real time identification of lofted debris associated with ongoing tornadoes on the ground. The focus of this paper is to analyze the dual-polarimetric radar-inferred tornado debris signatures and identify the associated debris paths of the long-track EF-4 and EF-5 tornadoes near ARMOR. The relative locations of the debris and damage paths for each tornado will be ascertained by careful comparison of the ARMOR analysis with NASA MODIS (Moderate Resolution Imaging Spectroradiometer) and ASTER (Advanced Spaceborne Thermal Emission and Reflection Radiometer) satellite imagery of the tornado damage scenes and the National Weather Service tornado damage surveys. With the ongoing upgrade of the WSR-88D (Weather Surveillance Radar 1988 Doppler) operational network to dual-polarimetry and a similar process having already taken place or ongoing for many private sector radars, dual-polarimetric radar signatures of tornado debris promise the potential to assist in the situational awareness of government and private sector forecasters and emergency managers during tornadic events. As such, a companion abstract (Schultz et al.) also submitted to this conference explores The use of dual-polarimetric tornadic debris

  19. Weather and eared grebe winter migration near the Great Salt Lake, Utah

    Science.gov (United States)

    Williams, Augusta A.; Laird, Neil F.

    2018-03-01

    This study provides insight from the use of weather radar observations to understand the characteristics of the eared grebe migration near the Great Salt Lake (GSL) and provides unique information on weather conditions connected to these migration events. Doppler weather radar measurements from the Salt Lake City, Utah WSR-88D radar site (KMTX), along with meteorological surface and rawinsonde data, were used to identify and examine 281 eared grebe migration events across 15 winters from 1997/1998 through 2011/2012. An average of about 19 migration events occurred each winter with considerable interannual variability, as well as large variance in the spatial area and number of birds departing the GSL during each event. The migration events typically occurred during clear sky conditions in the presence of surface high pressure and colder than average surface temperatures. Migration events began 55 min after sunset, on average across the winter seasons, and in one case we demonstrate that an extended, nonstop flight was initiated of the departing eared grebes to northern Mexico. Eared grebes leaving the GSL largely flew above the freezing level with a mean northerly tailwind at flight altitude of 3.1 m s-1 and a westerly, cross-flight wind of 5.0 m s-1 while having an average flight speed at cruising altitude of 16.9 m s-1, or 61 km h-1. In addition to determining the variability of meteorological conditions during migration events across the 15 winters, atmospheric conditions during the largest migration event observed are presented and discussed.

  20. Comparison Of Quantitative Precipitation Estimates Derived From Rain Gauge And Radar Derived Algorithms For Operational Flash Flood Support.

    Science.gov (United States)

    Streubel, D. P.; Kodama, K.

    2014-12-01

    To provide continuous flash flood situational awareness and to better differentiate severity of ongoing individual precipitation events, the National Weather Service Research Distributed Hydrologic Model (RDHM) is being implemented over Hawaii and Alaska. In the implementation process of RDHM, three gridded precipitation analyses are used as forcing. The first analysis is a radar only precipitation estimate derived from WSR-88D digital hybrid reflectivity, a Z-R relationship and aggregated into an hourly ¼ HRAP grid. The second analysis is derived from a rain gauge network and interpolated into an hourly ¼ HRAP grid using PRISM climatology. The third analysis is derived from a rain gauge network where rain gauges are assigned static pre-determined weights to derive a uniform mean areal precipitation that is applied over a catchment on a ¼ HRAP grid. To assess the effect of different QPE analyses on the accuracy of RDHM simulations and to potentially identify a preferred analysis for operational use, each QPE was used to force RDHM to simulate stream flow for 20 USGS peak flow events. An evaluation of the RDHM simulations was focused on peak flow magnitude, peak flow timing, and event volume accuracy to be most relevant for operational use. Results showed RDHM simulations based on the observed rain gauge amounts were more accurate in simulating peak flow magnitude and event volume relative to the radar derived analysis. However this result was not consistent for all 20 events nor was it consistent for a few of the rainfall events where an annual peak flow was recorded at more than one USGS gage. Implications of this indicate that a more robust QPE forcing with the inclusion of uncertainty derived from the three analyses may provide a better input for simulating extreme peak flow events.

  1. Promiscuity is related to masculine and feminine body traits in both men and women: evidence from Brazilian and Czech samples.

    Science.gov (United States)

    Varella, Marco Antonio Correa; Valentova, Jaroslava Varella; Pereira, Kamila Janaina; Bussab, Vera Silvia Raad

    2014-11-01

    One of the possible explanations for human within-sex variation in promiscuity stems from conditional strategies dependent on the level of body sex-dimorphism. There is some evidence that masculine men and feminine women are more promiscuous than their sex-atypical counterparts, although mixed results persist. Moreover, another line of evidence shows that more promiscuous women are rather sex-atypical. We tested whether diverse sex-dimorphic body measures (2D:4D, WHR/WSR, handgrip strength, and height and weight) influence sociosexual desires, attitudes, promiscuous behavior, and age of first intercourse in a sex-typical or sex-atypical direction. Participants were 185 young adults, 51 men and 54 women from Brazil, and 40 men and 40 women from the Czech Republic. In men stronger handgrip and more feminine 2D:4D predicted higher sociosexual behaviors, desires, and lower age of the first sexual intercourse. While in women, sociosexual desires were predicted by lower handgrip strength and more feminine 2D:4D. It thus seems that it is rather a mixture of masculine and feminine traits in men, and feminine traits in women that increase their sociosexuality. Masculine traits (height) predicting female promiscuous behavior were specific for only one population. In conclusion, a mosaic combination of sex-typical but also sex-atypical independent body traits can lead to higher promiscuity, particularly in men. Limitations, implications, and future directions for research are considered. This article is part of a Special Issue entitled: Neotropical Behaviour. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. Should providers encourage realistic weight expectations and satisfaction with lost weight in commercial weight loss programs? a preliminary study.

    Science.gov (United States)

    Ames, Gretchen E; Thomas, Colleen S; Patel, Roshni H; McMullen, Jillian S; Lutes, Lesley D

    2014-01-01

    Attrition is a problem among patients who participate in commercial weight loss programs. One possible explanation is that if patients are unable to reach a weight that they expect to achieve, they may be more likely to drop out of treatment. This study investigated variables associated with attrition among 30 obese patients who completed a liquid meal replacement program (LMR) and enrolled in a 52-week Small Changes Maintenance intervention (SCM). Patients lost a median 18% of body weight during LMR and completed assessments about weight expectations and weight satisfaction pre- and post-SCM. Of the 30 patients who started SCM, 8 (27%) were lost to attrition. Odds of SCM attrition were higher in patients who lost ≤ 18.2% of pre-LMR weight (OR: 12.25, P = 0.035), had lower satisfaction (≤7) pre-SCM (OR: 10.11, P = 0.040), and who expected further weight loss of 9.1 kg or more pre-SCM (OR: 10.11, P = 0.040). SCM completers significantly increased weight loss expectations by a median of 2.3 kg from pre-SCM to post-SCM (WSR P = 0.049) that paralleled weight regained post-SCM (2.7 kg). After completion of a medically-supervised commercial weight loss program, patients with the greatest expectations for further weight loss and the lowest weight satisfaction were more likely to drop out of SCM. Failure to participate in maintenance treatment may lead to regain of greater than half of lost weight over the next year. Among SCM completers, lower expectations for further weight loss and greater weight satisfaction appeared to be associated with continued engagement in maintenance treatment.

  3. A Machine Learning-based Rainfall System for GPM Dual-frequency Radar

    Science.gov (United States)

    Tan, H.; Chandrasekar, V.; Chen, H.

    2017-12-01

    Precipitation measurement produced by the Global Precipitation Measurement (GPM) Dual-frequency Precipitation Radar (DPR) plays an important role in researching the water circle and forecasting extreme weather event. Compare with its predecessor - Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR), GRM DPR measures precipitation in two different frequencies (i.e., Ku and Ka band), which can provide detailed information on the microphysical properties of precipitation particles, quantify particle size distribution and quantitatively measure light rain and falling snow. This paper presents a novel Machine Learning system for ground-based and space borne radar rainfall estimation. The system first trains ground radar data for rainfall estimation using rainfall measurements from gauges and subsequently uses the ground radar based rainfall estimates to train GPM DPR data in order to get space based rainfall product. Therein, data alignment between space DPR and ground radar is conducted using the methodology proposed by Bolen and Chandrasekar (2013), which can minimize the effects of potential geometric distortion of GPM DPR observations. For demonstration purposes, rainfall measurements from three rain gauge networks near Melbourne, Florida, are used for training and validation purposes. These three gauge networks, which are located in Kennedy Space Center (KSC), South Florida Water Management District (SFL), and St. Johns Water Management District (STJ), include 33, 46, and 99 rain gauge stations, respectively. Collocated ground radar observations from the National Weather Service (NWS) Weather Surveillance Radar - 1988 Doppler (WSR-88D) in Melbourne (i.e., KMLB radar) are trained with the gauge measurements. The trained model is then used to derive KMLB radar based rainfall product, which is used to train GPM DPR data collected from coincident overpasses events. The machine learning based rainfall product is compared against the GPM standard products

  4. Random Forest Application for NEXRAD Radar Data Quality Control

    Science.gov (United States)

    Keem, M.; Seo, B. C.; Krajewski, W. F.

    2017-12-01

    Identification and elimination of non-meteorological radar echoes (e.g., returns from ground, wind turbines, and biological targets) are the basic data quality control steps before radar data use in quantitative applications (e.g., precipitation estimation). Although WSR-88Ds' recent upgrade to dual-polarization has enhanced this quality control and echo classification, there are still challenges to detect some non-meteorological echoes that show precipitation-like characteristics (e.g., wind turbine or anomalous propagation clutter embedded in rain). With this in mind, a new quality control method using Random Forest is proposed in this study. This classification algorithm is known to produce reliable results with less uncertainty. The method introduces randomness into sampling and feature selections and integrates consequent multiple decision trees. The multidimensional structure of the trees can characterize the statistical interactions of involved multiple features in complex situations. The authors explore the performance of Random Forest method for NEXRAD radar data quality control. Training datasets are selected using several clear cases of precipitation and non-precipitation (but with some non-meteorological echoes). The model is structured using available candidate features (from the NEXRAD data) such as horizontal reflectivity, differential reflectivity, differential phase shift, copolar correlation coefficient, and their horizontal textures (e.g., local standard deviation). The influence of each feature on classification results are quantified by variable importance measures that are automatically estimated by the Random Forest algorithm. Therefore, the number and types of features in the final forest can be examined based on the classification accuracy. The authors demonstrate the capability of the proposed approach using several cases ranging from distinct to complex rain/no-rain events and compare the performance with the existing algorithms (e

  5. Weather and eared grebe winter migration near the Great Salt Lake, Utah.

    Science.gov (United States)

    Williams, Augusta A; Laird, Neil F

    2018-03-01

    This study provides insight from the use of weather radar observations to understand the characteristics of the eared grebe migration near the Great Salt Lake (GSL) and provides unique information on weather conditions connected to these migration events. Doppler weather radar measurements from the Salt Lake City, Utah WSR-88D radar site (KMTX), along with meteorological surface and rawinsonde data, were used to identify and examine 281 eared grebe migration events across 15 winters from 1997/1998 through 2011/2012. An average of about 19 migration events occurred each winter with considerable interannual variability, as well as large variance in the spatial area and number of birds departing the GSL during each event. The migration events typically occurred during clear sky conditions in the presence of surface high pressure and colder than average surface temperatures. Migration events began 55 min after sunset, on average across the winter seasons, and in one case we demonstrate that an extended, nonstop flight was initiated of the departing eared grebes to northern Mexico. Eared grebes leaving the GSL largely flew above the freezing level with a mean northerly tailwind at flight altitude of 3.1 m s -1 and a westerly, cross-flight wind of 5.0 m s -1 while having an average flight speed at cruising altitude of 16.9 m s -1 , or 61 km h -1 . In addition to determining the variability of meteorological conditions during migration events across the 15 winters, atmospheric conditions during the largest migration event observed are presented and discussed.

  6. CSU-CHILL Polarimetric Radar Measurements from a Severe Hail Storm in Eastern Colorado.

    Science.gov (United States)

    Hubbert, J.; Bringi, V. N.; Carey, L. D.; Bolen, S.

    1998-08-01

    Polarimetric radar measurements made by the recently upgraded CSU-CHILL radar system in a severe hailstorm are analyzed permitting for the first time the combined use of Zh, ZDR, linear depolarization ratio (LDR), KDP, and h to infer hydrometeor types. A chase van equipped for manual collection of hail, and instrumented with a rain gauge, intercepted the storm core for 50 min. The period of golfball-sized hail is easily distinguished by high LDR (greater than or equal to 18 dB), negative ZDR (less than or equal to 0.5 dB), and low h (less than or equal to 0.93) values near the surface. Rainfall accumulation over the entire event (about 40 mm) estimated using KDP is in excellent agreement with the rain gauge measurement. Limited dual-Doppler synthesis using the CSU-CHILL and Denver WSR-88D radars permit estimates of the horizontal convergence at altitudes less than 3 km above ground level (AGL) at 1747 and 1812 mountain daylight time (MDT). Locations of peak horizontal convergence at these times are centered on well-defined positive ZDR columns. Vertical sections of multiparameter radar data at 1812 MDT are interpreted in terms of hydrometeor type. In particular, an enhanced LDR `cap' area on top of the the positive ZDR column is interpreted as a region of mixed phase with large drops mixed with partially frozen and frozen hydrometeors. A positive KDP column on the the western fringe of the main updraft is inferred to be the result of drops (1-2 mm) shed by wet hailstones. Swaths of large hail at the surface (inferred from LDR signatures) and positive ZDR at 3.5 km AGL suggest that potential frozen drop embryos are favorably located for growth into large hailstones. Thin section analysis of a sample of the large hailstones shows that 30%-40% have frozen drop embryos.

  7. Combined VLF and VHF lightning observations of Hurricane Rita landfall

    Science.gov (United States)

    Henderson, B. G.; Suszcynsky, D. M.; Wiens, K. C.; Hamlin, T.; Jeffery, C. A.; Orville, R. E.

    2009-12-01

    Hurricane Rita displayed abundant lightning in its northern eyewall as it made landfall at 0740 UTC 24 Sep 2005 near the Texas/Louisiana border. For this work, we combined VHF and VLF lightning data from Hurricane Rita, along with radar observations from Gulf Coast WSR-88D stations, for the purpose of demonstrating the combined utility of these two spectral regions for hurricane lightning monitoring. Lightning is a direct consequence of the electrification and breakdown processes that take place during the convective stages of thunderstorm development. As Rita approached the Gulf coast, the VHF lightning emissions were distinctly periodic with a period of 1.5 to 2 hours, which is consistent with the rotational period of hurricanes. VLF lightning emissions, measured by LASA and NLDN, were present in some of these VHF bursts but not all of them. At landfall, there was a significant increase in lightning emissions, accompanied by a significant convective surge observed in radar. Furthermore, VLF and VHF lightning source heights clearly increase as a function of time. The evolution of the IC/CG ratio is consistent with that seen in thunderstorms, showing a dominance of IC activity during storm development, followed by an increase in CG activity at the storm’s peak. The periodic VHF lightning events are correlated with increases in convective growth (quantified by the volume of radar echo >40 dB) above 7 km altitude. VLF can discriminate between lightning types, and in the LASA data, Rita landfall lightning activity was dominated by Narrow Bi-polar Events (NBEs)—high-energy, high-altitude, compact intra-cloud discharges. The opportunity to locate NBE lightning sources in altitude may be particularly useful in quantifying the vertical extent (strength) of the convective development and in possibly deducing vertical charge distributions.

  8. Merging Radar Quantitative Precipitation Estimates (QPEs) from the High-resolution NEXRAD Reanalysis over CONUS with Rain-gauge Observations

    Science.gov (United States)

    Prat, O. P.; Nelson, B. R.; Stevens, S. E.; Nickl, E.; Seo, D. J.; Kim, B.; Zhang, J.; Qi, Y.

    2015-12-01

    The processing of radar-only precipitation via the reanalysis from the National Mosaic and Multi-Sensor Quantitative (NMQ/Q2) based on the WSR-88D Next-generation Radar (Nexrad) network over the Continental United States (CONUS) is completed for the period covering from 2002 to 2011. While this constitutes a unique opportunity to study precipitation processes at higher resolution than conventionally possible (1-km, 5-min), the long-term radar-only product needs to be merged with in-situ information in order to be suitable for hydrological, meteorological and climatological applications. The radar-gauge merging is performed by using rain gauge information at daily (Global Historical Climatology Network-Daily: GHCN-D), hourly (Hydrometeorological Automated Data System: HADS), and 5-min (Automated Surface Observing Systems: ASOS; Climate Reference Network: CRN) resolution. The challenges related to incorporating differing resolution and quality networks to generate long-term large-scale gridded estimates of precipitation are enormous. In that perspective, we are implementing techniques for merging the rain gauge datasets and the radar-only estimates such as Inverse Distance Weighting (IDW), Simple Kriging (SK), Ordinary Kriging (OK), and Conditional Bias-Penalized Kriging (CBPK). An evaluation of the different radar-gauge merging techniques is presented and we provide an estimate of uncertainty for the gridded estimates. In addition, comparisons with a suite of lower resolution QPEs derived from ground based radar measurements (Stage IV) are provided in order to give a detailed picture of the improvements and remaining challenges.

  9. Understanding the addiction cycle: a complex biology with distinct contributions of genotype vs. sex at each stage.

    Science.gov (United States)

    Wilhelm, C J; Hashimoto, J G; Roberts, M L; Sonmez, M K; Wiren, K M

    2014-10-24

    Ethanol abuse can lead to addiction, brain damage and premature death. The cycle of alcohol addiction has been described as a composite consisting of three stages: intoxication, withdrawal and craving/abstinence. There is evidence for contributions of both genotype and sex to alcoholism, but an understanding of the biological underpinnings is limited. Utilizing both sexes of genetic animal models with highly divergent alcohol withdrawal severity, Withdrawal Seizure-Resistant (WSR) and Withdrawal Seizure-Prone (WSP) mice, the distinct contributions of genotype/phenotype and of sex during addiction stages on neuroadaptation were characterized. Transcriptional profiling was performed to identify expression changes as a consequence of chronic intoxication in the medial prefrontal cortex. Significant expression differences were identified on a single platform and tracked over a behaviorally relevant time course that covered each stage of alcohol addiction; i.e., after chronic intoxication, during peak withdrawal, and after a defined period of abstinence. Females were more sensitive to ethanol with higher fold expression differences. Bioinformatics showed a strong effect of sex on the data structure of expression profiles during chronic intoxication and at peak withdrawal irrespective of genetic background. However, during abstinence, differences were observed instead between the lines/phenotypes irrespective of sex. Confirmation of identified pathways showed distinct inflammatory signaling following intoxication at peak withdrawal, with a pro-inflammatory phenotype in females but overall suppression of immune signaling in males. Combined, these results suggest that each stage of the addiction cycle is influenced differentially by sex vs. genetic background and support the development of stage- and sex-specific therapies for alcohol withdrawal and the maintenance of sobriety. Published by Elsevier Ltd.

  10. Improving Satellite Quantitative Precipitation Estimation Using GOES-Retrieved Cloud Optical Depth

    Energy Technology Data Exchange (ETDEWEB)

    Stenz, Ronald; Dong, Xiquan; Xi, Baike; Feng, Zhe; Kuligowski, Robert J.

    2016-02-01

    To address significant gaps in ground-based radar coverage and rain gauge networks in the U.S., geostationary satellite quantitative precipitation estimates (QPEs) such as the Self-Calibrating Multivariate Precipitation Retrievals (SCaMPR) can be used to fill in both the spatial and temporal gaps of ground-based measurements. Additionally, with the launch of GOES-R, the temporal resolution of satellite QPEs may be comparable to that of Weather Service Radar-1988 Doppler (WSR-88D) volume scans as GOES images will be available every five minutes. However, while satellite QPEs have strengths in spatial coverage and temporal resolution, they face limitations particularly during convective events. Deep Convective Systems (DCSs) have large cloud shields with similar brightness temperatures (BTs) over nearly the entire system, but widely varying precipitation rates beneath these clouds. Geostationary satellite QPEs relying on the indirect relationship between BTs and precipitation rates often suffer from large errors because anvil regions (little/no precipitation) cannot be distinguished from rain-cores (heavy precipitation) using only BTs. However, a combination of BTs and optical depth (τ) has been found to reduce overestimates of precipitation in anvil regions (Stenz et al. 2014). A new rain mask algorithm incorporating both τ and BTs has been developed, and its application to the existing SCaMPR algorithm was evaluated. The performance of the modified SCaMPR was evaluated using traditional skill scores and a more detailed analysis of performance in individual DCS components by utilizing the Feng et al. (2012) classification algorithm. SCaMPR estimates with the new rain mask applied benefited from significantly reduced overestimates of precipitation in anvil regions and overall improvements in skill scores.

  11. Polarimetric Radar Retrievals in Southeast Texas During Hurricane Harvey

    Science.gov (United States)

    Wolff, D. B.; Petersen, W. A.; Tokay, A.; Marks, D. A.; Pippitt, J. L.; Kirstetter, P. E.

    2017-12-01

    Hurricane Harvey hit the Texas Gulf Coast as a major hurricane on August 25, 2017 before exiting the state as a tropical storm on September 1, 2017. In its wake, it left a flood of historic proportions, with some areas measuring 60 inches of rain over a five-day period. Although the storm center stayed west of the immediate Houston area training bands of precipitation impacted the Houston area for five full days. The National Weather Service (NWS) WSR88D dual-polarimetric radar (KHGX), located southeast of Houston, maintained operations for the entirety of the event. The Harris County Flood Warning System (HCFWS) had 150 rain gauges deployed in its network and seven NWS Automated Surface Observing Systems (ASOS) rain gauges are also located in the area. In this study, we used the full radar data set to retrieve daily and event-total precipitation estimates within 120 km of the KHGX radar for the period August 25-29, 2017. These estimates were then compared to the HCFWS and ASOS gauges. Three different polarimetric hybrid rainfall retrievals were used: Ciffeli et al. 2011; Bringi et al. 2004; and, Chen et al. 2017. Each of these hybrid retrievals have demonstrated robust performance in the past. However, both daily and event-total comparisons from each of these retrievals compared to those of HCFWS and ASOS rain gauge networks resulted in significant underestimates by the radar retrievals. These radar underestimates are concerning. Sources of error and variance will be investigated to understand the source of radar-gauge disagreement. One current hypothesis is that due to the large number of small drops often found in hurricanes, the differential reflectivity and specific differential phase are relatively small so that the hybrid algorithms use only the reflectivity/rain rate procedure (so called Z-R relationships), and hence rarely invoke the ZDR or KDP procedures. Thus, an alternative Z-R relationship must be invoked to retrieve accurate rain rate estimates.

  12. Regulation and Guidance for the Geological Disposal of Radioactive Waste. Review of the Literature and Initiatives of the Past Decade

    International Nuclear Information System (INIS)

    2010-01-01

    In January 1997, the NEA workshop 'Regulating the Long-term Safety of Radioactive Waste Disposal' (the 'Cordoba workshop') provided an important reference point for regulatory issues in the field of geological disposal of radioactive waste. These issues included regulatory frameworks at the national and international levels, the understanding of what is meant by demonstrating regulatory compliance, and approaches to an appropriate regulatory process. In the intervening years many international and national developments have taken place. A follow-up workshop was organised in Tokyo in January 2009 to take stock of progress, with a draft providing an overview of the development of regulation and guidance at both national and international levels, on international and multi-national initiatives for developing recommendations and common views on regulatory issues, as well as an overview of the experience of regulatory review of some of the safety studies produced during the last decade. This paper reviews the evolution of these initiatives and issues over the past decade or so focusing on the major areas addressed in Cordoba, notably: international developments in regulation (IRCP recommendations, IAEA Safety Standards, developments at the NEA), radioactive waste disposal criteria (risk/dose criteria for protection of human beings, protection of the environment, timescales), performance assessment trends (General development of performance assessment/safety case, further technical, scientific and methodical aspects), the conduct of the regulatory process (technical review process, non-technical aspects and their impact). With regard to regulatory development at the international level, the Safety Requirements WS-R-4 'Geological Disposal of Radioactive Waste' (issued in 2006 and jointly sponsored by the IAEA and the NEA) is addressed in particular

  13. The effect of intense intermittent training with and without taking vitamin E on mRNA expression of p53/PTEN tumor suppressing genes in prostate glands of male rats

    Directory of Open Access Journals (Sweden)

    Mohammad Esmaeil Afzalpour

    2016-11-01

    Full Text Available Physical activity and diet are the most important modifiable determinants of cancer risk. The objective of this study was to examine the effect of intense intermittent training with and without taking vitamin E on expression of p53 and PTEN tumor suppressing genes in the prostate gland of male rats. For this purpose, 50 Sprague-Dawley male rats were randomly assigned into 5 groups: [1] control (CON, n = 10, [2] sham (S, n = 10, [3] intense intermittent training (IIT, n = 10, [4] intense intermittent training + vitamin E (IIT + VE, n = 10, [5] vitamin E (VE, n = 10. Protocol of this study was implemented for 6 days per week for 6 weeks, with observing the overload principle on the motorized treadmill. After implementing training protocol, expression rate of p53 and PTEN genes reduced significantly (p<0.000, p<0.031, respectively. Taking vitamin E with intermittent training caused significant reduction in p53 expression (p<0.013, while it caused significant increase in expression of PTEN (p<0.035. These results showed that intense intermittent training reduces expression of p53 and PTEN tumor suppressing genes and taking supplementation vitamin E along with this type of training could cause different effects in expression of these tumor suppressor genes.

  14. Staphylokinase has distinct modes of interaction with antimicrobial peptides, modulating its plasminogen-activation properties

    Science.gov (United States)

    Nguyen, Leonard T.; Vogel, Hans J.

    2016-01-01

    Staphylokinase (Sak) is a plasminogen activator protein that is secreted by many Staphylococcus aureus strains. Sak also offers protection by binding and inhibiting specific antimicrobial peptides (AMPs). Here, we evaluate Sak as a more general interaction partner for AMPs. Studies with melittin, mCRAMP, tritrpticin and bovine lactoferricin indicate that the truncation of the first ten residues of Sak (SakΔN10), which occurs in vivo and uncovers important residues in a bulge region, improves its affinity for AMPs. Melittin and mCRAMP have a lower affinity for SakΔN10, and in docking studies, they bind to the N-terminal segment and bulge region of SakΔN10. By comparison, lactoferricin and tritrpticin form moderately high affinity 1:1 complexes with SakΔN10 and their cationic residues form several electrostatic interactions with the protein’s α-helix. Overall, our work identifies two distinct AMP binding surfaces on SakΔN10 whose occupation would lead to either inhibition or promotion of its plasminogen activating properties. PMID:27554435

  15. Novel vector vaccine against Brucella abortus based on influenza A viruses expressing Brucella L7/L12 or Omp16 proteins: evaluation of protection in pregnant heifers.

    Science.gov (United States)

    Tabynov, Kaissar; Yespembetov, Bolat; Sansyzbay, Abylai

    2014-10-14

    The present study provides the first information about the protection of a novel influenza viral vector vaccine expressing the Brucella proteins ribosomal L7/L12 or Omp16 containing the adjuvant Montanide Gel01 in pregnant heifers. Immunization of pregnant heifers was conducted via the conjunctival (n=10) or subcutaneous (n=10) route using cross prime and booster vaccination schedules at an interval of 28 days. The vector vaccine was evaluated in comparison with positive control groups vaccinated with Brucella abortus S19 (n=10) or B. abortus RB51 (n=10) and a negative (PBS+Montanide Gel01; n=10) control group. Via both the conjunctival or subcutaneous route, evaluation of protectiveness against abortion, effectiveness of vaccination and index of infection (in heifers and their fetuses or calves) demonstrated the vector vaccine provided good protection against B. abortus 544 infection compared to the negative control group (PBS+Montanide Gel01) and comparable protection to commercial vaccines B. abortus S19 or B. abortus RB51. Copyright © 2014 Elsevier Ltd. All rights reserved.

  16. Effect of four different opalescence tooth-whitening products on enamel microhardness.

    Science.gov (United States)

    Majeed, A; Grobler, S R; Moola, M H; Rossouw, R J; van Kotze, T J W

    2008-06-01

    The purpose was to evaluate the effect of various Opalescence tooth-whitening products on enamel. Enamel blocks were exposed to Opalescence PF 10% Carbamide Peroxide (n = 10), Opalescence PF 20% Carbamide Peroxide (n = 10), Opalescence Trèswhite Supreme 10% Hydrogen Peroxide (n = 10) and Opalescence Quick PF 45% Carbamide Peroxide (n = 10) according to the manufacturer's instructions. The control group was enamel blocks (n = 10) kept in artificial saliva. The values were obtained before exposure and after the 14-days treatment period. Enamel blocks were kept in saliva between treatments. Indent marks on enamel blocks were examined using the scanning electron microscope for treatment effects. All four different Opalescence products damaged enamel. The most damage was done when treated for a long period (112 hours). SEM images also showed damage to enamel by all 4 products. Opalescence with 10% and with 20% Carbamide Peroxide showed the highest damage, which also differed significantly (p enamel. Higher damage was done by the 10% carbamide peroxide and 20% carbamide peroxide products because of the much longer exposure period (112 hours in comparison to 7 hours).

  17. Coupling HPLC-SPE-NMR with a microplate-based high-resolution antioxidant assay for efficient analysis of antioxidants in food--validation and proof-of-concept study with caper buds.

    Science.gov (United States)

    Wiese, Stefanie; Wubshet, Sileshi G; Nielsen, John; Staerk, Dan

    2013-12-15

    This work describes the coupling of a microplate-based antioxidant assay with a hyphenated system consisting of high-performance liquid chromatography-solid-phase extraction-nuclear magnetic resonance spectroscopy, i.e., HPLC-SPE-NMR/high-resolution antioxidant assay, for the analysis of complex food extracts. The applicability of the microplate-based antioxidant assay for high-resolution screening of common food phenolics as well as parameters related to their trapping efficiency, elution behavior, and recovery on/from SPE cartridges are described. It was found that the microplate-based high-resolution antioxidant assay is an attractive and easy implementable alternative to direct on-line screening methods. Furthermore, it was shown that Resin SH and Resin GP SPE material are superior to RP C18HD for trapping of phenolic compounds. Proof-of-concept study was performed with caper bud extract, revealing the most important antioxidants to be quercetin, kaempferol, rutin, kaempferol-3-O-β-rutinoside and N(1),N(5),N(10)-triphenylpropenoyl spermidine amides. Targeted isolation of the latter, and comprehensive NMR experiments showed them to be N(1),N(10)-di-(E)-caffeoyl-N(5)-p-(E)-coumaroyl spermidine, N(1)-(E)-caffeoyl-N(5),N(10)-di-p-(E)-coumaroyl spermidine, N(10)-(E)-caffeoyl-N(1),N(5)-di-p-(E)-coumaroyl spermidine, and N(1),N(5),N(10)-tri-p-(E)-coumaroyl spermidine amides. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. Fiscal 1999 geothermal energy development promotion survey. Survey of Akinomiya area (Long-term spurt test report - 1/2); 1999 nendo chinetsu kaihatsu sokushin chosa Akinomiya chiiki chosa hokokusho. 1/2. Choki funshutsu shiken

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-01-01

    A long-term survey was conducted on the spurting properties and fluid properties of geothermal fluids, when boreholes N9-AY-3 and N10-AY-8 were used as spurting wells and N8-AY-1, N10-AY-6, and N10-AY-7 as reinjection wells. Conducted or investigated were pH, electric conductivity, chlorine concentration determination, static temperature/pressure logging, PTS (pressure, temperature, spinner flowmeter) logging with wells spurting, buildup test, sampler logging with wells spurting, fluid property survey, tracer test, and borehole N10-AY-8 pulsation with fume spurting. It was then found that the maximum spurting capacity of borehole N9-AY-3 was 65.7t/h in steam and 90.8t/h in thermal water at a pit mouth pressure of 1.30MPaG. Some decrease was detected for approximately one month after the start of spurting, but it was concluded that there would be no further decrease thereafter. The maximum spurting capacity of borehole N10-AY-8 was 10.4t/h in steam and 8.9t/h in thermal water at a pit mouth pressure of 0.24MPaG. Some reduction was detected in the flow of steam and in fluid enthalpy after the start of spurting, and it was inferred that there would be still further reduction after continual spurting. (NEDO)

  19. Safety of the novel influenza viral vector Brucella abortus vaccine in pregnant heifers

    Directory of Open Access Journals (Sweden)

    Kaissar Tabynov

    2016-01-01

    Full Text Available ABSTRACT: The present study provides the first information about the safety of a new influenza viral vector vaccine expressing the Brucella ribosomal protein L7/L12 or Omp16 containing the adjuvant Montanide Gel01 in pregnant heifers. Immunization of pregnant heifers was conducted via the conjunctival (n=10 or subcutaneous (n=10 route using cross prime and booster vaccination schedules at an interval of 28 days. The vector vaccine was evaluated in comparison with positive control groups vaccinated with B. abortus S19 (n=10 or B. abortus RB51 (n=10 and a negative (PBS+Montanide Gel01; n=10 control group. Clinical studies, thermometry, assessment of local reactogenicity and observation of abortion showed that the vector vaccine via the conjunctival or subcutaneous route was completely safe for pregnant heifers compared to the commercial vaccines B. abortus S19 or B. abortus RB51. The only single adverse event was the formation of infiltration at the site of subcutaneous injection; this reaction was not observed for the conjunctival route.

  20. Tetrahydrobiopterin restores endothelial dysfunction induced by an oral glucose challenge in healthy subjects

    DEFF Research Database (Denmark)

    Ihlemann, Nikolaj; Rask-Madsen, Christian; Perner, Anders

    2003-01-01

    (n = 10) and SNP (n = 8). On different days (6R)-5,6,7,8-tetrahydro-l-biopterin dihydrochloride (6R-BH4; n = 10), the active cofactor of eNOS or its stereoisomer (6S)-5,6,7,8-tetrahydro-l-biopterin sulfate (6S-BH4; n = 10), which is inactive as a cofactor, was added 10 min (500 microg/min) before...... and during the 1-h postchallenge serotonin dose-response study. In vitro studies showed that 6R-BH4 and 6S-BH4 were equipotent antioxidants. Serotonin response was reduced by 24 +/- 7% (at the highest dose) at 1 h postchallenge compared with fasting (P = 0.001) and was restored 2 h postchallenge...

  1. Relationship between weak central coherence and mental states understanding in children with Autism and in children with ADHD.

    Directory of Open Access Journals (Sweden)

    Pina Filippello

    2013-05-01

    Full Text Available The central coherence involves the processes of perceptual coding and attention mechanisms, highly deficient in children with ADHD (Booth & Happé, 2010. According to this theory, also children with autism are overly focused on details to the expense of a global perspective, and this negatively affects their ability to integrate environmental stimuli into a coherent whole (Happé, Booth, Charlton, Hughes, 2006. The aim of this study was to determine differences in central coherence of children with high functioning autism (ASD; n=10, children with attention-deficit hyperactivity disorder (ADHD; n=10 and typically developing peers (n=10. Individuals with ADHD exhibit significant deficits in perceptual skills and problem solving, failing also in mental states understanding tasks. While the children with autism spectrum disorder show impairments in making pragmatic inferences. Future research should therefore concentrate on the investigation of the cognitive and psychological mechanisms underlying these effects.

  2. Detection of selected trace elements in yogurt components.

    Science.gov (United States)

    Capcarova, Marcela; Harangozo, Lubos; Toth, Tomas; Schwarczova, Loretta; Bobkova, Alica; Stawarz, Robert; Guidi, Alessandra; Massanyi, Peter

    2017-12-02

    The objective of this study was to determine the concentrations of Cu, Cd, Pb, Mn, Cr, Co, Ni, Zn, and Hg in the white and fruit parts of commercially available yogurts (n = 30) from Nitra markets (Slovak Republic). The results were correlated to determine their relationships. Three yogurt fruit flavors were chosen and tested, strawberry (n = 10), blueberry (n = 10), and cherry (n = 10). The elements were analyzed using atomic absorption spectrophotometry. Higher concentrations of toxic elements, such as Cd and Pb, were found in the fruit parts of the yogurt, and in some cases, the tolerable limit was exceeded. The white part of the yogurt was not contaminated by toxic elements. White yogurt is a good source of nutrients for humans, but the fruit part in yogurt requires detailed monitoring and improvements in the processing techniques.

  3. Modificaciones histológicas del cartílago hialino a nivel de la articulación maleolar en ratas artríticas tratadas con Zea mays L (variedad morada)

    OpenAIRE

    Villalobos Pacheco, Eduardo Jesús

    2017-01-01

    Demuestra que el extracto de Zea mays L reduce las modificaciones histológicas en el cartílago hialino a nivel de la articulación maleolar en términos de la estructura, células y estado de integridad del cartílago, en ratas artríticas inducidas por pristane. Realiza un modelo de artritis en ratas Sprague Dawley inducido por pristane vía subdérmica (0.2 ml). Se distribuyeron en control positivo (n=10) vehículo (1ml/100g), Metotrexato (n=10) 0,1mg/Kg, Indometacina (n=10) 0.6 mg/kg, Zea mays 1% ...

  4. Fast form alpha-2-macroglobulin

    DEFF Research Database (Denmark)

    Biltoft, Daniel; Gram, Jørgen Brodersen; Larsen, Anette

    2017-01-01

    Objectives: Investigation of the blood compatibility requires a number of sensitive assays to quantify the activation of the blood protein cascades and cells induced by biomaterials. A global assay measuring the blood compatibility of biomaterials could be a valuable tool in such regard....... In this study, we investigated whether an enzyme-linked immunosorbent assay (ELISA), that specifically measures the electrophoretic "fast form" of α2-macroglobulin (F-α2M), could be a sensitive and global marker for activation of calcium dependent and in-dependent proteases in plasma exposed to biomaterials...... in vitro. Methods: A F-α2M specific monoclonal antibody was generated and applied in an ELISA setup. Using the F-α2M ELISA, we investigated activation of calcium dependent and in-dependent proteases by polyvinylchloride (n=10), polytetrafluoroethylene (n=10) and silicone (n=10) tubings as well as glass...

  5. [Eutopic parturition: psychoprophylaxis or extradural analgesia. Influence on the endocrine response].

    Science.gov (United States)

    Carrasco, M S; Iglesias, J; Freire, J; Martín, M L; Marín Santana, A; Cobo, I; García Rendón, A

    1989-01-01

    Prolactin, ACTH, cortisol and HGH levels have been studied on 30 pregnant women in three different periods: during the labour, at the delivery and 24 hours later. They were divided into 3 groups depending on the analgesia: I) no analgesia (n = 10); II) psychoprophylaxis (n = 10), and III) extradural analgesia (n = 10). Prolactin levels increased during delivery and 24 hours later. A significant increase of ACTH levels (p less than 0.01) was observed during the delivery in the 3 groups even though they were under hasal values 24 hours later. Cortisol increased 38% (p less than 0.01) and 52% (p less than 0.02) in II and III groups, respectively during the delivery. No difference was found with HGH. Our results suggest that endocrine response modified by labour and delivery doesn't change with different analgesia techniques.

  6. Low-temperature cyclic cracking resistance of Fe-Cr-Ni and Fe-Cr-Mn steels welded joints

    International Nuclear Information System (INIS)

    Ostash, O.P.; Zhmur-Klimenko, V.T.; Yarema, S.Ya.; Yushchenko, K.A.; Strok, L.P.; Belotserkovets, V.I.

    1983-01-01

    Results of further investigations into regularities of development of low-temperature fatigue fracture of welded oints in 07Kh13G20AN4 steel are presented, they are compared with analogous data traditional cryogenic 0Kh18N10T and 03Kh13AG19 steels. Welded joints have been prepared by means of automatic V-like level arc Welding of plates; 0Kh18N10T and 07Kh13G20AN4 steels have been welded by means of sv-04Kh19N9 wire, 03Kh13AG19 steel-by means of sv-07Kh13AG19 wire. Tests at almost zero (asymmetry coefficient R=0.05) cycle of extension at 15-20 Hz frequency have been conducted on 5 mm thick disk samples at 20 deg C and - 160 deg C according to the given methods. It is shown that by cyclic crack resistance of welded joint zones of 0Kh18N10T steel and chromium-manganese steels at normal temperature the 07Kh13G20AN4 steel exceeds 0Kh18N10T steel, at low temperature it yields to 0Kh18N10T only by fracture toughness of heat affected zones HAZ and weld metal (ne). 07Kh13G20AN4 steel and its welded joints as most hardened and cheap may be a good substituent for 0Kh18N10T steel. Optimization of WM alloying for increase of its cyclic fracture toughness at cryogenic temperatures is necessary

  7. Human α-defensin (DEFA) gene expression helps to characterise benign and malignant salivary gland tumours

    International Nuclear Information System (INIS)

    Winter, Jochen; Wenghoefer, Matthias; Pantelis, Annette; Kraus, Dominik; Reckenbeil, Jan; Reich, Rudolf; Jepsen, Soeren; Fischer, Hans-Peter; Allam, Jean-Pierre; Novak, Natalija

    2012-01-01

    Because of the infrequence of salivary gland tumours and their complex histopathological diagnosis it is still difficult to exactly predict their clinical course by means of recurrence, malignant progression and metastasis. In order to define new proliferation associated genes, purpose of this study was to investigate the expression of human α-defensins (DEFA) 1/3 and 4 in different tumour entities of the salivary glands with respect to malignancy. Tissue of salivary glands (n=10), pleomorphic adenomas (n=10), cystadenolymphomas (n=10), adenocarcinomas (n=10), adenoidcystic carcinomas (n=10), and mucoepidermoid carcinomas (n=10) was obtained during routine surgical procedures. RNA was extracted according to standard protocols. Transcript levels of DEFA 1/3 and 4 were analyzed by quantitative realtime PCR and compared with healthy salivary gland tissue. Additionally, the proteins encoded by DEFA 1/3 and DEFA 4 were visualized in paraffin-embedded tissue sections by immunohistochemical staining. Human α-defensins are traceable in healthy as well as in pathological altered salivary gland tissue. In comparison with healthy tissue, the gene expression of DEFA 1/3 and 4 was significantly (p<0.05) increased in all tumours – except for a significant decrease of DEFA 4 gene expression in pleomorphic adenomas and a similar transcript level for DEFA 1/3 compared to healthy salivary glands. A decreased gene expression of DEFA 1/3 and 4 might protect pleomorphic adenomas from malignant transformation into adenocarcinomas. A similar expression pattern of DEFA-1/3 and -4 in cystadenolymphomas and inflamed salivary glands underlines a potential importance of immunological reactions during the formation of Warthin’s tumour

  8. Altered enzymatic activity and allele frequency of OMI/HTRA2 in Alzheimer's disease

    Science.gov (United States)

    Westerlund, Marie; Behbahani, Homira; Gellhaar, Sandra; Forsell, Charlotte; Belin, Andrea Carmine; Anvret, Anna; Zettergren, Anna; Nissbrandt, Hans; Lind, Charlotta; Sydow, Olof; Graff, Caroline; Olson, Lars; Ankarcrona, Maria; Galter, Dagmar

    2011-01-01

    The serine-protease OMI/HTRA2, required for several cellular processes, including mitochondrial function, autophagy, chaperone activity, and apoptosis, has been implicated in the pathogenesis of both Alzheimer's disease (AD) and Parkinson's disease (PD). Western blot quantification of OMI/HTRA2 in frontal cortex of patients with AD (n=10) and control subjects (n=10) in two separate materials indicated reduced processed (active, 35 kDa) OMI/HTRA2 levels, whereas unprocessed (50 kDa) enzyme levels were not significantly different between the groups. Interestingly, the specific protease activity of OMI/HTRA2 was found to be significantly increased in patients with AD (n=10) compared to matched control subjects (n=10) in frontal cortex in two separate materials. Comparison of OMI/HTRA2 mRNA levels in frontal cortex and hippocampus, two brain areas particularly affected by AD, indicated similar levels in patients with AD (n=10) and matched control subjects (n=10). In addition, we analyzed the occurrence of the OMI/HTRA2 variants A141S and G399S in Swedish case-control materials for AD and PD and found a weak association of A141S with AD, but not with PD. In conclusion, our genetic, histological, and biochemical findings give further support to an involvement of OMI/HTRA2 in the pathology of AD; however, further studies are needed to clarify the role of this gene in neurodegeneration.—Westerlund, M., Behbahani, H., Gellhaar, S., Forsell, C., Carmine Belin, A., Anvret, A., Zettergren, A., Nissbrandt, H., Lind, C., Sydow, O., Graff, C., Olson, L., Ankarcrona, M., Galter, D. Altered enzymatic activity and allele frequency of OMI/HTRA2 in Alzheimer's disease. PMID:21163861

  9. Proposal for a source of polarized protons; Projet de source de protons polarises

    Energy Technology Data Exchange (ETDEWEB)

    Abragam, A.; Winter, J. M. [Commissariat a l' energie atomique et aux energies alternatives - CEA, Centre d' Etudes Nucleaires de Saclay, BP2, Gif-sur-Yvette (France)

    1959-07-01

    Proposal for a source of polarized protons based on the theory of adiabatic fast passage due to F. Bloch. Reprint of a paper published in 'Physical review letters', vol 1, n. 10, 15 Nov 1958, p. 374-375 [French] On propose une methode nouvelle pour la realisation d'une source de protons polarises basee sur la theorie du passage adiabatique de F. Bloch. Reproduction d'un article publie dans 'Physical review letters', vol 1, n. 10, 15 nov 1958, p. 374-375.

  10. Fixed cord in spinal stenosis

    International Nuclear Information System (INIS)

    Levy, L.M.; Wang, H.; Francomano, C.; Hurko, O.; Carson, B.; Heffez, D.S.; DiChiro, G.; Bryan, R.N.

    1990-01-01

    This paper evaluates patients with cervical spinal canal compromise due to congenital anomalies (achondroplasia, Chiari malformation) and degenerative diseases using MR cord motion and cerebrospinal fluid (CSF) flow studies. Pulsatile longitudinal motion of the cervical cord was determined by means of cardiac-gated velocity phase contrast methods, including cine. Pathology included dwarfism (n = 15), Chiari malformation (n = 10), spondylosis (n = 10), and acute cord compression (n = 9). Symptomatic cases of congenital cervical stenosis had decreased cord motion, although CSF flow was not always significantly compromised. Postoperative cases demonstrated good cord and CSF motion, unless compression or obstruction was present

  11. Investigating the enhancing effect of music on autobiographical memory in mild Alzheimer's disease.

    Science.gov (United States)

    Irish, Muireann; Cunningham, Conal J; Walsh, J Bernard; Coakley, Davis; Lawlor, Brian A; Robertson, Ian H; Coen, Robert F

    2006-01-01

    The enhancing effect of music on autobiographical memory recall in mild Alzheimer's disease individuals (n = 10; Mini-Mental State Examination score >17/30) and healthy elderly matched individuals (n = 10; Mini-Mental State Examination score 25-30) was investigated. Using a repeated-measures design, each participant was seen on two occasions: once in music condition (Vivaldi's 'Spring' movement from 'The Four Seasons') and once in silence condition, with order counterbalanced. Considerable improvement was found for Alzheimer individuals' recall on the Autobiographical Memory Interview in the music condition, with an interaction for condition by group (p music condition (p music on autobiographical memory recall.

  12. Obesity literacy and culture among African American women in Florida.

    Science.gov (United States)

    López, Ivette A; Boston, Patricia Q; Dutton, Matthew; Jones, Chauneva Glenn; Mitchell, M Miaisha; Vilme, Helene

    2014-07-01

    To explore causal explanations of obesity among African-American women of diverse weight across the life spectrum. In-depth interviews were conducted with adult African-American women of healthy weight (N = 10), overweight (N = 10), and obese weight (N = 20) to evaluate the relationship between causal explanations of obesity and weight. Generally overlooked dimensions of health definitions were discovered. Differences in weight definitions were detected between women of different weights. Terminology, symptoms, and solutions to obesity were detected between the women of different weights and public health recommendations. Identified causal discrepancies will help bridge the disconnection between public health recommendations and African-American women's perceptions with tailored interventions.

  13. Extreme sea level variability along the coast of India. Vol. 1-2

    Digital Repository Service at National Institute of Oceanography (India)

    Unnikrishnan, A.S.; Shetye, S.R.; Shankar, D; Sundar, D; Michael, G.S.; Fernandes, S.E.; Telang, M.

    52 Annexure – II 53 Annexure – III 107 Project Team A.S. Unnikrishnan S.R. Shetye D. Shankar D... 95˚E 95˚E 5˚N 5˚N 10˚N 10˚N 15˚N 15˚N 20˚N 20˚N 25˚N 25˚N Arabian Sea Bay of Bengal Indian Ocean India Contai Nagapattinam Gopalpur Puri Balasore Cape Comorin Nellore Kakinada Chittagong NizampatnamOngole Chandbali Rameswaram Hatia Bhavnagar Porbandar...

  14. Magnesium deficiency induces anxiety-and depression-like behavior and metabolic dysfunction in C57Bl/6J mice

    DEFF Research Database (Denmark)

    Winther, G.; Wang, T.; Singewald, N.

    2012-01-01

    ) in mice through depression-and anxiety phenotyping experiments, namely the forced swim test and light-dark box respectively. We determined the behavioural effects 30 minutes after treatment with imipramine (20 mg/kg), diazepam (2 mg/kg) and ketamine (3 mg/kg). The glucose tolerance test was used to assess...... metabolic function in Mg deficient mice. Results: We found that, compared to control (n=10), mice receiving Mg deficient diet (n=10) (10 % RDA), were more immobile in the forced swim test....

  15. Multivariate Analysis of Variance: Finding significant growth in mice with craniofacial dysmorphology caused by the Crouzon mutation

    DEFF Research Database (Denmark)

    Thorup, Signe Strann; Ólafsdóttir, Hildur; Darvann, Tron Andre

    2010-01-01

    Crouzon syndrome is characterized by growth disturbances caused by premature fusion of the cranial growth zones. A mouse model with mutation Fgfr2C342Y, equivalent to the most common Crouzon syndrome mutation (henceforth called the Crouzon mouse model), has a phenotype showing many parallels to t...... used micro-CT scans of 4-week-old mice (N=5) and 6-week-old mice (N=10) with Crouzon syndrome (Fgfr2 C342Y/+) were compared to control groups of 4-week-old wild-type mice (N=5) and 6-week-old wild-type mice (N=10), respectively....

  16. Effect of helium ion bombardment on hydrogen behaviour in stainless steel

    International Nuclear Information System (INIS)

    Guseva, M.I.; Stolyarova, V.G.; Gorbatov, E.A.

    1987-01-01

    The effect of helium ion bombardment on hydrogen behaviour in 12Kh18N10T stainless steel is investigated. Helium and hydrogen ion bombardment was conducted in the ILU-3 ion accelerator; the fluence and energy made up 10 16 -5x10 17 cm -2 , 30 keV and 10 16 -5x10 18 cm -2 , 10 keV respectively. The method of recoil nuclei was used for determination of helium and hydrogen content. Successive implantation of helium and hydrogen ions into 12Kh18N10T stainless steel results in hydrogen capture by defects formed by helium ions

  17. Establishment of a blunt impact-induced brain injury model in rabbits

    OpenAIRE

    LI Kui; CAO Yun-xing; YANG Yong-qiang; YIN Zhi-yong; ZHAO Hui; WANG Li-jun

    2012-01-01

    【Abstract】 Objective: To establish an animal model to replicate the blunt impact brain injury in forensic medicine. Methods: Twenty-four New Zealand white rabbits were randomly divided into control group (n=4), minor injury group (n=10) and severe injury group (n=10). Based on the BIM-Ⅱ Horizontal Bio-impact Machine, self-designed iron bar was used to produce blunt brain injury. Two rabbits from each injury group were randomly selected to monitor the change of in...

  18. Exercise training normalizes skeletal muscle vascular endothelial growth factor levels in patients with essential hypertension

    DEFF Research Database (Denmark)

    Hansen, Ane Håkansson; Nielsen, Jens Jung; Saltin, Bengt

    2010-01-01

    METHODS: Vascular endothelial growth factor (VEGF) protein and capillarization were determined in muscle vastus lateralis biopsy samples in individuals with essential hypertension (n = 10) and normotensive controls (n = 10). The hypertensive individuals performed exercise training for 16 weeks....... Muscle samples as well as muscle microdialysis fluid samples were obtained at rest, during and after an acute exercise bout, performed prior to and after the training period, for the determination of muscle VEGF levels, VEGF release, endothelial cell proliferative effect and capillarization. RESULTS......: Prior to training, the hypertensive individuals had 36% lower levels of VEGF protein and 22% lower capillary density in the muscle compared to controls. Training in the hypertensive group reduced (P

  19. IAEA Perspectives on Radiological Characterisation

    International Nuclear Information System (INIS)

    O'Sullivan, Patrick; Ljubenov, Vladan

    2012-01-01

    Requirements for characterization of radiological and other hazards in nuclear facilities are reflected in the IAEA Safety Standards. WS-R-5, Safety Requirements for Decommissioning of Facilities using Radioactive Material, includes a requirement that 'During the preparation of the final decommissioning plan, the extent and type of radioactive material (irradiated and contaminated structures and components) at the facility shall be determined by means of a detailed characterization survey and on the basis of records collected during the operational period'. The subsidiary Safety Guide WS-G-2.1, Decommissioning of Nuclear Power Plants and Research Reactors, further elaborates that 'A survey of radiological and non-radiological hazards provides an important input for the safety assessment and for implementing a safe approach during the work'. Although the characterisation requirements addressed in the Safety Standards relate primarily to the detailed survey activities undertaken following the shutdown of the facility, it is evident that radiological characterization is of relevance to all major phases of the lifetime of a nuclear facility, including: - the siting phase - baseline surveys are undertaken to determine background radiation levels; - the construction phase - construction materials are retained to support future calculations of radioactivity distributions; - the operational phase - surveys are done regularly, with additional surveys being required following incidents involving plant contamination; - the transition phase - detailed radiological surveys are required to support the development of the final decommissioning plan; and - the closure phase - a final survey of the site and any remaining structures will be needed to support an application for release of the site from regulatory control. In the case of facilities that are already shut down, the main purpose of radiological characterisation is to provide a reliable database of information on the

  20. Hydrometeor Size Distribution Measurements by Imaging the Attenuation of a Laser Spot

    Science.gov (United States)

    Lane, John

    2013-01-01

    The optical extinction of a laser due to scattering of particles is a well-known phenomenon. In a laboratory environment, this physical principle is known as the Beer-Lambert law, and is often used to measure the concentration of scattering particles in a fluid or gas. This method has been experimentally shown to be a usable means to measure the dust density from a rocket plume interaction with the lunar surface. Using the same principles and experimental arrangement, this technique can be applied to hydrometeor size distributions, and for launch-pad operations, specifically as a passive hail detection and measurement system. Calibration of a hail monitoring system is a difficult process. In the past, it has required comparison to another means of measuring hydrometeor size and density. Using a technique recently developed for estimating the density of surface dust dispersed during a rocket landing, measuring the extinction of a laser passing through hail (or dust in the rocket case) yields an estimate of the second moment of the particle cloud, and hydrometeor size distribution in the terrestrial meteorological case. With the exception of disdrometers, instruments that measure rain and hail fall make indirect measurements of the drop-size distribution. Instruments that scatter microwaves off of hydrometeors, such as the WSR-88D (Weather Surveillance Radar 88 Doppler), vertical wind profilers, and microwave disdrometers, measure the sixth moment of the drop size distribution (DSD). By projecting a laser onto a target, changes in brightness of the laser spot against the target background during rain and hail yield a measurement of the DSD's second moment by way of the Beer-Lambert law. In order to detect the laser attenuation within the 8-bit resolution of most camera image arrays, a minimum path length is required. Depending on the intensity of the hail fall rate for moderate to heavy rainfall, a laser path length of 100 m is sufficient to measure variations in

  1. Safety assessment methodologies for near surface disposal facilities. Results of a co-ordinated research project (ISAM). Volume 1: Review and enhancement of safety assessment approaches and tools. Volume 2: Test cases

    International Nuclear Information System (INIS)

    2004-07-01

    For several decades, countries have made use of near surface facilities for the disposal of low and intermediate level radioactive waste. In line with the internationally agreed principles of radioactive waste management, the safety of these facilities needs to be ensured during all stages of their lifetimes, including the post-closure period. By the mid 1990s, formal methodologies for evaluating the long term safety of such facilities had been developed, but intercomparison of these methodologies had revealed a number of discrepancies between them. Consequently, in 1997, the International Atomic Energy Agency launched a Co-ordinated Research Project (CRP) on Improvement of Safety Assessment Methodologies for Near Surface Disposal Facilities (ISAM). The particular objectives of the CRP were to provide a critical evaluation of the approaches and tools used in post-closure safety assessment for proposed and existing near-surface radioactive waste disposal facilities, enhance the approaches and tools used and build confidence in the approaches and tools used. The CRP ran until 2000 and resulted in the development of a harmonized assessment methodology (the ISAM project methodology), which was applied to a number of test cases. Over seventy participants from twenty-two Member States played an active role in the project and it attracted interest from around seven hundred persons involved with safety assessment in seventy-two Member States. The results of the CRP have contributed to the Action Plan on the Safety of Radioactive Waste Management which was approved by the Board of Governors and endorsed by the General Conference in September 2001. Specifically, they contribute to Action 5, which requests the IAEA Secretariat to 'develop a structured and systematic programme to ensure adequate application of the Agency's waste safety standards', by elaborating on the Safety Requirements on 'Near Surface Disposal of Radioactive Waste' (Safety Standards Series No. WS-R-1) and

  2. Effect of seasonal variations on the phytoconstituents of Aśvagandhā w.r. to lunar cycles.

    Science.gov (United States)

    Tavhare, Swagata Dilip; Nishteswar, Karra; Shukla, Vinay J

    2016-01-01

    Suśruta, Caraka and other ācāryas advocate the collection of medicinal plants keeping in view the part used, season, soil in which the herb grows and the desired pharmacological actions or therapeutic benefits. The logic behind such recommendations is being validated by modern scientific research. To assess the effect of seasonal variations on the phytoconstituents of Aśvagandhā (Withania somnifera L. Dunal) w.s.r. to lunar cycles. The plant specimens were collected from Jamnagar identified pharmacognostically and cultivated under a defined habitat in a herbal garden of IPGT and RA on 7 Oct 2013. The root samples were collected on every paurṇimā (full moon) and amāvāsyā (new moon) days in śiśira and grīṣṃa ṛtu (as per classics) of the year 2013-14. The physicochemical parameters such as pH, ash values, extractive value, total alkaloid content, total flavonoids content (UV spectrometer with AlCl3 reagent), total phenolic content (Singleton and Rossi method), total carbohydrate content (UV spectroscopy with glucose as standard), UV-VIS-NIR and HPTLC were determined. The results of the analytical studies clearly validate the logic of the recommendations of Suśruta and Cakrapāṇi. According to these recommendations, uṣṇa vīrya drugs must be collected during āgneya ṛtu i.e. grīṣṃa ṛtu. In present study, total phenolic, flavonide and carbohydrate content were found more in pournima samples. GAP samples showed maximum differentiation from rest of the samples with regards to TCA, TCW, TFW, MEx, WEX, pH etc. parameters. The Grīṣṃa Jyeṣṭha Paurṇimā (GJP) and Āṣāḍha Paurṇimā (GAP) samples were found to be superior than amāvāsyā samples w.r.t. functional groups and withanoloid content respectively on HPTLC. The observations of experimental studies validate the concept of seasonal as well as lunar collection of herb Ashwagandha to yield a drug of superior quality of active principles.

  3. Development of Deep Learning Based Data Fusion Approach for Accurate Rainfall Estimation Using Ground Radar and Satellite Precipitation Products

    Science.gov (United States)

    Chen, H.; Chandra, C. V.; Tan, H.; Cifelli, R.; Xie, P.

    2016-12-01

    Rainfall estimation based on onboard satellite measurements has been an important topic in satellite meteorology for decades. A number of precipitation products at multiple time and space scales have been developed based upon satellite observations. For example, NOAA Climate Prediction Center has developed a morphing technique (i.e., CMORPH) to produce global precipitation products by combining existing space based rainfall estimates. The CMORPH products are essentially derived based on geostationary satellite IR brightness temperature information and retrievals from passive microwave measurements (Joyce et al. 2004). Although the space-based precipitation products provide an excellent tool for regional and global hydrologic and climate studies as well as improved situational awareness for operational forecasts, its accuracy is limited due to the sampling limitations, particularly for extreme events such as very light and/or heavy rain. On the other hand, ground-based radar is more mature science for quantitative precipitation estimation (QPE), especially after the implementation of dual-polarization technique and further enhanced by urban scale radar networks. Therefore, ground radars are often critical for providing local scale rainfall estimation and a "heads-up" for operational forecasters to issue watches and warnings as well as validation of various space measurements and products. The CASA DFW QPE system, which is based on dual-polarization X-band CASA radars and a local S-band WSR-88DP radar, has demonstrated its excellent performance during several years of operation in a variety of precipitation regimes. The real-time CASA DFW QPE products are used extensively for localized hydrometeorological applications such as urban flash flood forecasting. In this paper, a neural network based data fusion mechanism is introduced to improve the satellite-based CMORPH precipitation product by taking into account the ground radar measurements. A deep learning system is

  4. Precipitation from the GPM Microwave Imager and Constellation Radiometers

    Science.gov (United States)

    Kummerow, Christian; Randel, David; Kirstetter, Pierre-Emmanuel; Kulie, Mark; Wang, Nai-Yu

    2014-05-01

    Satellite precipitation retrievals from microwave sensors are fundamentally underconstrained requiring either implicit or explicit a-priori information to constrain solutions. The radiometer algorithm designed for the GPM core and constellation satellites makes this a-priori information explicit in the form of a database of possible rain structures from the GPM core satellite and a Bayesian retrieval scheme. The a-priori database will eventually come from the GPM core satellite's combined radar/radiometer retrieval algorithm. That product is physically constrained to ensure radiometric consistency between the radars and radiometers and is thus ideally suited to create the a-priori databases for all radiometers in the GPM constellation. Until a robust product exists, however, the a-priori databases are being generated from the combination of existing sources over land and oceans. Over oceans, the Day-1 GPM radiometer algorithm uses the TRMM PR/TMI physically derived hydrometer profiles that are available from the tropics through sea surface temperatures of approximately 285K. For colder sea surface temperatures, the existing profiles are used with lower hydrometeor layers removed to correspond to colder conditions. While not ideal, the results appear to be reasonable placeholders until the full GPM database can be constructed. It is more difficult to construct physically consistent profiles over land due to ambiguities in surface emissivities as well as details of the ice scattering that dominates brightness temperature signatures over land. Over land, the a-priori databases have therefore been constructed by matching satellite overpasses to surface radar data derived from the WSR-88 network over the continental United States through the National Mosaic and Multi-Sensor QPE (NMQ) initiative. Databases are generated as a function of land type (4 categories of increasing vegetation cover as well as 4 categories of increasing snow depth), land surface temperature and

  5. Long-Term Quantitative Precipitation Estimates (QPE) at High Spatial and Temporal Resolution over CONUS: Bias-Adjustment of the Radar-Only National Mosaic and Multi-sensor QPE (NMQ/Q2) Precipitation Reanalysis (2001-2012)

    Science.gov (United States)

    Prat, Olivier; Nelson, Brian; Stevens, Scott; Seo, Dong-Jun; Kim, Beomgeun

    2015-04-01

    The processing of radar-only precipitation via the reanalysis from the National Mosaic and Multi-Sensor Quantitative (NMQ/Q2) based on the WSR-88D Next-generation Radar (NEXRAD) network over Continental United States (CONUS) is completed for the period covering from 2001 to 2012. This important milestone constitutes a unique opportunity to study precipitation processes at a 1-km spatial resolution for a 5-min temporal resolution. However, in order to be suitable for hydrological, meteorological and climatological applications, the radar-only product needs to be bias-adjusted and merged with in-situ rain gauge information. Several in-situ datasets are available to assess the biases of the radar-only product and to adjust for those biases to provide a multi-sensor QPE. The rain gauge networks that are used such as the Global Historical Climatology Network-Daily (GHCN-D), the Hydrometeorological Automated Data System (HADS), the Automated Surface Observing Systems (ASOS), and the Climate Reference Network (CRN), have different spatial density and temporal resolution. The challenges related to incorporating non-homogeneous networks over a vast area and for a long-term record are enormous. Among the challenges we are facing are the difficulties incorporating differing resolution and quality surface measurements to adjust gridded estimates of precipitation. Another challenge is the type of adjustment technique. The objective of this work is threefold. First, we investigate how the different in-situ networks can impact the precipitation estimates as a function of the spatial density, sensor type, and temporal resolution. Second, we assess conditional and un-conditional biases of the radar-only QPE for various time scales (daily, hourly, 5-min) using in-situ precipitation observations. Finally, after assessing the bias and applying reduction or elimination techniques, we are using a unique in-situ dataset merging the different RG networks (CRN, ASOS, HADS, GHCN-D) to

  6. Long-Term Large-Scale Bias-Adjusted Precipitation Estimates at High Spatial and Temporal Resolution Derived from the National Mosaic and Multi-Sensor QPE (NMQ/Q2) Precipitation Reanalysis over CONUS

    Science.gov (United States)

    Prat, O. P.; Nelson, B. R.; Stevens, S. E.; Seo, D. J.; Kim, B.

    2014-12-01

    The processing of radar-only precipitation via the reanalysis from the National Mosaic and Multi-Sensor Quantitative (NMQ/Q2) based on the WSR-88D Next-generation Radar (Nexrad) network over Continental United States (CONUS) is nearly completed for the period covering from 2000 to 2012. This important milestone constitutes a unique opportunity to study precipitation processes at a 1-km spatial resolution for a 5-min temporal resolution. However, in order to be suitable for hydrological, meteorological and climatological applications, the radar-only product needs to be bias-adjusted and merged with in-situ rain gauge information. Rain gauge networks such as the Hydrometeorological Automated Data System (HADS), the Automated Surface Observing Systems (ASOS), the Climate Reference Network (CRN), and the Global Historical Climatology Network - Daily (GHCN-D) are used to adjust for those biases and to merge with the radar only product to provide a multi-sensor estimate. The challenges related to incorporating non-homogeneous networks over a vast area and for a long-term record are enormous. Among the challenges we are facing are the difficulties incorporating differing resolution and quality surface measurements to adjust gridded estimates of precipitation. Another challenge is the type of adjustment technique. After assessing the bias and applying reduction or elimination techniques, we are investigating the kriging method and its variants such as simple kriging (SK), ordinary kriging (OK), and conditional bias-penalized Kriging (CBPK) among others. In addition we hope to generate estimates of uncertainty for the gridded estimate. In this work the methodology is presented as well as a comparison between the radar-only product and the final multi-sensor QPE product. The comparison is performed at various time scales from the sub-hourly, to annual. In addition, comparisons over the same period with a suite of lower resolution QPEs derived from ground based radar

  7. Socioeconomic Drought in a Changing Climate: Modeling and Management

    Science.gov (United States)

    AghaKouchak, Amir; Mehran, Ali; Mazdiyasni, Omid

    2016-04-01

    Drought is typically defined based on meteorological, hydrological and land surface conditions. However, in many parts of the world, anthropogenic changes and water management practices have significantly altered local water availability. Socioeconomic drought refers to conditions whereby the available water supply cannot satisfy the human and environmental water needs. Surface water reservoirs provide resilience against local climate variability (e.g., droughts), and play a major role in regional water management. This presentation focuses on a framework for describing socioeconomic drought based on both water supply and demand information. We present a multivariate approach as a measure of socioeconomic drought, termed Multivariate Standardized Reliability and Resilience Index (MSRRI; Mehran et al., 2015). This model links the information on inflow and surface reservoir storage to water demand. MSRRI integrates a "top-down" and a "bottom-up" approach for describing socioeconomic drought. The "top-down" component describes processes that cannot be simply controlled or altered by local decision-makers and managers (e.g., precipitation, climate variability, climate change), whereas the "bottom-up" component focuses on the local resilience, and societal capacity to respond to droughts. The two components (termed, Inflow-Demand Reliability (IDR) indicator and Water Storage Resilience (WSR) indicator) are integrated using a nonparametric multivariate approach. We use this framework to assess the socioeconomic drought during the Australian Millennium Drought (1998-2010) and the 2011-2014 California Droughts. MSRRI provides additional information on socioeconomic drought onset, development and termination based on local resilience and human demand that cannot be obtained from the commonly used drought indicators. We show that MSRRI can be used for water management scenario analysis (e.g., local water availability based on different human water demands scenarios). Finally

  8. Maintaining a Local Data Integration System in Support of Weather Forecast Operations

    Science.gov (United States)

    Watson, Leela R.; Blottman, Peter F.; Sharp, David W.; Hoeth, Brian

    2010-01-01

    Since 2000, both the National Weather Service in Melbourne, FL (NWS MLB) and the Spaceflight Meteorology Group (SMG) have used a local data integration system (LDIS) as part of their forecast and warning operations. Each has benefited from 3-dimensional analyses that are delivered to forecasters every 15 minutes across the peninsula of Florida. The intent is to generate products that enhance short-range weather forecasts issued in support of NWS MLB and SMG operational requirements within East Central Florida. The current LDIS uses the Advanced Regional Prediction System (ARPS) Data Analysis System (ADAS) package as its core, which integrates a wide variety of national, regional, and local observational data sets. It assimilates all available real-time data within its domain and is run at a finer spatial and temporal resolution than current national- or regional-scale analysis packages. As such, it provides local forecasters with a more comprehensive and complete understanding of evolving fine-scale weather features. Recent efforts have been undertaken to update the LDIS through the formal tasking process of NASA's Applied Meteorology Unit. The goals include upgrading LDIS with the latest version of ADAS, incorporating new sources of observational data, and making adjustments to shell scripts written to govern the system. A series of scripts run a complete modeling system consisting of the preprocessing step, the main model integration, and the post-processing step. The preprocessing step prepares the terrain, surface characteristics data sets, and the objective analysis for model initialization. Data ingested through ADAS include (but are not limited to) Level II Weather Surveillance Radar- 1988 Doppler (WSR-88D) data from six Florida radars, Geostationary Operational Environmental Satellites (GOES) visible and infrared satellite imagery, surface and upper air observations throughout Florida from NOAA's Earth System Research Laboratory/Global Systems Division

  9. Sensitivity of Spaceborne and Ground Radar Comparison Results to Data Analysis Methods and Constraints

    Science.gov (United States)

    Morris, Kenneth R.; Schwaller, Mathew

    2011-01-01

    categorization applied to the data. In this paper, we will show results comparing the 3-D gridded analysis "black box" approach to the GPM prototype volume-matching approach, using matching TRMM PR and WSR-88D ground radar data. The affects of applying data constraints and data categorizations on the volume-matched data to the results will be shown, and explanations of the differences in terms of data and analysis algorithm characteristics will be presented. Implications of the differences to the determination of PR/DPR calibration differences and use of ground radar data to evaluate the PR and DPR attenuation correction algorithms will be discussed.

  10. Hydrological Impacts of Land Use Change in the Central Appalachian Mountains, U.S.: A Multi-Scale Analysis

    Science.gov (United States)

    Eshleman, K. N.; Negley, T. L.; Townsend, P. A.

    2003-12-01

    (area = 127 sq. km.) and predominantly-forested Savage River (area = 188 sq. km.) watersheds in western Maryland was unable to establish a comparable land use effect on stormflow response, due to inherent climatic variability. Such an effect was suggested, however, when high-resolution, gage-adjusted rainfall data generated from NEXRAD (NEXt generation weather RADar; WSR-88D) radars were employed for developing unit hydrographs for specific extreme events. Inadequacies in spatial rainfall estimation thus appear to be a major limiting factor in scaling changes in observed stormflow responses from small experimental watersheds to larger river basins undergoing extensive land use changes. We conclude that land use change effects in gaged river basins can be discerned if flood hydrographs are interpreted using accurate, areal precipitation data.

  11. Effect of seasonal variations on the phytoconstituents of Aśvagandhā w.r. to lunar cycles

    Directory of Open Access Journals (Sweden)

    Swagata Dilip Tavhare

    2016-01-01

    Aim: To assess the effect of seasonal variations on the phytoconstituents of Aśvagandhā (Withania somnifera L. Dunal w.s.r. to lunar cycles. Material and Methods: The plant specimens were collected from Jamnagar identified pharmacognostically and cultivated under a defined habitat in a herbal garden of IPGT and RA on 7 Oct 2013. The root samples were collected on every paurṃimā (full moon and amāvāsyā (new moon days in śiśira and grīşṃa ṃṛtu (as per classics of the year 2013-14. The physicochemical parameters such as pH, ash values, extractive value, total alkaloid content, total flavonoids content (UV spectrometer with AlCl3 reagent, total phenolic content (Singleton and Rossi method, total carbohydrate content (UV spectroscopy with glucose as standard, UV-VIS-NIR and HPTLC were determined. Result: The results of the analytical studies clearly validate the logic of the recommendations of Suśruta and Cakrapāṃi. According to these recommendations, uşṃa vīrya drugs must be collected during āgneya ṃṛtu i.e. grīşṃa ṃṛtu. In present study, total phenolic, flavonide and carbohydrate content were found more in pournima samples. GAP samples showed maximum differentiation from rest of the samples with regards to TCA, TCW, TFW, MEx, WEX, pH etc. parameters. The Grīşṃa Jyeşṃha Paurṃimā (GJP and Āşāḍha Paurṃimā (GAP samples were found to be superior than amāvāsyā samples w.r.t. functional groups and withanoloid content respectively on HPTLC. Conclusion: The observations of experimental studies validate the concept of seasonal as well as lunar collection of herb Ashwagandha to yield a drug of superior quality of active principles.

  12. Status Update on the GPM Ground Validation Iowa Flood Studies (IFloodS) Field Experiment

    Science.gov (United States)

    Petersen, Walt; Krajewski, Witold

    2013-04-01

    The overarching objective of integrated hydrologic ground validation activities supporting the Global Precipitation Measurement Mission (GPM) is to provide better understanding of the strengths and limitations of the satellite products, in the context of hydrologic applications. To this end, the GPM Ground Validation (GV) program is conducting the first of several hydrology-oriented field efforts: the Iowa Flood Studies (IFloodS) experiment. IFloodS will be conducted in the central to northeastern part of Iowa in Midwestern United States during the months of April-June, 2013. Specific science objectives and related goals for the IFloodS experiment can be summarized as follows: 1. Quantify the physical characteristics and space/time variability of rain (rates, DSD, process/"regime") and map to satellite rainfall retrieval uncertainty. 2. Assess satellite rainfall retrieval uncertainties at instantaneous to daily time scales and evaluate propagation/impact of uncertainty in flood-prediction. 3. Assess hydrologic predictive skill as a function of space/time scales, basin morphology, and land use/cover. 4. Discern the relative roles of rainfall quantities such as rate and accumulation as compared to other factors (e.g. transport of water in the drainage network) in flood genesis. 5. Refine approaches to "integrated hydrologic GV" concept based on IFloodS experiences and apply to future GPM Integrated GV field efforts. These objectives will be achieved via the deployment of the NASA NPOL S-band and D3R Ka/Ku-band dual-polarimetric radars, University of Iowa X-band dual-polarimetric radars, a large network of paired rain gauge platforms with attendant soil moisture and temperature probes, a large network of both 2D Video and Parsivel disdrometers, and USDA-ARS gauge and soil-moisture measurements (in collaboration with the NASA SMAP mission). The aforementioned measurements will be used to complement existing operational WSR-88D S-band polarimetric radar measurements

  13. Genome-wide methylation analysis identifies a core set of hypermethylated genes in CIMP-H colorectal cancer.

    Science.gov (United States)

    McInnes, Tyler; Zou, Donghui; Rao, Dasari S; Munro, Francesca M; Phillips, Vicky L; McCall, John L; Black, Michael A; Reeve, Anthony E; Guilford, Parry J

    2017-03-28

    Aberrant DNA methylation profiles are a characteristic of all known cancer types, epitomized by the CpG island methylator phenotype (CIMP) in colorectal cancer (CRC). Hypermethylation has been observed at CpG islands throughout the genome, but it is unclear which factors determine whether an individual island becomes methylated in cancer. DNA methylation in CRC was analysed using the Illumina HumanMethylation450K array. Differentially methylated loci were identified using Significance Analysis of Microarrays (SAM) and the Wilcoxon Signed Rank (WSR) test. Unsupervised hierarchical clustering was used to identify methylation subtypes in CRC. In this study we characterized the DNA methylation profiles of 94 CRC tissues and their matched normal counterparts. Consistent with previous studies, unsupervized hierarchical clustering of genome-wide methylation data identified three subtypes within the tumour samples, designated CIMP-H, CIMP-L and CIMP-N, that showed high, low and very low methylation levels, respectively. Differential methylation between normal and tumour samples was analysed at the individual CpG level, and at the gene level. The distribution of hypermethylation in CIMP-N tumours showed high inter-tumour variability and appeared to be highly stochastic in nature, whereas CIMP-H tumours exhibited consistent hypermethylation at a subset of genes, in addition to a highly variable background of hypermethylated genes. EYA4, TFPI2 and TLX1 were hypermethylated in more than 90% of all tumours examined. One-hundred thirty-two genes were hypermethylated in 100% of CIMP-H tumours studied and these were highly enriched for functions relating to skeletal system development (Bonferroni adjusted p value =2.88E-15), segment specification (adjusted p value =9.62E-11), embryonic development (adjusted p value =1.52E-04), mesoderm development (adjusted p value =1.14E-20), and ectoderm development (adjusted p value =7.94E-16). Our genome-wide characterization of DNA

  14. Evaluation of a Core Team Centred Professional Development Programme for Building a Whole-School Cooperative Problem Solving Approach to Conflict

    Science.gov (United States)

    White, Andrew Jonathan; Wertheim, Eleanor H.; Freeman, Elizabeth; Trinder, Margot

    2013-01-01

    This study evaluated a professional learning approach using a core team (CT) model to assist primary (elementary) schools to develop whole-school collaborative conflict resolution processes. Thirteen schools were matched and randomly assigned to the enhancing relationships in school communities programme ("n"?=?10) or a non-programme…

  15. Common variants at 12q15 and 12q24 are associated with infant head circumference

    NARCIS (Netherlands)

    H.R. Taal (Rob); B. St Pourcain (Beate); E. Thiering (Eelisabeth); S. Das (Shikta); D.O. Mook-Kanamori (Dennis); N.M. Warrington (Nicole); M. Kaakinen (Marika); E. Kreiner-Møller (Eskil); J.P. Bradfield (Jonathan); R.M. Freathy (Rachel); F. Geller (Frank); M. Guxens Junyent (Mònica); D.L. Cousminer (Diana); M. Kerkhof (Marjan); N.J. Timpson (Nicholas); M.A. Ikram (Arfan); L.J. Beilin (Lawrence); K. Bønnelykke (Klaus); J.L. Buxton (Jessica); P. Charoen (Pimphen); B.L.K. Chawes (Bo Lund Krogsgaard); J.G. Eriksson (Johan); D.M. Evans (David); A. Hofman (Albert); J.P. Kemp (John); C.E. Kim (Cecilia); N. Klopp (Norman); J. Lahti (Jari); S.J. Lye (Stephen); G. Mcmahon (George); F.D. Mentch (Frank); M. Müller-Nurasyid (Martina); P.F. O'Reilly (Paul); I. Prokopenko (Inga); F. Rivadeneira Ramirez (Fernando); E.A.P. Steegers (Eric); J. Sunyer (Jordi); C. Tiesler (Carla); H. Yaghootkar (Hanieh); M.M.B. Breteler (Monique); S. Debette (Stéphanie); M. Fornage (Myriam); V. Gudnason (Vilmunder); L.J. Launer (Lenore); A. van der Lugt (Aad); T.H. Mosley (Thomas); S. Seshadri (Sudha); A.V. Smith (Albert V.); M.W. Vernooij (Meike); A.I.F. Blakemore (Alexandra); R.M. Chiavacci (Rosetta); B. Feenstra (Bjarke); J. Fernandez-Banet (Julio); S.F.A. Grant (Struan); A.-L. Hartikainen (Anna-Liisa); A.J. van der Heijden (Albert); C. Iniguez (Carmen); M. Lathrop (Mark); W.L. McArdle (Wendy); A. Mølgaard (Anne); J.P. Newnham (John); L.J. Palmer (Lyle); A. Palotie (Aarno); A. Pouta (Anneli); S.M. Ring (Susan); U. Sovio (Ulla); M. Standl (Marie); A.G. Uitterlinden (André); E.H. Wichmann (Erich); N.H. Vissing (Nadja); C. DeCarli (Charles); C.M. van Duijn (Cornelia); M.I. McCarthy (M.); G.H. Koppelman (Gerard); X. Estivill (Xavier); A.T. Hattersley (Andrew); M. Melbye (Mads); H. Bisgaard (Hans); C.E. Pennell (Craig); E. Widen (Elisabeth); H. Hakonarson (Hakon); G. Davey-Smith (George); J. Heinrich (Joachim); M.-R. Jarvelin (Marjo-Riitta); V.W.V. Jaddoe (Vincent)

    2012-01-01

    textabstractTo identify genetic variants associated with head circumference in infancy, we performed a meta-analysis of seven genome-wide association studies (GWAS) (N = 10,768 individuals of European ancestry enrolled in pregnancy and/or birth cohorts) and followed up three lead signals in six

  16. Can early thinning and pruning lessen the impact of pine plantations ...

    African Journals Online (AJOL)

    dwelling insects found in pine tree plantations in Patagonia. We compared the abundance, species richness and composition of the beetle and ant assemblages within 16-year-old pine stands (n = 10) subjected to early pruning and thinning (i.e. ...

  17. Investigation of hemorheological and analgesic properties of Qing ...

    African Journals Online (AJOL)

    Nao tablet (QNT). Methods: Sixty animals were divided into 6 groups (n = 10 for each group): normal, control, positive and 3 QNT-treated groups (QNT-H, QNT-M, QNT-L). Animals in normal and control groups received normal saline orally, while ...

  18. Metabolic Consequences of Dieting and Exercise in the Treatment of Obesity.

    Science.gov (United States)

    Donahoe, Clyde P.; And Others

    1984-01-01

    Investigated the effects of dieting and exercise on resting metabolic rate (RMR) in overweight women (N=10). Results showed that dieting lowered RMR by nearly double that expected on the basis of resulting weight loss; and that exercise caused RMR to rise to a level appropriate to prevailing body weight. (LLL)

  19. Mexican American Adolescent Couples Communicating about Conflict: An Integrated Developmental and Cultural Perspective

    Science.gov (United States)

    Rueda, Heidi Adams; Williams, Lela Rankin

    2016-01-01

    Using observational methods on a small sample of committed Mexican American couples (N = 10, ages 15-17, M length of relationship = 26.5 months), we describe and categorize developmental and cultural communication patterns concerning the negotiation of conflict issues. Videotaped dyadic interactions were transcribed and qualitatively coded using…

  20. Effect of a Hippotherapy Intervention Program on Static Balance and Strength in Adolescents with Intellectual Disabilities

    Science.gov (United States)

    Giagazoglou, Paraskevi; Arabatzi, Fotini; Dipla, Konstantina; Liga, Maria; Kellis, Eleftherios

    2012-01-01

    The aim of this study was to assess the effects of a hippotherapy program on static balance and strength in adolescents with intellectual disability (ID). Nineteen adolescents with moderate ID were assigned either an experimental group (n = 10) or a control group (n = 9). The experimental group attended a 10-week hippotherapy program. To assess…

  1. Attentional processes of high-skilled soccer players with congenital hemiparesis: Differences related to the side of the hemisperic lesion

    NARCIS (Netherlands)

    Steenbergen, B.; Kamp, J. van der

    2008-01-01

    We investigated attentional processes that support the performance of high-skilled soccer players with hemiparetic cerebral palsy. Participants (N = 10) dribbled a slalom course as quickly and accurately as possible under two attentional-focus manipulation conditions. In the task-relevant focus

  2. Acute fatigue-induced changes in muscle mechanical properties and neuromuscular activity in elite handball players following a handball match

    DEFF Research Database (Denmark)

    Thorlund, Jonas Bloch; Michalsik, L B; Madsen, Klavs

    2008-01-01

    The purpose of the present study was to determine the acute fatigue development in muscle mechanical properties and neuromuscular activity in response to handball match play. Male elite handball players (n = 10) were tested before and after a simulated handball match for maximal isometric strength...... work (6.8%, P handball match play, which...

  3. Evaluation of Children with Selective Mutism and Social Phobia: A Comparison of Psychological and Psychophysiological Arousal

    Science.gov (United States)

    Young, Brennan J.; Bunnell, Brian E.; Beidel, Deborah C.

    2012-01-01

    Although children with social phobia (SP) and selective mutism (SM) present similarly in a clinical setting, it remains unclear whether children with SM are unable to speak due to overwhelming anxiety, or whether withholding speech functions as an avoidance mechanism. A total of 35 children (ages 5-12 years) with either SM (n = 10), SP (n = 11),…

  4. The Use of the Bilingual Aphasia Test for Assessment and Transcranial Direct Current Stimulation to Modulate Language Acquisition in Minimally Verbal Children with Autism

    Science.gov (United States)

    Schneider, Harry D.; Hopp, Jenna P.

    2011-01-01

    Minimally verbal children with autism commonly demonstrate language dysfunction, including immature syntax acquisition. We hypothesised that transcranial direct current stimulation (tDCS) should facilitate language acquisition in a cohort (n = 10) of children with immature syntax. We modified the English version of the Bilingual Aphasia Test (BAT)…

  5. Perkutan endoskopisk gastrostomisonde hos børn med cancer

    DEFF Research Database (Denmark)

    Barlaug, Mari; Kruse, Aksel; Schrøder, Henrik

    2008-01-01

    (n=10). Eight tubes were changed, and eight tubes were removed due to complications. 85% of the inflammations were related to neutropenia. There was a significant (p=0,0006) decrease in the median weight-for-age standard deviation score (SDS) of 0, 70 (-1,12; -0,28) from the time of diagnosis...... during periods of neutropenia. Udgivelsesdato: 2008-Jun-2...

  6. Methodic recommendations on ultrasonic testing of pipeline austenitic butt joints

    International Nuclear Information System (INIS)

    Grebennik, V.S.; Lantukh, V.M.; Tajts, M.Z.; Ermolov, I.N.; Volkov, A.S.; Vyatskov, I.A.; Kesler, N.A.; Shchedrin, I.F.

    1989-01-01

    Recommendations for the application of ultrasonic testing of austenitic welded joints of the Du 500 pipelines with the walls 32-34 mm thick made of steel Kh18N10T are developed. The optimal values of the main parameters of ultrasonic testing are determined experimentally. Principles of calculation of the optimal parameters are considered. 1 ref.; 4 figs

  7. A comparison of microhardness of indirect composite restorative materials

    DEFF Research Database (Denmark)

    Miranda, Carolina Baptista; Pagani, Clóvis; Bottino, Marco Cícero

    2003-01-01

    The purpose of this study was to compare the microhardness of four indirect composite resins. Forty cylindrical samples were prepared according to the manufacturer’s recommendations using a Teflon mold. Ten specimens were produced from each tested material, constituting four groups (n=10) as foll...... esthetics and adequate mechanical properties may be considered as substitutes of natural teeth....

  8. Co-ingestion of a protein hydrolysate with or without additional leucine effectively reduces postprandial blood glucose excursions in type 2 diabetic men

    NARCIS (Netherlands)

    Manders, R.J.; Koopman, R.; Sluijsmans, W.E.; Berg, R. van den; Verbeek, K.; Saris, W.H.; Wagenmakers, A.J.; Loon, L.J. van

    2006-01-01

    This study examined postprandial plasma insulin and glucose responses after co-ingestion of an insulinotropic protein (Pro) hydrolysate with and without additional free leucine with a single bolus of carbohydrate (Cho). Male patients with long-standing Type 2 diabetes (n = 10) and healthy controls

  9. Diurnal variability of upper ocean temperature and heat budget in ...

    Indian Academy of Sciences (India)

    Time-series data on upper-ocean temperature, Vessel-Mounted Acoustic Doppler Current Profiler (VM-ADCP) measured currents and surface meteorological parameters have been obtained for the first time in the southern Bay of Bengal at 7° N, 10° N, and 13° N locations along 87° E during October - November, 1998 ...

  10. Stenosis differentially affects subendocardial and subepicardial arterioles in vivo

    NARCIS (Netherlands)

    Merkus, D.; Vergroesen, I.; Hiramatsu, O.; Tachibana, H.; Nakamoto, H.; Toyota, E.; Goto, M.; Ogasawara, Y.; Spaan, J. A.; Kajiya, F.

    2001-01-01

    The presence of a coronary stenosis results primarily in subendocardial ischemia. Apart from the decrease in coronary perfusion pressure, a stenosis also decreases coronary flow pulsations. Applying a coronary perfusion system, we compared the autoregulatory response of subendocardial (n = 10) and

  11. Application of biocatalysis in synthetic chemistry

    CSIR Research Space (South Africa)

    Brady, D

    2006-11-01

    Full Text Available 20 25 30 35 40 45 50 0 1 2 3 4 5 6 Time (h) C o n v e r s i o n ( % ) 10 units 20 Units 30 Units Slide 13 © CSIR 2006 www.csir.co.za Thermostable lipase – ESL 001 73.50 76.62 79.75 82.88 86...

  12. Vastus lateralis single motor unit EMG at the same absolute torque production at different knee angles

    NARCIS (Netherlands)

    Altenburg, T.M.; de Haan, A.; Verdijk, P.W.; van Mechelen, W.; de Ruiter, C.J.

    2009-01-01

    Single motor unit electromyographic (EMG) activity of the knee extensors was investigated at different knee angles with subjects (n = 10) exerting the same absolute submaximal isometric torque at each angle. Measurements were made over a 20° range around the optimum angle for torque production

  13. Effect of opium on glucose metabolism and lipid profiles in rats with streptozotocin-induced diabetes

    NARCIS (Netherlands)

    Sadeghian, Saeed; Boroumand, Mohammad Ali; Sotoudeh-Anvari, Maryam; Rahbani, Shahram; Sheikhfathollahi, Mahmood; Abbasi, Ali

    2009-01-01

    Background: This experimental study was performed to determine the impact of opium use on serum lipid profile and glucose metabolism in rats with streptozotocin-induced diabetes. Material and methods: To determine the effect of opium, 20 male rats were divided into control (n = 10) and opium-treated

  14. Descubriendo el electromagnetismo

    OpenAIRE

    Moreno Gómez, Esteban; López Sancho, José María; Cejudo Rodríguez, Salomé

    2015-01-01

    Película de dibujos animados con audio. Baja resolución (300 px.). Duración 10 minutos y 35 segundos. Formato MP4. LOW RESOLUTION VIDEO, FOR HIGH RESOLUTION VISIT: http://www.kids.csic.es/cuentos/cuentos.html

  15. Plasma Concentrations of Fentanyl Achieved With Transdermal Application in Chickens

    NARCIS (Netherlands)

    Delaski, Kristina M; Gehring, Ronette; Heffron, Brendan T; Negrusz, Adam; Gamble, Kathryn C

    2017-01-01

    Providing appropriate analgesia is an important concern in any species. Fentanyl, a μ-receptor specific opioid, use is common in mammalian species but has been incompletely evaluated for this purpose in avian species. Transdermal fentanyl patches were applied to domestic chickens (n = 10) of varying

  16. Most and Least Helpful Events in Three Supervision Modalities

    Science.gov (United States)

    Fickling, Melissa J.; Borders, L. DiAnne; Mobley, Keith A.; Wester, Kelly

    2017-01-01

    The authors conducted a content analysis of supervisors' (n = 10) and supervisees' (n = 31) descriptions (n = 707) of most and least helpful significant events in individual, group, and triadic supervision across 1 semester. Categories by group for each modality and areas of agreement and disagreement are highlighted.

  17. Intimate Relationships across ethnic borders in the globalised world

    DEFF Research Database (Denmark)

    Singla, Rashmi

    2016-01-01

    and counseling based primarily on an explorative study A theoretical framework consisting of intersectionality approach combined with everyday life management and life course forms the basis of the study. The participants (n=10) are ‘ordinary’ persons in mixed relationships where one partner is from South Asia...

  18. An ion-imprinted polymer for the selective extraction of mercury(II ...

    African Journals Online (AJOL)

    that meets the monitoring requirements for the USA EPA of 2 000 ng/. for Hg2+ in drinking water. Generally, the data (n=10) had percentage relative standard deviations (%RSD) of less than 4%. Satisfactory results were also obtained when the prepared sorbent was applied for the pre-concentration of Hg2+ from an

  19. Effect of vitamin C on N,N′-dimethyl-4,4′-bipyridinium dichloride ...

    African Journals Online (AJOL)

    Purpose: To evaluate the effectiveness of vitamin C on paraquat-induced hepatic and renal toxicity in Swiss albino mice. Methods: Three groups of Swiss albino mice (n = 10), i.e., control, paraquat (15 mg/kg) and paraquat (15 mg/kg) + vitamin C (20 mg/kg) were used in the study. The drugs were administered ...

  20. A Randomized Controlled Trial of Local Heat Therapy Versus Intravenous Sodium Stibogluconate for the Treatment of Cutaneous Leishmania Major Infection

    Science.gov (United States)

    2010-01-01

    solely on patient evaluation. This difference was not found in the analysis using blinded reading of photographs where the efficacy by treatment was...Disorders n (%) 10 (37) 15 (56) 0.28 EKG changes 10 (37) 14 (52) 0.41 Chest pain 0 (0) 3 (11) 0.24 Palpitations 0 (0) 1 (4) 0.99 Gastrointestinal n (%) 3 (11

  1. The effect of recombinant growth hormone on intestinal anastomotic wound healing in rats with obstructive jaundice.

    Science.gov (United States)

    Cağlikülekçi, Mehmet; Ozçay, Necdet; Oruğ, Taner; Aydoğ, Gülden; Renda, Nurten; Atalay, Fuat

    2002-03-01

    Several clinical and experimental studies have shown that obstructive jaundice delays wound healing. Growth hormone may prevent delayed wound healing, since it has effects on the release of mediators in jaundice, as well as increasing the protein synthesis. Forty male Wistar rats were allocated to four groups: Group I (n=10): intestinal anastomosis to normal small bowel, Group II (n=10): intestinal anastomosis to normal small bowel followed by growth hormone therapy (2mg/kg/day, subcutaneously), Group III (n=10): intestinal anastomosis to obstructive jaundice rat's small bowel, Group IV (n=10): intestinal anastomosis to obstructive jaundice rat's small bowel followed by growth hormone therapy at the same dosage The animals were observed for seven days then killed. Intraabdominal adhesions, anastomotic complications and anastomotic bursting pressures were recorded and tissue samples from the anastomotic site were obtained to measure hydroxyproline levels and for histopathologic examination. Growth hormone had a beneficial effect on the healing of intestinal anastomosis in both jaundiced and non-jaundiced rats. This was demonstrated by clinical and mechanical parameters such as a significant increase in anastomotic bursting pressure, hydroxyproline content and histopathological scores. Growth hormone reverses the adverse effects of obstructive jaundice on small bowel anastomotic healing. It can be hypothesized that this effect is due to augmentation of insulin-like growth factors, protection of hepatocytes, enhancement of intestinal epithelization, and reversal of the resultant malnutritional state caused by growth hormone in obstructive jaundice.

  2. 78 FR 48182 - 60-Day Notice of Proposed Information Collection: Promise Zones

    Science.gov (United States)

    2013-08-07

    ... initiative, the federal government will invest and partner with high-poverty urban, rural, and tribal... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5690-N-10] 60-Day Notice of Proposed... Officer, QDAM, Department of Housing and Urban Development, 451 7th Street SW., Room 4176, Washington, DC...

  3. Driving Performance among Bioptic Telescope Users with Low Vision Two Years after Obtaining Their Driver's License: A Quasi-Experimental Study

    Science.gov (United States)

    Vincent, Claude; Lachance, Jean-Paul; Deaudelin, Isabelle

    2012-01-01

    This study sought to compare road safety of new drivers with low vision who have followed a specific pilot bioptic training program with other groups of drivers all matched for age and driving experience. A quasi-experimental design was used two years after drivers obtained their license. Drivers were classified in the experimental group (n = 10,…

  4. Effect of contraction mode of slow-speed resistance training on the maximum rate of force development in the human quadriceps

    DEFF Research Database (Denmark)

    Blazevich, Anthony J; Horne, Sara; Cannavan, Dale

    2008-01-01

    This study examined the effects of slow-speed resistance training involving concentric (CON, n = 10) versus eccentric (ECC, n = 11) single-joint muscle contractions on contractile rate of force development (RFD) and neuromuscular activity (EMG), and its maintenance through detraining. Isokinetic...

  5. SwissProt search result: AK121588 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121588 J033037N10 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (A...cid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 1e-126 ...

  6. Effects of Enantia chlorantha extracts in Laboratory-Induced ...

    African Journals Online (AJOL)

    kg of various extracts of the herbal preparation or 30 – 100mg/kg aspirin or distilled water was administered to groups of rats of either sex (200 – 250g, n = 10). Each of the groups of rats then received 0.1ml of 1% of carrageen into the plantar ...

  7. Effect of feed supplementation with a-ketoglutarate, combined with vitamin B6 or C, on the performance and haemoglobin and amino acid levels in growing rats

    DEFF Research Database (Denmark)

    Pierzynowski, Stefan Grzegorz; Filip, Rafal; Harrison, Adrian Paul

    2007-01-01

    for 9 d (n=16) or 18 d (n=10). No significant differences in average daily gain (ADG), average daily feed intake (ADFI), or feed efficiency were seen between the dextrose-treated control group and the AKG treated groups. The highest ADG and ADFI were seen in the AKG 2B rats. The AKG 2B and AKG 2C...

  8. Abnormal umbilical artery Doppler velocimetry and placental ...

    African Journals Online (AJOL)

    fetal. Hence, DV provides information about the fetal side of the placenta and, alongside placental ... The study was prospective and conducted in a low-income setting. .... placental tissue (n=10), and some cases were lost to follow-up (n=6).

  9. Further Psychodrama with Delinquent Adolescents.

    Science.gov (United States)

    Carpenter, Patricia; Sandberg, Salek

    1985-01-01

    Adjusted delinquent adolescents (N=7) participated in a 12-session psychodramatic group therapy program which integrated behavioral-cognitive techniques. Participants and control subjects (N=10) completed pre- and post-tests measuring acting-out behavior and ego strength. Results showed that significant improvement occurred in the experimental…

  10. Characterisation of oral and i.v. glucose handling in truncally vagotomised subjects with pyloroplasty

    DEFF Research Database (Denmark)

    Plamboeck, Astrid; Veedfald, Simon; Deacon, Carolyn F

    2013-01-01

    =16) and matched controls (n=10) underwent 50 g-oral glucose tolerance test (OGTT)±vildagliptin, a DPP4 inhibitor (DPP4i) and isoglycaemic i.v. glucose infusion (IIGI), copying the OGTT without DPP4i. RESULTS: Isoglycaemia was obtained with 25±2 g glucose in vagotomised subjects and 18±2 g in controls...

  11. Amelioration of rCBF and PbtO2 following TBI at high altitude by hyperbaric oxygen pre-conditioning.

    Science.gov (United States)

    Hu, Shengli; Li, Fei; Luo, Haishui; Xia, Yongzhi; Zhang, Jiuquan; Hu, Rong; Cui, Gaoyu; Meng, Hui; Feng, Hua

    2010-03-01

    Hypobaric hypoxia at high altitude can lead to brain damage and pre-conditioning with hyperbaric oxygen (HBO) can reduce ischemic/hypoxic brain injury. This study investigates the effects of high altitude on traumatic brain injury (TBI) and examines the neuroprotection provided by HBO preconditioning against TBI. Rats were randomly divided into four groups: HBO pre-conditioning group (HBOP, n=10), high altitude group (HA, n=10), plain control group (PC, n=10) and plain sham operation group (sham, n=10). All groups were subjected to head trauma by weight drop device except for the sham group. Rats from each group were examined for neurological function, regional cerebral blood flow (rCBF) and brain tissue oxygen pressure (PbtO(2)) and were killed for analysis by transmission electron microscope. The score of neurological deficits in the HA group was highest, followed by the HBOP group and the PC group, respectively. Both rCBF and PbtO(2) were the lowest in the HA group. Brain morphology and structure seen via the transmission electron microscope was diminished in the HA group, while fewer pathological injuries occurred in the HBOP and PC groups. High altitude aggravates TBI significantly and HBO pre-conditioning can attenuate TBI in rats at high altitude by improvement of rCBF and PbtO(2). Pre-treatment with HBO might be beneficial for people traveling to high altitude locations.

  12. Working group report: Neutrino and astroparticle physics

    Indian Academy of Sciences (India)

    explaining the origin of dark energy in the context of supersymmetric ADD models. Below we .... light fermions so that the effective ultraviolet cut-off is much greater than TeV and the FCNC's are ..... Cl vs. l for constant mass and n = 10. 1402.

  13. Effect of Three Calmodulin Antagonists on Subpopulations of CD44 ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research is indexed by Science Citation Index (SciSearch), Scopus,. International Pharmaceutical ... cancer stem cells. It is not known, however, whether targeting CD44 can alter the fate of cancer stem cells themselves. In this study, the effect of the calmodulin antagonists (N-(10-.

  14. Intimacies Across Borders: ‘Gaze’ and Gender Perspectives in Round table

    DEFF Research Database (Denmark)

    Singla, Rashmi

    identity and transnational relations are also included. The explorative study is based on depth interviews with ‘ordinary’ persons in mixed marriage (n = 10). The contextual tension between the concepts of ethnicity and ‘race’ related to the ‘visible differences’ is also a part of the framework...

  15. The effect of shot biopsy on behavior, salivary cortisol, and heart rate in slaughter pigs

    NARCIS (Netherlands)

    Geverink, NA; Ruis, MAW; Eisen, R; Lambooij, E; Blokhuis, HJ; Wiegant, VM

    This paper describes behavioral and. physiological responses of pigs to shot biopsy, an experimental method used to study muscle tissue processes or to:predict meat quality. One biopsy sample from the longissimus muscle was obtained from 23-wk-old gilts (n = 10) using a cannula connected to a

  16. Early Maternal Employment and Children's School Readiness in Contemporary Families

    Science.gov (United States)

    Lombardi, Caitlin McPherran; Coley, Rebekah Levine

    2014-01-01

    This study assessed whether previous findings linking early maternal employment to lower cognitive and behavioral skills among children generalized to modern families. Using a representative sample of children born in the United States in 2001 (N = 10,100), ordinary least squares regression models weighted with propensity scores assessed links…

  17. AFJU OFC 18(3).indd

    African Journals Online (AJOL)

    imac-3

    to 88 years, with a male to female ratio of 4 to 1. ... visual internal urethrotomy (n = 86), endoscopic cystolitholapaxy (n = 10), and rigid retrograde endoscopic ... Surgical trainees can benefit by learning the technique of caudal ... less performed in our environment because of high cost of procur- ... Urethral stricture. 87 (19.8).

  18. Effect of water quality parameters on the distribution of Pleuromamma (Copepoda-Calanoida) species in the Indian Ocean: A statistical approach

    Digital Repository Service at National Institute of Oceanography (India)

    Jayalakshmy, V.K.; Saraswathy, M.; Nair, M.

    degrees N, 10 degrees N to 10 degrees S, 10 degrees S to 30 degrees S, along the Somali Coast (38 degrees S-40 degrees S) and a fifth region along the western boundary of the above four regions. Relation between Pleuromamma species` abundance and the water...

  19. Long-term musculoskeletal and cardiac health effects of recreational football and running for premenopausal women

    DEFF Research Database (Denmark)

    Krustrup, Peter; Hansen, Peter Riis; Andersen, Lars Juel

    2010-01-01

    We examined long-term musculoskeletal and cardiac adaptations elicited by recreational football (FG, n=9) and running (RG, n=10) in untrained premenopausal women in comparison with a control group (CG, n=9). Training was performed for 16 months ( approximately 2 weekly 1-h sessions). For FG, right...

  20. Monocular and binocular development in children with albinism, infantile nystagmus syndrome, and normal vision

    NARCIS (Netherlands)

    Huurneman, B.; Boonstra, F.N.

    2013-01-01

    Abstract Background/aims: To compare interocular acuity differences, crowding ratios, and binocular summation ratios in 4- to 8-year-old children with albinism (n = 16), children with infantile nystagmus syndrome (n = 10), and children with normal vision (n = 72). Methods: Interocular acuity

  1. Different Muscle Action Training Protocols on Quadriceps-Hamstrings Neuromuscular Adaptations.

    Science.gov (United States)

    Ruas, Cassio V; Brown, Lee E; Lima, Camila D; Gregory Haff, G; Pinto, Ronei S

    2018-05-01

    The aim of this study was to compare three specific concentric and eccentric muscle action training protocols on quadriceps-hamstrings neuromuscular adaptations. Forty male volunteers performed 6 weeks of training (two sessions/week) of their dominant and non-dominant legs on an isokinetic dynamometer. They were randomly assigned to one of four groups; concentric quadriceps and concentric hamstrings (CON/CON, n=10), eccentric quadriceps and eccentric hamstrings (ECC/ECC, n=10), concentric quadriceps and eccentric hamstrings (CON/ECC, n=10), or no training (CTRL, n=10). Intensity of training was increased every week by decreasing the angular velocity for concentric and increasing it for eccentric groups in 30°/s increments. Volume of training was increased by adding one set every week. Dominant leg quadriceps and hamstrings muscle thickness, muscle quality, muscle activation, muscle coactivation, and electromechanical delay were tested before and after training. Results revealed that all training groups similarly increased MT of quadriceps and hamstrings compared to control (p0.05). These findings suggest that different short-term muscle action isokinetic training protocols elicit similar muscle size increases in hamstrings and quadriceps, but not for other neuromuscular variables. Nevertheless, effect sizes indicate that CON/ECC and ECC/ECC may elicit the greatest magnitude of change in muscle hypertrophy. © Georg Thieme Verlag KG Stuttgart · New York.

  2. Interpreting Rape: Differences Among Professionals and Non-Professional Resources.

    Science.gov (United States)

    Calhoun, Lawrence G.

    Physicians and rape crisis counselors may play important roles in assisting a rape victim; their beliefs and perceptions about rape may influence their treatment of the victim. Physicians (N=10) and volunteer rape counselors (N=44) completed questionnaires focused on demographic characteristics, their experiences with rape victims, and personal…

  3. The effect of arm and wrist supports on the load of the upper extremity during VDU work

    NARCIS (Netherlands)

    Visser, B.; de Korte, E.; van der Kraan, I.; Kuijer, P. [=P. Paul F. M.

    2000-01-01

    To evaluate the effectiveness of arm and wrist supports in reducing the workload during computer work. Female subjects (n=10) performed computer work in conditions with arm or wrist supports and in a condition without supports. Sustained muscle tension in the trapezius muscle is a risk factor for

  4. The effect of arm and wrist supports on the load of he upper extrimity during VDU work

    NARCIS (Netherlands)

    Visser, B.; de Korte, E.; van der Kraan, I.; Kuijer, P.

    2000-01-01

    Objective. To evaluate the effectiveness of arm and wrist supports in reducing the workload during computer work. Design. Female subjects (n=10) performed computer work in conditions with arm or wrist supports and in a condition without supports. Background. Sustained muscle tension in the trapezius

  5. Occurrence of diploid and polyploid microspores in Sorghum bicolor ...

    African Journals Online (AJOL)

    Analysis of 230 pollen mother cells at first metaphase stage showed 73.91% haploid (n=10), 10.43% diploid (n=20), ... Pollen diameters showed that the cytomictic cells differed from the normal cells. These results ... HOW TO USE AJOL.

  6. Raising the Curtain: Exploring Dancers’ Perceptions of Obligation through the Psychological Contract Lens

    Science.gov (United States)

    Stanway, Alicia R.; Bordia, Sarbari; Fein, Erich C.

    2013-01-01

    The current study takes an exploratory approach to investigate which situational factors influence perceptions of psychological contracts, as well as the content that comprises psychological contracts in the dance training industry. Semi-structured interviews ("n"?=?10) were conducted with students enrolled in a higher education…

  7. Evaluation of peritoneal endometriosis treatment using intralesional acetylsalicylic acid injection in rabbits.

    Science.gov (United States)

    Saad-Hossne, Rogério; Barretto, Adriana Beatriz; Siqueira, Juliana Menezes; Denadai, Rafael

    2016-04-01

    To investigate the efficacy of intralesional 20% aspirin injection for treatment of experimental peritoneal endometriosis. Peritoneal endometriosis was experimentally induced in forty adult nulligravid female rabbits. On day 30 post-endometriosis induction, rabbits were randomly divided to assess early (10 days) and late (20 days) effects of intralesional injection of physiological saline solution (control groups) in comparison to intralesional injection of 20% bicarbonate aspirin solution (experimental groups) as follows: control group 1 (10 days, n=10); control group 2 (20 days, n=10); experimental group 3 (10 days, n=10); experimental group 4 (20 days, n=10). Resected tissues, including endometriosis foci, were qualitatively (general morphology and signs of inflammatory cells infiltrate, necrosis and apoptosis) and quantitatively (remaining endometriosis area) assessed by histopathological analysis. Extensive necrosis, hemorrhage, apoptosis, and fibrosis were observed in the experimental groups 3 and 4. Groups 1 and 2 presented typical endometrial tissue cysts, respectively. Groups 3 and 4 showed sparse endometrial tissue foci and no endometrial tissue, respectively. Quantitative analysis revealed that aspirin-treated groups 3 and 4 had significantly (pendometriosis area, compared to control groups 1 and 2. Intralesional 20% aspirin injection caused total destruction of peritoneal endometriosis foci in rabbits.

  8. Enkele polycyclische aromatische koolwaterstoffen (PAH) en stikstofhoudende analoga (N-PAH) in levensmiddelen en ander biologisch materiaal

    NARCIS (Netherlands)

    Vaessen; H.A.M.G.; Wilbers; A.A.M.M.; Jekel; A.A..nf

    1986-01-01

    Beschreven worden de resultaten van het onderzoek van margarine en halvarine (N=28), rundernieren (N=6), maiskiemen (N=1), "vet" uit overstortputjes (N=1), spinazie (N=5), boerenkool (N=8), mosselen (N=10), brood (N=4) en duplicaten van 24-uurs voeding (N=6) op gehalte aan

  9. Heavy metals in the ecosystem components at 'Degelen' testing ground of the former Semipalatinsk test site

    International Nuclear Information System (INIS)

    Yankauskas, A.B.; Lukashenko, S.N.; Amirov, A.A.; Govenko, P.V.

    2012-01-01

    The ecological situation in the former Semipalatinsk test site is characterized by a combination of both radiative and nonradiative factors. There were investigated near-portal areas of the tunnels with water seepage at 'Degelen' site. All the tunnel waters are characterized by higher concentrations of uranium, beryllium, and molybdenum. The watercourse of the tunnel number 504 is unique for its elemental composition, in particular, the content of rare earth elements, whose concentration in the water is in the range n*10 -5 -n*10 -7 %. Of all the rare earth elements in the samples were found 13, the concentrations of aluminum, manganese, zinc are comparable to the concentrations of macro-components. Concentration of 238 U in the studied waters lie in the range of n*10 -4 - n*10 -6 %, which suggests the influence of uranium, not only as a toxic element, but its significance as the radiation factor. The analysis of complex data obtained showed that the elevated concentrations of heavy metals in the soils of the areas under study, as a rule, are a consequence of the carry-over of these metals by water flows and their subsequent deposition in the sediments. (authors)

  10. Extending a Community of Care beyond the Ninth Grade: A Follow-Up Study

    Science.gov (United States)

    Ellerbrock, Cheryl R.; Kiefer, Sarah M.

    2013-01-01

    This qualitative within-site case study ("N" = 10) is a follow-up study to a 2006-2007 investigation that analyzed how 1 high school created a community of care for its ninth-grade students through the implementation of a ninth-grade transition program--Freshman Focus. All participants were interviewed again 3 years later during…

  11. US Military Nurses: Experience of Coming Home after Iraq and Afghanistan

    Science.gov (United States)

    2013-11-25

    1) Command Support, 2) reintegration briefings as Check the Blocks, 3) Stress of Being Home, 4) They Dont Understand if they havent deployed and 5...Investigator: Rivers, Felecia USU Project Number: N10-C05 19 Poster Presentations Authors: Rivers, F., Gordon, S., Speraw, S., Reese, S., Wilson

  12. Study quality on groin injury management remains low

    DEFF Research Database (Denmark)

    Serner, Andreas; van Eijck, Casper H; Beumer, Berend R

    2015-01-01

    : Nine medical databases were searched in May 2014. INCLUSION CRITERIA: treatment studies in athletes with groin pain; randomised controlled trials, controlled clinical trials or case series; n>10; outcome measures describing number of recovered athletes, patient satisfaction, pain scores or functional...

  13. Transforming Growth Factor Beta Signaling in Growth of Estrogen-Insensitive Metastatic Bone Lesions

    Science.gov (United States)

    2012-01-01

    osteolytic lesion areas. Corresponding 3D micro-CT images (bottom row). n=10 animals per treatment group. (B) Kaplan -meyer survival curve demonstrating...Gilks B, Yorida E, Cheang M, Turbin D, Gelmon K, Huntsman DG. Coexpression of the type 1 growth factor receptor family members HER-1, HER-2, and HER-3

  14. Multicentre comparison of a diagnostic assay

    DEFF Research Database (Denmark)

    Waters, Patrick; Reindl, Markus; Saiz, Albert

    2016-01-01

    ) assays in neuromyelitis optica spectrum disorders (NMOSD). METHODS: Coded samples from patients with neuromyelitis optica (NMO) or NMOSD (101) and controls (92) were tested at 15 European diagnostic centres using 21 assays including live (n=3) or fixed cell-based assays (n=10), flow cytometry (n=4...

  15. Radiography with neutrons: use in inspection of hydrogenated materials

    International Nuclear Information System (INIS)

    Pugliesi, R.; Assuncao, M.P.M.

    1989-01-01

    Neutron radiography technique is used for showing the viability of inspecting hydrogenated materials. The experimental disposition is installed in irradiation radial channel n. 10 from IEA-R1 (IPEN-CNEN-SP). The inspetionated materials were munitions for gun and rifle. (C.G.C.)

  16. 76 FR 59066 - Notice of Regulatory Review Plan

    Science.gov (United States)

    2011-09-23

    ... [No. 2011-N-10] Notice of Regulatory Review Plan AGENCY: Federal Housing Finance Agency. ACTION... of and requesting comments on the FHFA interim regulatory review plan for review of existing... comments on all aspects of the interim regulatory review plan, including legal and policy considerations...

  17. FY 1999 report on the geothermal development promotion survey - Akinomiya area survey. Temperature/pressure logging before the long-term jetting test; 1999 nendo chinetsu kaihatsu sokushin chosa Akinomiya chiiki chosa hokokusho. Choki funshutsu shikenmae no ondo atsuryoku kenso

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-06-01

    As a part of the FY 1999 geothermal development promotion survey - Akinomiya area survey, the rising speed/vertical permeability of the fluid associated with the natural flow were calculated by grasping the temperature of geologic layers/reservoir pressure in the survey area and the temperature distribution for vertical depth. In the survey of boreholes in the Akinomiya area: N9-AY-3, N10-AY-6, N10-AY-7, N10-AY-8, temperature/pressure logging was conducted in the stationary state at the time when a lot of time passed after drilling, water-filling test and jetting test having been finished. In the temperature/pressure logging, the continued measurement was made using PTS logging device to simultaneously measure temperature/pressure/impeller revolution number and lowering measuring device. As a result of the survey, it was assumed that there is a possibility of occurrence of the borehole fluid flow around the depth of 980-1290m and 1320-1540m of N9-AY-3 and around the depth of 880-1090m of N10-AY-8. The rising speed and permeability of fluid from each well indicated the same order at three wells. (NEDO)

  18. Functional Near-Infrared Spectroscopy Brain Imaging Investigation of Phonological Awareness and Passage Comprehension Abilities in Adult Recipients of Cochlear Implants

    Science.gov (United States)

    Bisconti, Silvia; Shulkin, Masha; Hu, Xiaosu; Basura, Gregory J.; Kileny, Paul R.; Kovelman, Ioulia

    2016-01-01

    Purpose: The aim of this study was to examine how the brains of individuals with cochlear implants (CIs) respond to spoken language tasks that underlie successful language acquisition and processing. Method: During functional near-infrared spectroscopy imaging, CI recipients with hearing impairment (n = 10, mean age: 52.7 ± 17.3 years) and…

  19. Comparison of Technology Use between Biology and Physics Teachers in a 1:1 Laptop Environment

    Science.gov (United States)

    Crook, Simon J.; Sharma, Manjula D.; Wilson, Rachel

    2015-01-01

    Using a mixed-methods approach the authors compared the associated practices of senior physics teachers (n = 7) and students (n = 53) in a 1:1 laptop environment with those of senior biology teachers (n = 10) and students (n = 125) also in a 1:1 laptop environment, in seven high schools in Sydney, NSW, Australia. They found that the physics…

  20. Nocturnal foot blood flow in patients with arterial insufficiency

    DEFF Research Database (Denmark)

    Jelnes, Rolf; Tønnesen, K H

    1984-01-01

    Twenty-four hour continuous recording of xenon (133Xe) wash-out from the forefoot was performed on patients with normal circulations (n = 10) and on patients with different degrees of arterial insufficiency (n = 36). During day hours the calculated subcutaneous blood flow in the forefoot was on a...

  1. Effects of Equine Assisted Activities on Autism Spectrum Disorder

    Science.gov (United States)

    Lanning, Beth A.; Baier, Margaret E. Matyastik; Ivey-Hatz, Julie; Krenek, Nancy; Tubbs, Jack D.

    2014-01-01

    Quality of life assessments were used in this study to determine the behavioral changes of children diagnosed with autism spectrum disorder (ASD) who participated in equine assisted activities. Behavioral changes of children with ASD participating in 9 weeks of equines assisted activities (EAA) (N = 10) were compared to behavioral changes of…

  2. Prediction of Liquefaction Potential of Dredge Fill Sand by DCP and Dynamic Probing

    International Nuclear Information System (INIS)

    Alam, Md. Jahangir; Azad, Abul Kalam; Rahman, Ziaur

    2008-01-01

    From many research it is proved that liquefaction potential of sand is function of mainly relative density and confining pressure. During routine site investigations, high-quality sampling and laboratory testing of sands are not feasible because of inevitable sample disturbance effects and budgetary constraints. On the other hand quality control of sand fill can be done by determining in situ density of sand in layer by layer which is expensive and time consuming. In this paper TRL DCP (Transportation Research Laboratory Dynamic Cone Penetration) and DPL (Dynamic Probing Light) are calibrated to predict the relative density of sand deposit. For this purpose sand of known relative density is prepared in a calibration chamber which is a mild steel cylinder with diameter 0.5 m and height 1.0 m. Relative density of sand is varied by controlling height of fall and diameter of hole of sand discharge bowl. After filling, every time DPL and DCP tests are performed and for every blow the penetration of cone is recorded. N10 is then calculated from penetration records. Thus a database is compiled where N10 and relative densities are known. A correlation is made between N 10 and relative density for two types of sand. A good correlation of N 10 and relative density is found

  3. Memories of Childhood Sexual Abuse: Narrative Analyses of Types, Experiences, and Processes of Remembering

    Science.gov (United States)

    Crowley, M. Sue

    2007-01-01

    The study explored types of memory for childhood sexual abuse (CSA) in a clinical sample of 30 women and identified factors that led some women (n = 24) to report recovered memories. Questionnaires produced three types of memory: always (n = 6), recovered (n = 14), both (n = 10); however, analysis of narrative data also revealed the use of…

  4. Patterns and Correlates of Tic Disorder Diagnoses in Privately and Publicly Insured Youth

    Science.gov (United States)

    Olfson, Mark; Crystal, Stephen; Gerhard, Tobias; Huang, Cecilia; Walkup, James T.; Scahill, Lawrence; Walkup, John T.

    2011-01-01

    Objective: This study examined the prevalence and demographic and clinical correlates of children diagnosed with Tourette disorder, chronic motor or vocal tic disorder, and other tic disorders in public and private insurance plans over the course of a 1-year period. Method: Claims were reviewed of Medicaid (n = 10,247,827) and privately (n =…

  5. Hard Incongruence Between ITS and Plastid Phylogenetic Trees in Amaryllidaceae Tribe Hippeastreae (Asparagales)

    Science.gov (United States)

    Amaryllidaceae tribe Hippeastreae constitutes a horticulturally valuable group of American endemics, characterized by disploidy and polyploidy (x = 5, 6, 8, 9, 10, 11, 12; 2n = 10-150). It is a clade putatively descended (in part) from an ancient hybridization event. Its taxonomy at the generic leve...

  6. Effects Of Chloroquine On Some Visceral Organs In The Rabbit ...

    African Journals Online (AJOL)

    Effects Of Chloroquine On Some Visceral Organs In The Rabbit: Histopathological Perspective. ... Journal of Experimental and Clinical Anatomy ... 60 and 90 days in the albino (n=10) and pigmented (n=22) rabbits, with mean weight value of 1.40 ± 0.44kg and mean age value of 9.0 ± 0.25 months were investigated in the ...

  7. 76 FR 4569 - Market-Based Rate Affiliate Restrictions

    Science.gov (United States)

    2011-01-26

    ... assets and corporate finance.\\30\\ \\29\\ EEI Comments at 7-8. \\30\\ Id. at 8, n.10. 20. TAPS argues that the...) provide shared fuel procurement services within the corporate family when the Commission or a state... senior executives responsible for overseeing corporate activities from a family-wide perspective and who...

  8. Bacterial contribution to mitigation of iron and manganese in mangrove sediments

    Digital Repository Service at National Institute of Oceanography (India)

    Krishnan, K.P.; Fernandes, S.O.; Chandan, G.S.; LokaBharathi, P.A.

    of their response to the metal enrichment. They could thus contribute towards maintaining the level of Mn at par with reference levels at Chapora. A positive correlation between Mn with NtB (n = 10, p is less than 0.05, r = 0.58) at the experimental site during...

  9. Bioavailability of folate from processed spinach in humans

    NARCIS (Netherlands)

    Castenmiller, J.J.M.; Poll, van de C.J.; West, C.E.; Brouwer, I.A.; Thomas, C.M.G.; Dusseldorp, van M.

    2000-01-01

    The effect of the food matrix and dietary fibre on the bioavailability of folate is not known. In a controlled, 3-week dietary intervention study, 28 men and 42 women were divided into six groups to receive either a control diet (n = 10), or the control diet plus 20 g/MJ per day (n = 12 per group)

  10. The Effects of Two Different Stretching Programs on Balance Control and Motor Neuron Excitability

    Science.gov (United States)

    Kaya, Fatih; Biçer, Bilal; Yüktasir, Bekir; Willems, Mark E. T.; Yildiz, Nebil

    2018-01-01

    We examined the effects of training (4d/wk for 6 wks) with static stretching (SS) or contract-relax proprioceptive neuromuscular facilitation (PNF) on static balance time and motor neuron excitability. Static balance time, H[subscript max]/M[subscript max] ratios and H-reflex recovery curves (HRRC) were measured in 28 healthy subjects (SS: n = 10,…

  11. Arabidopsis CDS blastp result: AK072243 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072243 J023003N10 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bispho...sphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 0.0 ...

  12. Uptake of faecal occult blood test colorectal cancer screening by different ethnic groups in the Netherlands

    NARCIS (Netherlands)

    Deutekom, M.; van Rijn, A. F.; Dekker, E.; Blaauwgeers, H.; Stronks, K.; Fockens, P.; Essink-Bot, M.-L.

    2009-01-01

    We investigated the participation rates in CRC screening with a FOBT among various ethnic groups in the Netherlands. Individuals (n = 10 054) were invited by mail and grouped by country of birth. Overall participation rate was 49%. Participation among ethnic minority groups was significantly lower

  13. EST Table: BJ982788 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BJ982788 E_FL_BmN-_10B19_F_0 10/09/28 89 %/130 aa ref|XP_002092788.1| GE14387 [Dros...ophila yakuba] gb|EDW92500.1| GE14387 [Drosophila yakuba] 10/08/28 89 %/130 aa FBpp0259397|DyakGE14387-PA 10

  14. Characterization of adult ghrelin and ghrelin receptor knockout mice under positive and negative energy balance

    Science.gov (United States)

    Ghrelin and the ghrelin receptor (GH secretagogue receptor, GHS-R) are believed to have important roles in energy homeostasis. We describe results from the first studies to be conducted in congenic (N10) adult ghrelin(-/-) and Ghsr(-/-) mice under conditions of both positive (high-fat diet) and nega...

  15. Effect of Virtual Reality Exposure and Aural Stimuli on Eye Contact, Directional Focus, and Focus of Attention of Novice Wind Band Conductors

    Science.gov (United States)

    Orman, Evelyn K.

    2016-01-01

    This study examined the effects of virtual reality immersion with audio on eye contact, directional focus and focus of attention for novice wind band conductors. Participants (N = 34) included a control group (n = 12) and two virtual reality groups with (n = 10) and without (n = 12) head tracking. Participants completed conducting/score study…

  16. Microscopic evaluation of implant platform adaptation with UCLA-type abutments: in vitro study

    Directory of Open Access Journals (Sweden)

    Vinícius Anéas RODRIGUES

    Full Text Available Abstract Introduction The fit between abutment and implant is crucial to determine the longevity of implant-supported prostheses and the maintenance of peri-implant bones. Objective To evaluate the vertical misfit between different abutments in order to provide information to assist abutment selection. Material and method UCLA components (N=40 with anti-rotational system were divided as follows: components usinated in titanium (n=10 and plastic components cast proportionally in titanium (n=10, nickel-chromium-titanium-molybdenum (n=10 and nickel-chromium (n=10 alloys. All components were submitted to stereomicroscope analysis and were randomly selected for characterization by SEM. Result Data were analyzed using mean and standard deviation and subjected to ANOVA-one way, where the groups proved to statistically different (p=<0.05, followed by Tukey’s test. Conclusion The selection of material influences the value of vertical misfit. The group machined in Ti showed the lowest value while the group cast in Ni Cr showed the highest value of vertical misfit.

  17. Mentoring and Tutoring Your Students through Self-Assessment

    Science.gov (United States)

    McDonald, Betty

    2013-01-01

    This paper describes practical procedures in mentoring/tutoring students through self-assessment (SA) to establish and maintain partnership in learning. High school teachers ("n"?=?10) allow their students ("N"?=?515: 359 males) to engage in activities that help them identify standards and/or criteria to apply to their work and…

  18. Parental Stress, Coping Strategies and Social Support in Families of Children with a Disability

    Science.gov (United States)

    Cuzzocrea, Francesca; Murdaca, Anna Maria; Costa, Sebastiano; Filippello, Pina; Larcan, Rosalba

    2016-01-01

    The aim of this research was to compare parental stress, coping strategies and social support perceived in families of children with low functioning autism (n = 8), high functioning autism (n = 10), Down syndrome (n = 12) and parents of typically developing children (n = 20). Specifically, the objective was to investigate which variables (coping…

  19. To read or not to read

    NARCIS (Netherlands)

    Mol, Suzanne Elizabeth

    2010-01-01

    There is a widely held belief that reading (story)books makes us smarter and helps promote success in life. Does scientific evidence support this notion? The three meta-analyses in this thesis comprise 146 studies between 1988 and 2010 (N=10,308 participants) that addressed the role of book reading

  20. Serological evidence of influenza a viruses in frugivorous bats from Africa

    NARCIS (Netherlands)

    G.S. Freidl (Gudrun); T. Binger (Tabea); M.A. Müller (Marcel); E.I. de Bruin (Esther); J. van Beek (Janko); V.M. Corman (Victor); A. Rasche (Andrea); J.-F. Drexler (Jan-Felix); Sylverken, A. (Augustina); S. Oppong (Samuel); Y. Adu-Sarkodie (Yaw); M. Tschapka (Marco); V.M. Cottontail (Veronika); C. Drosten (Christian); M.P.G. Koopmans D.V.M. (Marion)

    2015-01-01

    textabstractBats are likely natural hosts for a range of zoonotic viruses such as Marburg, Ebola, Rabies, as well as for various Corona- and Paramyxoviruses. In 2009/10, researchers discovered RNA of two novel influenza virus subtypes - H17N10 and H18N11 - in Central and South American fruit bats.

  1. Elder Abuse among African Americans

    Science.gov (United States)

    Tauriac, Jesse J.; Scruggs, Natoschia

    2006-01-01

    Perceptions of extreme, moderate, and mild forms of elder abuse among African-American women (n=25) and men (n=10) were examined. African-American respondents emphasized physical abuse when giving examples of extremely abusive behavior. Along with physical abuse, verbal abuse was the most frequently identified form of abuse, and was significantly…

  2. Ceramic inlays : effect of mechanical cycling and ceramic type on restoration-dentin bond strength

    NARCIS (Netherlands)

    Trindade, F.Z.; Kleverlaan, C.J.; da Silva, L.H.; Feilzer, A.J.; Cesar, P.F.; Bottino, M.A.; Valandro, L.F.

    2016-01-01

    This study aimed to evaluate the bond strength between dentin and five different ceramic inlays in permanent maxillary premolars, with and without mechanical cycling. One hundred permanent maxillary premolars were prepared and divided into 10 groups (n=10) according to the ceramic system (IPS e.Max

  3. Isometric muscle strength and mobility capacity in children with cerebral palsy

    NARCIS (Netherlands)

    Dallmeijer, Annet J.; Rameckers, Eugene A.; Houdijk, Han; de Groot, Sonja; Scholtes, Vanessa A.; Becher, Jules G.

    2017-01-01

    Purpose: To determine the relationship between isometric leg muscle strength and mobility capacity in children with cerebral palsy (CP) compared to typically developing (TD) peers. Method: Participants were 62 children with CP (6-13 years), able to walk with (n=10) or without (n=52) walking aids,

  4. African American Social Work Faculty: Overcoming Existing Barriers and Achieving Research Productivity

    Science.gov (United States)

    Allen, Junior Lloyd; Huggins-Hoyt, Kimberly Y.; Holosko, Michael J.; Briggs, Harold E.

    2018-01-01

    Purpose: This study explored the scholarship experiences of top-ranked African American faculty in schools of social work. Method: Qualitative interviews were conducted with N = 10 top-ranked African American faculty identified as achieving considerable productivity and impact of scholarship. Findings: Four major themes were identified, each of…

  5. Head Injuries in School-Age Children Who Play Golf

    Science.gov (United States)

    Reuter-Rice, Karin; Krebs, Madelyn; Eads, Julia K.

    2016-01-01

    Traumatic brain injury (TBI) is the leading cause of death and disability in children. We conducted a prospective study, which examined injury characteristics and outcomes of school-age children of 5.0-15.0 years (N = 10) who were admitted to hospital for a TBI. This study evaluated the role of age, gender, the Glasgow Coma Scale, mechanisms and…

  6. The Effect of Biological Movement Variability on the Performance of the Golf Swing in High- and Low-Handicapped Players

    Science.gov (United States)

    Bradshaw, Elizabeth J.; Keogh, Justin W. L.; Hume, Patria A.; Maulder, Peter S.; Nortje, Jacques; Marnewick, Michel

    2009-01-01

    The purpose of this study was to examine the role of neuromotor noise on golf swing performance in high- and low-handicap players. Selected two-dimensional kinematic measures of 20 male golfers (n = 10 per high- or low-handicap group) performing 10 golf swings with a 5-iron club was obtained through video analysis. Neuromotor noise was calculated…

  7. Protective effects of udenafil citrate, piracetam and dexmedetomidine treatment on testicular torsion/detorsion-induced ischaemia/reperfusion injury in rats.

    Science.gov (United States)

    Tuglu, D; Yuvanc, E; Ozan, T; Bal, F; Yilmaz, E; Atasoy, P; Kisa, U; Batislam, E

    2016-08-01

    The aim of this study was to investigate the antioxidant properties of udenafil citrate (1.4 mg kg(-1) -2.8 mg kg(-1) ), dexmedetomidine 25 μg kg(-1) and piracetam 200 mg kg(-1) administered on ipsilateral/contralateral testes after ischaemia in a rat model of testicular torsion/detorsion (T/D) and define its protective effect histologically. Fifty-six Wistar albino rats were included and randomly assigned into 6 groups. No intervention was performed in control group (Group 1, n = 8) and in torsion/detorsion group, (Group 2, n = 8). Udenafil 1.4 mg kg(-1) was given to torsion/detorsion group (Group 3, n = 10), udenafil 2.8 mg kg(-1) was given to torsion/detorsion group (Group 4, n = 10), piracetam 200 mg kg(-1) was given to torsion/detorsion group (Group 5, n = 10) and dexmedetomidine 25 μg kg(-1) was given to torsion/detorsion group (Group 6, n = 10) intraperitoneally after 60 mins of testicular torsion. Biochemical and histopathological testicular injury were evaluated. When the tissue was examined by TOS values, Group 3, Group 4 and Group 5 were significantly lower than Group 2. In contrary Group 6 values were significantly higher than Group 2. The increasing doses of udenafil demonstrated antioxidant properties on the testis tissue and histopathological that protects the testicles. © 2015 Blackwell Verlag GmbH.

  8. Characterization of a Head-Only Aerosol Exposure System for Nonhuman Primates

    Science.gov (United States)

    2010-01-01

    Alicat Scientific). The flow used provided isokinetic sampling, assuming the presence of laminar flow at the filter inlet, so that the chamber...airflow measured at the chamber inlet using a Gilibrator flow meter (Sensidyne LP) was 29.79±0.88L/min (n= 10; CV=2.97%). With both the aerosol

  9. Myocardial hypoperfusion/reperfusion tolerance with exercise training in hypertension.

    Science.gov (United States)

    Reger, Patricia O; Barbe, Mary F; Amin, Mamta; Renna, Brian F; Hewston, Leigh Ann; MacDonnell, Scott M; Houser, Steven R; Libonati, Joseph R

    2006-02-01

    The purpose of this study was to examine whether exercise training, superimposed on compensated-concentric hypertrophy, could increase myocardial hypoperfusion-reperfusion (H/R) tolerance. Female Wistar-Kyoto rats (WKY) and spontaneously hypertensive rats (SHR) (age: 4 mo; N = 40) were placed into a sedentary (SED) or exercise training (TRD) group (treadmill running; 25 m/min, 1 h/day, 5 days/wk for 16 wk). Four groups were studied: WKY-SED (n = 10), WKY-TRD (n = 10), SHR-SED (n = 10), and SHR-TRD (n = 10). Blood pressure and heart rate were determined, and in vitro isolated heart performance was measured with a retrogradely perfused, Langendorff isovolumic preparation. The H/R protocol consisted of a 75% reduction in coronary flow for 17 min followed by 30 min of reperfusion. Although the rate-pressure product was significantly elevated in SHR relative to WKY, training-induced bradycardia reduced the rate-pressure product in SHR-TRD (P Endurance training superimposed on hypertension-induced compensated hypertrophy conferred no further cardioprotection to H/R. Postreperfusion 72-kDa heat shock protein abundance was enhanced in WKY-TRD and both groups of SHR relative to WKY-SED (P hypertension and endurance training individually improved H/R and that increased postreperfusion 72-kDa heat shock protein abundance was, in part, associated with the cardioprotective phenotype observed in this study.

  10. Subluxation of the Carpus in Thirteen Horses

    OpenAIRE

    Bailey, J.V.; Barber, S.M.; Fretz, P.B.; Jacobs, K.A.

    1984-01-01

    The records of 13 horses of various breeds with subluxation of the radiocarpal, intercarpal or carpometacarpal joint, or combinations of these were reviewed. Subluxation was most common at the carpometacarpal joint (n = 10) and concomitant fractures of individual carpal bones or metacarpus II and IV were seen (n = 12).

  11. Effect of Strength Training on Rate of Force Development in Older Women

    Science.gov (United States)

    Gurjao, Andre Luiz Demantova; Gobbi, Lilian Teresa Bucken; Carneiro, Nelson Hilario; Goncalves, Raquel; Ferreira de Moura, Rodrigo; Cyrino, Edilson Serpeloni; Altimari, Leandro Ricardo; Gobbi, Sebastiao

    2012-01-01

    We analyzed the effect of an 8-week strength training (ST) program on the rate of force development (RFD) and electromyographic activity (EMG) in older women. Seventeen women (M age = 63.4 years, SD = 4.9) without previous ST experience were randomly assigned to either a control (n = 7) or training (n = 10) group. A leg-press isometric test was…

  12. Rate of Forgetting in Dementia and Depression.

    Science.gov (United States)

    Hart, Robert P.; And Others

    1987-01-01

    Examined patients (N=14) with mild Alzheimer's dementia (DAT), patients with major depression (N=10), and normal control subjects (N=14), for rate of forgetting. Suggests that some form of deficient consolidation contributes to memory loss in DAT but not in depression. Implicates the disruption of different psychobiological mechanisms in these…

  13. Histopathological review of breast tumours in children and ...

    African Journals Online (AJOL)

    ... of all tumours followed by tubular adenoma (n = 11; 8.2%) and adenosis (n = 10; 7.4%). No case of malignancy was recorded in this study. Conclusion: Fibroadenoma is the most common breast tumour in children and adolescents in our environment. Key words: Adolescents, breast tumours, childhood, fi broadenoma ...

  14. Effect of four over-the-counter tooth-whitening products on enamel microhardness.

    Science.gov (United States)

    Majeed, A; Grobler, S R; Moola, M H; Oberholzer, T G

    2011-10-01

    This in vitro study evaluated the effect of four over-the-counter tooth-whitening products on enamel microhardness. Fifty enamel blocks were prepared from extracted human molar teeth. The enamel surfaces were polished up to 1200 grit fineness and the specimens randomly divided into five groups. Enamel blocks were exposed to: Rapid White (n=10); Absolute White (n=10); Speed White (n=10) and White Glo (n=10) whitening products, according to the manufacturers' instructions. As control, ten enamel blocks were kept in artificial saliva at 37 degrees C without any treatment. Microhardness values were obtained before exposure (baseline) and after 1, 7 and 14-day treatment periods using a digital hardness tester with a Vickers diamond indenter. Data were analysed using Wilcoxon Signed Rank Sum Test, one-way ANOVA and Tukey-Kramer Multiple Comparison Test (penamel microhardness. Speed White increased the microhardness of enamel, while White Glo and artificial saliva had no effect on hardness. Over-the-counter tooth-whitening products might decrease enamel microhardness depending on the type of product.

  15. Influence of distance to urban markets on smallholder dairy farming systems in Kenya

    NARCIS (Netherlands)

    Migose, S.A.; Bebe, B.O.; Boer, de I.J.M.; Oosting, S.J.

    2018-01-01

    We studied influence of distance to urban markets on smallholder dairy farming system development. Farms were chosen from three locations that varied in distance to the urban market of Nakuru Town in the Kenyan highlands: urban location (UL, n = 10) at less than 15 km distance, mid-rural location

  16. Childhood Gender Nonconformity, Bullying Victimization, and Depressive Symptoms across Adolescence and Early Adulthood: An 11-Year Longitudinal Study

    Science.gov (United States)

    Roberts, Andrea L.; Rosario, Margaret; Slopen, Natalie; Calzo, Jerel P.; Austin, S. Bryn

    2013-01-01

    Objective: Childhood gender nonconformity has been associated with increased risk of caregiver abuse and bullying victimization outside the home, but it is unknown whether as a consequence children who are nonconforming are at higher risk of depressive symptoms. Method: Using data from a large national cohort (N = 10,655), we examined differences…

  17. Mexican Parenting Questionnaire (MPQ)

    Science.gov (United States)

    Halgunseth, Linda C.; Ispa, Jean M.

    2012-01-01

    The present study was conducted in four phases and constructed a self-report parenting instrument for use with Mexican immigrant mothers of children aged 6 to 10. The 14-item measure was based on semistructured qualitative interviews with Mexican immigrant mothers (N = 10), was refined by a focus group of Mexican immigrant mothers (N = 5), and was…

  18. Choledochal cysts: Age of presentation, symptoms, and late complications related to Todani's classification

    NARCIS (Netherlands)

    de Vries, J. S.; de Vries, S.; Aronson, D. C.; Bosman, D. K.; Rauws, E. A. J.; Bosma, A.; Heij, H. A.; Gouma, D. J.; van Gulik, T. M.

    2002-01-01

    Purpose: The aim of this study was to compare presentation, complications, diagnosis, and treatment of choledochal cysts in pediatric and adult patients. Methods: Forty-two patients were analyzed after subdivision into 3 groups: group A, less than 2 years (n = 10); group B, 2 to 16 years In = 11);

  19. Effect of heavy training in contact sports on MRI findings in the pubic region of asymptomatic competitive athletes compared with non-athlete controls

    Energy Technology Data Exchange (ETDEWEB)

    Paajanen, Hannu [Kuopio University Hospital, Department of Surgery, Kuopio (Finland); Hermunen, Heikki; Karonen, Jari [Central Hospital of Mikkeli, Department of Radiology, Mikkeli (Finland)

    2011-01-15

    Bone marrow edema (BME) at the pubic symphysis on magnetic resonance imaging (MRI) is usually associated with groin pain and stress injury of the pubic bone. Little is known of the pubic MR imaging findings of asymptomatic heavy training athletes in contact sports. Pelvic MRI of male asymptomatic soccer (n = 10), ice hockey (n = 10), bandy (n = 10) and female floor-ball players (n = 10) were compared with non-athlete controls (10 males, 10 females) without groin pain to analyse the presence of BME (on a four-point scale). To study the possible changes of BME directly following heavy physical activity, 10 bandy players underwent MRI before and immediately after a 2-h training session. Magnetic resonance imaging showed minimal BME (grade 1) at the pubic symphysis in 19 of the 40 athletes (48%). Two soccer and 2 ice hockey players (20%) had moderate grade 2 pubic edema, but severe grade 3 BME findings were not found. Also 10 out of 20 (50%) of controls had grade 1 BME. The extent of increased signal was equally distributed in the asymptomatic athletes of different contact sports and controls. A heavy 2-h training session did not cause any enhanced signal at the pubic symphysis. This study indicates that the presence of grade 1 pubic BME was a frequent finding in contact sports and comparable to that in non-athletes. Grade 2 BME was found only in asymptomatic athletes undergoing heavy training. (orig.)

  20. A survey of environmental exposure amongst locoshed workers by instrumental neutron activation analysis

    International Nuclear Information System (INIS)

    Singh, V.K.N.; Garg, A.N.

    1995-01-01

    Instrumental neutron activation analysis (INAA) has been used for the determination of 16 elements in hair of locoshed workers (n=10) to study environmental exposure. A comparison of mean elemental contents with control (n=11) shows a significant enhancement for Cr, Th, Ca, Se and Na whereas Br and Sb show a declining trend. (author). 4 refs., 1 tab

  1. East is east and west is west and never the twain shall meet: Work engagement and workaholism across Eastern and Western cultures

    NARCIS (Netherlands)

    Hu, Q.; Schaufeli, Wilmar; Taris, Toon; Hessen, Dave; Hakanen, J.J.; Salanova, M.; Shimazu, Akihito

    2014-01-01

    This article compares the mean levels of work engagement and workaholism across two cultures (East Asia and Western Europe) by using a latent variable approach. Data were collected in Western Europe in the Netherlands (N = 10,162), Spain (N = 3,481), and Finland (N = 3,472) and in East Asia in China

  2. 75 FR 41180 - Notice of Order: Revisions to Enterprise Public Use Database

    Science.gov (United States)

    2010-07-15

    .... This responsibility to maintain a public use database (PUDB) for such mortgage data was transferred to... FEDERAL HOUSING FINANCE AGENCY [No. 2010-N-10] Notice of Order: Revisions to Enterprise Public Use Database AGENCY: Federal Housing Finance Agency. ACTION: Notice of order. SUMMARY: Section 1323(a)(1) of...

  3. Oxytocin injections in the postpartal period affect mammary tight junctions in sows

    DEFF Research Database (Denmark)

    Farmer, C.; Lessard, M.; Knight, C. H.

    2017-01-01

    The potential impacts of injecting oxytocin (OXY) to sows in the early postpartum period on the quality of mammary tight junctions, milk composition, and immune status of sows and piglets were studied. Postparturient sows received i.m. injections of either saline (control [CTL]; n = 10) or 75 IU ...

  4. Emotional, Motivational and Interpersonal Responsiveness of Children with Autism in Improvisational Music Therapy

    Science.gov (United States)

    Kim, Jinah; Wigram, Tony; Gold, Christian

    2009-01-01

    Through behavioural analysis, this study investigated the social-motivational aspects of musical interaction between the child and the therapist in improvisational music therapy by measuring emotional, motivational and interpersonal responsiveness in children with autism during joint engagement episodes. The randomized controlled study (n = 10)…

  5. Host transcriptional responses following ex vivo re-challenge with Mycobacterium tuberculosis vary with disease status.

    Directory of Open Access Journals (Sweden)

    Elaine A Yu

    Full Text Available The identification of immune correlates that are predictive of disease outcome for tuberculosis remains an ongoing challenge. To address this issue, we evaluated gene expression profiles from peripheral blood mononuclear cells following ex vivo challenge with Mycobacterium tuberculosis, among participants with active TB disease (ATBD, n = 10, latent TB infection (LTBI, n = 10, and previous active TB disease (after successful treatment; PTBD, n = 10, relative to controls (n = 10. Differential gene expression profiles were assessed by suppression-subtractive hybridization, dot blot, real-time polymerase chain reaction, and the comparative cycle threshold methods. Comparing ATBD to control samples, greater fold-increases of gene expression were observed for a number of chemotactic factors (CXCL1, CXCL3, IL8, MCP1, MIP1α. ATBD was also associated with higher IL1B gene expression, relative to controls. Among LTBI samples, gene expression of several chemotactic factors (CXCL2, CXCL3, IL8 was similarly elevated, compared to individuals with PTBD. Our results demonstrated that samples from participants with ATBD and LTBI have distinct gene expression profiles in response to ex vivo M. tuberculosis infection. These findings indicate the value in further characterizing the peripheral responses to M. tuberculosis challenge as a route to defining immune correlates of disease status or outcome.

  6. Host transcriptional responses following ex vivo re-challenge with Mycobacterium tuberculosis vary with disease status.

    Science.gov (United States)

    Yu, Elaine A; John, Serene H; Tablante, Elizabeth C; King, Christine A; Kenneth, John; Russell, David G; Mehta, Saurabh

    2017-01-01

    The identification of immune correlates that are predictive of disease outcome for tuberculosis remains an ongoing challenge. To address this issue, we evaluated gene expression profiles from peripheral blood mononuclear cells following ex vivo challenge with Mycobacterium tuberculosis, among participants with active TB disease (ATBD, n = 10), latent TB infection (LTBI, n = 10), and previous active TB disease (after successful treatment; PTBD, n = 10), relative to controls (n = 10). Differential gene expression profiles were assessed by suppression-subtractive hybridization, dot blot, real-time polymerase chain reaction, and the comparative cycle threshold methods. Comparing ATBD to control samples, greater fold-increases of gene expression were observed for a number of chemotactic factors (CXCL1, CXCL3, IL8, MCP1, MIP1α). ATBD was also associated with higher IL1B gene expression, relative to controls. Among LTBI samples, gene expression of several chemotactic factors (CXCL2, CXCL3, IL8) was similarly elevated, compared to individuals with PTBD. Our results demonstrated that samples from participants with ATBD and LTBI have distinct gene expression profiles in response to ex vivo M. tuberculosis infection. These findings indicate the value in further characterizing the peripheral responses to M. tuberculosis challenge as a route to defining immune correlates of disease status or outcome.

  7. Tectonics of the Ninetyeast Ridge derived from spreading records in adjacent oceanic basins and age constraints of the ridge

    Digital Repository Service at National Institute of Oceanography (India)

    Krishna, K.S.; Abraham, H.; Sager, W.W.; Pringle, M.S.; Frey, F.; Rao, D.G.; Levchenko, O.V.

    and the Wharton spreading ridge. Satellite gravity data and magnetic anomalies 34 through 19 define crustal isochrons and show fracture zones striking approx. N5 degrees E. One of these, at 89 degrees E, crosses the approx. N10 degrees E trending NER, impacting...

  8. MicroRNA-155 is upregulated in ascites in patients with spontaneous bacterial peritonitis

    DEFF Research Database (Denmark)

    Lutz, Philipp; M'haimid, Mohamed; Pohlmann, Alessandra

    2017-01-01

    , sex or aetiology of cirrhosis. MiR-125b levels differed between patients with low and high MELD score, and miR-125b levels showed an inverse correlation to serum creatinine (r 2 = â '0.23; p = 0.05). MiR-155 was elevated in patients with spontaneous bacterial peritonitis (SBP) (n = 10; p = 0.04). Mi...

  9. Comparative activity of tigecycline and tetracycline on Gram-negative and Gram-positive bacteria revealed by a multicentre study in four North European countries

    DEFF Research Database (Denmark)

    Nilsson, Lennart E; Frimodt-Møller, Niels; Vaara, Martti

    2011-01-01

    This study involves a multicentre surveillance of tigecycline and tetracycline activity against Gram-negative and Gram-positive bacteria from primary care centres (PCCs), general hospital wards (GHWs) and intensive care units (ICUs) in Denmark (n = 9), Finland (n = 10), Norway (n = 7) and Sweden (n...

  10. International Immersion in Counselor Education: A Consensual Qualitative Research Investigation

    Science.gov (United States)

    Barden, Sejal M.; Cashwell, Craig S.

    2014-01-01

    This study used consensual qualitative research methodology to examine the phenomenon of international immersion on counselor education students' (N = 10) development and growth. Seven domains emerged from the data (cultural knowledge, empathy, personal and professional impact, process/reflection, relationships, personal characteristics, and…

  11. Perilymphatic and endolymphatic pressure in the normal guinea pig

    NARCIS (Netherlands)

    Warmerdam, TJ; Schroder, FHH; Wit, HP; Albers, FWJ

    1999-01-01

    Perilymphatic and endolymphatic pressures were measured consecutively in the normal guinea pig using a WPI 900A micropressure system. The mean (n = 10) perilymphatic and endolymphatic pressures were 2.26 and 2.31 cm H2O, respectively. There was no statistically significant difference between the

  12. Sports Betting and Other Gambling in Athletes, Fans, and Other College Students

    Science.gov (United States)

    Nelson, Toben F.; LaBrie, Richard A.; LaPlante, Debi A.; Stanton, Michael; Shaffer, Howard J.; Wechsler, Henry

    2007-01-01

    Gambling on college and professional sports and the influence of attending colleges with differing levels of "sports interest" were examined among athletes, sports fans, and other students (N = 10,559) at 119 colleges in the United States using multilevel statistical analysis. Athletes and fans reported more sports gambling compared to…

  13. Profitability Analysis of Rice Processing and Marketing in Kano State ...

    African Journals Online (AJOL)

    that the Net Milling Income, value added and service efficiency for millers were higher, ... Present Value of N10, 555,709 at 22% and an Internal Rate of Return of 140 which shows that the .... producers, processors and quality oriented retail.

  14. Effect of heavy training in contact sports on MRI findings in the pubic region of asymptomatic competitive athletes compared with non-athlete controls

    International Nuclear Information System (INIS)

    Paajanen, Hannu; Hermunen, Heikki; Karonen, Jari

    2011-01-01

    Bone marrow edema (BME) at the pubic symphysis on magnetic resonance imaging (MRI) is usually associated with groin pain and stress injury of the pubic bone. Little is known of the pubic MR imaging findings of asymptomatic heavy training athletes in contact sports. Pelvic MRI of male asymptomatic soccer (n = 10), ice hockey (n = 10), bandy (n = 10) and female floor-ball players (n = 10) were compared with non-athlete controls (10 males, 10 females) without groin pain to analyse the presence of BME (on a four-point scale). To study the possible changes of BME directly following heavy physical activity, 10 bandy players underwent MRI before and immediately after a 2-h training session. Magnetic resonance imaging showed minimal BME (grade 1) at the pubic symphysis in 19 of the 40 athletes (48%). Two soccer and 2 ice hockey players (20%) had moderate grade 2 pubic edema, but severe grade 3 BME findings were not found. Also 10 out of 20 (50%) of controls had grade 1 BME. The extent of increased signal was equally distributed in the asymptomatic athletes of different contact sports and controls. A heavy 2-h training session did not cause any enhanced signal at the pubic symphysis. This study indicates that the presence of grade 1 pubic BME was a frequent finding in contact sports and comparable to that in non-athletes. Grade 2 BME was found only in asymptomatic athletes undergoing heavy training. (orig.)

  15. Assessing the Double Phonemic Representation in Bilingual Speakers of Spanish and English: An Electrophysiological Study

    Science.gov (United States)

    Garcia-Sierra, Adrian; Ramirez-Esparza, Nairan; Silva-Pereyra, Juan; Siard, Jennifer; Champlin, Craig A.

    2012-01-01

    Event Related Potentials (ERPs) were recorded from Spanish-English bilinguals (N = 10) to test pre-attentive speech discrimination in two language contexts. ERPs were recorded while participants silently read magazines in English or Spanish. Two speech contrast conditions were recorded in each language context. In the "phonemic in English"…

  16. Determination of antidepressant activity of Cyperus rotundus L ...

    African Journals Online (AJOL)

    CRLE) in rats. Methods: A rat model of depression was prepared for behavioral tests including tail suspension test or forced swimming test. Wistar rats were randomly divided into six groups (n = 10): normal group (0.9 % NaCl), model group ...

  17. JOS JOURNAL 2

    African Journals Online (AJOL)

    150-205g and female Westar albino rats (N=10) weighing between 145-200g were used for the experiment. The animals were obtained from the animal house, department of Anatomy, University of Benin and were kept in a well ventilated and hygienic animal house under constant environmental and nutritional conditions.

  18. Long-term aldosterone treatment induces decreased apical but increased basolateral expression of AQP2 in CCD of rat kidney.

    NARCIS (Netherlands)

    Seigneux, S. de; Nielsen, J.; Olesen, E.T.; Dimke, H.; Kwon, T.H.; Frokiaer, J.; Nielsen, S.

    2007-01-01

    The purpose of the present studies was to determine the effects of high-dose aldosterone and dDAVP treatment on renal aquaporin-2 (AQP2) regulation and urinary concentration. Rats were treated for 6 days with either vehicle (CON; n = 8), dDAVP (0.5 ng/h, dDAVP, n = 10), aldosterone (Aldo, 150

  19. Exploring Use of Self: Moving beyond Definitional Challenges

    Science.gov (United States)

    Liechty, Jeanne

    2018-01-01

    "Use of self" is a central concept throughout social work history and theory, yet no unified definition and little empirical research exist. Thus, a qualitative exploration was required. Three focus groups (n = 10) were conducted with experienced BSW educators. Participants defined use of self in the context of their students' beginning…

  20. Comparison of fast neutrons and X-rays in respect to genetic effects accompanying induced chromosome aberrations, in relation to the evaluation of the BARN-reactor

    International Nuclear Information System (INIS)

    Ramulu, K.S.

    1980-01-01

    The M 2 and M 3 plants derived from both fast neutron and X-ray treatments have been studied to detect and analyse reciprocal translocations in Arabidopsis thaliana (L.) Heynh. cv. Landsberg erecta (2n=10), Hordeum vulgare L. cv. Aramir (2n=14) and Secale cereale L., summer inbred line ZF9 (2n=14). (Auth.)

  1. An Action Research Study Exploring How Education May Enhance Pain Management in Children.

    Science.gov (United States)

    Simons, Joan M.

    2002-01-01

    Focus groups (n=14) and a study day (n=10) on pain management for child patients were held for pediatric nurses. Participants felt they increased their knowledge of pharmacology and their confidence and assertiveness in the practice of pain management. (Contains 37 references.) (SK)

  2. Evaluation of a Biofeedback Intervention in College Students Diagnosed with Autism Spectrum Disorders

    Science.gov (United States)

    Westlake, Garret

    2013-01-01

    This study used exploratory data analysis (EDA) to examine the use of a biofeedback intervention in the treatment of anxiety for college students diagnosed with an Autism Spectrum Disorder (ASD) (n = 10) and in a typical college population (n = 37). The use of EDA allowed for trends to emerge from the data and provided a foundation for future…

  3. Relationships between In-Service Teacher Achievement Motivation and Use of Educational Technology: Case Study with Latvian and Estonian Teachers

    Science.gov (United States)

    Karaseva, Agnese; Pruulmann-Vengerfeldt, Pille; Siibak, Andra

    2018-01-01

    This study explored the relationship of in-service teacher achievement goal orientation and practices of educational technology use. Semi-structured individual interviews with secondary school teachers in Latvia (N = 16) and Estonia (N = 10) revealed that the use of information and communication technology (ICT) in pedagogical work and the ways in…

  4. Role of nitric oxide and prostanoids in the regulation of leg blood flow and blood pressure in humans with essential hypertension: effect of high-intensity aerobic training

    DEFF Research Database (Denmark)

    Nyberg, Michael Permin; Jensen, Lasse Gliemann; Thaning, Pia

    2012-01-01

    We examined the role of nitric oxide (NO) and prostanoids in the regulation of leg blood flow and systemic blood pressure before and after 8 weeks of aerobic high-intensity training in individuals with essential hypertension (n=10) and matched healthy control subjects (n=11). Hypertensive subjects...

  5. Acute physical exercise under hypoxia improves sleep, mood and reaction time.

    Science.gov (United States)

    de Aquino-Lemos, Valdir; Santos, Ronaldo Vagner T; Antunes, Hanna Karen Moreira; Lira, Fabio S; Luz Bittar, Irene G; Caris, Aline V; Tufik, Sergio; de Mello, Marco Tulio

    2016-02-01

    This study aimed to assess the effect of two sessions of acute physical exercise at 50% VO2peak performed under hypoxia (equivalent to an altitude of 4500 m for 28 h) on sleep, mood and reaction time. Forty healthy men were randomized into 4 groups: Normoxia (NG) (n = 10); Hypoxia (HG) (n = 10); Exercise under Normoxia (ENG) (n = 10); and Exercise under Hypoxia (EHG) (n = 10). All mood and reaction time assessments were performed 40 min after awakening. Sleep was reassessed on the first day at 14 h after the initiation of hypoxia; mood and reaction time were measured 28 h later. Two sessions of acute physical exercise at 50% VO2peak were performed for 60 min on the first and second days after 3 and 27 h, respectively, after starting to hypoxia. Improved sleep efficiency, stage N3 and REM sleep and reduced wake after sleep onset were observed under hypoxia after acute physical exercise. Tension, anger, depressed mood, vigor and reaction time scores improved after exercise under hypoxia. We conclude that hypoxia impairs sleep, reaction time and mood. Acute physical exercise at 50% VO2peak under hypoxia improves sleep efficiency, reversing the aspects that had been adversely affected under hypoxia, possibly contributing to improved mood and reaction time.

  6. Analysis of microleakage of temporary restorative materials in primary teeth

    Directory of Open Access Journals (Sweden)

    Geórgia Linhares dos Santos

    2014-01-01

    Full Text Available Aim: The aim of this study was to compare the coronal microleakage of restorative materials used between sessions of endodontic treatment in primary teeth. Materials and Methods: Forty healthy primary canines were chosen and randomly allocated to four groups: Group 1 - Cimpat Branco ® (n = 10, Group 2 - Bioplic ® (n = 10, Group 3 - Maxxion R ® glass ionomer cement (n = 10, and Group 4 (control - Z350 ® composite resin (n = 10. Class V cavities were created and fillings carried out following the manufacturer′s instructions. The teeth were submitted to thermocycling, sealed, and immersed in 0.5% basic fuchsin solution for 24 h. The teeth were split along their long axis in the vestibulolingual direction and the tooth-restorative material interface was photographed. The percentage of microleakage was calculated using the ImageJ program. Data were analyzed using the analysis of variance (ANOVA F-test and Bonferroni′s t-test, with a 5% level of significance. Results: The following mean percentages of microleakage were found: Group 1 = 16.08%, Group 2 = 46.98%, Group 3 = 47.93%, and Group 4 = 11.03%. Statistically, significant differences were found in the comparison of Groups 1 and 4 to Groups 2 and 3. Conclusion: Cimpat Branco ® had a lower percentage of microleakage in comparison to Bioplic ® and Maxxion R ® glass ionomer cement.

  7. The Influence of Low Platelet Count on Whole Blood Aggregometry Assessed by Multiplate

    DEFF Research Database (Denmark)

    Stissing, Trine; Dridi, Nadia P; Ostrowski, Sisse R

    2011-01-01

    in an artificial matrix, platelet-rich plasma (PRP). Heparinized and citrated blood was diluted with autologous plasma to platelet concentrations 200 to 25 × 10(9)/L in WB samples (n = 10) and 200 to 100 × 10(9)/L in PRP samples (n = 7). The platelet aggregation was investigated by the ADP-, ASPI-, COL-, and TRAP...

  8. Stability of skeletal changes induced by growth modulation procedures in the treatment of skeletal Class II malocclusion

    Directory of Open Access Journals (Sweden)

    Prashantha Govinakovi Shivamurthy

    2016-01-01

    Full Text Available Objective: Objective of this study, based on an evaluation of lateral cephalograms, was to evaluate the degree of skeletal changes produced by the various growth modulative procedures in the treatment of skeletal Class II malocclusion and to characterize the stability of these changes in the years after treatment. Materials and Methods: Total of 40 patients with Class II malocclusion was divided into three groups according to appliance used, i.e. removable or fixed functional appliances (n = 10, combination of functional appliance with headgear (n = 10, and only headgear (n = 10. In addition, almost a matched control group (n = 10 also characterized by skeletal Class II pattern and were under observation, for more than 2 years was also selected. Lateral cephalograms of each patient were taken at the start of treatment (T1, at its completion (T2, and long-term posttreatment (T3. Results: This study showed significant improvement in maxillomandibular relationship in treated group compared to control group, and the changes remained stable in posttreatment phase. Restriction of maxillary growth was evident in headgear and combination groups whereas significant forward movement of the mandible was seen in functional group. Conclusion: Analysis of lateral cephalograms indicates that growth modulation therapy in angle Class II malocclusion brings about desired skeletal changes which remain relatively stable over a long-term period.

  9. N-3 polyunsaturated fatty acids do not affect the cytokine response to strenuous exercise

    DEFF Research Database (Denmark)

    Toft, A.D.; Thorn, Mette; Ostrowski, Kenneth

    2000-01-01

    (PUFA), for 6 wk or to receive no supplementation (n = 10) before participating in The Copenhagen Marathon 1998. Blood samples were collected before the race, immediately after, and 1.5 and 3 h postexercise. The fatty acid composition in blood mononuclear cells (BMNC) differed between the fish oil...

  10. A NEW ANIMAL-MODEL FOR HUMAN PREECLAMPSIA - ULTRA-LOW-DOSE ENDOTOXIN INFUSION IN PREGNANT RATS

    NARCIS (Netherlands)

    FAAS, MM; SCHUILING, GA; BALLER, JFW; VISSCHER, CA; BAKKER, WW

    OBJECTIVE: An animal model for preeclampsia was developed by means of an ultra-low-dose endotoxin infusion protocol in conscious pregnant rats. STUDY DESIGN: Rats received a permanent jugular vein cannula on day 0 of pregnancy, through which endotoxin (1.0 mu/kg body weight) (n = 10) or saline

  11. Ten-year changes in sun protection behaviors and beliefs of young adults in 13 European countries

    NARCIS (Netherlands)

    Peacey, Victoria; Steptoe, Andrew; Sandennan, Robbert; Wardle, Jane; Sanderman, R.

    2006-01-01

    Objective. Sun protection behaviors are important to the prevention of skin cancers, but little is known about changes over time in attitudes and behavior. Methods. Cross-sectional surveys were carried out among university students in thirteen European countries in 1990 (n = 10,241) and 2000 (n =

  12. Generalization and maintenance of a self-management program for drooling in children with neurodevelopmental disabilities: A second case series

    NARCIS (Netherlands)

    Burg, J.J.W. van der; Sohier, J.; Jongerius, P.H.

    2018-01-01

    In this case series (n = 10) with a non-concurrent multiple baseline design, a self-management program was shown to be effective during inpatient training in eight participants with oral-motor problems and normal intelligence or mild intellectual disabilities. They were taught to perform a

  13. Effects of Methylphenidate and Bupropion on DHEA-S and Cortisol Plasma Levels in Attention-Deficit Hyperactivity Disorder

    Science.gov (United States)

    Lee, Moon-Soo; Yang, Jae-Won; Ko, Young-Hoon; Han, Changsu; Kim, Seung-Hyun; Lee, Min-Soo; Joe, Sook-Haeng; Jung, In-Kwa

    2008-01-01

    We evaluated plasma levels of DHEA-S and cortisol before and after treating ADHD patients with one of two medications: methylphenidate (n = 12) or bupropion (n = 10). Boys with ADHD (combined type) were evaluated with the Korean ADHD rating scale (K-ARS) and the computerized ADHD diagnostic system (ADS). All assessments were measured at baseline…

  14. Psychological Stress and Parenting Behavior among Chinese Families: Findings from a Study on Parent Education for Economically Disadvantaged Families

    Science.gov (United States)

    Lam, Ching Man

    2011-01-01

    With the recognition of the crucial role of family and with the belief that parents have the greatest influence on a child's life, family and parent education has been widely practiced in Hong Kong and many other countries as measure for poverty alleviation. A study, employed quantitative method of a cross-sectional parent survey (N = 10,386) was…

  15. A School-Based Movement Programme for Children with Motor Learning Difficulty

    Science.gov (United States)

    Mannisto, Juha-Pekka; Cantell, Marja; Huovinen, Tommi; Kooistra, Libbe; Larkin, Dawne

    2006-01-01

    The study investigated the effectiveness of a school-based movement programme for a population of 5 to 7 year old children. Performance profiles on the Movement ABC were used to classify the children and to assess skill changes over time. Children were assigned to four different groups: motor learning difficulty (n = 10), borderline motor learning…

  16. Electrochemical machining of internal built-up surfaces of large-sized vessels for nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Ryabchenko, N N; Pulin, V Ya [Vsesoyuznyj Proektno-Tekhnologicheskij Inst. Atomnogo Mashinostroeniya i Kotlostroeniya, Rostov-na-Donu (USSR)

    1977-01-01

    Electrochemical machining (ECM) has been employed for finishing of mechanically processed inner surfaces of large lateral parts of construction bodies with welded 0Kh18N10T steel overlayer. The finishing technology developed reduces the surface roughness from 10 mcm to the standard 2.5 mcm at the efficiency of machining of 2-4 m/sup 2/ per hour.

  17. Effect of Physical Load on Aerobic Exercise Performance during Heat Stress.

    Science.gov (United States)

    Kenefick, Robert W; Heavens, Kristen R; Luippold, Adam J; Charkoudian, Nisha; Schwartz, Steven A; Cheuvront, Samuel N

    2017-12-01

    This study aimed to investigate the effect of increasing external loads on 5-km treadmill time trial (TT) performance in 20°C and 40°C environmental conditions and to construct an ecologically relevant performance prediction decision aid. Twenty-six male and four female volunteers (age, 23.5 ± 6.9 yr; weight, 76.0 ± 8.9 kg; height, 1.75 ± 0.07 m; V˙O2peak, 50.7 ± 4.5 mL·kg·min) participated in a counterbalanced, mixed-model design, with each subject assigned to a load group (20%, 30%, or 50% body mass (BM); n = 10 per group). Volunteers performed three, self-paced 5-km familiarization TT (treadmill) without external load. Each volunteer then performed a 5-km TT in each environment with loads of either 20% (n = 10), 30% (n = 10), or 50% (n = 10) of BM. 1) Loads of (20%, 30%, and 50% of BM) impaired 5-km TT performance compared with that when unloaded (P exercise trials, an ecologically valid decision aid was developed from self-paced data, in which pace (km·h) can be predicted for individual levels of heat, load, or heat + load in combination.

  18. Virtual Reality Job Interview Training in Adults with Autism Spectrum Disorder

    Science.gov (United States)

    Smith, Matthew J.; Ginger, Emily J.; Wright, Katherine; Wright, Michael A.; Taylor, Julie Lounds; Humm, Laura Boteler; Olsen, Dale E.; Bell, Morris D.; Fleming, Michael F.

    2014-01-01

    The feasibility and efficacy of virtual reality job interview training (VR-JIT) was assessed in a single-blinded randomized controlled trial. Adults with autism spectrum disorder were randomized to VR-JIT (n = 16) or treatment-as-usual (TAU) (n = 10) groups. VR-JIT consisted of simulated job interviews with a virtual character and didactic…

  19. Working women's choices for domestic help: the effects of financial and time resources

    NARCIS (Netherlands)

    Tijdens, K.; van der Lippe, T.; de Ruijter, E.

    2003-01-01

    Household services are increasing. Which households consume these services, in particular domestic help? This article tests whether time and financial resources influence the use of domestic help, performing logistic regression analyses with the WWIQ-2000/01-data (N=10,969), addressing working women

  20. Helium induces preconditioning in human endothelium in vivo

    NARCIS (Netherlands)

    Smit, Kirsten F.; Oei, Gezina T. M. L.; Brevoord, Daniel; Stroes, Erik S.; Nieuwland, Rienk; Schlack, Wolfgang S.; Hollmann, Markus W.; Weber, Nina C.; Preckel, Benedikt

    2013-01-01

    Helium protects myocardium by inducing preconditioning in animals. We investigated whether human endothelium is preconditioned by helium inhalation in vivo. Forearm ischemia-reperfusion (I/R) in healthy volunteers (each group n = 10) was performed by inflating a blood pressure cuff for 20 min.

  1. Accuracy of Single-Step versus 2-Step Double-Mix Impression Technique

    DEFF Research Database (Denmark)

    Franco, Eduardo Batista; da Cunha, Leonardo Fernandes; Herrera, Francyle Simões

    2011-01-01

    Objective. To investigate the accuracy of dies obtained from single-step and 2-step double-mix impressions. Material and Methods. Impressions (n = 10) of a stainless steel die simulating a complete crown preparation were performed using a polyether (Impregum Soft Heavy and Light body) and a vinyl...

  2. 75 FR 8391 - Assisted Living Conversion Program (ALCP) and Emergency Capital Repair Program (ECRP)

    Science.gov (United States)

    2010-02-24

    ... Conversion Program (ALCP) provides funding for the physical costs of converting some or all the units of an... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-10] Assisted Living Conversion... rehabilitate, modernize, or retrofit aging structure, common areas, or individual dwelling units through the...

  3. 77 FR 43902 - Notice of Availability of a Supplemental Draft Environmental Impact Statement for the California...

    Science.gov (United States)

    2012-07-26

    ..., Exhibit Hall III, 848 M Street, Fresno, CA; Hanford, CA, Tuesday, August 28, 2012, 3:00 to 8:00 p.m., Hanford Fraternal Hall, 1015 N. 10th Avenue, Hanford, CA; and Bakersfield, CA, Monday, August 27, 2012, 3... facility for assembly, testing, and commissioning of trains, train inspection and service, and train...

  4. An in vivo endoluminal ultrasonographic study of peristaltic activity in the distal porcine ureter

    NARCIS (Netherlands)

    Roshani, H.; Dabhoiwala, N. F.; Dijkhuis, T.; Kurth, K. H.; Lamers, W. H.

    2000-01-01

    PURPOSE: Experiments were performed to quantify the duration and frequency of ureteric peristaltic activity in the laparotomized and non-laparotomized pig in its virgin and postinstrumented states. MATERIALS AND METHODS: Pigs (n = 10) in a steady state of hydration were studied under halothane

  5. ORIGINAL ARTICLE

    African Journals Online (AJOL)

    Patient population. The study ... The average sizes of the GIST were 8.7 cm, 5.4 cm and 5.9 ... By stratifying GISTs according to classes of risk, KIT mutation was shown in most of the ... (n = 13), epitheloid type (n = 10) and mixed populations .... were first applied to estimate the risk of aggressive GIST ..... Which is the optimal.

  6. Nonmedical Prescription Drug Use among College Students: A Comparison between Athletes and Nonathletes

    Science.gov (United States)

    Ford, Jason A.

    2008-01-01

    Objective: Given the substantial increase in nonmedical prescription drug use in recent years and a lack of research on the topic, the author analyzed data on nonmedical prescription drug use among college students. Participants and Methods: Using data from the 2001 College Alcohol Study (N = 10,904), the author examined variation in nonmedical…

  7. The effectiveness of mindfulness training on behavioral problems and attentional functioning in adolescents with ADHD

    NARCIS (Netherlands)

    van de Weijer-Bergsma, E.; Formsma, A.R.; de Bruin, E.I.; Bögels, S.M.

    2012-01-01

    The effectiveness of an 8-week mindfulness training for adolescents aged 11-15 years with ADHD and parallel Mindful Parenting training for their parents was evaluated, using questionnaires as well as computerized attention tests. Adolescents (N = 10), their parents (N = 19) and tutors (N = 7)

  8. Improvement of resource efficiency by efficient waste shipment inspections; Steigerung der Ressourceneffizienz durch effiziente Kontrollen von Abfallverbringungen

    Energy Technology Data Exchange (ETDEWEB)

    Schilling, Stephanie [Institut fuer Oekologie und Politik GmbH (OEKOPOL), Hamburg (Germany)

    2011-09-15

    Illegal shipment of waste as well as enforcement related to waste shipment have been regularly the centre of attention of public and professional debates and are also a topic of cross-national relations. In addition, the fear persists that by illegal waste shipments waste is treated in plants neither adapted to protect the environment and health nor having sufficient recuperation capabilities for precious raw materials. This project therefore intends to clarify the status quo of waste shipment inspections in the 16 federal states of Germany (Bundeslaender, in the following cited as states or federal states) to identify potential for development regarding the organisation and execution of inspections and to elaborate recommendations to optimise enforcement activities and further development of European and German legislative regulations. In order to optimise the enforcement of the European Waste Shipment Regulation (WSR) and the German Waste Shipment Act (AbfVerbrG), an adequate number of qualified personnel is necessary within all bodies involved into waste shipment inspections. Those bodies are namely the competent waste authorities, customs, police, the Federal Office for Transport of Goods (BAG), the Federal Railway Authority (EBA) and the prosecution offices. An adequate number of qualified personnel is not provided for in all states/authorities. This is also reflected in the number of transport and plant inspections which deviate between zero to a fixed number per year as well as being continuously performed and based occasion-/cause oriented inspections. Tangible means like access to IT-systems and the Internet should be provided for on-site inspections. Besides qualified and experienced personnel also IT-Systems have a relevant impact on the preselection of the entity to be inspected as well as for on-the-spot investigations. Therefore IT-System can increase the efficiency of inspections (inspections per time unit resp. exposure of illegal shipments per time

  9. Continuous infusion of small-volume fluid resuscitation in the treatment of combined uncontrolled hemorrhagic shock and head injury

    International Nuclear Information System (INIS)

    Hayrettin, O.; Yagmur, Y.; Tas, A.; Topcu, S.; Orak, M.

    2007-01-01

    To determine the effect of continuous limited fluid resuscitation on the hemodynamic response and survival in rats in a model of uncontrolled hemorrhage shock due to Massive Splenic Injury (MSI) and Head Injury (HI). Seventy Sprague-Dawley rats were used in this study. Group 1 rats (n=10) was sham-operated. In group 2 (n=10), only Massive Splenic Injury (MSI) was performed and untreated. In group 3 (n=10), only head injury (HI) was performed and untreated. In group 4 (n=10), HI and MSI were performed and were untreated. In group 5 (n=10), HI and MSI were performed and 15 minutes later treated with 7.5% NaCl. In group 6 (n=10), HI and MSI were performed, and rats were treated with Ringer's Lactate (RL) solution. In group 7 (n=10), HI and MSI were performed, rats were treated with 0.9 % NaCl. In groups 2,4,5,6 and 7 midline incision was reopened and splenectomy was performed at 45 minutes. In group 4 rats, Mean Arterial Pressure (MAP) was decreased from 104 +- 6.1 mmHg to 75 +- 19.5 mmHg at 15 minutes; heart rate decreased from 357+- 24.9 beats/min to 321 +- 62.1 beats/min and hematocrit decreased from 46 +- 1.3 % to 43 +- 2.5 % (p<0.01). Similar early changes in MAP, heart rate and hematocrit were observed in groups 5, 6, and 7, at 15 minutes. At 45,60 and 120 minutes, in fluid resuscitated rats (group 5,6,7) MAP, heart rate and hematocrit values were measured higher than group 2 and 4 (p<0.01 for all). At 120 min. in group 6, hematocrit was higher than group 4, 5 and 7, in group 6, total blood loss after splenectomy was calculated at 20 +- 2.4% of blood volume and was the best value compared to other fluid resuscitated group 5 and 7 (28% and 27% of blood volume) (p<0.01). Mortality was lower in all fluid resuscitated groups when compared to group 3 and 4 (p< 0.05). The median survival time was again higher in fluid resuscitated groups. Continuous infusion of 7.5% NaCl, RL and 0.9 % NaCl following uncontrolled hemorrhagic shock with massive splenic injury and

  10. A resposta oxidativa em corações de camundongos é modulada por background genético The oxidative response of mouse hearts is modulated by genetic background

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Santos-Silva

    2013-02-01

    Full Text Available FUNDAMENTO: o tabagismo apresenta importante papel sobre as doenças cardiovasculares, entretanto permanecem pouco compreendidos os motivos pelos quais alguns seres humanos as desenvolvem e outros não. OBJETIVO: nosso objetivo foi analisar o perfil redox do coração de diferentes linhagens de camundongos após exposição à fumaça de cigarro. MÉTODOS: camundongos machos suíços (n = 10, C3H (n = 10, BALB/c (n = 10 e C57BL/6 (n = 10 foram expostos à fumaça de cigarro (12 cigarros/dia, enquanto os respectivos controles (n = 10 ao ar ambiente por 60 dias. Após sacrifício, o coração foi retirado para análises bioquímicas. RESULTADOS: embora o conteúdo de malondialdeído não tenha aumentado em nenhum grupo, a atividade da catalase diminuiu no grupo suíço (p BACKGROUND: Smoking plays an important role in cardiovascular diseases. However, the reasons why some individuals develop those diseases and others do not remain to be explained. OBJECTIVE: This study aimed at assessing the redox profile of the heart of different mouse strains after exposure to cigarette smoke. METHODS: Male mice of the Swiss (n = 10, C3H (n = 10, BALB/c (n = 10 and C57BL/6 (n = 10 strains were exposed to cigarette smoke (12 cigarettes/day, while their respective controls (n = 10 were exposed to ambient air for 60 days. After being euthanized, their heart was removed for biochemical analyses. RESULTS: Although the malondialdehyde content did not increase in any of the groups, catalase activity decreased in the Swiss (p < 0.05 and BALB/c (p < 0.05 strain mice as compared with their respective control groups, while myeloperoxidase decreased in the C3H (p < 0.05 and C57BL/6 (p < 0.001 strain mice as compared with their respective control groups. The reduced glutathione content decreased in the Swiss, C3H, C57BL/6 (p < 0.05 and BALB/c (p < 0,001 strain mice as compared with their respective control groups. Regarding reduced glutathione content, an increase was

  11. Propriedades mecânicas do gastrocnêmio eletroestimulado pós-imobilização Mechanical properties of gastrocnemius eletrostimulated after immobilization

    Directory of Open Access Journals (Sweden)

    Leonardo César Carvalho

    2009-01-01

    Full Text Available INTRODUÇÃO: As propriedades mecânicas (PM consistem num instrumento de aplicabilidade clínica para profissionais de saúde que atuam no sistema músculo-esquelético. OBJETIVOS: Avaliar dois protocolos de estimulação elétrica neuromuscular (NMES na potencialização do restabelecimento das PM no complexo músculo-tendíneo após imobilização segmentar de ratas. MATERIAIS E MÉTODOS: Foram utilizados 50 animais distribuídos em: Controle (GC, n=10; Imobilizado (GI, n=10; Imobilizado e remobilizado livre (GIL, n=10, Imobilizado e NMES uma vez ao dia (GIE1, n=10 e Imobilizado e NMES duas vezes ao dia (GIE2, n=10. A imobilização foi realizada por 14 dias. O GIL foi liberado posteriormente por 10 dias. A NMES foi aplicada pós-imobilização por 10 dias, GIE1 aplicado pela manhã (10 minutos e, GIE2 aplicado pela manhã e à tarde (totalizando 20 minutos. Posteriormente, o músculo gastrocnêmio foi submetido ao ensaio mecânico de tração sendo as PM de rigidez, resiliência, carga e o alongamento no limite máximo avaliadas. RESULTADOS: A imobilização reduziu os valores das propriedades de carga e rigidez (p0,05. CONCLUSÃO: O músculo gastrocnênio tornou-se estruturalmente mais organizado frente à aplicação unitária da NMES e na remobilização.INTRODUCTION: Mechanical properties (MP are clinically applicable tools for healthcare professionals working on the musculoskeletal system. OBJECTIVES: The aim of this study was to evaluate two protocols of neuromuscular electric stimulation (NMES to improve MP regeneration of the myotendinous complex after segment immobilization in female rats. MATERIALS AND METHODS: Fifty animals were equally distributed into five groups: Control (CG, n=10; Immobilized (IG, n=10; Immobilized and freely remobilized (IFG, n=10; Immobilized and NMES once /day (IEG1, n=10; Immobilized and MNES twice/day (IEG2, n=10. Immobilization was kept for 14 days, and remobilization was subsequently released for 10

  12. Distribution characteristics of liquid sequestration in rats with sepsis

    Directory of Open Access Journals (Sweden)

    Bin LI

    2012-03-01

    Full Text Available Objective To investigate the distribution characteristics of organs with liquid sequestration during fluid resuscitation in rats with sepsis. Methods Fifty male Wistar rats were randomly divided into five groups: control group (n=10, sepsis group (n=10, crystalloid group (n=10, albumin group (n=10, and artificial colloid (HAES group (n=10. The sepsis model was reproduced by cecal ligation and puncture. The mean arterial pressure was monitored with carotid artery intubation. Twelve hours after fluid infusion by micro-infusion pump via the femoral vein, tissues from the heart, liver, lungs, kidney (right, and small intestine were harvested to observe the pathological changes and calculate the tissue water content. Results The water content of every visceral tissue was higher in the sepsis group than in the control group (P < 0.05; the water content in the heart, liver, and lung tissues was higher in the albumin group than in the crystalloid group (P < 0.05. The water content in both albumin and crystalloid groups was higher than that in the sepsis group (P < 0.05. Moreover, the water content in the heart, liver, and lungs in the HAES group was lower than that in the crystalloid and albumin groups (P < 0.05. Cellular injuries were more severe in the heart, liver, and lungs than in the intestine and kidney in the crystalloid group and albumin group under electron-microscope. Conclusion Liquid sequestration exists mainly in the lungs, heart, and liver of rats with sepsis during fluid resuscitation. The phenomenon is less evident in the kidney and small intestine. Artificial colloid can reduce capillary leak with a good volume expansion effect.

  13. Changes of lipoperoxidation and antioxidant system in pariodontal tissues in experimental bronchial asthma under conditions of chronic periodonitis and correction of these changes with thiotriazoline

    Directory of Open Access Journals (Sweden)

    Mykhailo Reheda

    2018-04-01

    Full Text Available We have analyzed the results of the research of changes in indices of lipid peroxidation (conjugated dienes and malondialdehide and antioxidant (superoxide dismutase, catalase, ceruloplasmin systems in guinea pigs’ periodontal soft tissues in experimental bronchial asthma in the dynamics of asthma under conditions of chronic periodontitis and correction of these changes with thiotriazoline. The research was conducted on 50 male guinea pigs weighting 250-270 g, divided into 5 groups: I – intact guinea pigs (n=10, II – guinea pigs (n=10 with asthma under conditions of chronic periodontitis before correction (4th day, III - guinea pigs (n=10 with asthma under conditions of chronic periodontitis before correction (18th day, IV - guinea pigs (n=10 with asthma under conditions of chronic periodontitis before correction (25 th day, V - guinea pigs (n=10 with asthma under conditions of chronic periodontitis after correction (25th day. The results of experimental studies showed the significant increase of conjugated dienes and malondialdehide levels in animal’s periodontal soft tissues at all observed stages of asthma development under conditions of chronic periodontitis before the correction as compared with control group. Intensive synthesis of LPO’s products caused increase on 4th day with further decrease on 18th and 25th days of activity levels of superoxide dismutase, catalase and ceruloplasmin in animal’s periodontal soft tissues before the correction as compared with indices of the control group. After correction with thiotriazoline the the results showed decrease of indices of LPO and increase of activity levels of antioxidant enzymes.

  14. A arterapia e o desenvolvimento do comportamento no contexto da hospitalização El arteterapia y el desarrollo del comportamiento en el contexto de la hospitalización Art therapy and behavior development in the context of hospitalization

    Directory of Open Access Journals (Sweden)

    Ana Cláudia Afonso Valladares

    2006-09-01

    Full Text Available A hospitalização pode ter efeitos negativos sobre o desenvolvimento e comportamento infantil. Assim, objetivou-se avaliar, neste trabalho, o comportamento de crianças com idade de 7 a 10 anos internadas, antes e após intervenção de arteterapia. Utilizou-se, para esse fim, um esquema quasi-experimental com grupo controle (n=10 e um grupo experimental (n=10. Os resultados mostraram que as intervenções de arteterapia foram eficazes, por promoverem a melhoria das respostas comportamentais de seus participantes. Conclui-se, então, que os hospitais podem ser ambientes estimulantes para a criança, implementando práticas de cuidados para além da doença.La hospitalización puede tener efectos negativos sobre el desarrollo y comportamiento infantil. Así, se tuvo como objetivo evaluar, en este trabajo, el comportamiento de niños con edad de 7 a 10 años internados, antes y después de la intervención de la arteterapia. Se utilizó, para este fin, un esquema cuasi -experimental con grupo control (n=10 y un grupo experimental (n=10. Los resultados mostraron que las intervenciones de arteterapia fueron eficaces, por promover la mejora de las respuestas de comportamiento de sus participantes. Se concluyó, entonces, que los hospitales pueden ser ambientes estimulantes para el niño, implementando prácticas de cuidados para más allá de la enfermedad.Hospitalization may have negative effects on child development and behavior. Thus the aim of this work was to evaluate the behavior during the hospitalization of 7- to 10-year old children, before and after art therapy intervention. It was proposed a quasi-experimental plan with a control group (n=10 and a group that was submitted to art therapy intervention (n=10. Results show that these interventions were effective in improving the behavior of the children. Hospitals can also be stimulating environments for children if they offer them health care practices that go beyond the disease.

  15. The effect of manipulating context-specific information on perceptual-cognitive processes during a simulated anticipation task.

    Science.gov (United States)

    McRobert, Allistair P; Ward, Paul; Eccles, David W; Williams, A Mark

    2011-08-01

    We manipulated contextual information in order to examine the perceptual-cognitive processes that support anticipation using a simulated cricket-batting task. Skilled (N= 10) and less skilled (N= 10) cricket batters responded to video simulations of opponents bowling a cricket ball under high and low contextual information conditions. Skilled batters were more accurate, demonstrated more effective search behaviours, and provided more detailed verbal reports of thinking. Moreover, when they viewed their opponent multiple times (high context), they reduced their mean fixation time. All batters improved performance and altered thought processes when in the high context, compared to when they responded to their opponent without previously seeing them bowl (low context). Findings illustrate how context influences performance and the search for relevant information when engaging in a dynamic, time-constrained task. ©2011 The British Psychological Society.

  16. Postprandial responses of incretin and pancreatic hormones in non-diabetic patients with end-stage renal disease

    DEFF Research Database (Denmark)

    Idorn, Thomas; Knop, Filip K; Jørgensen, Morten

    2014-01-01

    of the insulinotropic gut-derived incretin hormones and pancreatic hormones play a critical role in the maintenance of a normal postprandial glucose tolerance. METHODS: We studied patients with ESRD and either normal (n = 10) or impaired (n = 10) glucose tolerance, and control subjects (n = 11). Plasma concentrations...... glucose responses were comparable between groups (P > 0.082). Patients with ESRD exhibited higher fasting levels of GIP and glucagon compared with controls (P corrected GLP-1 and glucagon responses were enhanced (P corrected insulin responses and insulin excursions...... increased secretion of the insulinotropic incretin hormone GLP-1. Fasting levels and baseline-corrected responses of glucagon were elevated and gastric emptying was delayed in the ESRD patients. These perturbations seem to be caused by uraemia per se and may contribute to the disturbed glucose metabolism...

  17. Instrumental neutron activation analysis of hair for mercury determination in case of possible professional contamination. 1

    International Nuclear Information System (INIS)

    Dubinskaya, N.A.

    1980-01-01

    The results of neutron-activation determination of Hg in hair of the staff working with laboratory Hg-equipment are presented. The accuracy of the analysis has been tested including the possible Hg losses from phenol-formaldehyde resigns base standards in Al foils and from hair samples in polyethylene ampoules during their irradiation in water-filled nuclear reactor channel. The mean content of Hg in hair has been found to be 1.42+-0.42 (n=22) for the staff, and 1.05+-0.21 (n=10) μg for the controls. A staff group with a higher Hg content in hair (7.3+-3.0, n=10) has been singled out

  18. Identification of patients with chronic obstructive pulmonary disease (COPD) by measurement of plasma biomarkers

    DEFF Research Database (Denmark)

    Shaker, S.B.; Wachenfeldt, K.A. von; Larsson, S.

    2008-01-01

    Introduction: Inflammation is an important constituent of the pathology of chronic obstructive pulmonary disease (COPD), leading to alveolar destruction and airway remodelling. Objective: The aim of this study was to assess the difference in plasma biomarkers of inflammation between asymptomatic...... smokers and patients with COPD. Methods: We used commercially available enzyme-linked immunosorbent assay kits to measure the plasma levels of tumour necrosis factor-alpha (TNF-alpha), interleukin-8 (IL-8), matrix metalloproteinase-9 (MMP-9), monocyte chemotactic protein-1 (MCP-1), tissue inhibitor...... of metalloproteinase-1 (TIMP-1) and tissue inhibitor of metalloproteinase-2 (TIMP-2) on two occasions with a 2-week interval in patients with COPD (n = 20), asymptomatic smokers (n = 10) and healthy life-long non-smokers (n = 10). The participants were characterised clinically, physiologically and by quantitative...

  19. Choice of corrosion-resistant metal for fluotitanic acid

    International Nuclear Information System (INIS)

    Reingeverts, M.D.; Lapchenko, E.P.; Semenyuk, E.Y.

    1986-01-01

    The authors investigate the corrosion and anodic behavior of steels 12Kh18N10T, 08Kh21N6M2T, and 06KhN28MDT, nickel, and molybdenum in 10-40% naturally aerated solutions of H 2 TiF 6 at 20 and 50 degrees C. The authors found that in solutions of fluotitanic acid, as also in tetrafluoroboric and hydrofluoric acids, the most stable alloys are chromium-nickel-molybdenum alloy of type 06KhN28MDT and (for acid concentrations above 20%) copper-nickel-alloys of the monel metal type. Steels 12Kh18N10T and 08Kh21N6M2T can be used in acid concentrations of less than 10% and temperatures up to 20 degrees C with anodic protection

  20. Health Status of Male Adult Wistar Rats from Two Experimental Animal Houses of UFMG: Leukocyte Counts, Feces and Lung Histological Exams

    Directory of Open Access Journals (Sweden)

    Andrade Bruno Horta

    2002-01-01

    Full Text Available A study was conducted to compare health status of male adult Wistar rats from two Experimental Animal Houses of UFMG with literature data of SPF (free from specific pathogens and conventional rats. The animals were divided into two groups: Group I (n=10, rats from the experimental animal houses of FAFICH and Group II (n=10 from ICB and following aspects were studied: a evident clinical signs (behavior modification, hair loss (alopecia, b leukocyte counts, c feces exam and d histological study of the lungs. The rats did not show clinical signs. However, when compared with SPF and conventional rats, both the groups showed a significant increase (p<0,05 of leukocyte count. On feces exam we detected some parasites and on lung histological exam we observed fungus (Group I and bacteria (Group II. These results showed that the health status of the rats was not satisfactory and required improvements in the conditions of the animal houses.

  1. A simple digestion method with a Lefort aqua regia solution for diatom extraction.

    Science.gov (United States)

    Wang, Huipin; Liu, Yan; Zhao, Jian; Hu, Sunlin; Wang, Yuzhong; Liu, Chao; Zhang, Yanji

    2015-01-01

    Presence of diatoms in tissues has been considered as a significant sign of drowning. However, there are limitations in the present extraction methods. We developed a new digestion method using the Lefort aqua regia solution (3:1 nitric acid to hydrochloric acid) for diatom extraction and evaluated the digestive capability, diatom destruction, and diatoms' recovery of this new method. The kidney tissues from rabbit mixed with water rich in diatoms were treated by the Lefort aqua regia digestion method (n = 10) and the conventional acid digestion method (n = 10). The results showed that the digestive capability of Lefort aqua regia digestion method was superior to conventional acid digestion method (p 0.05). The Lefort aqua regia reagent is an improvement over the conventional acid digestion for recovery of diatoms from tissue samples. © 2014 American Academy of Forensic Sciences.

  2. The effects of a multiflavonoid supplement on vascular and hemodynamic parameters following acute exercise.

    Science.gov (United States)

    Kappus, Rebecca M; Curry, Chelsea D; McAnulty, Steve; Welsh, Janice; Morris, David; Nieman, David C; Soukup, Jeffrey; Collier, Scott R

    2011-01-01

    Antioxidants can decrease oxidative stress and combined with acute exercise they may lead to further decreases in blood pressure. The purpose of this study was to investigate the effects of 2 weeks of antioxidant supplementation on vascular distensibility and cardiovascular hemodynamics during postexercise hypotension. Twenty young subjects were randomized to placebo (n = 10) or antioxidant supplementation (n = 10) for two weeks. Antioxidant status, vascular distensibility, and hemodynamics were obtained before, immediately, and 30 minutes after an acute bout of aerobic exercise both before and after supplementation. Two weeks of antioxidant supplementation resulted in a greater systolic blood pressure (SBP) decrease during postexercise hypotension (PEH) and significant decreases in augmentation index versus placebo (12.5% versus 3.5%, resp.). Also ferric-reducing ability of plasma (FRAP) increased significantly (interaction P = 0.024) after supplementation. Supplementation showed an additive effect on PEH associated with increased FRAP values and decreases in systolic blood pressure and augmentation index.

  3. Supporting Regional Aged Care Nursing Staff to Manage Residents' Behavioural and Psychological Symptoms of Dementia, in Real Time, Using the Nurses' Behavioural Assistant (NBA): A Pilot Site 'End-User Attitudes' Trial.

    Science.gov (United States)

    Klein, Britt; Clinnick, Lisa; Chesler, Jessica; Stranieri, Andrew; Bignold, Adam; Dazeley, Richard; McLaren, Suzanne; Lauder, Sue; Balasubramanian, Venki

    2018-01-01

    This regional pilot site 'end-user attitudes' study explored nurses' experiences and impressions of using the Nurses' Behavioural Assistant (NBA) (a knowledge-based, interactive ehealth system) to assist them to better respond to behavioural and psychological symptoms of dementia (BPSD) and will be reported here. Focus groups were conducted, followed by a four-week pilot site 'end-user attitudes' trial of the NBA at a regional aged care residential facility (ACRF). Brief interviews were conducted with consenting nursing staff. Focus group feedback (N = 10) required only minor cosmetic changes to the NBA prototype. Post pilot site end-user interview data (N = 10) indicated that the regional ACRF nurses were positive and enthusiastic about the NBA, however several issues were also identified. Overall the results supported the utility of the NBA to promote a person centred care approach to managing BPSD. Slight modifications may be required to maximise its uptake across all ACRF nursing staff.

  4. Does longstanding nicotine exposure impair bone healing and osseointegration? An experimental study in rabbits

    DEFF Research Database (Denmark)

    Gotfredsen, Klaus; Lindh, Christian H; Berglundh, Tord

    2009-01-01

    OBJECTIVES: The aim of this study was to analyze the effect of longstanding nicotine exposure on bone healing and osseointegration of titanium implants. MATERIALS AND METHODS: 20 female rabbits received either nicotine (n = 10) or saline (n = 10) administered subcutaneously via mini-osmotic pumps...... for 32 weeks. The pump delivered 6 microg/kg/min of nicotine for the animals in the test group. Blood samples were collected and plasma cotinine levels were measured monthly. Six months after the commencement of nicotine or saline administration three osteotomy preparations, one in right, femoral condyle...... increase in RMT between 2 and 4 weeks within each group. The histomorphometric analysis of bone-to-implant contact and bone density in the bone defects revealed no differences between the test and the control group after 2 or 4 weeks of healing. CONCLUSION: Longstanding (6 months) nicotine exposure did...

  5. Behavioral Evaluation of hMSC-GFP+ Transplantation in an Hemiparkinson Experimental Model in Wistar Rat

    Directory of Open Access Journals (Sweden)

    Jéssica Paola Alcázar Arzuza

    2017-05-01

    Full Text Available The effect of hMSCs-GFP+ transplantation was evaluated in an experimental model of Parkinson's disease (PD in 27 Wistar rats, or in three experimental groups: control (CON  n=7, injured (LES n=10 and transplanted (LES+T n=10. In order to evaluate the influence of the transplantation on the motor behavior, one month after the injury, rotation behavior induced by apomorphine, neurological test, transversal bar and SNpc cells positive to TH were developed. Using the Anova test, there was a decrease in the number of turns in transplanted animals (p=0.005 as well as in the neurological test (p=0.0004 and in the transverse bar that lead to this group in an intermediate position regarding LES and CON groups. There is a possible recovery of the transplantation-mediated nigroestriatal pathway of hMSC-GFP +.

  6. Short-term effect of recombinant human growth hormone in patients with alcoholic cirrhosis

    DEFF Research Database (Denmark)

    Møller, S; Becker, U; Grønbaek, M

    1994-01-01

    As growth hormone possesses anabolic properties that are active on protein metabolism, and thus of potential benefit to patients with chronic liver disease, we determined the metabolic effects of recombinant human growth hormone on insulin-like growth factor-I (IGF-I) its specific binding proteins......, and liver function. Twenty consecutive patients with cirrhosis were randomized to recombinant human growth hormone (Norditropin, 4 I.U. twice daily) subcutaneously for 6 weeks (n = 10) or conventional medical treatment (n = 10). The serum concentrations of insulin-like growth factor-I in the recombinant...... patients as well as in controls, whereas no change in insulin-like growth factor binding protein-1 concentrations was found. No significant changes were seen in the area under the curve for biochemical liver function tests. We conclude that administration of recombinant human growth hormone induces...

  7. Hepatic transcriptional changes in critical genes for gluconeogenesis following castration of bulls

    Science.gov (United States)

    Fassah, Dilla Mareistia; Jeong, Jin Young

    2018-01-01

    Objective This study was performed to understand transcriptional changes in the genes involved in gluconeogenesis and glycolysis pathways following castration of bulls. Methods Twenty Korean bulls were weaned at average 3 months of age, and castrated at 6 months. Liver tissues were collected from bulls (n = 10) and steers (n = 10) of Korean cattle, and hepatic gene expression levels were measured using quantitative real-time polymerase chain reaction. We examined hepatic transcription levels of genes encoding enzymes for irreversible reactions in both gluconeogenesis and glycolysis as well as genes encoding enzymes for the utilization of several glucogenic substrates. Correlations between hepatic gene expression and carcass characteristics were performed to understand their associations. Results Castration increased the mRNA (3.6 fold; pgluconeogenesis reactions from pyruvate to glucose and enzymes responsible for incorporation of glucogenic substrates including lactate, glycerol, and propionate. Hepatic gluconeogenic gene expression levels were associated with intramuscular fat deposition. PMID:29502393

  8. Effects of nutritional supplement of ginger root on antioxidant status in sheep

    Directory of Open Access Journals (Sweden)

    majid fartashvand

    2016-01-01

    Full Text Available Ginger (Zingiber officinale is a medicinal plant and pungent food spice, which has antioxidant properties. The aim of this study was to investigate the effects of ginger on antioxidant status of blood in healthy sheep. In this study, dried ginger root powder was added to the ration of 10 male yearling sheep (treatment group, at the rate of 1g/head/day for a period of 2 months. In the second group (n = 10 sheep, a single dose of vitamin E+selenium injection was administered intramuscularly (positive control group and the control group (n=10 sheep received no medication or special additives. Blood samples were collected regularly at 2 week intervals and enzyme activities of superoxide dismutase (SOD, glutathione peroxidase (GPX, catalase (CAT and total antioxidant levels were measured. Ginger increased total antioxidant capacity of serum and blood levels of SOD, GPX and CAT, which was significant compared to the control group (p

  9. Experimental antegrade enema: effects on water, electrolyte and acid-base balances with different solutions Enema anterógrado experimental: equilíbrio hídrico eletrolítico e ácido-base em coelhos submetidos a enema com diferentes soluções

    Directory of Open Access Journals (Sweden)

    Laura Helman

    2007-10-01

    Full Text Available PURPOSE: To study the effects on the water, electrolyte, and acid-base balances in rabbits submitted to antegrade enema with different solutions through appendicostomy. METHODS: Forty male New Zealand rabbits were submitted to appendicostomy, and distributed in 4 groups, according to the antegrade enema solution: PEG group, polyethylene glycol electrolyte solution (n=10; ISS group, isotonic saline solution (n=10; GS group, glycerin solution (n=10; SPS group, sodium phosphate solution (n=10. After being weighed, arterial blood gas analysis, red blood count, creatinine and electrolytes were measured at 4 times: preoperatively (T1; day 6 postop, before enema (T2; 4h after enema (T3; and 24h after T3 (T4. RESULTS: In PEG group occurred Na retention after 4h, causing alkalemia, sustained for 24h with HCO3 retention. In ISS group occurred isotonic water retention and hyperchloremic acidosis after 4h, which was partially compensated in 24h. GS group showed metabolic acidosis after 4h, compensated in 24h. In SPS group occurred hypernatremic dehydration, metabolic acidosis in 4h, and hypokalemia, hypocalcemia, hypomagnesemia, and metabolic alkalosis with partially compensated dehydration in 24h. CONCLUSIONS: All solutions used in this study caused minor alterations on water, electrolyte or acid-base balances. The most intense ones were caused by hypertonic sodium phosphate solution (SPS and isotonic saline solution (ISS and the least by polyethyleneglycol electrolyte solution (PEG and glycerin solution 12% (GS.OBJETIVO: Estudar os efeitos no equilíbrio hídrico, eletrolítico e ácido-base, do enema anterógrado com diferentes soluções em coelhos através de apendicostomia. MÉTODOS: 40 coelhos Nova Zelândia, machos, submetidos a apendicostomia, distribuídos em quatro grupos segundo a solução de enema: grupo PEG (n = 10 solução de polietilenoglicol com eletrólitos; grupo SF (n = 10 solução fisiológica; grupo SG (n = 10 solução glicerinada

  10. Inhibitor effect on corrosion of titanium alloys in muriatic solutions of titanium-magnesium production

    International Nuclear Information System (INIS)

    Dobrunov, Yu.V.; Volynskij, V.V.; Kolobov, G.A.; Kuznetsov, S.I.

    1977-01-01

    Corrosion tests of titanium alloys VTI-0, OT4, VT5-1 and steel Kh18N1OT in 10% and 18% HCl with additions of carnallite at 40 deg C have been carried out. It has been established that titanium alloys in 10% and 18% HCl containing 5 and 10% carnallite are sufficiently corrosion resistant in the presence of 0.1-1% FeCl or HNO 3 and can be used for manufacturing the equipment of recirculation gas scrubbers. Steel Kh18N10T is unstable in all the media tested. It is subjected to intensive pitting. Specimens of steel Kh18N10T have also revealed edge cracking

  11. Determination of lethal doses 50 and 100 of propofol in lipid emulsion nor nanoemulsion intraperitoneally in miceDeterminação das doses letal 50 e 100 do propofol em nanoemulsão ou em emulsão lipídica pela via intraperitoneal em camundongos

    Directory of Open Access Journals (Sweden)

    Martielo Ivan Gehrcke

    2012-10-01

    Full Text Available The formulation of a drug can interfere with its absorption into the circulatory system and may result in changes in the dose required to achieve that particular effect. The aim of this study was to determine the lethal dose 50 (LD 50 and 100 (LD100 of a nanoemulsion of propofol and the lipid emulsion in mice intraperitoneally. One hundred sixty animals weighing 36.47±4.6g, which were distributed randomly into two groups: NANO and EMU who received propofol 1% in the nanoemulsion and lipid emulsion, respectively, intraperitoneally. Began with a dose of 250mg/kg (n=10 and from this isdecreased or increased the dose until achieving 0 and 100% of deaths in each group thus formed were seven subgroups in NANO (each subgroup n = 10 at doses 200, 250, 325, 350, 400, 425 and 475 mg/kg and in EMU eight subgroups (n= 10 each subset 250, 325, 350, 400, 425, 475, 525 and 575 mg/kg. In the CONTROL group (n=10 animals received saline in the largest volume used in the other groups to rule out death by the volume injected. Analysis of LD 50 and LD 100 were obtained by linear regression. The LD 50 was 320, 95 mg / kg and 4243, 51mg / kg and the LD 100 was445.99 mg / kg and 595.31 mg / kg to groups NANO and EMU, respectively. It follows that nanoemulsion is propofol in 25% more potent compared to the lipid emulsionintraperitoneally. A formulação de um fármaco pode interferir na sua absorção para o sistema circulatório, podendo resultar em alterações da dose necessária para que se consiga determinado efeito. O objetivo deste estudo foi determinar as doses letais 50 (DL 50 e 100 (DL100 do propofol em nanoemulsão e emulsão lipídica em camundongos pela via intraperitoneal. Foram utilizados 160 animais pesando 36,47 ± 4,6g, os quais foram distribuídos aleatoriamente em dois grupos: NANO e EMU que receberam propofol à 1% em nanoemulsão e em emulsão lipídica, respectivamente, pela via intraperitoneal. Iniciou-se com a dose de 250mg/kg (n=10 e a partir

  12. Corrosion resistance of heat exchange equipment in hydrotreating Orenburg Condensate

    International Nuclear Information System (INIS)

    Teslya, B.M.; Burlov, V.V.; Parputs, I.V.; Parputs, T.P.

    1986-01-01

    The authors study the corrosion resistance of materials of construction and select appropriate materials for the fabrication of heat exchange equipment that will be serviceable under hydrotreating conditions. This paper discusses the Orenburg condensate hydrotreating unit which has been shut down repeatedly for repair because of corrosion damage to components of heat exchangers in the reactor section: tube bundles (08Kh18N10T steel), corrugated compensators (12Kh18N10T steel), and pins of the floating heads (37Kh13N8G8MFB steel). The authors recommend that the tube bundles and the compensators in heat exchangers in the reaction section should be fabricated of 08Kh21N6M2T or 10Kh17N13M2T steel. The pins have been replaced by new pins made of 10Kh17N13 X M2T steel, increasing the service life from 6-12 months to 2 years

  13. Account of internal friction when estimating recoverable creep strain

    International Nuclear Information System (INIS)

    Demidov, A.S.

    1986-01-01

    It is supposed that a difference of empirical and calculated data on the creep strain recovery for Kh18N10T steel under conditions of cyclic variations in stress is specified by the effect of internal friction. In the accepted model of creep β-flow is considered to be reversible and γ-flow- irreversible. Absorptivity is determined as a ratio of the difference between the expended work and work of strain recovery forces to the work expended in cycle. A notion of the equivalent stress acting in the period of the creep strain recovery is introduced. Results of the calculation according to the empirical formula where absorptivity was introduced into are compared with empirical data obtained for Kh18N10T steel at 750 deg C

  14. Stokes shift spectroscopy for the early diagnosis of epithelial precancers in DMBA treated mouse skin carcinogenesis

    Science.gov (United States)

    Jeyasingh, Ebenezar; Singaravelu, Ganesan; Prakasarao, Aruna

    2018-02-01

    In this study, we aim to characterize the tissue transformation in dimethylbenz(a)anthracene (DMBA) treated mouse skin tumor model using stokes shift spectroscopy (SSS) technique for early detection of the neoplastic changes. Stokes shift (SS) spectra measured by scanning both excitation and emission wavelength simultaneously with a fixed wavelength of interval (Δλ=20 nm) in vivo from 33 DMBA treated animals and 6 control animals. The SS spectra of normal (n=6), hyperplasia (n=10), dysplasia (n=10), and WDSCC (n=13) of mice skin shows the distinct peaks around 300, 350, and 386 nm may be attributed to tryptophan, collagen, and NADH respectively. From the observed spectral differences and the ratio variables that resulted in better classification between groups, it is concluded that tryptophan, collagen, and NADH are the key fluorophores that undergo changes during tissue transformation process and hence they can be targeted as tumor markers for early neoplastic changes.

  15. Corrosion behaviour of stainless steels by internal friction method

    International Nuclear Information System (INIS)

    Postnikov, V.S.; Kovalevskij, V.I.

    1987-01-01

    Corrosion of austenite chromium-nickel stainless steels 12 Kh18N9, 12Kh18N9T, 12Kh18N10 and 12Kh18N10T is investigated. Wire samples 0.7...0.8 mm in diameter before tests were subjected to quenching in water from the temperature of 1050...1100 deg C and part of them - to tempering at 650 deg C for 2 h. Pitting corrosion was brought about by different concentration of iron chloride solutions (C FeCl 3 ). Total corrosion has a slight effect on the character of IF (internal friction) variation that increases without the whole test period up to the moment when mechanical strength of the sample

  16. Ocean power plants

    Energy Technology Data Exchange (ETDEWEB)

    Dembicki, E.

    1982-01-01

    In the fall of 1980 on the shores of the Hawaiian Islands, a floating laboratory of the United States was successfully introduced for testing a heat exchanger and pipes for collecting cold water of the OTES with power of 1 MW. The first American OTES N=10-40 MW should start operation in 1985. By the year 2000, ..sigma..N of the U.S. OTES should reach 10 GW. The Japanese OTES N=10-25 MW should start up in 1989. The experimental OTES N=100 KW has been in operation since October 1981 on the Nauru Island. An OTES of 2 MW is under construction. The concern Empain-Schneider is involved in planning the OTES of closed cycle in France, and the concern CGE is planning the OTES of open cycle.

  17. Effect of training in the fasted state on metabolic responses during exercise with carbohydrate intake

    DEFF Research Database (Denmark)

    De Bock, K; Derave, W; Eijnde, B O

    2008-01-01

    program (6 wk, 3 day/wk, 1-2 h, 75% of peak Vo(2)) in moderately active males. They trained in the fasted (F; n = 10) or carbohydrate-fed state (CHO; n = 10) while receiving a standardized diet [65 percent of total energy intake (En) from carbohydrates, 20%En fat, 15%En protein]. Before and after...... the training period, substrate use during a 2-h exercise bout was determined. During these experimental sessions, all subjects were in a fed condition and received extra carbohydrates (1 g.kg body wt(-1) .h(-1)). Peak Vo(2) (+7%), succinate dehydrogenase activity, GLUT4, and hexokinase II content were...... adaptations in peak Vo(2) whether carried out in the fasted or carbohydrate-fed state. Although there was a decrease in exercise-induced glycogen breakdown and an increase in proteins involved in fat handling after fasting training, fat oxidation during exercise with carbohydrate intake was not changed....

  18. Examining the interplay among family, culture, and latina teen suicidal behavior.

    Science.gov (United States)

    Gulbas, Lauren E; Zayas, Luis H

    2015-05-01

    In this article, we explore the relationships among culture, family, and attempted suicide by U.S. Latinas. We analyzed qualitative interviews conducted with Latina teen suicide attempters (n = 10) and their parents. We also incorporated data collected from adolescents with no reported history of self-harm (n = 10) and their parents to examine why some individuals turned to suicide under similar experiences of cultural conflict. Our results reveal that Latina teens who attempted suicide lacked the resources to forge meaningful social ties. Without the tools to bridge experiences of cultural contradiction, the girls in our study described feeling isolated and alone. Under such conditions, adolescents turned to behaviors aimed at self-destruction. Unlike their peers who attempted suicide, adolescent Latinas with no lifetime history of attempted suicide were able to mobilize resources in ways that balanced experiences of acculturative tension by creating supportive relationships with other individuals. © The Author(s) 2014.

  19. The effects of ultraviolet-A radiation on visual evoked potentials in the young human eye

    International Nuclear Information System (INIS)

    Sanford, B.E.; Beacham, S.; Hanifin, J.P.; Hannon, P.; Streletz, L.; Sliney, D.; Brainard, G.C.

    1996-01-01

    A recent study from this laboratory using visual evoked potentials (VEPs) demonstrated that children's eyes are capable of detecting ultraviolet radiation. The aim of this study was to compare dose-response relationships in two age groups, 6-10 years (n=10) and 20-25 years (n=10). Under photopic viewing conditions (550 lux), exposures of monochromatic UV-A (339 nm) and visible radiation (502 nm) were correlated to VEPs. The results demonstrate that monochromatic UV-A can elicit age and dose dependent responses in the human visual system, suggesting that the eyes of children are more responsive to UV stimuli than the eyes of young adults. (au) 17 refs

  20. On the corrosion resistance of 01Kh25 ferritic steel

    International Nuclear Information System (INIS)

    Eremeeva, R.A.; Koval', E.K.

    1989-01-01

    Effect of non-ferrous metal ions on corrosion behaviour of 01Kh25 specific low carbon steel as compared to austenitic 12Kh18N10T and 06KhN28MDT steels in boiling solutions of sulfuric and nitric acids and their mixture is studied. Compositions initating commercial ones are chosen the media. It is shown that trough corrosion resistance of 01Kh25 steel in 10% H 2 SO 4 is two order below 06KhN28MDT austenitic steel in presence of Cu 2+ ions as a result of the surface passivation corrosion resistance of ferritic steel is an order higher the austenitic ones. Ferrite steel resistance in the nitric acid and its mixture with sulfuric acid is five timesas much as in 12Kh18N10T austenitic steel

  1. Immobilization induced osteopenia is strain specific in mice

    DEFF Research Database (Denmark)

    Lodberg, Andreas; Vegger, Jens Bay; Jensen, Michael Vinkel

    2015-01-01

    systemic effects on bone. Female mice from four inbred mouse strains (BALB/cJ, C57BL/6 J, DBA/2 J, and C3H/HeN) were injected unilaterally with BTX (n = 10/group) or unilaterally with saline (n = 10/group). Mice were euthanized after 21 days, and the bone properties evaluated using μCT, DXA, bone...... resolution μCT we found no evidence of a systemic effect on any of the microstructural parameters of the contralateral limb. Likewise, there was no evidence of a systemic effect on the bone strength in any mouse strain. We did, however, find a small systemic effect on aBMD in DBA/2 J and C3H/HeN mice...

  2. Estudo sobre a eficácia da aerostasia pulmonar, em modelo animal, utilizando diferentes tipos de suturas Study about the ability of the pulmonary aerostasia, in animal model, using differents parenchymal pulmonary types of the sutures

    Directory of Open Access Journals (Sweden)

    Darcy Ribeiro Pinto Filho

    2003-10-01

    Full Text Available INTRODUÇÃO: A busca de um modelo perfeito de aerostasia pulmonar, após cirurgias que envolvam ressecções parciais, permanece um desafio para a prática da cirurgia torácica. OBJETIVO: Avaliar e comparar, em um modelo animal (suínos, a eficácia de quatro diferentes tipos de sutura pulmonar em manter aerostasia. MÉTODO: Estudo experimental, ex vivo, em pulmões de suínos, realizado no biotério da Universidade de Caxias do Sul. Quatro tipos de sutura pulmonares foram avaliadas: tipo 1, sutura manual com fios cirúrgicos absorvíveis; tipo 2, grampeador exclusivo; tipo 3, grampeador recoberto por pericárdio bovino e tipo 4, grampeador recoberto por cola biológica. As suturas foram submetidas a níveis crescentes de pressão, que variaram de 10cmH2O a 60cmH2O. O teste do borracheiro avaliou o hermetismo das suturas. RESULTADOS: A média de pressão em que se observou perda do hermetismo pulmonar foi de 29cmH2O no tipo 1 (n = 10; 38,5cmH2O no tipo 2 (n = 10; 44cmH2O no tipo 3 (n = 10 e 51,4cmH2O no tipo 4 (n = 10. A comparação entre as médias mostrou diferença estatística apenas entre as suturas tipo 1 e as suturas tipo 3 e 4, p = 0,04 e p BACKGROUND: The search for an ideal procedure to accomplish aerostasis, after partial surgical resection of the lung parenchyma, remains a practical challenge for the thoracic surgeon. OBJECTIVE: The objective of this study was to compare the ability of four types of parenchymal pulmonary sutures in preventing air leaks, using a porcine model with incremental endobronchial pressures. METHOD: Ex vivo experimental study in porcine lungs (n = 5 at the Laboratory of Experimental Surgery of the Universidade de Caxias do Sul. Four different parenchymal pulmonary types of suture were analyzed: type 1 (absorbable suture, type 2: (stapled suture, type 3 (stapled suture with bovine pericardium and type 4 (stapled suture with biologic glue. The surgical sutures (n = 40 were exposed to different intrabronchial

  3. Radiation therapy of the nasopharyngeal carcinoma

    International Nuclear Information System (INIS)

    Chatani, M.; Matayoshi, Y.; Masaki, N.; Fujii, T.; Umatani, K.; Yoshino, K.; Sato, T.

    1993-01-01

    Between September 1977 and December 1989, 89 consecutive patients of nasopharyngeal carcinoma were treated with radiation therapy. The study comprized of 66 males and 23 females; their ages ranged 17 to 80 years (mean 55 years). Five-years survival rates according to stage were as follows: stages I and II (n=10), 90%; stage III (n=10), 43%; stage IV (n=69), 47%. The important prognostic factors for predicting poor prognostic in this series, which were shown by stepwise proportional hazard (Cox) model, were the level of lactate dehydrogenase (LDH) and neck node involvement. LDH level also influenced nodal failure (p=0.0002) and distant metastatis (p=0.006). (orig.) [de

  4. Characteristics of PVdF copolymer/Nafion blend membrane for direct methanol fuel cell (DMFC)

    International Nuclear Information System (INIS)

    Cho, Ki-Yun; Eom, Ji-Yong; Jung, Ho-Young; Choi, Nam-Soon; Lee, Yong Min; Park, Jung-Ki; Choi, Jong-Ho; Park, Kyung-Won; Sung, Yung-Eun

    2004-01-01

    For direct methanol fuel cell, blends of vinylidene fluoride-hexafluoropropylene copolymer (P(VdF-co-HFP)) and Nafion were prepared the different equivalent weight of Nafion. The investigations of the blend morphology were performed by means of permeability test, uptake measurement, differential-scanning calorimetry (DSC), and scanning electron microscopy. In the blend membranes, many pores were created as the content of Nafion in blend increased. Then, the methanol uptake was sharply increased. But the methanol permeability was not sharply increased because the methanol permeation through blend membranes is diffusion-controlled process. The methanol permeability of N10 (low equivalent weight) series was similar to that of N11 series (high equivalent weight). The proton conductivity of N10 series was around one and a half times higher than that of N11 series. The cell performance of the blend was much enhanced when the equivalent weight of Nafion was 1000

  5. Metabolic Evidence of Diminished Lipid Oxidation in Women With Polycystic Ovary Syndrome

    Science.gov (United States)

    Whigham, Leah D.; Butz, Daniel E.; Dashti, Hesam; Tonelli, Marco; Johnson, LuAnn K.; Cook, Mark E.; Porter, Warren P.; Eghbalnia, Hamid R.; Markley, John L.; Lindheim, Steven R.; Schoeller, Dale A.; Abbott, David H.; Assadi-Porter, Fariba M.

    2014-01-01

    Polycystic ovary syndrome (PCOS), a common female endocrinopathy, is a complex metabolic syndrome of enhanced weight gain. The goal of this pilot study was to evaluate metabolic differences between normal (n=10) and PCOS (n=10) women via breath carbon isotope ratio, urinary nitrogen and nuclear magnetic resonance (NMR)-determined serum metabolites. Breath carbon stable isotopes measured by cavity ring down spectroscopy (CRDS) indicated diminished (pglucose tolerance test showed that a transient elevation in blood glucose levels decreased circulating levels of lipid, glucose and amino acid metabolic intermediates (acetone, 2-oxocaporate, 2-aminobutyrate, pyruvate, formate, and sarcosine) in PCOS women, whereas the 2 h glucose challenge led to increases in the same intermediates in normal women. These pilot data suggest that PCOS-related inflexibility in fasting-related switching between lipid and carbohydrate/protein utilization for carbon metabolism may contribute to enhanced weight gain. PMID:24765590

  6. Inline skating for balance and strength promotion in children during physical education.

    Science.gov (United States)

    Muehlbauer, Thomas; Kuehnen, Matthias; Granacher, Urs

    2013-12-01

    Deficiencies in balance and strength are common in children and they may lead to injuries. This study investigated the effects of inline skating exercise on balance and strength performance in healthy children. Twenty 11-12-year-old children (8 girls, 12 boys) were assigned to an intervention (n = 10) or a control (n = 10) group. Participants in the intervention group underwent a 4-week inline skating program (2 times/week, 90 min. each) integrated in their physical education lessons. Balance and strength were measured using the Star Excursion Balance test and the countermovement jump test. As compared to the control group, the intervention group significantly improved balance (17-48%, Cohen's d = 0.00-1.49) and jump height (8%, Cohen's d = 0.48). In children, inline skating is a safe, feasible (90% adherence rate), and effective program that can be integrated in physical education lessons to promote balance and strength.

  7. Fouling and biocorrosion of a high-alloy steel in the Golden Horn bay

    International Nuclear Information System (INIS)

    Koryakova, M.D.; Nikitin, V.M.; Suponina, A.P.; Kharchenko, U.V.; Zvyagintsev, A.Yu.

    2002-01-01

    The studies on the effect of contamination of the Golden Horn bay waters (the Peter the Great Bay in the Japanese Sea) on formation of the community of the bacterio- and macrofouling and corrosion resistance of the Kh18N10T high-alloy steel are continued. The dissolved and chemically absorbed oxygen, pH, saprophytes, oil-oxidizing, sulfate-reducing bacteria and heavy metals are among the medium indicators, characterizing the level of pollution of the regions of the samples testing. It is shown, that the obtained experimental data extend our understanding of the dependent effect of three factors: the sea medium → fouling → corrosion resistance of the Kh18N10T high-alloy steel [ru

  8. Density function theory study of the adsorption and dissociation of carbon monoxide on tungsten nanoparticles.

    Science.gov (United States)

    Weng, Meng-Hsiung; Ju, Shin-Pon; Chen, Hsin-Tsung; Chen, Hui-Lung; Lu, Jian-Ming; Lin, Ken-Huang; Lin, Jenn-Sen; Hsieh, Jin-Yuan; Yang, Hsi-Wen

    2013-02-01

    The adsorption and dissociation properties of carbon monoxide (CO) molecule on tungsten W(n) (n = 10-15) nanoparticles have been investigated by density-functional theory (DFT) calculations. The lowest-energy structures for W(n) (n = 10-15) nanoparticles are found by the basin-hopping method and big-bang method with the modified tight-binding many-body potential. We calculated the corresponding adsorption energies, C-O bond lengths and dissociation barriers for adsorption of CO on nanoparticles. The electronic properties of CO on nanoparticles are studied by the analysis of density of state and charge density. The characteristic of CO on W(n) nanoparticles are also compared with that of W bulk.

  9. Chromosome reduction in Eleocharis maculosa (Cyperaceae).

    Science.gov (United States)

    da Silva, C R M; González-Elizondo, M S; Laforga Vanzela, A L

    2008-01-01

    Chromosome numbers in Cyperaceae lower than the typical basic number x = 5 have been described for only three species: Rhynchospora tenuis (n = 2), Fimbristylis umbellaris (n = 3) and Eleocharis subarticulata (n = 3). Eleocharis maculosa is recorded here as the fourth species of Cyperaceae that has a chromosome number lower than 2n = 10, with 2n = 8, 7 and 6. The karyotype differentiation in E. maculosa was studied using conventional staining (mitosis and meiosis), FISH with 45S and 5S rDNA and telomere probes. The results allow us to determine which chromosomes of the chromosome race with 2n = 10 fused to form the remaining reduced numbers, as well as to understand how the symploidy and translocation mechanisms were important in karyotype differentiation and the formation of chromosome races in Eleocharis. Copyright 2008 S. Karger AG, Basel.

  10. Growth Hormone Receptor Antagonist Treatment Reduces Exercise Performance in Young Males

    DEFF Research Database (Denmark)

    Goto, K.; Doessing, S.; Nielsen, R.H.

    2009-01-01

    between the groups in terms of changes in serum free fatty acids, glycerol, (V) over dotO(2), or relative fat oxidation. Conclusion: GH might be an important determinant of exercise capacity during prolonged exercise, but GHR antagonist did not alter fat metabolism during exercise. (J Clin Endocrinol......Context: The effects of GH on exercise performance remain unclear. Objective: The aim of the study was to examine the effects of GH receptor (GHR) antagonist treatment on exercise performance. Design: Subjects were treated with the GHR antagonist pegvisomant or placebo for 16 d. After the treatment...... period, they exercised to determine exercise performance and hormonal and metabolic responses. Participants: Twenty healthy males participated in the study. Intervention: Subjects were treated with the GHR antagonist (n = 10; 10 mg/d) or placebo (n = 10). After the treatment period, they performed...

  11. Comparative Effectiveness of Three Occupational Therapy Sleep Interventions: A Randomized Controlled Study.

    Science.gov (United States)

    Gutman, Sharon A; Gregory, Kristin A; Sadlier-Brown, Megan M; Schlissel, Marcy A; Schubert, Allison M; Westover, Lee Ann; Miller, Richard C

    2017-01-01

    Although sleep intervention is within the domain of occupational therapy, few studies exist supporting practice. Effectiveness of three sleep interventions was compared: Dreampad Pillow®, iRest® meditation, and sleep hygiene. Twenty-nine participants were randomly assigned to the Dreampad Pillow® ( n = 10), iRest® meditation ( n = 9), and sleep hygiene ( n = 10) groups. In Phase 1, all participants used a 7-day sleep hygiene regimen to reduce poor sleep habits. In Phase 2 (14 days), 10 participants used the Dreampad Pillow® and sleep hygiene, nine used the iRest meditation and sleep hygiene, and 10 continued sleep hygiene only. At intervention-end, the iRest meditation group experienced statistically greater time asleep than both the Dreampad Pillow® ( p meditation ( p occupational therapy's domain.

  12. Interscalene plexus block versus general anaesthesia for shoulder surgery: a randomized controlled study.

    Science.gov (United States)

    Lehmann, Lars J; Loosen, Gregor; Weiss, Christel; Schmittner, Marc D

    2015-02-01

    This randomized clinical trial evaluates interscalene brachial plexus block (ISB), general anaesthesia (GA) and the combination of both anaesthetic methods (GA + ISB) in patients undergoing shoulder arthroscopy. From July 2011 until May 2012, 120 patients (male/female), aged 20-80 years, were allocated randomly to receive ISB (10 ml mepivacaine 1 % and 20 ml ropivacaine 0.375%), GA (propofol, sunfentanil, desflurane) or ISB + GA. The primary outcome variable was opioid consumption at the day of surgery. Anaesthesia times were analysed as secondary endpoints. After surgery, 27 of 40 patients with a single ISB bypassed the recovery room (p surgery [GA: n = 25 vs. GA + ISB: n = 10 vs. ISB: n = 10, p = 0.0037]. ISB is superior to GA and GA + ISB in patients undergoing shoulder arthroscopy in terms of faster recovery and analgesics consumption.

  13. Effect of 6-week course of glucagon-like peptide 1 on glycaemic control, insulin sensitivity, and beta-cell function in type 2 diabetes: a parallel-group study

    DEFF Research Database (Denmark)

    Zander, Mette; Madsbad, Sten; Madsen, Jan Lysgaard

    2002-01-01

    subcutaneous infusion of GLP-1 (n=10) or saline (n=10) for 6 weeks. Before (week 0) and at weeks 1 and 6, they underwent beta-cell function tests (hyperglycaemic clamps), 8 h profiles of plasma glucose, insulin, C-peptide, glucagon, and free fatty acids, and appetite and side-effect ratings on 100 mm visual...... analogue scales; at weeks 0 and 6 they also underwent dexascanning, measurement of insulin sensitivity (hyperinsulinaemic euglycaemic clamps), haemoglobin A(1c), and fructosamine. The primary endpoints were haemoglobin A(1c) concentration, 8-h profile of glucose concentration in plasma, and beta......-cell function (defined as the first-phase response to glucose and the maximum insulin secretory capacity of the cell). Analyses were per protocol. FINDINGS: One patient assigned saline was excluded because no veins were accessible. In the remaining nine patients in that group, no significant changes were...

  14. Measurements of H*(10) in reference neutron fields using Bonner sphere spectrometry and LET spectrometry

    CERN Document Server

    Golnik, N; Králik, M

    2002-01-01

    A Bonner sphere spectrometer and the REM-2 recombination chamber were used for inter-comparison measurements of the neutron component of ambient dose equivalent, H sub n *(10) in reference neutron fields. The sup 2 sup 4 sup 1 Am-Be and sup 2 sup 5 sup 2 Cf neutron sources were exposed either free-in-air or placed in iron or paraffin filters. The REM-2 recombination chamber was used as a LET spectrometer. The agreement of H sub n *(10) values measured with both the methods was within experimental uncertainties of few percent. The determined neutron spectra were used for calculations of the REM-2 chamber response to H*(10).

  15. Detection and Modeling of a Meteotsunami in Lake Erie During a High Wind Event on May 27, 2012

    Science.gov (United States)

    Anderson, E. J.; Schwab, D. J.; Lombardy, K. A.; LaPlante, R. E.

    2012-12-01

    On May 27, 2012, a mesoscale convective system moved southeast across the central basin of Lake Erie (the shallowest of the Great Lakes) causing an increase in surface wind speed from 3 to 15 m/s over a few minutes. Although no significant pressure change was observed during this period (+1 mbar), the storm resulted in 3 reported edge waves on the southern shore (5 minutes apart), with wave heights up to 7 feet (2.13 m). Witnesses along the coast reported that the water receded before the waves hit, the only warning of the impending danger. After impact on the southern shore, several individuals were stranded in the water near Cleveland, Ohio. Fortunately, there were no fatalities or serious injury as a result of the edge waves. The storm event yielded two separate but similar squall line events that impacted the southern shore of Lake Erie several hours apart. The first event had little impact on nearshore conditions, however, the second event (moving south-eastward at 21.1 m/s or 41 knots), resulted in 7 ft waves near Cleveland as reported above. The thunderstorms generated three closely packed outflow boundaries that intersected the southern shore of Lake Erie between 1700 and 1730 UTC. The outflow boundaries were followed by a stronger outflow at 1800 UTC. Radial velocities on the WSR-88D in Cleveland, Ohio indicated the winds were stronger in the second outflow boundary. The radar indicated winds between 20.6 and 24.7 m/s (40 and 48 knots) within 240 meters (800 feet) above ground level. In order to better understand the storm event and the cause of the waves that impacted the southern shore, a three-dimensional hydrodynamic model of Lake Erie has been developed using the Finite Volume Coastal Ocean Model (FVCOM). The model is being developed as part of the Great Lakes Coastal Forecasting (GLCFS), a set of experimental real-time pre-operational hydrodynamic models run at the NOAA Great Lakes Research Laboratory that forecast currents, waves, temperature, and

  16. Application of Observed Precipitation in NCEP Global and Regional Data Assimilation Systems, Including Reanalysis and Land Data Assimilation

    Science.gov (United States)

    Mitchell, K. E.

    2006-12-01

    The Environmental Modeling Center (EMC) of the National Centers for Environmental Prediction (NCEP) applies several different analyses of observed precipitation in both the data assimilation and validation components of NCEP's global and regional numerical weather and climate prediction/analysis systems (including in NCEP global and regional reanalysis). This invited talk will survey these data assimilation and validation applications and methodologies, as well as the temporal frequency, spatial domains, spatial resolution, data sources, data density and data quality control in the precipitation analyses that are applied. Some of the precipitation analyses applied by EMC are produced by NCEP's Climate Prediction Center (CPC), while others are produced by the River Forecast Centers (RFCs) of the National Weather Service (NWS), or by automated algorithms of the NWS WSR-88D Radar Product Generator (RPG). Depending on the specific type of application in data assimilation or model forecast validation, the temporal resolution of the precipitation analyses may be hourly, daily, or pentad (5-day) and the domain may be global, continental U.S. (CONUS), or Mexico. The data sources for precipitation include ground-based gauge observations, radar-based estimates, and satellite-based estimates. The precipitation analyses over the CONUS are analyses of either hourly, daily or monthly totals of precipitation, and they are of two distinct types: gauge-only or primarily radar-estimated. The gauge-only CONUS analysis of daily precipitation utilizes an orographic-adjustment technique (based on the well-known PRISM precipitation climatology of Oregon State University) developed by the NWS Office of Hydrologic Development (OHD). The primary NCEP global precipitation analysis is the pentad CPC Merged Analysis of Precipitation (CMAP), which blends both gauge observations and satellite estimates. The presentation will include a brief comparison between the CMAP analysis and other global

  17. Ground Validation Assessments of GPM Core Observatory Science Requirements

    Science.gov (United States)

    Petersen, Walt; Huffman, George; Kidd, Chris; Skofronick-Jackson, Gail

    2017-04-01

    NASA Global Precipitation Measurement (GPM) Mission science requirements define specific measurement error standards for retrieved precipitation parameters such as rain rate, raindrop size distribution, and falling snow detection on instantaneous temporal scales and spatial resolutions ranging from effective instrument fields of view [FOV], to grid scales of 50 km x 50 km. Quantitative evaluation of these requirements intrinsically relies on GPM precipitation retrieval algorithm performance in myriad precipitation regimes (and hence, assumptions related to physics) and on the quality of ground-validation (GV) data being used to assess the satellite products. We will review GPM GV products, their quality, and their application to assessing GPM science requirements, interleaving measurement and precipitation physical considerations applicable to the approaches used. Core GV data products used to assess GPM satellite products include 1) two minute and 30-minute rain gauge bias-adjusted radar rain rate products and precipitation types (rain/snow) adapted/modified from the NOAA/OU multi-radar multi-sensor (MRMS) product over the continental U.S.; 2) Polarimetric radar estimates of rain rate over the ocean collected using the K-Pol radar at Kwajalein Atoll in the Marshall Islands and the Middleton Island WSR-88D radar located in the Gulf of Alaska; and 3) Multi-regime, field campaign and site-specific disdrometer-measured rain/snow size distribution (DSD), phase and fallspeed information used to derive polarimetric radar-based DSD retrievals and snow water equivalent rates (SWER) for comparison to coincident GPM-estimated DSD and precipitation rates/types, respectively. Within the limits of GV-product uncertainty we demonstrate that the GPM Core satellite meets its basic mission science requirements for a variety of precipitation regimes. For the liquid phase, we find that GPM radar-based products are particularly successful in meeting bias and random error requirements

  18. Esophageal atresia with tracheoesophageal fistula and early ...

    African Journals Online (AJOL)

    Résultat: Trente et un patients soit 30,7% étaient morts. On avait identifié deux groupes majeurs de la mortalité post opératoire. Le premier groupe comprend les causes possible de la mortalité évitable qui étaient le sepsis premaire (n = 10, 32, 3%), problème techniques (n = 8,25,8%) et pneumonie grave (n = 5, 16, 1%).

  19. EST Table: FS895588 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS895588 E_FL_ftes_18N10_R_0 10/09/28 46 %/153 aa ref|XP_973163.1| PREDICTED: similar to jump...46 %/151 aa gnl|Amel|GB14856-PA 10/09/10 46 %/153 aa gi|91086783|ref|XP_973163.1| PREDICTED: similar to jumping translocation breakpoint protein [Tribolium castaneum] FS891321 ftes ...

  20. EST Table: FS880548 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS880548 E_FL_ftes_18N10_F_0 10/09/28 45 %/153 aa ref|XP_973163.1| PREDICTED: similar to jump...45 %/151 aa gnl|Amel|GB14856-PA 10/09/10 45 %/153 aa gi|91086783|ref|XP_973163.1| PREDICTED: similar to jumping translocation breakpoint protein [Tribolium castaneum] FS906679 ftes ...

  1. Does hybridized dentin affect bond strength of self-adhesive resin cement?

    OpenAIRE

    Pamato, Saulo; do Valle, Acc?cio-Lins; de Andrade, Gustavo-Henrique-Barbosa; Vidotti, Hugo-Alberto; S?, Marcus-Vin?cius-Reis; Pereira, Jefferson-Ricardo

    2016-01-01

    Background Evaluate the influence of different hybridization bonding techniques of a self-adhesive resin cement. Material and Methods 30 human health molars were divided into six groups (n=10). The specimens received three longitudinal sections, allowing insertion of central cuts in PVC matrices. Each group received a different dentin pretreatment according to the manufacturer?s recommendations, except the control group (G1), as follows. G2 - a 3-step total-etch adhesive system (Optibond? FL,...

  2. Systematic Development and Validation of a Theory-Based Questionnaire to Assess Toddler Feeding12

    OpenAIRE

    Hurley, Kristen M.; Pepper, M. Reese; Candelaria, Margo; Wang, Yan; Caulfield, Laura E.; Latta, Laura; Hager, Erin R.; Black, Maureen M.

    2013-01-01

    This paper describes the development and validation of a 27-item caregiver-reported questionnaire on toddler feeding. The development of the Toddler Feeding Behavior Questionnaire was based on a theory of interactive feeding that incorporates caregivers’ responses to concerns about their children’s dietary intake, appetite, size, and behaviors rather than relying exclusively on caregiver actions. Content validity included review by an expert panel (n = 7) and testing in a pilot sample (n = 10...

  3. Improving composition of protective coatings for steel casting

    International Nuclear Information System (INIS)

    Kuz'kina, N.N.; Pegov, V.G.; Bogatenkov, V.F.; Shub, L.G.; Raspopova, N.A.

    1983-01-01

    A radically new fuel-free slag-forming mixture used as protective coating for steel casting is introduced. The lack of combustible powders precludes explosion and fire Lazard in mixture preparation. Usage of the new mixture in stainless steel casting of Kh18N10T type permitted to improve the ingot surface quality and reduce spoilage from 1.16 to 0.66%

  4. Mastication in subjects with extremely shortened dental arches rehabilitated with removable partial dentures.

    Science.gov (United States)

    Arce-Tumbay, Jackelyn; Sanchez-Ayala, Alfonso; Sotto-Maior, Bruno Salles; Senna, Plinio Mendes; Campanha, Nara Hellen

    2011-01-01

    Mastication was evaluated in subjects presenting extremely shortened dental arches (ESDAs) rehabilitated with mandibular free-end removable partial dentures (RPDs). Subjects were divided into four groups (n = 10): those with a complete dentition, those with ESDAs, and those with ESDAs who were rehabilitated with an RPD, who were evaluated both with and without their prostheses. Mastication was measured through masticatory performance, time, and ability. RPD wearers showed higher masticatory performance (P mastication in ESDA subjects but without achieving normal mastication levels.

  5. Histopathological and Reproductive Evaluation in Male Rats Fed Jatropha curcas Seed Cake with or without Alkaline Hydrolysis and Subjected to Heat Treatment

    OpenAIRE

    Teixeira Sousa Moura, Laiane; Palomaris Mariano Souza, Domenica; Mendon?a, Simone; de Aquino Ribeiro, Jos? Ant?nio; Fernandes Sousa, Luciano; Tony Ramos, Adriano; Maiorka, Paulo C?sar; de Ara?jo, Vera L?cia; Mayumi Maruo, Viviane

    2017-01-01

    Jatropha curcas cake, a by-product of biodiesel production, is rich in protein and has potential to be used in livestock feed; however, the presence of antinutritional factors and phorbol esters limits its use. Thus, this study investigated toxicological and reproductive effects in male Wistar rats after subchronic exposure to J. curcas cake subjected to detoxification procedures. Rats were divided into seven groups (n = 10) and treated for 60 days. The control group received commercial feed,...

  6. Structural properties of silicon clusters: An empirical potential study

    International Nuclear Information System (INIS)

    Gong, X.G.; Zheng, Q.Q.; He Yizhen

    1993-09-01

    By using our newly proposed empirical interatomic potential for silicon, the structure and some dynamical properties of silicon cluster Si n (10 ≤ n ≤ 24) have been studied. It is found that the obtained results are close to those from ab-initio methods. From present results, we can gain a new insight into the understanding of the experimental data on the Si n clusters. (author). 20 refs, 6 figs

  7. Blood Transcriptomics and Metabolomics for Personalized Medicine

    Science.gov (United States)

    2015-10-31

    involved in rheumatoid arthritis . PLoS Comput Biol 2011;7. [100] Zhu J. Stitching together multiple data dimensions reveals interacting metabolomic...capability, detecting N10,000 metabo- lites, together with environmental exposure, dietary intake, microbial activity, and pharmaceutical drugs. Thus...research to clinical care has constantly seen huge disap- pointments. With the accumulation of detailed, information-rich data, human subjects start to

  8. Piercing by composite electrode tool

    International Nuclear Information System (INIS)

    Abdukarimov, Eh.T.; Krakov, B.G.; Saidinov, S.Ya.

    1990-01-01

    The construction of the electrode consisting of a dielectric shell, where a working liquid enters, and a metal rod is designed for precision super-deep piercing by the electroerosion treatment method. Technological parameters of piercing with small diameter (0.5-1.9 mm) for 12Kh18N10T steel, copper and tungsten are presented. A possibility to use a new tool for treating components of any form and sizes is marked

  9. Effect of operational conditions of electroerosion machining on the surface microgeometry parameters of steels and alloys

    International Nuclear Information System (INIS)

    Foteev, N.K.

    1976-01-01

    Studies the influence of pulse duration and a series of operating conditions of a ShGI-40-440 spark-machining generator on changes in the basic surface microgeometry characteristics of components of stainless steel 1Kh18N10T, steel St 45 and hard alloy T14K8. The microgeometry characteristics of spark-machined surfaces differ significantly from the corresponding characteristics of surfaces machined by cutting and vibro-rolling

  10. X-ray spectrum microanalysis of copper and stainless steel surface layer after electroerosion machining

    International Nuclear Information System (INIS)

    Abdukarimov, Eh.T.; Saidinov, S.Ya.

    1989-01-01

    The results of experimental investigations of the surface layer of copper and steel 12Kh18N10T after electroerrosion treatment by a rotating tungsten electrode in natural and distilled water are presented. It is established that the quantity of electrode material transferred to the surface of the steel treated grows with the spark discharge energy increase. Tungsten concentration in the surface layer reaches 5-10% with the average depth of penetration 40-50 μm

  11. Prevalence and Risk Factors for Human Immunodeficiency Virus (HIV) and Syphilis Infections Among Military Personnel in Sierra Leone

    Science.gov (United States)

    2017-03-01

    sponses (n=10). 3.5. Factors Associated with Syphilis Status Syphilis seropositivity was increased by older age , HIV in- fection and the...multiple sexual partnerships in the same week and HIV testing outside of military facilities (pɘ.05). Increasing age , positive HIV status and rural...population (15-49 years of age ) of Sierra Leone, and the estimated syphilis prevalence ranged from 1.5% to 5.2% based on regional studies. We examined the

  12. Spin dynamics at level crossing in molecular AF rings probed by NMR

    Energy Technology Data Exchange (ETDEWEB)

    Lascialfari, A. E-mail: lascialfari@fisicavolta.unipv.it; Borsa, F.; Julien, M.-H.; Micotti, E.; Furukawa, Y.; Jang, Z.H.; Cornia, A.; Gatteschi, D.; Horvatic, M.; Van Slageren, J

    2004-05-01

    The low-temperature spin dynamics in molecular rings with a finite number (N{<=}10) of magnetic ions was studied by means of {sup 1}H NMR. When an external magnetic field (B) induces a crossing between energy levels, peaks are observed in the spin-lattice relaxation rate of protons, 1/T{sub 1}(B), at constant temperature. We discuss similarities and differences in the data from three different rings: Fe10, Fe6:Li and Cr8.

  13. Parameterization of surface irradiance and primary production in Århus Bay, SW Kattegat, Baltic Sea

    DEFF Research Database (Denmark)

    Lund-Hansen, Lars Chresten; Sørensen, Helene Munk

    2009-01-01

    . The study is based on a one year long time-series of PAR, CTD-casts (n = 45), and primary production measurements (n = 24) from Århus Bay (56°09′ N; 10°20′ E), south west Kattegat. Results showed a high and positive correlation between observed and calculated primary production in the bay, as based...

  14. Effect of mechanical load cycling on the microleakage of three different glass ionomer restorations in class V cavities

    OpenAIRE

    Baharan Ranjbar Omidi; Ladan Madani; Aida Mirnejad Joybari; Ensyeh Rashvand; Sonia Oveisi

    2015-01-01

    Background and Aims: Microleakage is an important problem with direct restorations and familiarity with contributing factors is of utmost importance. The aim of this study was to evaluate the microleakage of three glass ionomer restorations in class V cavities.   Materials and Methods: In this in vitro study, class V cavity preparations were made on the buccal and lingual/ palatal surfaces of 30 human premolars (60 cavities). The specimens were divided into three group (n=10, 20 cavities). Re...

  15. Account of low temperature hardening in calculation of permissible stresses

    International Nuclear Information System (INIS)

    Novikov, N.V.; Ul'yanenko, A.P.; Gorodyskij, N.I.

    1980-01-01

    Suggested is a calculation scheme of permissible stresses with the account of temperature hardening for steels and alloys, the dependences of strength, plasticity and rupture work of which on cooling temperature do not have threshold changes in a wide range of low temperatures (from 300 to 4.2 K). Application of the suggested scheme is considered on the example of 12Kh18N10T austenitic chromium-nickel steel

  16. ABC transporter genes and risk of type 2 diabetes

    DEFF Research Database (Denmark)

    Schou, Jesper; Tybjærg-Hansen, Anne; Møller, Holger J

    2012-01-01

    of both genes, were genotyped in the Copenhagen City Heart Study (CCHS) (n = 10,185). Two loss-of-function mutations (ABCA1 N1800H and ABCG1 g.-376C>T) (n = 322) and a common variant (ABCG1 g.-530A>G) were further genotyped in the Copenhagen General Population Study (CGPS) (n = 30,415). RESULTS: Only one...

  17. Effects of Herbal Supplements on PTSD-Induced Changes in Rat Behavior & Brain Gene Expression

    Science.gov (United States)

    2014-06-10

    Corporation; 2008. 14. Bent S. Herbal medicine in the United States: review of efficacy, safety, and regulation: grand rounds at University of...Ceremuga, Thomas COL (Ret) USU Project Number: N10-P12 70. Bent S: Herbal medicine in the United States: review of efficacy, safety, and regulation...2012;177(7):814-822. 135. Ang-Lee MK, Moss J, Yuan CS. Herbal medicines and perioperative care. Jama. Jul 11 2001;286(2):208-216. 136. Jankowsi K

  18. Hormone effects on fMRI and cognitive measures of encoding: importance of hormone preparation.

    Science.gov (United States)

    Gleason, C E; Schmitz, T W; Hess, T; Koscik, R L; Trivedi, M A; Ries, M L; Carlsson, C M; Sager, M A; Asthana, S; Johnson, S C

    2006-12-12

    We compared fMRI and cognitive data from nine hormone therapy (HT)-naive women with data from women exposed to either opposed conjugated equine estrogens (CEE) (n = 10) or opposed estradiol (n = 4). Exposure to either form of HT was associated with healthier fMRI response; however, CEE-exposed women exhibited poorer memory performance than either HT-naive or estradiol-exposed subjects. These preliminary findings emphasize the need to characterize differential neural effects of various HTs.

  19. VLDL from Metabolic Syndrome Individuals Enhanced Lipid Accumulation in Atria with Association of Susceptibility to Atrial Fibrillation.

    Science.gov (United States)

    Lee, Hsiang-Chun; Lin, Hsin-Ting; Ke, Liang-Yin; Wei, Chi; Hsiao, Yi-Lin; Chu, Chih-Sheng; Lai, Wen-Ter; Shin, Shyi-Jang; Chen, Chu-Huang; Sheu, Sheng-Hsiung; Wu, Bin-Nan

    2016-01-20

    Metabolic syndrome (MetS) represents a cluster of metabolic derangements. Dyslipidemia is an important factor in MetS and is related to atrial fibrillation (AF). We hypothesized that very low density lipoproteins (VLDL) in MetS (MetS-VLDL) may induce atrial dilatation and vulnerability to AF. VLDL was therefore separated from normal (normal-VLDL) and MetS individuals. Wild type C57BL/6 male mice were divided into control, normal-VLDL (nVLDL), and MetS-VLDL (msVLDL) groups. VLDL (15 µg/g) and equivalent volumes of saline were injected via tail vein three times a week for six consecutive weeks. Cardiac chamber size and function were measured by echocardiography. MetS-VLDL significantly caused left atrial dilation (control, n = 10, 1.64 ± 0.23 mm; nVLDL, n = 7, 1.84 ± 0.13 mm; msVLDL, n = 10, 2.18 ± 0.24 mm; p < 0.0001) at week 6, associated with decreased ejection fraction (control, n = 10, 62.5% ± 7.7%, vs. msVLDL, n = 10, 52.9% ± 9.6%; p < 0.05). Isoproterenol-challenge experiment resulted in AF in young msVLDL mice. Unprovoked AF occurred only in elderly msVLDL mice. Immunohistochemistry showed excess lipid accumulation and apoptosis in msVLDL mice atria. These findings suggest a pivotal role of VLDL in AF pathogenesis for MetS individuals.

  20. Resistance to Reperfusion Injury Following Short Term Postischemic Administration of Natural Honey in Globally Ischemic Isolated Rat Heart

    OpenAIRE

    Haleh Vaez; Mehrban Samadzadeh; Fahimeh Zahednezhad; Moslem Najafi

    2012-01-01

    Purpose: Results of our previous study revealed that preischemic perfusion of honey before zero flow global ischemia had cardioprotective effects in rat. The present study investigated potential resistance to reperfusion injury following short term postischemic administration of natural honey in globally ischemic isolated rat heart. Methods: Male Wistar rats were divided into five groups (n=10-13). The rat hearts were isolated, mounted on a Langendorff apparatus, allowed to equilibra...

  1. Differential Item Functioning of Pathological Gambling Criteria: An Examination of Gender, Race/Ethnicity, and Age

    OpenAIRE

    Sacco, Paul; Torres, Luis R.; Cunningham-Williams, Renee M.; Woods, Carol; Unick, G. Jay

    2011-01-01

    This study tested for the presence of differential item functioning (DIF) in DSM-IV Pathological Gambling Disorder (PGD) criteria based on gender, race/ethnicity and age. Using a nationally representative sample of adults from the National Epidemiologic Survey on Alcohol and Related Conditions (NESARC), indicating current gambling (n = 10,899), Multiple Indicator-Multiple Cause (MIMIC) models tested for DIF, controlling for income, education, and marital status. Compared to the reference grou...

  2. The role of radiotherapy in the management of POEMS syndrome

    OpenAIRE

    Suh, Yang-Gun; Kim, Young-Suk; Suh, Chang-Ok; Kim, Yu Ri; Cheong, June-Won; Kim, Jin Seok; Cho, Jaeho

    2014-01-01

    Background POEMS syndrome is a paraneoplastic syndrome caused by an underlying plasma cell proliferative disease. In this study, we examined the treatment outcomes and role of radiotherapy in the management of POEMS syndrome. Methods In total, 33 patients diagnosed with POEMS syndrome were analyzed. These patients presented with osteosclerotic myeloma (OSM, n = 13), Castleman’s disease (CD, n = 4), OSM with CD (n = 10), and vascular endothelial growth factor elevation without gross lesions (V...

  3. Male and female runners demonstrate different sagittal plane mechanics as a function of static hamstring flexibility

    Science.gov (United States)

    Williams III, D. S. Blaise; Welch, Lee M.

    2015-01-01

    ABSTRACT Background: Injuries to runners are common. However, there are many potential contributing factors to injury. While lack of flexibility alone is commonly related to injury, there are clear differences in hamstring flexibility between males and females. Objective: To compare the effect of static hamstring length on sagittal plane mechanics between male and female runners. Method: Forty subjects (30.0±6.4 years) participated and were placed in one of 4 groups: flexible males (n=10), inflexible males (n=10), flexible females (n=10), and inflexible females (n=10). All subjects were free of injury at the time of data collection. Three-dimensional kinematics and kinetics were collected while subjects ran over ground across 2 force platforms. Sagittal plane joint angles and moments were calculated at the knee and hip and compared with a 2-way (sex X flexibility) ANOVA (α=0.05). Results: Males exhibited greater peak knee extension moment than females (M=2.80±0.47, F=2.48±0.52 Nm/kg*m, p=0.05) and inflexible runners exhibited greater peak knee extension moment than flexible runners (In=2.83±0.56, Fl=2.44±0.51 Nm/kg*m, p=0.01). For hip flexion at initial contact, a significant interaction existed (pHamstring flexibility results in different mechanical profiles in males and females. Flexibility in the hamstrings may result in decreased moments via active or passive tension. These differences may have implications for performance and injury in flexible female runners. PMID:26537812

  4. Aluminium resistant, plant growth promoting bacteria induce overexpression of Aluminium stress related genes in Arabidopsis thaliana and increase the ginseng tolerance against Aluminium stress.

    Science.gov (United States)

    Farh, Mohamed El-Agamy; Kim, Yeon-Ju; Sukweenadhi, Johan; Singh, Priyanka; Yang, Deok-Chun

    2017-07-01

    Panax ginseng is an important cash crop in the Asian countries due to its pharmaceutical effects, however the plant is exposed to various abiotic stresses, lead to reduction of its quality. One of them is the Aluminum (Al) accumulation. Plant growth promoting bacteria which able to tolerate heavy metals has been considered as a new trend for supporting the growth of many crops in heavy metal occupied areas. In this study, twelve bacteria strains were isolated from rhizosphere of diseased Korean ginseng roots located in Gochang province, Republic of Korea and tested for their ability to grow in Al-embedded broth media. Out of them, four strains (Pseudomonas simiae N3, Pseudomonas fragi N8, Chryseobacterium polytrichastri N10, and Burkholderia ginsengiterrae N11-2) were able to grow. The strains could also show other plant growth promoting activities e.g. auxins and siderophores production and phosphate solubilization. P. simiae N3, C. polytrichastri N10, and B. ginsengiterrae N11-2 strains were able to support the growth of Arabidopsis thaliana stressed by Al while P. fragi N8 could not. Plants inoculated with P. simiae N3, C. polytrichastri N10, and B. ginsengiterrae N11-2 showed higher expression level of Al-stress related genes, AtAIP, AtALS3 and AtALMT1, compared to non-bacterized plants. Expression profiles of the genes reveal the induction of external mechanism of Al resistance by P. simiae N3 and B. ginsengiterrae N11-2 and internal mechanism by C. polytrichastri N10. Korean ginseng seedlings treated with these strains showed higher biomass, particularly the foliar part, higher chlorophyll content than non-bacterized Al-stressed seedlings. According to the present results, these strains can be used in the future for the cultivation of ginseng in Al-persisted locations. Copyright © 2017 Elsevier GmbH. All rights reserved.

  5. Effect of Vertical, Horizontal, and Combined Plyometric Training on Explosive, Balance, and Endurance Performance of Young Soccer Players.

    Science.gov (United States)

    Ramírez-Campillo, Rodrigo; Gallardo, Francisco; Henriquez-Olguín, Carlos; Meylan, Cesar M P; Martínez, Cristian; Álvarez, Cristian; Caniuqueo, Alexis; Cadore, Eduardo L; Izquierdo, Mikel

    2015-07-01

    The aim of this study was to compare the effects of 6 weeks of vertical, horizontal, or combined vertical and horizontal plyometric training on muscle explosive, endurance, and balance performance. Forty young soccer players aged between 10 and 14 years were randomly divided into control (CG; n = 10), vertical plyometric group (VG; n = 10), horizontal plyometric group (HG; n = 10), and combined vertical and horizontal plyometric group (VHG; n = 10). Players performance in the vertical and horizontal countermovement jump with arms, 5 multiple bounds test (MB5), 20-cm drop jump reactive strength index (RSI20), maximal kicking velocity (MKV), sprint, change of direction speed (CODS), Yo-Yo intermittent recovery level 1 test (Yo-Yo IR1), and balance was measured. No significant or meaningful changes in the CG, apart from small change in the Yo-Yo IR1, were observed while all training programs resulted in meaningful changes in explosive, endurance, and balance performance. However, only VHG showed a statistically significant (p ≤ 0.05) increase in all performance test and most meaningful training effect difference with the CG across tests. Although no significant differences in performance changes were observed between experimental groups, the VHG program was more effective compared with VG (i.e., jumps, MKV, sprint, CODS, and balance performance) and HG (i.e., sprint, CODS, and balance performance) to small effect. The study demonstrated that vertical, horizontal, and combined vertical and horizontal jumps induced meaningful improvement in explosive actions, balance, and intermittent endurance capacity. However, combining vertical and horizontal drills seems more advantageous to induce greater performance improvements.

  6. Serum YKL-40 and assessment of severity of bronchial asthma in ...

    African Journals Online (AJOL)

    EL-HAKIM

    YKL-40 and asthma severity. 95. Table 1. Characteristics of the studied groups. Variable. Control. (n=15). Mild-Moderate asthma. (n=15). Severe asthma. (n=15). Age (yrs) mean±SD. 7.7±4.7. 6.6±4.9. 3.3±2.7. Gender (male); n (%). 10 (67%). 9 (60%). 8 (50%). PAS score. 0-4 (normal). 5-7 (mild attack). 8-11(moderate).

  7. Analysis of WWER 440 SG primary collector bolted joint damage

    Energy Technology Data Exchange (ETDEWEB)

    Matocha, K.; Wozniak, J. [Vitkovice J.S.C., Ostrava (Switzerland); Pochman, K. [NPP Dukovany (Switzerland)

    1997-12-31

    The susceptibility of CHN35VT-VD and 08CH18N10T stainless steels to stress corrosion cracking in water environment, simulating water solution found in threaded holes, was investigated using rising load line displacement tests of precracked C(T) specimens. To judge the role of oxidant on stress corrosion cracking of both stainless steels, the effect of dissolved oxygen content (fully deaerated water, water aerated at the beginning of the test) was studied. 7 refs.

  8. Subclinical laminitis and its association with pO2 and faecal alterations: Isikli, Aydin experience

    OpenAIRE

    Ibrahim Akin; Deniz Alic Ural; Mehmet Gultekin; Kerem Ural

    2015-01-01

    ABSTRACTObjective. The aim of this field trial was to investigate the relationships among subclinical laminitis, hematological, ruminal and faecal alterations. Materials and Methods. To this extent dairy cows presenting subclinical laminitis (n=11) and to those of other healthy cows without laminitis (n=10) were enrolled and assigned into two groups. All animals were receiving the same daily ration formulated to contain 47% cornsilage and 18% hay, mainly. Effects of subclinical laminitis chal...

  9. Activity, stability and kinetic parameters for α-chymotrypsin catalysed ...

    Indian Academy of Sciences (India)

    Three typical surfactants were selected based on their head group charges: a non-ionic surfactant Triton-X 100 and two zwitterionic sulphobetaine surfactants of the type CH2+1N+Me2 (CH2)3 SO 3 − (n = 10; SB3-10, n = 16; SB3-16). The kinetic parameters (such as cat and M) of the -CT at 27°C were determined ...

  10. Effects of melatonin on the ovarian response to pinealectomy or continuous light in female rats: similarity with polycystic ovary syndrome

    Directory of Open Access Journals (Sweden)

    M.F. Prata Lima

    2004-07-01

    Full Text Available The current study was conducted to investigate the relationship between melatonin and chronic anovulation. Adult (3-4 months old female Wistar rats were submitted to pinealectomy: group I: pinealectomized ovariectomized melatonin-treated (N = 10; group II: pinealectomized ovariectomized placebo-treated (N = 12; group III: pinealectomized light-treated placebo-treated(N = 10 or maintained under continuous light; group IV: maintained under continuous light, ovariectomized melatonin-treated (N = 22; group V: maintained under continuous light, ovariectomized placebo-treated (N = 10; group VI: maintained under continuous light placebo-treated (N = 10. In order to assess ovarian modifications, unilateral ovariectomy was performed during the fourth month in groups I, II, IV, V and the other ovary was removed after 8 months. Ovariectomy was performed in groups III and VI only after eight months. Melatonin (200 µg/100 g body weight dissolved in 0.02 ml absolute ethanol was injected intramuscularly daily during the last 4 months into groups I and IV. The other groups were treated with placebo (NaCl. The ovarian cysts were analyzed and their area, perimeter and maximum diameter, as well as the thickness of the ovarian capsule were measured. Daily colpocytological smears were performed throughout the study. Persistent estrous condition and ovarian cysts were observed in all groups. In pinealectomized rats the ovarian and vaginal alterations disappeared at the end of the study and in rats maintained under continuous light the vaginal and ovarian polycystic aspect was reversed only in those treated with melatonin. We conclude that melatonin may act on the ovarian response reverting chronic anovulation induced by pinealectomy or continuous light.

  11. Clinical and Surgical Findings and Outcome Following Rumenotomy in Adult Dairy Cattle Affected with Recurrent Rumen Tympany Associated with Non-Metallic Foreign Bodies

    OpenAIRE

    Z. Bani Ismail; A. Al-Majali; K. Al-Qudah

    2007-01-01

    Medical records of 31 adult dairy cows suffering from recurrent rumen tympany for at least 1 month duration that underwent exploratory laparotomy and rumenotomy were reviewed and information was obtained on signalment, history, physical examination findings, laboratory findings and surgical findings. Cases were categorized according to surgical findings into 3 groups. Group 1 (n = 10) included cattle with reticuloruminal, metallic foreign bodies and perireticular adhesions/inflammation, group...

  12. Antibacterial efficacy and effect of chlorhexidine mixed with irreversible hydrocolloid for dental impressions: a randomized controlled trial.

    Science.gov (United States)

    Cubas, Glória; Valentini, Fernanda; Camacho, Guilherme Brião; Leite, Fábio; Cenci, Maximiliano Sérgio; Pereira-Cenci, Tatiana

    2014-01-01

    This study aimed to evaluate whether chlorhexidine mixed with irreversible hydrocolloid powder decreases microbial contamination during impression taking without affecting the resulting casts. Twenty volunteers were randomly divided into two groups (n = 10) according to the liquid used for impression taking in conjunction with irreversible hydrocolloid: 0.12% chlorhexidine or water. Surface roughness and dimensional stability of the casts were evaluated. Chlorhexidine mixed with irreversible hydrocolloid decreased the percentage of microorganisms when compared with water (P impression quality.

  13. Cerebral blood flow during submaximal and maximal dynamic exercise in humans

    DEFF Research Database (Denmark)

    Thomas, S N; Schroeder, T; Secher, N H

    1989-01-01

    not differ significantly between work loads from 32 (24-33) to 86% (74-96) of VO2max (n = 10). During exercise, mean arterial pressure increased from 84 (60-100) to 101 (78-124) Torr (P less than 0.01) and PCO2 remained unchanged [5.1 (4.6-5.6) vs. 5.4 (4.4-6.3) kPa, n = 6]. These results demonstrate...

  14. Manufacture of tube billets for fuel cans by vacuum centrifugal casting

    International Nuclear Information System (INIS)

    Zelenskij, V.F.; Neklyudov, I.M.; Chernyj, B.P.

    1989-01-01

    Vacuum device for induction melting with centrifugal casting in the ingot mold with rotation vertical or horisontal axis is presented. Removing and grinding of nonmetallic inclusions are realized by selection of casting conditions and of chemically active reducer, sound metal with high ductility is obtained. Data on micro- and macrostructure of casted tube billets made of 08Kh18N10T and 06Kh16H15M3B stainless steels, designed for manufacture of fuel cans are presented

  15. Effects of tramadol and acepromazine on intraocular pressure and pupil diameter in young healthy cats

    OpenAIRE

    Schroder, Deise Cristine; Monteiro, Bianca Garay; Pytlak, Deborah Braga; Souza, Mayara Carvalho de; Mendonça, Adriane Jorge; Ribeiro, Alexandre Pinto

    2018-01-01

    ABSTRACT: This study aimed to investigate the effects of the systemic administration of acepromazine, tramadol and the association of both on intraocular pressure (IOP) and pupil diameter (PD) in young healthy cats. Cats were randomly allocated into three groups (n=10/each) and intramuscular acepromazine (AG), tramadol (TG) or acepromazine combined with tramadol (ATG) were injected. PD (electronic caliper) and IOP (applanation tonometry) were assessed before (baseline) and following 15, 30, 6...

  16. Movement of liquid metal in welding bath during welding in longitudinal magnetic field

    International Nuclear Information System (INIS)

    Kovalev, I.M.; Rybakov, A.S.

    1977-01-01

    The specific features are considered of liquid metal flow in a bath during welding of steel 12Kh18N10T plates with a non-consumable electrode in argon under interaction of the arc and bath with a longitudinal constant magnetic field. In controlling the velocity field of metal flow, the longitudinal magnetic field permits to form a seam at automatic welding of horizontal joints on a vertical plane

  17. The protective effect of aqueous extracts of roselle (Hibiscus sabdariffa L. UKMR-2) against red blood cell membrane oxidative stress in rats with streptozotocin-induced diabetes

    OpenAIRE

    Mohamed, Jamaludin; Shing, Saw Wuan; Idris, Muhd Hanis Md; Budin, Siti Balkis; Zainalabidin, Satirah

    2013-01-01

    OBJECTIVES: The aim of this study was to investigate the protective effects of aqueous extracts of roselle (Hibiscus sabdariffa L. UKMR-2) against red blood cell (RBC) membrane oxidative stress in rats with streptozotocin-induced diabetes. METHODS: Forty male Sprague-Dawley rats weighing 230-250 g were randomly divided into four groups (n = 10 rats each): control group (N), roselle-treated control group, diabetic group, and roselle-treated diabetic group. Roselle was administered by force-f...

  18. Investigação sobre o desamparo aprendido em humanos

    OpenAIRE

    Mariana Januario Samelo

    2008-01-01

    A literatura sobre o desamparo aprendido utilizando humanos como participantes de pesquisa, tem encontrado dificuldades metodologicas. O presente experimento teve como objetivo geral estabelecer um procedimento que permitisse controle experimental suficiente para verificacao do efeito de uma historia de incontrolabilidade, com e sem feedback de erro, sobre a aprendizagem de uma nova resposta operante em sujeitos humanos. Estudantes universitarios foram divididos em quatro grupos (n=10), deno...

  19. Vitality of Enterococcus faecalis inside dentinal tubules after five root canal disinfection methods

    OpenAIRE

    Vatkar, Niranjan Ashok; Hegde, Vivek; Sathe, Sucheta

    2016-01-01

    Aim: To compare the vitality of Enterococcus faecalis within dentinal tubules after subjected to five root canal disinfection methods. Materials and Methods: Dentin blocks (n = 60) were colonized with E. faecalis. After 4 weeks of incubation, the dentin blocks were divided into one control and five test groups (n = 10 each). The root canals of test groups were subjected to one of the disinfection methods, namely, normal saline (NS), sodium hypochlorite (NaOCl), chlorhexidine digluconate (C...

  20. Effect of wind direction and speed on the dispersion of nucleation and accumulation mode particles in an urban street canyon.

    Science.gov (United States)

    Kumar, Prashant; Fennell, Paul; Britter, Rex

    2008-08-25

    There have been many studies concerning dispersion of gaseous pollutants from vehicles within street canyons; fewer address the dispersion of particulate matter, particularly particle number concentrations separated into the nucleation (10-30 nm or N10-30) or accumulation (30-300 nm or N30-300) modes either separately or together (N10-300). This study aimed to determine the effect of wind direction and speed on particle dispersion in the above size ranges. Particle number distributions (PNDs) and concentrations (PNCs) were measured in the 5-2738 nm range continuously (and in real-time) for 17 days between 7th and 23rd March 2007 in a regular (aspect ratio approximately unity) street canyon in Cambridge (UK), using a newly developed fast-response differential mobility spectrometer (sampling frequency 0.5 Hz), at 1.60 m above the road level. The PNCs in each size range, during all wind directions, were better described by a proposed two regime model (traffic-dependent and wind-dependent mixing) than by simply assuming that the PNC was inversely proportional to the wind speed or by fitting the data with a best-fit single power law. The critical cut-off wind speed (Ur,crit) for each size range of particles, distinguishing the boundary between these mixing regimes was also investigated. In the traffic-dependent PNC region (UrUrwind speed and direction. In the wind speed dependent PNC region (UrUr>Ur,critUr,crit), concentrations were inversely proportional to Ur irrespective of any particle size range and wind directions. The wind speed demarcating the two regimes (Ur,critUr,crit) was 1.23+/-0.55 m s(-1) for N10-300, (1.47+/-0.72 m s(-1)) for N10-30 but smaller (0.78+/-0.29 m s(-1)) for N30-300.