Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

Directory of Open Access Journals (Sweden)

Stephen Fox

2017-06-01

Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

Man-machine communication in reactor control using AI methods

International Nuclear Information System (INIS)

Klebau, J.; Lindner, A.; Fiedler, U.

1987-01-01

In the last years the interest in process control has expecially focused on problems of man-machine communication. It depends on its great importance to process performance and user acceptance. Advanced computerized operator aids, e.g. in nuclear power plants, are as well as their man-machine interface. In the Central Institute for Nuclear Research in Rossendorf a computerized operator support system for nuclear power plants is designed, which is involved in a decentralized process automation system. A similar but simpler system, the Hierarchical Informational System (HIS) at the Rossendorf Research Reactor, works with a computer controlled man-machine interface, based on menu. In the special case of the disturbance analysis program SAAP-2, which is included in the HIS, the limits of menu techniques are obviously. Therefore it seems to be necessary and with extended hard- and software possible to realize an user controlled natural language interface using Artificial Intelligence (AI) methods. The draft of such a system is described. It should be able to learn during a teaching phase all phrases and their meanings. The system will work on the basis of a self-organizing, associative data structure. It is used to recognize a great amount of words which are used in language analysis. Error recognition and, if possible, correction is done by means of a distance function in the word set. Language analysis should be carried out with a simplified word class controlled functional analysis. With this interface it is supposed to get experience in intelligent man-machine communication to enhance operational safety in future. (author)

Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

Science.gov (United States)

Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

1987-01-01

In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

AIS as key component in modern vessel traffic management and information systems

Energy Technology Data Exchange (ETDEWEB)

Lamers, W. [DaimlerChrysler Aerospace AG (DASA), Ulm (Germany)

1999-07-01

The objective of this paper is to provide information in respect to universal shipborne identification system (UAIS) as main sensor in various vessel traffic applications. The presented paper will give general information concerning AIS functionality and the standardisation process. Based on experience from recent projects and various IALA working group activities, a typical future VTMIS architectures is also presented being based on AIS as key sensor. The required key performance of AIS associated with the HW components will be described. The results from European technology study Indris are presented and discussed. Finally, a summary and conclusion from the presented material will complete the technical paper. The elaboration of this presentation has been carried out as a joint task between Mr. Andre van Berg, MDS Suedafrika und Mr. Walter Lamers, DASA Ulm. (orig.)

Risk Reducing Effect of AIS Implementation on Collision Risk

DEFF Research Database (Denmark)

Lützen, Marie; Friis-Hansen, Peter

2003-01-01

AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

AIS authentication

CERN Multimedia

2006-01-01

Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

Adolescent idiopathic scoliosis (AIS, environment, exposome and epigenetics: a molecular perspective of postnatal normal spinal growth and the etiopathogenesis of AIS with consideration of a network approach and possible implications for medical therapy

Directory of Open Access Journals (Sweden)

Burwell R Geoffrey

2011-12-01

Full Text Available Abstract Genetic factors are believed to play an important role in the etiology of adolescent idiopathic scoliosis (AIS. Discordant findings for monozygotic (MZ twins with AIS show that environmental factors including different intrauterine environments are important in etiology, but what these environmental factors may be is unknown. Recent evidence for common chronic non-communicable diseases suggests epigenetic differences may underlie MZ twin discordance, and be the link between environmental factors and phenotypic differences. DNA methylation is one important epigenetic mechanism operating at the interface between genome and environment to regulate phenotypic plasticity with a complex regulation across the genome during the first decade of life. The word exposome refers to the totality of environmental exposures from conception onwards, comprising factors in external and internal environments. The word exposome is used here also in relation to physiologic and etiopathogenetic factors that affect normal spinal growth and may induce the deformity of AIS. In normal postnatal spinal growth we propose a new term and concept, physiologic growth-plate exposome for the normal processes particularly of the internal environments that may have epigenetic effects on growth plates of vertebrae. In AIS, we propose a new term and concept pathophysiologic scoliogenic exposome for the abnormal processes in molecular pathways particularly of the internal environment currently expressed as etiopathogenetic hypotheses; these are suggested to have deforming effects on the growth plates of vertebrae at cell, tissue, structure and/or organ levels that are considered to be epigenetic. New research is required for chromatin modifications including DNA methylation in AIS subjects and vertebral growth plates excised at surgery. In addition, consideration is needed for a possible network approach to etiopathogenesis by constructing AIS diseasomes. These approaches may

[Artificial intelligence] AI for protection systems

Energy Technology Data Exchange (ETDEWEB)

Aggarwal, R.; Johns, A.

1997-12-31

The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

THE SPECIAL STATUS OF EXOGENOUS WORD-FORMATION WITHIN THE GERMAN WORD-FORMATION SYSTEM

Directory of Open Access Journals (Sweden)

Zhilyuk Sergey Aleksandrovich

2014-06-01

Full Text Available The article presents the properties of exogenous word-formation system taking into account the existence of two word-formation systems in modern German. On the basis of foreign research which reveal modern trends in German word-formation connected with the internationalization and the development of new European Latin language. The author defines key features of exogenous word-formation, i.e. foreign origin of wordformation units, unmotivated units, unmotivated interchange in base and affixes as well as limited distribution rules in combination with German word-formation. The article analyzes various approaches to word-division, as well as motivated and unmotivated interchange of consonants in bases and in affixes. Unmotivated interchange showcases a special status of the exogenous word-formation within German. Another item covered by the article is the issue of confix. The article has opinions of researchers about correctness of its separation and a list of its features. The author presents his definition of confix: a confix is a bound exogenous word-formation unit with a certain lexical and semantic meaning and joining other units directly or indirectly (through linking morpheme -o-, which is able to make a base. Moreover, some confixes are able to participate at word-combination and have unlimited distribution. So far, confix showcases the integration of exogenous word-formation and traditional German word-formation. The research proves the special status of exogenous word-formation in German. Its results can be used as a base for further analysis of co-existing word-formation systems in German and determination of their characteristic features.

Why Don't Accounting Students like AIS?

Science.gov (United States)

Vatanasakdakul, Savanid; Aoun, Chadi

2011-01-01

Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

THE SPECIAL STATUS OF EXOGENOUS WORD-FORMATION WITHIN THE GERMAN WORD-FORMATION SYSTEM

OpenAIRE

Zhilyuk Sergey Aleksandrovich

2014-01-01

The article presents the properties of exogenous word-formation system taking into account the existence of two word-formation systems in modern German. On the basis of foreign research which reveal modern trends in German word-formation connected with the internationalization and the development of new European Latin language. The author defines key features of exogenous word-formation, i.e. foreign origin of wordformation units, unmotivated units, unmotivated interchange in base and affixes...

An SDR based AIS receiver for satellites

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

2011-01-01

For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

rTMS on left prefrontal cortex contributes to memories for positive emotional cues: a comparison between pictures and words.

Science.gov (United States)

Balconi, M; Cobelli, C

2015-02-26

The present research explored the cortical correlates of emotional memories in response to words and pictures. Subjects' performance (Accuracy Index, AI; response times, RTs; RTs/AI) was considered when a repetitive Transcranial Magnetic Stimulation (rTMS) was applied on the left dorsolateral prefrontal cortex (LDLPFC). Specifically, the role of LDLPFC was tested by performing a memory task, in which old (previously encoded targets) and new (previously not encoded distractors) emotional pictures/words had to be recognized. Valence (positive vs. negative) and arousing power (high vs. low) of stimuli were also modulated. Moreover, subjective evaluation of emotional stimuli in terms of valence/arousal was explored. We found significant performance improving (higher AI, reduced RTs, improved general performance) in response to rTMS. This "better recognition effect" was only related to specific emotional features, that is positive high arousal pictures or words. Moreover no significant differences were found between stimulus categories. A direct relationship was also observed between subjective evaluation of emotional cues and memory performance when rTMS was applied to LDLPFC. Supported by valence and approach model of emotions, we supposed that a left lateralized prefrontal system may induce a better recognition of positive high arousal words, and that evaluation of emotional cue is related to prefrontal activation, affecting the recognition memories of emotions. Copyright © 2014 IBRO. Published by Elsevier Ltd. All rights reserved.

The Relevance of AI Research to CAI.

Science.gov (United States)

Kearsley, Greg P.

This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

Artificial intelligence/expert (AI/EX) systems for steelworks pollution control

Energy Technology Data Exchange (ETDEWEB)

Schofield, N.; Le Louer, P.; Mirabile, D.; Hubner, R. [Corus UK Ltd., Rotherham (United Kingdom)

2002-07-01

The objectives of this project have been to develop and apply artificial intelligence and expert system (AI/EX) methods to improve the control and operational performance of steelworks' pollution control equipment and to assess the viability and benefits of using such systems in dynamic process plant applications. Four distinct sub-projects were carried out: an expert system incorporating knowledge-based rules and neural network simulations has been developed by Corus which provides plant personnel with a real-time condition monitoring tool for the plant. Abnormalities with plant operation are now instantly recognised and alarmed, allowing prioritised maintenance to increase plant availability. The LECES project focused on studies concerning three different sites in order to evaluate predictive emission monitoring systems using neural networks to replace conventional instrumental and controls in steelworks' combustion systems. VAI developed a software template for pollution control expert systems to demonstrate the transferability of AI/EX technology. This has been done through the development of a validated process database containing data from the Corus sub-project and the subsequent integration of this data with dynamic emission models to produce rules for input to an evaluation database. CSM developed a fuzzy logic controlled process management system applied to the biological treatment of coke-oven waste water. A pilot plant has been installed and results on simulations performed using the fuzzy logic system linked to a neural network simulator show that it is possible to obtain great advantages in the biological pilot plant performance.

Application of AI methods to aircraft guidance and control

Science.gov (United States)

Hueschen, Richard M.; Mcmanus, John W.

1988-01-01

A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

Discussion on AI Technology in Information Library Design

OpenAIRE

日比野, 省三; Shozo, HIBINO; 中京大学社会学部

1987-01-01

This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

Treat a new and efficient match algorithm for AI production system

CERN Document Server

Miranker, Daniel P

1988-01-01

TREAT: A New and Efficient Match Algorithm for AI Production Systems describes the architecture and software systems embodying the DADO machine, a parallel tree-structured computer designed to provide significant performance improvements over serial computers of comparable hardware complexity in the execution of large expert systems implemented in production system form.This book focuses on TREAT as a match algorithm for executing production systems that is presented and comparatively analyzed with the RETE match algorithm. TREAT, originally designed specifically for the DADO machine architect

Companion Cognitive Systems: A Step toward Human-Level AI

OpenAIRE

Forbus, Kenneth D.; Hinrichs, Thomas R.

2006-01-01

We are developing Companion Cognitive Systems, a new kind of software that can be effectively treated as a collaborator. Aside from their potential utility, we believe this effort is important because it focuses on three key problems that must be solved to achieve human-level AI: Robust reasoning and learning, interactivity, and longevity. We describe the ideas we are using to develop the first architecture for Companions: analogical processing, grounded in cognitive science for reasoning and...

Development of an advanced educational system using AI techniques

International Nuclear Information System (INIS)

Yoshimura, Seiichi

1990-01-01

This paper describes an advanced educational system that realizes effective education using AI techniques. The system is composed of three devices. One is a knowledge-processing computer that evaluates the operator's knowledge level and presents educational materials. Another is a computer for displaying transients. The other is a computer for voice input and output. The educational materials utilize cause-and-effect relationships. The relationships enable to perform effective education by pointing out the parts the operator failed to understand. An evaluation test was performed by actually operating the system. As a result, the system's fundamental characteristics, such as the ease of understanding the relationships, and the usefulness of the advanced evaluation of the operator's knowledge level, were evaluated highly. (author)

Expanding the Possibilities of AIS Data with Heuristics

Directory of Open Access Journals (Sweden)

Bjørnar Brende Smestad

2017-06-01

Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

OpenAIRE

Yampolskiy, Roman V.; Spellchecker, M. S.

2016-01-01

In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

AI and Mathematical Education

Directory of Open Access Journals (Sweden)

Angel Garrido

2012-01-01

Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

Artificial intelligence. Fears of an AI pioneer.

Science.gov (United States)

Russell, Stuart; Bohannon, John

2015-07-17

From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

Agricultural Innovation Systems (AIS): A Study of Stakeholders and Their Relations in System of Rice Intensification (SRI)

Science.gov (United States)

Suchiradipta, Bhattacharjee; Raj, Saravanan

2015-01-01

Purpose: This paper identifies the stakeholders of System of Rice Intensification (SRI), their roles and actions and the supporting and enabling environment of innovation in the state as the elements of the Agricultural Innovation Systems (AIS) in SRI in Tripura state of India and studies the relationship matrix among the stakeholders.…

AI-guided parameter optimization in inverse treatment planning

International Nuclear Information System (INIS)

Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

2003-01-01

An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

Learning game AI programming with Lua

CERN Document Server

Young, David

2014-01-01

If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

Energy Technology Data Exchange (ETDEWEB)

Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

1991-01-01

This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

Discovering Knowledge from AIS Database for Application in VTS

Science.gov (United States)

Tsou, Ming-Cheng

The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

Human-Assisted AI: an Intelligence Augmentation Approach

OpenAIRE

Alicea, Bradly

2018-01-01

As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

Integrating the Wall Street Journal into AIS Courses

Science.gov (United States)

Kohlmeyer, James M., III

2008-01-01

While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

A Review of Future and Ethical Perspectives of Robotics and AI

OpenAIRE

Jim Torresen

2018-01-01

In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to ...

Automatic Prompt System in the Process of Mapping plWordNet on Princeton WordNet

Directory of Open Access Journals (Sweden)

Paweł Kędzia

2015-06-01

Full Text Available Automatic Prompt System in the Process of Mapping plWordNet on Princeton WordNet The paper offers a critical evaluation of the power and usefulness of an automatic prompt system based on the extended Relaxation Labelling algorithm in the process of (manual mapping plWordNet on Princeton WordNet. To this end the results of manual mapping – that is inter-lingual relations between plWN and PWN synsets – are juxtaposed with the automatic prompts that were generated for the source language synsets to be mapped. We check the number and type of inter-lingual relations introduced on the basis of automatic prompts and the distance of the respective prompt synsets from the actual target language synsets.

Application of artificial intelligence (AI) methods for designing and analysis of reconfigurable cellular manufacturing system (RCMS)

CSIR Research Space (South Africa)

Xing, B

2009-12-01

Full Text Available This work focuses on the design and control of a novel hybrid manufacturing system: Reconfigurable Cellular Manufacturing System (RCMS) by using Artificial Intelligence (AI) approach. It is hybrid as it combines the advantages of Cellular...

AiGERM: A logic programming front end for GERM

Science.gov (United States)

Hashim, Safaa H.

1990-01-01

AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

SDI satellite autonomy using AI and Ada

Science.gov (United States)

Fiala, Harvey E.

1990-01-01

The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

A Review of Future and Ethical Perspectives of Robotics and AI

Directory of Open Access Journals (Sweden)

Jim Torresen

2018-01-01

Full Text Available In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to avoid a dystopian future. References to recent initiatives to outline ethical guidelines for both the design of systems and how they should operate are included.

AI empowered context-aware smart system for medication adherence

Directory of Open Access Journals (Sweden)

Qiong Wu

2017-06-01

Full Text Available Purpose – Poor medication adherence leads to high hospital admission rate and heavy amount of health-care cost. To cope with this problem, various electronic pillboxes have been proposed to improve the medication adherence rate. However, most of the existing electronic pillboxes use time-based reminders which may often lead to ineffective reminding if the reminders are triggered at inopportune moments, e.g. user is sleeping or eating. Design/methodology/approach – In this paper, the authors propose an AI-empowered context-aware smart pillbox system. The pillbox system collects real-time sensor data from a smart home environment and analyzes the user’s contextual information through a computational abstract argumentation-based activity classifier. Findings – Based on user’s different contextual states, the smart pillbox will generate reminders at appropriate time and on appropriate devices. Originality/value – This paper presents a novel context-aware smart pillbox system that uses argumentation-based activity recognition and reminder generation.

A regulator's viewpoint on the use of AI in the nuclear industry

International Nuclear Information System (INIS)

Wainwright, N.

1995-01-01

The regulatory position within the UK places the responsibility for safety on a nuclear site with the licensee. The licensee must produce a safety case that demonstrates that the plant is safe. Assessment of this safety case is performed by the regulator in the Health and Safety Executive (HSE) using HSE's published Safety Assessment Principles. This paper presents the personal views of a regulator on the use of artificial intelligence (AI) in the nuclear industry. The AI-based system considered are restricted to expert systems, neural networks and fuzzy logic. Some of the safety issues are discussed. The particular concerns associated with software-based systems are compounded by some of the inherent problems of AI-based systems. Such is the nature of these concerns that an acceptable safety case will be difficult to mount for safety systems and post-accident monitoring systems. However, given the present maturity of the technology, acceptable safety cases might be formulated in the areas of operator advisory systems designed to reduce accident frequencies, and robotics where dose reduction is important. There are also arguments that suggests that suitable safety cases could be formulated for AI-based plant control systems. Nevertheless, AI-based systems should be treated with caution - further research is required into suitable designs and safety demonstration techniques. (author)

Artificial Intelligence Study (AIS).

Science.gov (United States)

1987-02-01

ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

QML-AiNet: An immune network approach to learning qualitative differential equation models.

Science.gov (United States)

Pang, Wei; Coghill, George M

2015-02-01

In this paper, we explore the application of Opt-AiNet, an immune network approach for search and optimisation problems, to learning qualitative models in the form of qualitative differential equations. The Opt-AiNet algorithm is adapted to qualitative model learning problems, resulting in the proposed system QML-AiNet. The potential of QML-AiNet to address the scalability and multimodal search space issues of qualitative model learning has been investigated. More importantly, to further improve the efficiency of QML-AiNet, we also modify the mutation operator according to the features of discrete qualitative model space. Experimental results show that the performance of QML-AiNet is comparable to QML-CLONALG, a QML system using the clonal selection algorithm (CLONALG). More importantly, QML-AiNet with the modified mutation operator can significantly improve the scalability of QML and is much more efficient than QML-CLONALG.

AIS ASM Operational Integration Plan

Science.gov (United States)

2013-08-01

Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

Use of AI-1024 and AI-4096 analyzers in multiple regimes

International Nuclear Information System (INIS)

Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

1975-01-01

The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

AI and health

OpenAIRE

Martin Anderson

2018-01-01

ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

MassAI

DEFF Research Database (Denmark)

2011-01-01

A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

Alarm processing system using AI techniques for nuclear power plant

International Nuclear Information System (INIS)

Yang, Joon On; Chang, Soon Heung

1990-01-01

An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

Ada in AI or AI in Ada. On developing a rationale for integration

Science.gov (United States)

Collard, Philippe E.; Goforth, Andre

1988-01-01

The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

National AIS at 1 Minute Intervals

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

Application of AI technology to nuclear plant operations

International Nuclear Information System (INIS)

Sackett, J.I.

1988-01-01

In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

WORD LEVEL DISCRIMINATIVE TRAINING FOR HANDWRITTEN WORD RECOGNITION

NARCIS (Netherlands)

Chen, W.; Gader, P.

2004-01-01

Word level training refers to the process of learning the parameters of a word recognition system based on word level criteria functions. Previously, researchers trained lexicon­driven handwritten word recognition systems at the character level individually. These systems generally use statistical

Calibrating AIS images using the surface as a reference

Science.gov (United States)

Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

1987-01-01

A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

AIS Algorithm for Smart Antenna Application in WLAN

Directory of Open Access Journals (Sweden)

Evizal Abdul Kadir

2015-07-01

Full Text Available Increasing numbers of wireless local area networks (WLAN replacing wired networks have an impact on wireless network systems, causing issues such as interference. The smart antenna system is a method to overcome interference issues in WLANs. This paper proposes an artificial immune system (AIS for a switch beam smart antenna system. A directional antenna is introduced to aim the beam at the desired user. The antenna consists of 8 directional antennas, each of which covers 45 degrees, thus creating an omnidirectional configuration of which the beams cover 360 degrees. To control the beam switching, an inexpensive PIC 16F877 microchip was used. An AIS algorithm was implemented in the microcontroller, which uses the received radio signal strength of the mobile device as reference. This is compared for each of the eight beams, after which the AIS algorithm selects the strongest signal received by the system and the microcontroller will then lock to the desired beam. In the experiment a frequency of 2.4 GHz (ISM band was used for transmitting and receiving. A test of the system was conducted in an outdoor environment. The results show that the switch beam smart antenna worked fine based on locating the mobile device.

Ai

African Journals Online (AJOL)

:=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

AIS Ship Traffic: Hawaii: 2011-2012

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

AIS reception from a CubeSat in LEO

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

2013-01-01

The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

Formal languages, automata and numeration systems introduction to combinatorics on words

CERN Document Server

Rigo, Michel

2014-01-01

Formal Languages, Automaton and Numeration Systems presents readers with a review of research related to formal language theory, combinatorics on words or numeration systems, such as Words, DLT (Developments in Language Theory), ICALP, MFCS (Mathematical Foundation of Computer Science), Mons Theoretical Computer Science Days, Numeration, CANT (Combinatorics, Automata and Number Theory). Combinatorics on words deals with problems that can be stated in a non-commutative monoid, such as subword complexity of finite or infinite words, construction and properties of infinite words, unavoidabl

Dicty_cDB: FC-AI01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

Dicty_cDB: FC-AI13 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

Proceedings of conference on AI applications in physical sciences

International Nuclear Information System (INIS)

1993-01-01

A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

Present status of application of AI in nuclear industry

International Nuclear Information System (INIS)

Kitamura, Masaharu

1989-01-01

Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

AI, automation and the Flight Telerobotic Servicer

Science.gov (United States)

Goforth, Andre; Dominy, Robert

1988-01-01

A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

Dicty_cDB: FC-AI17 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

Dicty_cDB: FC-AI18 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

Detection of possible AI-2-mediated quorum sensing system in commensal intestinal bacteria.

Science.gov (United States)

Lukás, F; Gorenc, G; Kopecný, J

2008-01-01

The Vibrio harveyi strain BB170-autoinducer bioassay was used to detect possible quorum sensing autoinducer-2 molecule (AI-2) in culture fluids of commensal intestinal bacteria. Culture fluids of Bacteroides vulgatus, Clostridium proteoclasticum, Escherichia coli, Eubacterium rectale, Lachnospira multipara, Pseudobutyrivibrio ruminis, Roseburia intestinalis, Ruminococcus albus and Ruminococcus flavefaciens contained AI-2-like molecules. The PCR bands from some of the tested strains could be also amplified using primers designed for the luxS gene. These findings suggest that AI-2 is present in the gastrointestinal tract; however, it has not yet been proved whether it is used for bacterial cell-to-cell communication.

Procedure for Marine Traffic Simulation with AIS Data

Directory of Open Access Journals (Sweden)

Rina Miyake

2015-03-01

Full Text Available It is essential to evaluate safety of marine traffic for the improvement of efficiency and safety of marine traffic. Spread of AIS makes observation of actual marine traffic more easily and faster than before. Besides, description of collision avoidance behaviours of ships are indispensable to simulate a realistic marine traffic. It is important to develop and implement an algorithm of collision avoidance corresponding to a target traffic or target area into the marine traffic simulation because actual actions for collision avoidance depend on circumstances where ships are sailing. The authors developed an automated marine traffic simulation system with AIS data. And in this paper, we proposed a series of systematic procedures for marine traffic simulation including analysing for collision avoidance behaviours using AIS data.

Making Agricultural Innovation Systems (AIS Work for Development in Tropical Countries

Directory of Open Access Journals (Sweden)

Philipp Aerni

2015-01-01

Full Text Available Agricultural innovation in low-income tropical countries contributes to a more effective and sustainable use of natural resources and reduces hunger and poverty through economic development in rural areas. Yet, despite numerous recent public and private initiatives to develop capacities for agricultural innovation, such initiatives are often not well aligned with national efforts to revive existing Agricultural Innovation Systems (AIS. In an effort to improve coordination and responsiveness of Capacity Development (CD initiatives, the G20 Agriculture Ministers requested the Food and Agriculture Organization of the United Nations (FAO to lead the development of a Tropical Agricultural Platform (TAP, which is designed to improve coherence and coordination of CD for agricultural innovation in the tropics. This paper presents a summary of the results obtained from three regional needs assessments undertaken by TAP and its partners. The surveyed tropical regions were Southeast Asia, Sub-Saharan Africa and Central America. The findings reveal a mismatch in all three regions between the external supply of primarily individual CD and the actual demand for institutional CD. The misalignment might be addressed by strengthening south-south and triangular collaboration and by improving the institutional capacities that would render national AIS more demand-oriented and responsive to the needs of smallholders in domestic agriculture.

Managing bioengineering complexity with AI techniques.

Science.gov (United States)

Beal, Jacob; Adler, Aaron; Yaman, Fusun

2016-10-01

Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Dicty_cDB: FC-AI03 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

Dicty_cDB: FC-AI04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

Dicty_cDB: FC-AI10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

Dicty_cDB: FC-AI23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

Dicty_cDB: FC-AI05 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

Dicty_cDB: FC-AI21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

How to define a word in a lexical network?

Directory of Open Access Journals (Sweden)

Dorota Sikora

2012-01-01

Full Text Available As underlined in Wierzbicka (1996: 239, a «linguistic definition is a scientific hypothesis about the concept encoded in a given word». The present paper focuses on the problem of what such hypothesis is about. Lexicon of any language is structured with a set of connections relating lexical items. That is to say that speakers of any language need to master not only separate words, but rather a cluster of connected senses. If so, then a lexical definition should lay out the concept the word lexicalizes in the way that gives access to the whole grasp of its conceptual, paradigmatic and syntagmatic relations. We discuss the topic of definitional structures developed in the context of the French Lexical Network (Réseau Lexical du Français.

Dicty_cDB: FC-AI12 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

Dicty_cDB: FC-AI19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

Dicty_cDB: FC-AI14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

Dicty_cDB: FC-AI06 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

Dicty_cDB: FC-AI09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

AI 3D Cybug Gaming

OpenAIRE

Ahmed, Zeeshan

2010-01-01

In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

Dicty_cDB: FC-AI15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

Dicty_cDB: FC-AI24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

Explanation and trust: what to tell the user in security and AI?

NARCIS (Netherlands)

Pieters, Wolter

There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

Dicty_cDB: FC-AI08 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

NASA space station automation: AI-based technology review

Science.gov (United States)

Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

1985-01-01

Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

Explanation and trust: what to tell the user in security and AI?

NARCIS (Netherlands)

Pieters, Wolter

2010-01-01

There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

A study on the applications of AI in finishing of additive manufacturing parts

Science.gov (United States)

Fathima Patham, K.

2017-06-01

Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

Energy Technology Data Exchange (ETDEWEB)

Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

2017-04-15

A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

International Nuclear Information System (INIS)

Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

2017-01-01

A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

Dicty_cDB: FC-AI07 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

Dicty_cDB: FC-AI22 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

Dynamic burstiness of word-occurrence and network modularity in textbook systems

Science.gov (United States)

Cui, Xue-Mei; Yoon, Chang No; Youn, Hyejin; Lee, Sang Hoon; Jung, Jean S.; Han, Seung Kee

2017-12-01

We show that the dynamic burstiness of word occurrence in textbook systems is attributed to the modularity of the word association networks. At first, a measure of dynamic burstiness is introduced to quantify burstiness of word occurrence in a textbook. The advantage of this measure is that the dynamic burstiness is decomposable into two contributions: one coming from the inter-event variance and the other from the memory effects. Comparing network structures of physics textbook systems with those of surrogate random textbooks without the memory or variance effects are absent, we show that the network modularity increases systematically with the dynamic burstiness. The intra-connectivity of individual word representing the strength of a tie with which a node is bound to a module accordingly increases with the dynamic burstiness, suggesting individual words with high burstiness are strongly bound to one module. Based on the frequency and dynamic burstiness, physics terminology is classified into four categories: fundamental words, topical words, special words, and common words. In addition, we test the correlation between the dynamic burstiness of word occurrence and network modularity using a two-state model of burst generation.

Health Information in French (français)

Science.gov (United States)

... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

AI mass spectrometers for space shuttle health monitoring

Science.gov (United States)

Adams, F. W.

1991-01-01

The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

NARCIS (Netherlands)

Roets, F.; Oberlander, K.C.; Dreyer, L.L.

2012-01-01

South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

Archiving AIS messages in a Geo-DBMS

NARCIS (Netherlands)

Meijers, B.M.; Quak, C.W.; van Oosterom, P.J.M.; Bregt, Arnold; Sarjakoski, Tapani; Lammeren, Ron van; Rip, Frans

2017-01-01

This paper reports on the result of two studies for using a geographical database management system for archiving Automated Identification System (AIS) message data. In this paper, we analyse the storage (using MongoDB and PostgreSQL) and we give a more in-depth description of a possible data model

AI its nature and future

CERN Document Server

Boden, Margaret A

2016-01-01

least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

AI techniques in geomagnetic storm forecasting

Science.gov (United States)

Lundstedt, Henrik

This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

The Use of Hospital Information Systems Data Base with Word Processing and Other Medical Records System Applications

OpenAIRE

Rusnak, James E.

1982-01-01

The approach frequently used to introduce computer technology into a hospital Medical Records Department is to implement a Word Processing System. Word processing is a form of computer system application that is intended to improve the department's productivity by improving the medical information transcription process. The effectiveness of the Word Processing System may be further enhanced by installing system facilities to provide access to data processing file information in the Hospital's...

Modeling Progress in AI

OpenAIRE

Brundage, Miles

2015-01-01

Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

The implementation of AI technologies in computer wargames

Science.gov (United States)

Tiller, John A.

2004-08-01

Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

Tweeting AI: Perceptions of Lay vs Expert Twitterati

OpenAIRE

Manikonda, Lydia; Kambhampati, Subbarao

2017-01-01

With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

Areal Informations Systemet - AIS

DEFF Research Database (Denmark)

Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

LuxS/AI-2 system is involved in antibiotic susceptibility and autolysis in Staphylococcus aureus NCTC 8325.

Science.gov (United States)

Xue, Ting; Zhao, Liping; Sun, Baolin

2013-01-01

Current treatment for Staphylococcus aureus infections relies heavily upon the cell wall synthesis inhibitor antibiotics such as penicillin, oxacillin, vancomycin and teicoplanin. Increasing antibiotic resistance requires the development of new approaches to combating infection. Autoinducer-2 (AI-2) exists widely both in Gram-negative and Gram-positive pathogens and is suggested as a universal language for intraspecies and interspecies communication. This study demonstrates the association between AI-2 signalling and cell wall synthesis inhibitor antibiotic susceptibility in S. aureus. In addition, a luxS mutant exhibited decreased autolysis and upregulated vancomycin resistance-associated VraRS two-component regulatory system. This finding may provide novel clues for antimicrobial therapy in S. aureus infection. Copyright © 2012 Elsevier B.V. and the International Society of Chemotherapy. All rights reserved.

Development and application of AI technology to plant operation and support

International Nuclear Information System (INIS)

Sackett, J.I.; Mott, J.E.

1989-01-01

This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

La bêtise, un privilège français ?

Directory of Open Access Journals (Sweden)

Magdalena Cámpora

2012-03-01

Full Text Available Le mot « bêtise » en français est polysémique et graduel et il ne semble pas y avoir en espagnol d'équivalent qui recouvre la totalité de ses acceptions. Cette situation acquiert des proportions considérables lorsqu'il s'agit de traduire Flaubert : en français flaubertien le mot « bêtise » s'étend comme on sait sur toute une gamme de signifiés, et le sens et le degré de nuisance que Flaubert lui attribue changent incessamment selon le contexte. Or une étude suivie des occurrences de « bêtise » dans des éditions argentines montre que ce qui se perd en premier dans le processus de traduction est justement cet emploi répété du mot : “torpeza”, “estupidez”, “barbaridad”, “idiotez”, “necedad”, “tontería” sont quelques unes des équivalences retenues par les traducteurs. Quels sont les effets de ce manque sur la textualité flaubertienne lorsqu'elle est traduite en espagnol ? Et est-ce nécessairement un manque ?The word “bêtise” is in French polysemic and gradual and there does not seem to be an equivalent in Spanish that covers the totality of its occurrences. The problem gets patently worse when translating Flaubert: in Flaubertian French the word “bêtise” spreads, as we know, to a whole range of signifiers, and the meaning and degree of nuisance that Flaubert attributes to it change constantly according to the context. Now the study of the occurrences of “bêtise” in Argentinean editions show that what is lost at first in the translation process is precisely this repeated use of the word: “torpeza”, “estupidez”, “barbaridad”, “idiotez”, “necedad”, “tontería” are a few of the equivalences given by the translators. What are the effects of this deficiency on the Flaubertian text when it is translated into Spanish? And is it necessarily a deficiency?

Organisational intelligence and distributed AI

OpenAIRE

Kirn, Stefan

1995-01-01

The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

Adaptive Motion Gaming AI for Health Promotion

OpenAIRE

Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

2017-01-01

This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

Electronic Control System Of Home Appliances Using Speech Command Words

Directory of Open Access Journals (Sweden)

Aye Min Soe

2015-06-01

Full Text Available Abstract The main idea of this paper is to develop a speech recognition system. By using this system smart home appliances are controlled by spoken words. The spoken words chosen for recognition are Fan On Fan Off Light On Light Off TV On and TV Off. The input of the system takes speech signals to control home appliances. The proposed system has two main parts speech recognition and smart home appliances electronic control system. Speech recognition is implemented in MATLAB environment. In this process it contains two main modules feature extraction and feature matching. Mel Frequency Cepstral Coefficients MFCC is used for feature extraction. Vector Quantization VQ approach using clustering algorithm is applied for feature matching. In electrical home appliances control system RF module is used to carry command signal from PC to microcontroller wirelessly. Microcontroller is connected to driver circuit for relay and motor. The input commands are recognized very well. The system is a good performance to control home appliances by spoken words.

The Development of AI in Medicine and the Research Environment of the SPHINX Project at the Start of the 1980s.

Science.gov (United States)

Fieschi, M

2012-01-01

To review the history of AI in Medicine in the 1980's, placing the SPHINX system in the context of other research in this field. Summarize the main systems for AI in medicine developed in the 1970-1980 decade and their relationship to the development of clinical decision-making and consultation systems The approaches taken by AI in medicine research groups is compared and contrasted to those of others using statistical and logical methods for representing clinical inferences, and the different AI approaches are summarized, and related to the architecture and systems implementation of SPHINX CONCLUSION: The SPHINX system combined a number of advanced representational and inference choices from AI in designing a decision- support system for clinical consultation in the 1980s. The context within which the system was developed is outlined and related to the historical evolution of AI in medicine during that decade.

Google Earth Visualizations of the Marine Automatic Identification System (AIS): Monitoring Ship Traffic in National Marine Sanctuaries

Science.gov (United States)

Schwehr, K.; Hatch, L.; Thompson, M.; Wiley, D.

2007-12-01

The Automatic Identification System (AIS) is a new technology that provides ship position reports with location, time, and identity information without human intervention from ships carrying the transponders to any receiver listening to the broadcasts. In collaboration with the USCG's Research and Development Center, NOAA's Stellwagen Bank National Marine Sanctuary (SBNMS) has installed 3 AIS receivers around Massachusetts Bay to monitor ship traffic transiting the sanctuary and surrounding waters. The SBNMS and the USCG also worked together propose the shifting the shipping lanes (termed the traffic separation scheme; TSS) that transit the sanctuary slightly to the north to reduce the probability of ship strikes of whales that frequent the sanctuary. Following approval by the United Nation's International Maritime Organization, AIS provided a means for NOAA to assess changes in the distribution of shipping traffic caused by formal change in the TSS effective July 1, 2007. However, there was no easy way to visualize this type of time series data. We have created a software package called noaadata-py to process the AIS ship reports and produce KML files for viewing in Google Earth. Ship tracks can be shown changing over time to allow the viewer to feel the motion of traffic through the sanctuary. The ship tracks can also be gridded to create ship traffic density reports for specified periods of time. The density is displayed as map draped on the sea surface or as vertical histogram columns. Additional visualizations such as bathymetry images, S57 nautical charts, and USCG Marine Information for Safety and Law Enforcement (MISLE) can be combined with the ship traffic visualizations to give a more complete picture of the maritime environment. AIS traffic analyses have the potential to give managers throughout NOAA's National Marine Sanctuaries an improved ability to assess the impacts of ship traffic on the marine resources they seek to protect. Viewing ship traffic

Do adolescent idiopathic scoliosis (AIS neglect proprioceptive information in sensory integration of postural control?

Directory of Open Access Journals (Sweden)

Christine Assaiante

Full Text Available INTRODUCTION: It has been reported that AIS rely much more on ankle proprioception to control the amplitude of the balance control commands as compared to age-matched healthy adolescents. Our hypothesis was that AIS do not neglect proprioceptive information to control posture probably because of their vestibular deficits. We investigated the proprioceptive contribution to postural control in AIS which expresses spinal deformity during a crucial transitional period of ontogenesis. METHODS: 10 adolescents with idiopathic scoliosis (AIS with moderate spinal deformity (10° 35° and 10 control adolescents (CA had to maintain vertical stance while very slow oscillations in the frontal plane (below the detection threshold of the semicircular canal system were applied to the support with the eyes open and closed. Postural orientation and segmental stabilisation were analysed at head, shoulder, trunk and pelvis levels. RESULTS: Scoliosis did not affect vertical orientation control and segmental stabilization strategies. Vision improves postural control in both CA and AIS, which seem more dependent on visual cues than adults. CONCLUSIONS: AIS as CA were unable to control efficiently their postural orientation on the basis of the proprioceptive cues, the only sensory information available in the EC situation, whereas in the same condition healthy young adults present no difficulty to achieve the postural control. This suggests that AIS as CA transitory neglect proprioceptive information to control their posture. These results and previous studies suggest the existence of different afferent pathways for proprioceptive information subserving different parts in sensory integration of postural control. We conclude that the static proprioceptive system is not affected by the idiopathic scoliosis, while the dynamic proprioceptive system would be mainly affected.

Performance testing of real-time AI systems using the activation framework

International Nuclear Information System (INIS)

Becker, L.; Duckworth, J.; Laznovsky, A.; Green, P.

1992-01-01

This paper describes methods for automated performance testing of real-time artificial intelligence systems using the Activation Framework software development tool. The Activation Framework is suitable for applications such as the diagnosis of power system failures, which require the interpretation of large volumes of data in real-time. The Activation Framework consists of tools for compiling groups of Expert Systems rules into executable code modules, for automatically generating code modules from high level system configuration descriptions, and for automatically generating command files for program compilation and linking. It includes an operating system environment which provides the code which is common from one real-time AI applications to the next. It also includes mechanisms, described here, for automatic performance testing. The principal emphasis of this paper is on a rule based language which is used to capture performance specifications. This specification is compiled into code modules which are used to automatically test the system. This testing can validate that the system meets performance requirements during development and after maintenance. A large number of tests can be randomly generated and executed and the correctness of the outputs automatically validated. The paper also describes graph directed testing methods to minimize the number of test runs required

Word/sub-word lattices decomposition and combination for speech recognition

OpenAIRE

Le , Viet-Bac; Seng , Sopheap; Besacier , Laurent; Bigi , Brigitte

2008-01-01

International audience; This paper presents the benefit of using multiple lexical units in the post-processing stage of an ASR system. Since the use of sub-word units can reduce the high out-of-vocabulary rate and improve the lack of text resources in statistical language modeling, we propose several methods to decompose, normalize and combine word and sub-word lattices generated from different ASR systems. By using a sub-word information table, every word in a lattice can be decomposed into ...

Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

Science.gov (United States)

McManus, John W.; Goodrich, Kenneth H.

1990-01-01

A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

One language, two number-word systems and many problems: numerical cognition in the Czech language.

Science.gov (United States)

Pixner, S; Zuber, J; Heřmanová, V; Kaufmann, L; Nuerk, H-C; Moeller, K

2011-01-01

Comparing numerical performance between different languages does not only mean comparing different number-word systems, but also implies a comparison of differences regarding culture or educational systems. The Czech language provides the remarkable opportunity to disentangle this confound as there exist two different number-word systems within the same language: for instance, "25" can be either coded in non-inverted order "dvadsetpät" [twenty-five] or in inverted order "pätadvadset" [five-and-twenty]. To investigate the influence of the number-word system on basic numerical processing within one culture, 7-year-old Czech-speaking children had to perform a transcoding task (i.e., writing Arabic numbers to dictation) in both number-word systems. The observed error pattern clearly indicated that the structure of the number-word system determined transcoding performance reliably: In the inverted number-word system about half of all errors were inversion-related. In contrast, hardly any inversion-related errors occurred in the non-inverted number-word system. We conclude that the development of numerical cognition does not only depend on cultural or educational differences, but is indeed related to the structure and transparency of a given number-word system. Copyright © 2011 Elsevier Ltd. All rights reserved.

"All-In-One Test" (AI1)

DEFF Research Database (Denmark)

Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

2013-01-01

by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

Methods of defining ontologies, word disambiguation methods, computer systems, and articles of manufacture

Science.gov (United States)

Sanfilippo, Antonio P [Richland, WA; Tratz, Stephen C [Richland, WA; Gregory, Michelle L [Richland, WA; Chappell, Alan R [Seattle, WA; Whitney, Paul D [Richland, WA; Posse, Christian [Seattle, WA; Baddeley, Robert L [Richland, WA; Hohimer, Ryan E [West Richland, WA

2011-10-11

Methods of defining ontologies, word disambiguation methods, computer systems, and articles of manufacture are described according to some aspects. In one aspect, a word disambiguation method includes accessing textual content to be disambiguated, wherein the textual content comprises a plurality of words individually comprising a plurality of word senses, for an individual word of the textual content, identifying one of the word senses of the word as indicative of the meaning of the word in the textual content, for the individual word, selecting one of a plurality of event classes of a lexical database ontology using the identified word sense of the individual word, and for the individual word, associating the selected one of the event classes with the textual content to provide disambiguation of a meaning of the individual word in the textual content.

AI in space: Past, present, and possible futures

Science.gov (United States)

Rose, Donald D.; Post, Jonathan V.

1992-01-01

While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

The Potential of AI Techniques for Remote Sensing

Science.gov (United States)

Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

1984-01-01

The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

Radioimmunoassay of apolipoprotein A-I of rat serum

International Nuclear Information System (INIS)

Fainaru, M.; Havel, R.J.; Felker, T.E.

1976-01-01

A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

JACOS: AI-based simulation system for man-machine system behavior in NPP

International Nuclear Information System (INIS)

Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya; Komiya, Akitoshi

2001-08-01

A prototype of a computer simulation system named JACOS (JAERI COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of a nuclear power plant. The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also taken into account. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. This report is prepared as User's Manual for JACOS. The first chapter of this report describes both operator and plant models in detail. The second chapter includes instructive descriptions for program installation, building of a knowledge base for operator model, execution of simulation and analysis of simulation results. The examples of simulation with JACOS are shown in the third chapter. (author)

Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

CERN Document Server

Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

2013-01-01

Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

USACE AIS Transmit Technical Support Summary Report

Science.gov (United States)

2014-09-01

the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

Functional subdivisions in low-frequency primary auditory cortex (AI).

Science.gov (United States)

Wallace, M N; Palmer, A R

2009-04-01

We wished to test the hypothesis that there are modules in low-frequency AI that can be identified by their responsiveness to communication calls or particular regions of space. Units were recorded in anaesthetised guinea pig AI and stimulated with conspecific vocalizations and a virtual motion stimulus (binaural beats) presented via a closed sound system. Recording tracks were mainly oriented orthogonally to the cortical surface. Some of these contained units that were all time-locked to the structure of the chutter call (14/22 tracks) and/or the purr call (12/22 tracks) and/or that had a preference for stimuli from a particular region of space (8/20 tracks with four contralateral, two ipsilateral and two midline), or where there was a strong asymmetry in the response to beats of different direction (two tracks). We conclude that about half of low-frequency AI is organized into modules that are consistent with separate "what" and "where" pathways.

Artificial intelligence (AI) systems for interpreting complex medical datasets.

Science.gov (United States)

Altman, R B

2017-05-01

Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

AI applications in sheet metal forming

CERN Document Server

Hussein, Hussein

2017-01-01

This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

Beyond AI: Multi-Intelligence (MI) Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

OpenAIRE

Stephen Fox

2017-01-01

Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...

The hidden dangers of experimenting in distributed AI

NARCIS (Netherlands)

Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.

2006-01-01

Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

Development of AI (Artificial Intelligence)-based simulation system for man-machine system behavior in accidental situations of nuclear power plant

International Nuclear Information System (INIS)

Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya; Kawase, Katumi.

1996-01-01

A prototype version of a computer simulation system named JACOS (JAeri COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of an NPP (nuclear power plant). The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also modeled. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. Some simulations of incidents were performed to verify the human model. It was found that AI-techniques used in the human model are suitable to simulate the operator's cognitive behavior in an NPP accident. The models of cognitive characteristics were investigated in the effects on simulated results of cognitive behaviors. (author)

Do handwritten words magnify lexical effects in visual word recognition?

Science.gov (United States)

Perea, Manuel; Gil-López, Cristina; Beléndez, Victoria; Carreiras, Manuel

2016-01-01

An examination of how the word recognition system is able to process handwritten words is fundamental to formulate a comprehensive model of visual word recognition. Previous research has revealed that the magnitude of lexical effects (e.g., the word-frequency effect) is greater with handwritten words than with printed words. In the present lexical decision experiments, we examined whether the quality of handwritten words moderates the recruitment of top-down feedback, as reflected in word-frequency effects. Results showed a reading cost for difficult-to-read and easy-to-read handwritten words relative to printed words. But the critical finding was that difficult-to-read handwritten words, but not easy-to-read handwritten words, showed a greater word-frequency effect than printed words. Therefore, the inherent physical variability of handwritten words does not necessarily boost the magnitude of lexical effects.

JACOS: AI-based simulation system for man-machine system behavior in NPP

Energy Technology Data Exchange (ETDEWEB)

Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawase, Katsumi [CSK Corp., Tokyo (Japan); Komiya, Akitoshi [Computer Associated Laboratory, Inc., Hitachinaka, Ibaraki (Japan)

2001-08-01

A prototype of a computer simulation system named JACOS (JAERI COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of a nuclear power plant. The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also taken into account. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. This report is prepared as User's Manual for JACOS. The first chapter of this report describes both operator and plant models in detail. The second chapter includes instructive descriptions for program installation, building of a knowledge base for operator model, execution of simulation and analysis of simulation results. The examples of simulation with JACOS are shown in the third chapter. (author)

T'ai Chi

Science.gov (United States)

... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

Adaptive game AI with dynamic scripting

NARCIS (Netherlands)

Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

2006-01-01

Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

JGOMAS: New Approach to AI Teaching

Science.gov (United States)

Barella, A.; Valero, S.; Carrascosa, C.

2009-01-01

This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

Institute of Scientific and Technical Information of China (English)

李雪; 何芳; 卢金霞; 管翠萍; 周学章

2017-01-01

[Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2�

Squeeze Casting Method Of AI-Si Alloy For Piston Material

International Nuclear Information System (INIS)

Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

2001-01-01

The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

Building regional early flood warning systems by AI techniques

Science.gov (United States)

Chang, F. J.; Chang, L. C.; Amin, M. Z. B. M.

2017-12-01

Building early flood warning system is essential for the protection of the residents against flood hazards and make actions to mitigate the losses. This study implements AI technology for forecasting multi-step-ahead regional flood inundation maps during storm events. The methodology includes three major schemes: (1) configuring the self-organizing map (SOM) to categorize a large number of regional inundation maps into a meaningful topology; (2) building dynamic neural networks to forecast multi-step-ahead average inundated depths (AID); and (3) adjusting the weights of the selected neuron in the constructed SOM based on the forecasted AID to obtain real-time regional inundation maps. The proposed models are trained, and tested based on a large number of inundation data sets collected in regions with the most frequent and serious flooding in the river basin. The results appear that the SOM topological relationships between individual neurons and their neighbouring neurons are visible and clearly distinguishable, and the hybrid model can continuously provide multistep-ahead visible regional inundation maps with high resolution during storm events, which have relatively small RMSE values and high R2 as compared with numerical simulation data sets. The computing time is only few seconds, and thereby leads to real-time regional flood inundation forecasting and make early flood inundation warning system. We demonstrate that the proposed hybrid ANN-based model has a robust and reliable predictive ability and can be used for early warning to mitigate flood disasters.

Applying AI tools to operational space environmental analysis

Science.gov (United States)

Krajnak, Mike; Jesse, Lisa; Mucks, John

1995-01-01

The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

The application of AI-based refueling control system to the Fugen NPP

International Nuclear Information System (INIS)

Maeda, Koichi; Nakamura, Shinji; Kawasaki, Noboru; Nanko, Takashi; Nishimura, Hiroshi; Tanaka, Koichi

1996-01-01

In a refueling operation of the Advanced Thermal Reactor Fugen, it is essential to precisely handle fuel assemblies to guarantee quality and from the standpoint of safety guard. In order to plan and execute efficient operations, knowledge of experienced operators based on experiences is required. Therefore, an automatic control system based on the Artificial Intelligence (AI) technology has been developed, and has been put into operation in actual refueling operations. This system prepares an optimum refueling plan, controls the fuel handling facilities by that plan, displays and prints out the history of transfer and storage of items by automatically sampled data on a work station, a network to express fuel handling facilities and operational rules acquired through operating experiences. The development of this system has made it possible to optimize refueling schedule, save control labor of items and improve reliability of refueling. Firstly the development started the off-line system that prepares optimum refueling plan and gives to the operator step by step instructions for operation, secondly developed the on-line system that automatically controls facilities by that plan. The development of this system started in 1989, the off-line system has been put into practical operation in the 17th refueling in 1991, the 22nd (12th annual inspection) refueling in 1995 has been done by using the on-line system automatically

Short-term retention of pictures and words: evidence for dual coding systems.

Science.gov (United States)

Pellegrino, J W; Siegel, A W; Dhawan, M

1975-03-01

The recall of picture and word triads was examined in three experiments that manipulated the type of distraction in a Brown-Peterson short-term retention task. In all three experiments recall of pictures was superior to words under auditory distraction conditions. Visual distraction produced high performance levels with both types of stimuli, whereas combined auditory and visual distraction significantly reduced picture recall without further affecting word recall. The results were interpreted in terms of the dual coding hypothesis and indicated that pictures are encoded into separate visual and acoustic processing systems while words are primarily acoustically encoded.

Towards a science of integrated AI and Robotics

OpenAIRE

Rajan, Kanna; Saffiotti, Alessandro

2017-01-01

The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

The development of AI-based refueling control system to the FUGEN NPP

International Nuclear Information System (INIS)

Nanko, Takashi; Tanaka, Koichi.

1996-01-01

Since even skilled workers spent a considerable time to perform the refueling work previously, an automatic control system was developed by using φNET, an AI tool and its application to refueling works was started in practice. In this system, the optimum plan for the refueling work was constructed using a network which allows to present the equipments to handle the fuel, as well as the operational roles obtained from the worker's experiences. Based on the plan, the instruments concerned were automatically operated to collect the data on the actual operation, the expression and/or printing was made on the movement histories of the articles and the status of their storages. By the development of the system, optimization of refueling works, rationalization of the management and the improvement of reliability for the works became possible. The development was performed in the following two steps; the first was development of an off-line system providing an operational guidance ot the operator according to the optimum operation plan and the second was development of an on-line system which allows to automatically control the instruments according to the operational plan. The off-line system has been put into practice since 1991 and the automatic operation of refueling has been started with the on-line system from 1995. (M.N.)

A nuclear decision support system built with a real-time process control AI shell

International Nuclear Information System (INIS)

Nevins, M.A.

1990-01-01

Managing large nuclear power plants is generally approached by creating separate management teams to handle major functional areas such as operations, maintenance, training and engineering. While this approach facilitates a general understanding of the specific functions and problem areas of a nuclear plant, such broad definitions diminish the integration of information needed to understand the overall problem domain. One solution utilizes a decision support system that integrates a real-time process control AI shell, relational database manager, graphic depiction of the real-time events, and distributed knowledge bases that reside within each of the departments. The goal is to create a living model between plant components, procedures, tech specs, specific functions, maintenance and training requirements. This paper describes such a model, called Engineering Model and Simulation System (EMASS)

The Simulation of a Major Automated Information System (AIS) on a Microcomputer

Science.gov (United States)

1984-03-01

The AIS would be selected from a public zec cor application. Rationale for this choice are: a. Many public sector organizations have a far richer...19. Boehm, Barry W. and others, Characteristics of Software Quality, North-Holland, 1978. 20. Freeman, Peter and Wasserman, Anthony I., Tutorial on

Future role of AI/Robotics in physical security

International Nuclear Information System (INIS)

Jacobs, J.

1986-01-01

Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

AI Reloaded: Objectives, Potentials, and Challenges of the Novel Field of Brain-Like Artificial Intelligence

Directory of Open Access Journals (Sweden)

Rosemarie Velik

2012-11-01

Full Text Available The general objective of Artificial Intelligence (AI is to make machines – particularly computers – do things that require intelligence when done by humans. In the last 60 years, AI has significantly progressed and today forms an important part of industry and technology. However, despite the many successes, fundamental questions concerning the creation of human-level intelligence in machines still remain open and will probably not be answerable when continuing on the current, mainly mathematic-algorithmically-guided path of AI. With the novel discipline of
Brain-Like Artificial Intelligence, one potential way out of this dilemma has been suggested. Brain-Like AI aims at analyzing and deciphering the working mechanisms of the brain and translating this knowledge into implementable AI architectures with the objective to develop in this way more efficient, flexible, and capable technical systems This article aims at giving a review about this young and still heterogeneous and dynamic research field.

Application of Artificial Intelligence (AI) Programming Techniques to Tactical Guidance for Fighter Aircraft

Science.gov (United States)

McManus, John W.; Goodrich, Kenneth H.

1989-01-01

A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within-Visual-Range (WVR) air combat engagements is discussed. The application of AI methods for development and implementation of the TDG is presented. The history of the Adaptive Maneuvering Logic (AML) program is traced and current versions of the AML program are compared and contrasted with the TDG system. The Knowledge-Based Systems (KBS) used by the TDG to aid in the decision-making process are outlined in detail and example rules are presented. The results of tests to evaluate the performance of the TDG versus a version of AML and versus human pilots in the Langley Differential Maneuvering Simulator (DMS) are presented. To date, these results have shown significant performance gains in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify than the updated FORTRAN AML programs.

Word classes

DEFF Research Database (Denmark)

Rijkhoff, Jan

2007-01-01

in grammatical descriptions of some 50 languages, which together constitute a representative sample of the world’s languages (Hengeveld et al. 2004: 529). It appears that there are both quantitative and qualitative differences between word class systems of individual languages. Whereas some languages employ...... a parts-of-speech system that includes the categories Verb, Noun, Adjective and Adverb, other languages may use only a subset of these four lexical categories. Furthermore, quite a few languages have a major word class whose members cannot be classified in terms of the categories Verb – Noun – Adjective...... – Adverb, because they have properties that are strongly associated with at least two of these four traditional word classes (e.g. Adjective and Adverb). Finally, this article discusses some of the ways in which word class distinctions interact with other grammatical domains, such as syntax and morphology....

Adaptive game AI with dynamic scripting

OpenAIRE

Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

2006-01-01

Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

the Lexique kikongo–français by

African Journals Online (AJOL)

Gilles-Maurice de Schryver

français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

One Language, Two Number-Word Systems and Many Problems: Numerical Cognition in the Czech Language

Science.gov (United States)

Pixner, S.; Zuber, J.; Hermanova, V.; Kaufmann, L.; Nuerk, H.-C.; Moeller, K.

2011-01-01

Comparing numerical performance between different languages does not only mean comparing different number-word systems, but also implies a comparison of differences regarding culture or educational systems. The Czech language provides the remarkable opportunity to disentangle this confound as there exist two different number-word systems within…

Pathologies of AI: Responsible use of artificial intelligence in professional work

NARCIS (Netherlands)

Stamper, R.K.

1988-01-01

Although the AI paradigm is useful for building knowledge-based systems for the applied natural sciences, there are dangers when it is extended into the domains of business, law and other social systems. It is misleading to treat knowledge as a commodity that can be separated from the context in

Words, Words, Words: English, Vocabulary.

Science.gov (United States)

Lamb, Barbara

The Quinmester course on words gives the student the opportunity to increase his proficiency by investigating word origins, word histories, morphology, and phonology. The course includes the following: dictionary skills and familiarity with the "Oxford,""Webster's Third," and "American Heritage" dictionaries; word…

Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

Lifescience Database Archive (English)

Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

An efficient word typing P300-BCI system using a modified T9 interface and random forest classifier.

Science.gov (United States)

Akram, Faraz; Han, Seung Moo; Kim, Tae-Seong

2015-01-01

A typical P300-based spelling brain computer interface (BCI) system types a single character with a character presentation paradigm and a P300 classification system. Lately, a few attempts have been made to type a whole word with the help of a smart dictionary that suggests some candidate words with the input of a few initial characters. In this paper, we propose a novel paradigm utilizing initial character typing with word suggestions and a novel P300 classifier to increase word typing speed and accuracy. The novel paradigm involves modifying the Text on 9 keys (T9) interface, which is similar to the keypad of a mobile phone used for text messaging. Users can type the initial characters using a 3×3 matrix interface and an integrated custom-built dictionary that suggests candidate words as the user types the initials. Then the user can select one of the given suggestions to complete word typing. We have adopted a random forest classifier, which significantly improves P300 classification accuracy by combining multiple decision trees. We conducted experiments with 10 subjects using the proposed BCI system. Our proposed paradigms significantly reduced word typing time and made word typing more convenient by outputting complete words with only a few initial character inputs. The conventional spelling system required an average time of 3.47 min per word while typing 10 random words, whereas our proposed system took an average time of 1.67 min per word, a 51.87% improvement, for the same words under the same conditions. Copyright © 2014 Elsevier Ltd. All rights reserved.

Optimal selection of LQR parameter using AIS for LFC in a multi-area power system

Directory of Open Access Journals (Sweden)

Muhammad Abdillah

2016-12-01

Full Text Available This paper proposes a method to optimize the parameter of the linear quadratic regulator (LQR using artificial immune system (AIS via clonal selection. The parameters of LQR utilized in this paper are the weighting matrices Q and R. The optimal LQR control for load frequency control (LFC is installed on each area as a decentralized control scheme. The aim of this control design is to improve the dynamic performance of LFC automatically when unexpected load change occurred on power system network. The change of load demands 0.01 p.u used as a disturbance is applied to LFC in Area 1. The proposed method guarantees the stability of the overall closed-loop system. The simulation result shows that the proposed method can reduce the overshoot of the system and compress the time response to steady-state which is better compared to trial error method (TEM and without optimal LQR control.

A photometric and spectroscopic study of the early-type binary AI Crucis

International Nuclear Information System (INIS)

Bell, S.A.; Kilkenny, D.; Malcolm, G.J.

1987-01-01

New Stroemgren photometry and medium-dispersion spectroscopy of the early-type eclipsing binary AI Cru are presented. The masses and radii of the two components are found to be (9.8 +-0.5) and (5.8 +-0.3) solar masses and (4.9 +- 0.1) and (4.4 +- 0.1) solar radii, respectively. The semi-detached nature of the system is confirmed and by comparison with stationary models by previous authors it is shown that AI Cru has probably passed through the rapid phase of Case A mass transfer. It is suggested that the original system may have had a period of about 1.3 day and that the roles of the current primary and secondary components were at that time reversed. (author)

Recent progresses on AI-2 bacterial quorum sensing inhibitors.

Science.gov (United States)

Zhu, Peng; Li, Minyong

2012-01-01

Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

On the homotopy equivalence of simple AI-algebras

International Nuclear Information System (INIS)

Aristov, O Yu

1999-01-01

Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2012-11-15

.../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting... Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative... violence within AI/AN communities. Dates and Locations: The meeting will be held on the reservation of the...

LuxS-independent formation of AI-2 from ribulose-5-phosphate

Directory of Open Access Journals (Sweden)

Hardie Kim R

2008-06-01

Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

Creating an AI modeling application for designers and developers

Science.gov (United States)

Houlette, Ryan; Fu, Daniel; Jensen, Randy

2003-09-01

Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

4th June: AIS and NICE/MAIL unique authentication

CERN Multimedia

AIS and NICE teams

2007-01-01

Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

Model of the Dynamic Construction Process of Texts and Scaling Laws of Words Organization in Language Systems.

Science.gov (United States)

Li, Shan; Lin, Ruokuang; Bian, Chunhua; Ma, Qianli D Y; Ivanov, Plamen Ch

2016-01-01

Scaling laws characterize diverse complex systems in a broad range of fields, including physics, biology, finance, and social science. The human language is another example of a complex system of words organization. Studies on written texts have shown that scaling laws characterize the occurrence frequency of words, words rank, and the growth of distinct words with increasing text length. However, these studies have mainly concentrated on the western linguistic systems, and the laws that govern the lexical organization, structure and dynamics of the Chinese language remain not well understood. Here we study a database of Chinese and English language books. We report that three distinct scaling laws characterize words organization in the Chinese language. We find that these scaling laws have different exponents and crossover behaviors compared to English texts, indicating different words organization and dynamics of words in the process of text growth. We propose a stochastic feedback model of words organization and text growth, which successfully accounts for the empirically observed scaling laws with their corresponding scaling exponents and characteristic crossover regimes. Further, by varying key model parameters, we reproduce differences in the organization and scaling laws of words between the Chinese and English language. We also identify functional relationships between model parameters and the empirically observed scaling exponents, thus providing new insights into the words organization and growth dynamics in the Chinese and English language.

Model of the Dynamic Construction Process of Texts and Scaling Laws of Words Organization in Language Systems.

Directory of Open Access Journals (Sweden)

Shan Li

Full Text Available Scaling laws characterize diverse complex systems in a broad range of fields, including physics, biology, finance, and social science. The human language is another example of a complex system of words organization. Studies on written texts have shown that scaling laws characterize the occurrence frequency of words, words rank, and the growth of distinct words with increasing text length. However, these studies have mainly concentrated on the western linguistic systems, and the laws that govern the lexical organization, structure and dynamics of the Chinese language remain not well understood. Here we study a database of Chinese and English language books. We report that three distinct scaling laws characterize words organization in the Chinese language. We find that these scaling laws have different exponents and crossover behaviors compared to English texts, indicating different words organization and dynamics of words in the process of text growth. We propose a stochastic feedback model of words organization and text growth, which successfully accounts for the empirically observed scaling laws with their corresponding scaling exponents and characteristic crossover regimes. Further, by varying key model parameters, we reproduce differences in the organization and scaling laws of words between the Chinese and English language. We also identify functional relationships between model parameters and the empirically observed scaling exponents, thus providing new insights into the words organization and growth dynamics in the Chinese and English language.

STAR - A computer language for hybrid AI applications

Science.gov (United States)

Borchardt, G. C.

1986-01-01

Constructing Artificial Intelligence application systems which rely on both symbolic and non-symbolic processing places heavy demands on the communication of data between dissimilar languages. This paper describes STAR (Simple Tool for Automated Reasoning), a computer language for the development of AI application systems which supports the transfer of data structures between a symbolic level and a non-symbolic level defined in languages such as FORTRAN, C and PASCAL. The organization of STAR is presented, followed by the description of an application involving STAR in the interpretation of airborne imaging spectrometer data.

A quick overview of artificial intelligence and expert systems

International Nuclear Information System (INIS)

Engelmore, R.S.

1989-01-01

Artificial intelligence (AI) is almost a household word these days. There have been several conferences held in this country over the last two years on artificial intelligence and its applications. The international AI conference at Snowbird, Utah, in 1987 centered on AI applications in the nuclear industry. This paper serves as an introductory overview of the subject of AI for this state-of-the-art review of AI applications in the nuclear industry. We introduce the subject in a way that will be relevant to many people in the nuclear industry who have heard of AI but are not familiar with it and are looking for answers to several simple questions. We attempt to answer those simple questions here and prepare the reader so that he or she can appreciate the following sections on AI applications in the nuclear field. (orig./GL)

Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

Lifescience Database Archive (English)

Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

Highlights on artificial insemination (AI technology in the pig

Directory of Open Access Journals (Sweden)

Tarek Khalifa

2014-03-01

Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

Quality measures and assurance for AI (Artificial Intelligence) software

Science.gov (United States)

Rushby, John

1988-01-01

This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

4th June: AIS and NICE/MAIL unique authentication

CERN Multimedia

The AIS and NICE teams

2007-01-01

Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

International Nuclear Information System (INIS)

Erickson, S.A.

1984-01-01

This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

Energy Technology Data Exchange (ETDEWEB)

Erickson, S.A.

1984-04-25

This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

Object words modulate the activity of the mirror neuron system during action imitation.

Science.gov (United States)

Wu, Haiyan; Tang, Honghong; Ge, Yue; Yang, Suyong; Mai, Xiaoqin; Luo, Yue-Jia; Liu, Chao

2017-11-01

Although research has demonstrated that the mirror neuron system (MNS) plays a crucial role in both action imitation and action-related semantic processing, whether action-related words can inversely modulate the MNS activity remains unclear. Here, three types of task-irrelevant words (body parts, verbs, and manufactured objects) were presented to examine the modulation effect of these words on the MNS activity during action observation and imitation. Twenty-two participants were recruited for the fMRI scanning and remaining data from 19 subjects were reported here. Brain activity results showed that word types elicited different modulation effects over nodes of the MNS (i.e., the right inferior frontal gyrus, premotor cortex, inferior parietal lobule, and STS), especially during the imitation stage. Compared with other word conditions, action imitation following manufactured objects words induced stronger activation in these brain regions during the imitation stage. These results were consistent in both task-dependent and -independent ROI analysis. Our findings thus provide evidence for the unique effect of object words on the MNS during imitation of action, which may also confirm the key role of goal inference in action imitation.

An Immune Agent for Web-Based AI Course

Science.gov (United States)

Gong, Tao; Cai, Zixing

2006-01-01

To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

Word form Encoding in Chinese Word Naming and Word Typing

Science.gov (United States)

Chen, Jenn-Yeu; Li, Cheng-Yi

2011-01-01

The process of word form encoding was investigated in primed word naming and word typing with Chinese monosyllabic words. The target words shared or did not share the onset consonants with the prime words. The stimulus onset asynchrony (SOA) was 100 ms or 300 ms. Typing required the participants to enter the phonetic letters of the target word,…

Ai Weiwei - 21. sajandi märter? / Tanel Veenre

Index Scriptorium Estoniae

Veenre, Tanel, 1977-

2011-01-01

Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

Research Directions for AI in Computer Games

OpenAIRE

Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian

2001-01-01

The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

Strategic Team AI Path Plans: Probabilistic Pathfinding

Directory of Open Access Journals (Sweden)

Tng C. H. John

2008-01-01

Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

Towards AI-powered personalization in MOOC learning

Science.gov (United States)

Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

2017-12-01

Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

A Business Application of the System Dynamics Approach: Word-of-Mouth and Its Effect in an Online Environment

Directory of Open Access Journals (Sweden)

Shirley Ye Sheng

2012-06-01

Full Text Available In this article, we illustrate the use of system dynamics modeling approach to study a complex system: word-of-mouth. Word-of-mouth plays an important role in reducing risk and uncertainty in purchase and consumption. Most of the prior research on word-of-mouth focused on studying either the factors that trigger consumers’ participation (sending or receiving in word-of-mouth activities or the impact word-of-mouth information has on consumers’ buying decisions. The relationship between the two decision processes, however, is recursive and dynamic. Most prior studies have not focused on a recursive relationship. Our objective is to present a system dynamics model for the study of the relationship between the buying decision and the decision to participate in word-of-mouth communication. We also discuss how system dynamics modeling can be used in other complex problems in business such as the creation of a global business.

AI model for computer games based on case based reasoning and AI planning

NARCIS (Netherlands)

Menkovski, V.; Metafas, D.

2008-01-01

Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

Off The Beaten Lane: AI Challenges In MOBAs Beyond Player Control

OpenAIRE

Cook, Michael; Summerville, Adam; Colton, Simon

2017-01-01

MOBAs represent a huge segment of online gaming and are growing as both an eSport and a casual genre. The natural starting point for AI researchers interested in MOBAs is to develop an AI to play the game better than a human - but MOBAs have many more challenges besides adversarial AI. In this paper we introduce the reader to the wider context of MOBA culture, propose a range of challenges faced by the community today, and posit concrete AI projects that can be undertaken to begin solving them.

THE IMPROVEMENT AND APPLICATION OF EI-GUN (ELECTRICAL INSEMINATION GUN FOR ARTIFICIAL INSEMINATION (AI USING GOAT FRESH SEMEN

Directory of Open Access Journals (Sweden)

Mirsa Ita Dewi

2017-03-01

Full Text Available Electrical Insemination Gun (EI-GUN was a tool for Artificial Insemination (AI using fresh semen with an electric control system. The research objective was to produced EI-GUN for AI using fresh semen on small ruminants (goat. The research was conducted from March to June 2015. The process of EI-GUN creation implemented in Design and Prototype Laboratory and Aero Modeling Research Laboratory at Engineering Faculty, University of Brawijaya (UB. Testing tools EI-GUN on goat was conducted in the Sumber Sekar Laboratory, Animal Husbandry Faculty, UB.  The methods of research were literature study, tool specification determination, designing EI-GUN, running test, semen evaluation passed EI-GUN and application on Goat. EI-GUN has seven important parts, which supports each other in this operating system. Those parts consist of stylet, servo, system controlled, insemination pump, connecting rod, battery, and holder. EI-GUN work system sucked the semen into insemination pump as much as 5 ml, and release the semen 0.25 ml appropriate standard of AI. It was applicable for 20 times AI. The results showed that the cell motility of spermatozoa ≥ 70% were still in ranging of Indonesian National Standard (SNI.   Keywords: artificial insemination, EI-GUN, fresh semen.

AI in medical education--another grand challenge for medical informatics.

Science.gov (United States)

Lillehaug, S I; Lajoie, S P

1998-03-01

The potential benefits of artificial intelligence in medicine (AIM) were never realized as anticipated. This paper addresses ways in which such potential can be achieved. Recent discussions of this topic have proposed a stronger integration between AIM applications and health information systems, and emphasize computer guidelines to support the new health care paradigms of evidence-based medicine and cost-effectiveness. These proposals, however, promote the initial definition of AIM applications as being AI systems that can perform or aid in diagnoses. We challenge this traditional philosophy of AIM and propose a new approach aiming at empowering health care workers to become independent self-sufficient problem solvers and decision makers. Our philosophy is based on findings from a review of empirical research that examines the relationship between the health care personnel's level of knowledge and skills, their job satisfaction, and the quality of the health care they provide. This review supports addressing the quality of health care by empowering health care workers to reach their full potential. As an aid in this empowerment process we argue for reviving a long forgotten AIM research area, namely, AI based applications for medical education and training. There is a growing body of research in artificial intelligence in education that demonstrates that the use of artificial intelligence can enhance learning in numerous domains. By examining the strengths of these educational applications and the results from previous AIM research we derive a framework for empowering medical personnel and consequently raising the quality of health care through the use of advanced AI based technology.

AI based HealthCare Platform for Real Time, Predictive and Prescriptive Analytics using Reactive Programming

Science.gov (United States)

Kaur, Jagreet; Singh Mann, Kulwinder, Dr.

2018-01-01

AI in Healthcare needed to bring real, actionable insights and Individualized insights in real time for patients and Doctors to support treatment decisions., We need a Patient Centred Platform for integrating EHR Data, Patient Data, Prescriptions, Monitoring, Clinical research and Data. This paper proposes a generic architecture for enabling AI based healthcare analytics Platform by using open sources Technologies Apache beam, Apache Flink Apache Spark, Apache NiFi, Kafka, Tachyon, Gluster FS, NoSQL- Elasticsearch, Cassandra. This paper will show the importance of applying AI based predictive and prescriptive analytics techniques in Health sector. The system will be able to extract useful knowledge that helps in decision making and medical monitoring in real-time through an intelligent process analysis and big data processing.

Identification of AI-2 Quorum Sensing Inhibitors in Vibrio harveyi Through Structure-Based Virtual Screening.

Science.gov (United States)

Jiang, Tianyu; Zhu, Peng; Du, Lupei; Li, Minyong

2018-01-01

Quorum sensing (QS) is a cell-to-cell communication system that regulates gene expression as a result of the production and perception of signal molecules called autoinducers (AIs). AI-2 is a QS autoinducer produced by both Gram-negative and Gram-positive bacteria, in which it regulates intraspecies and interspecies communication. The identification of QS inhibitors is considered a promising strategy for the development of anti-virulence drugs with reduced selective pressure for resistance. Here we describe a high-throughput virtual screening approach to identify AI-2 quorum sensing inhibitors on the basis of Vibrio harveyi LuxPQ crystal structure. Seven potent inhibitors with IC 50 values in the micromolar range were selected with no effect or low effect on V. harveyi growth rate.

Universal brain systems for recognizing word shapes and handwriting gestures during reading.

Science.gov (United States)

Nakamura, Kimihiro; Kuo, Wen-Jui; Pegado, Felipe; Cohen, Laurent; Tzeng, Ovid J L; Dehaene, Stanislas

2012-12-11

Do the neural circuits for reading vary across culture? Reading of visually complex writing systems such as Chinese has been proposed to rely on areas outside the classical left-hemisphere network for alphabetic reading. Here, however, we show that, once potential confounds in cross-cultural comparisons are controlled for by presenting handwritten stimuli to both Chinese and French readers, the underlying network for visual word recognition may be more universal than previously suspected. Using functional magnetic resonance imaging in a semantic task with words written in cursive font, we demonstrate that two universal circuits, a shape recognition system (reading by eye) and a gesture recognition system (reading by hand), are similarly activated and show identical patterns of activation and repetition priming in the two language groups. These activations cover most of the brain regions previously associated with culture-specific tuning. Our results point to an extended reading network that invariably comprises the occipitotemporal visual word-form system, which is sensitive to well-formed static letter strings, and a distinct left premotor region, Exner's area, which is sensitive to the forward or backward direction with which cursive letters are dynamically presented. These findings suggest that cultural effects in reading merely modulate a fixed set of invariant macroscopic brain circuits, depending on surface features of orthographies.

AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

Science.gov (United States)

Goldstein, Ira P.; Miller, Mark L.

The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

Data of evolutionary structure change: 1AIFL-2AI0L [Confc[Archive

Lifescience Database Archive (English)

Full Text Available /ss_2> 0 n> 1AIF L...n> 1AIFLn> VSSSI----SSSNL 2AI0 Ln> 2AI0L...1AIFL-2AI0L 1AIF 2AI0 L L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...line> SER CA 273 SER CA 260 ASN CA 337 LEU CA 408

Flood AI: An Intelligent Systems for Discovery and Communication of Disaster Knowledge

Science.gov (United States)

Demir, I.; Sermet, M. Y.

2017-12-01

Communities are not immune from extreme events or natural disasters that can lead to large-scale consequences for the nation and public. Improving resilience to better prepare, plan, recover, and adapt to disasters is critical to reduce the impacts of extreme events. The National Research Council (NRC) report discusses the topic of how to increase resilience to extreme events through a vision of resilient nation in the year 2030. The report highlights the importance of data, information, gaps and knowledge challenges that needs to be addressed, and suggests every individual to access the risk and vulnerability information to make their communities more resilient. This project presents an intelligent system, Flood AI, for flooding to improve societal preparedness by providing a knowledge engine using voice recognition, artificial intelligence, and natural language processing based on a generalized ontology for disasters with a primary focus on flooding. The knowledge engine utilizes the flood ontology and concepts to connect user input to relevant knowledge discovery channels on flooding by developing a data acquisition and processing framework utilizing environmental observations, forecast models, and knowledge bases. Communication channels of the framework includes web-based systems, agent-based chat bots, smartphone applications, automated web workflows, and smart home devices, opening the knowledge discovery for flooding to many unique use cases.

Humans and Machines in the Evolution of AI in Korea

OpenAIRE

Zhang, Byoung-Tak

2016-01-01

Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

harnessing_ai_20180319.pptx

OpenAIRE

Johnson, Matthew

2018-01-01

There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

An automatic system for Turkish word recognition using Discrete Wavelet Neural Network based on adaptive entropy

International Nuclear Information System (INIS)

Avci, E.

2007-01-01

In this paper, an automatic system is presented for word recognition using real Turkish word signals. This paper especially deals with combination of the feature extraction and classification from real Turkish word signals. A Discrete Wavelet Neural Network (DWNN) model is used, which consists of two layers: discrete wavelet layer and multi-layer perceptron. The discrete wavelet layer is used for adaptive feature extraction in the time-frequency domain and is composed of Discrete Wavelet Transform (DWT) and wavelet entropy. The multi-layer perceptron used for classification is a feed-forward neural network. The performance of the used system is evaluated by using noisy Turkish word signals. Test results showing the effectiveness of the proposed automatic system are presented in this paper. The rate of correct recognition is about 92.5% for the sample speech signals. (author)

AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

Directory of Open Access Journals (Sweden)

Endang W. Bachtiar

2014-07-01

Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

Lifescience Database Archive (English)

Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

AI Researchers, Video Games Are Your Friends!

OpenAIRE

Togelius, Julian

2016-01-01

If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

Brosimacutins A-I, nine new flavonoids from Brosimum acutifolium.

Science.gov (United States)

Takashima, Junko; Ohsaki, Ayumi

2002-12-01

Nine new flavonoids, brosimacutins A-I (1-9), and four known flavonoids were isolated from the bark of Brosimum acutifolium, a Brazilian folk medicine ("Mururé"). Their structures were elucidated by spectroscopic methods, including 2D NMR. Brosimacutins A-I possess differentially functionalized isoprene units at C-8.

Arabic word recognizer for mobile applications

Science.gov (United States)

Khanna, Nitin; Abdollahian, Golnaz; Brame, Ben; Boutin, Mireille; Delp, Edward J.

2011-03-01

When traveling in a region where the local language is not written using a "Roman alphabet," translating written text (e.g., documents, road signs, or placards) is a particularly difficult problem since the text cannot be easily entered into a translation device or searched using a dictionary. To address this problem, we are developing the "Rosetta Phone," a handheld device (e.g., PDA or mobile telephone) capable of acquiring an image of the text, locating the region (word) of interest within the image, and producing both an audio and a visual English interpretation of the text. This paper presents a system targeted for interpreting words written in Arabic script. The goal of this work is to develop an autonomous, segmentation-free Arabic phrase recognizer, with computational complexity low enough to deploy on a mobile device. A prototype of the proposed system has been deployed on an iPhone with a suitable user interface. The system was tested on a number of noisy images, in addition to the images acquired from the iPhone's camera. It identifies Arabic words or phrases by extracting appropriate features and assigning "codewords" to each word or phrase. On a dictionary of 5,000 words, the system uniquely mapped (word-image to codeword) 99.9% of the words. The system has a 82% recognition accuracy on images of words captured using the iPhone's built-in camera.

A prototype system for perinatal knowledge engineering using an artificial intelligence tool.

Science.gov (United States)

Sokol, R J; Chik, L

1988-01-01

Though several perinatal expert systems are extant, the use of artificial intelligence has, as yet, had minimal impact in medical computing. In this evaluation of the potential of AI techniques in the development of a computer based "Perinatal Consultant," a "top down" approach to the development of a perinatal knowledge base was taken, using as a source for such a knowledge base a 30-page manuscript of a chapter concerning high risk pregnancy. The UNIX utility "style" was used to parse sentences and obtain key words and phrases, both as part of a natural language interface and to identify key perinatal concepts. Compared with the "gold standard" of sentences containing key facts as chosen by the experts, a semiautomated method using a nonmedical speller to identify key words and phrases in context functioned with a sensitivity of 79%, i.e., approximately 8 in 10 key sentences were detected as the basis for PROLOG, rules and facts for the knowledge base. These encouraging results suggest that functional perinatal expert systems may well be expedited by using programming utilities in conjunction with AI tools and published literature.

From Word Alignment to Word Senses, via Multilingual Wordnets

Directory of Open Access Journals (Sweden)

Dan Tufis

2006-05-01

Full Text Available Most of the successful commercial applications in language processing (text and/or speech dispense with any explicit concern on semantics, with the usual motivations stemming from the computational high costs required for dealing with semantics, in case of large volumes of data. With recent advances in corpus linguistics and statistical-based methods in NLP, revealing useful semantic features of linguistic data is becoming cheaper and cheaper and the accuracy of this process is steadily improving. Lately, there seems to be a growing acceptance of the idea that multilingual lexical ontologisms might be the key towards aligning different views on the semantic atomic units to be used in characterizing the general meaning of various and multilingual documents. Depending on the granularity at which semantic distinctions are necessary, the accuracy of the basic semantic processing (such as word sense disambiguation can be very high with relatively low complexity computing. The paper substantiates this statement by presenting a statistical/based system for word alignment and word sense disambiguation in parallel corpora. We describe a word alignment platform which ensures text pre-processing (tokenization, POS-tagging, lemmatization, chunking, sentence and word alignment as required by an accurate word sense disambiguation.

76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2011-07-22

... SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of... Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') is being established in accordance...

Validation of the Avoidance and Inflexibility Scale (AIS) among treatment-seeking smokers.

Science.gov (United States)

Farris, Samantha G; Zvolensky, Michael J; DiBello, Angelo M; Schmidt, Norman B

2015-06-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as a smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.2% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at 3 time points (baseline, quit-day, and 1 month postquit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a 2-factor solution, described by inflexibility and avoidance because of smoking related "thoughts/feelings" (9 items) and "somatic sensations" (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. (c) 2015 APA, all rights reserved).

Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

Science.gov (United States)

Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

2015-01-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Baseline, Quit day, 1 month post-quit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a two-factor solution, described by inflexibility and avoidance due to smoking related “thoughts/feelings” (9 items) and “somatic sensations” (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically-relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. PMID:25642937

Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

OpenAIRE

Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

2015-01-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Bas...

Code AI Personal Web Pages

Science.gov (United States)

Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

1998-01-01

The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

Substituted Benzamides Containing Azaspiro Rings as Upregulators of Apolipoprotein A-I Transcription

Directory of Open Access Journals (Sweden)

Bin Hong

2012-06-01

Full Text Available Apolipoprotein A-I (Apo A-I is the principal protein component of high density lipoprotein (HDL, which is generally considered as a potential therapeutic target against atherosclerosis. The understanding of the Apo A-I regulation mechanism has fuelled the development of novel HDL targeted therapeutic approaches. To identify novel agents that can upregulate Apo A-I expression, we performed a cell-based reporter assay to screen 25,600 small molecules. Based on the dataset obtained from screening, a series of novel analogs of substituted benzamides containing azaspiro rings were assessed for their ability to induce the transcription of the Apo A-I gene, and the structure-activity relationship (SAR around these analogs was also proposed. The results indicated that the trifluoromethyl substituted benzamide containing an azaspiro ring is a promising backbone for designing Apo A-I transcriptional upregulator and could be viable leads for development of new drugs to prevent and treat atherosclerosis in the future.

78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2013-03-20

.../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting. SUMMARY: The National Coordination Committee on the American Indian/ Alaska Native (AI/AN) Sexual Assault... violence within AI/AN communities. DATES AND LOCATIONS: The meeting will be held via webinar on Wednesday...

Ship Emission Inventories in Estuary of the Yangtze River Using Terrestrial AIS Data

Directory of Open Access Journals (Sweden)

Xin Yao

2016-12-01

Full Text Available Estuary forms a transition zone between inland river and open sea. In China, the estuary of the Yangtze River plays a vital role in connecting the inland and oversea shipping, and witnesses heavy vessel traffic in the recent decades. Nowadays, more attentions have been directed to the issue of ship pollution in busy waterways. In order to investigate the ship emission inventory, this paper presents an Automatic Identification System(AIS based method. AIS data is the realistic data of vessel traffic including dynamic information (position, speed, course, etc. and static information (ship type, dimensions, name, etc.. According to ship dimensions, the power of engines is estimated for different ship types. By using AIS based bottom-up approach, ship emission inventories and shares of air pollutants and GHGs (Greenhouse gases are developed. Spatial distribution of ship emissions is illustrated in the form of heat map. As a case study, the emission inventories are analyzed using AIS data of 2010 in the estuary, and following results are made:(1 shares of the emission are cruise ships 6.59%, bulk carriers 5.16%, container ships 52.96%, tankers 15.16%, fishing ships 9.16%, other ships 10.97%; (2 CO2 is the dominant part of the emission. (3 Areas of highest emission intensity are generally clustered around the South Channel, the North Channel and ports in the vicinity. The proposed method is promising because it is derived from the AIS data which contains not only real data of individual ship but also vessel traffic situation in the study area. It can server as a reference for other researchers and policy makers working in this field.

Formal Safety Assessment (FSA for Analysis of Ship Collision Using AIS Data

Directory of Open Access Journals (Sweden)

Muhammad Badrus Zaman

2015-03-01

Full Text Available Currently, Maritime safety is the best issue in the world. International Maritime organization (IMO have recommended FSA methodology to enhance maritime safety. In this paper, the research conducted in the Malacca Strait. Malacca Strait is an area that has a high risk for shipping navigation. Many accidents occur in the area are like collision, fire, grounding and so on. Therefore a study on improving safety in this area is very important. it is to produce an output that can be used to provide input to the master and multiple stakeholders to improve safety on board at the time of sailing. In this study, AIS is used as a data source. Sea condition data collected actual traffic through the Automatic Identification System (AIS equipment installed at Kobe University, Japan, and Universiti Teknologi Malaysia (UTM in Johor, Malaysia. The data is applied to define a method with the help of Geographic Information Systems (GIS.

SMARTER THAN YOUR AVERAGE SENSOR: AIS SENSOR THAT INTELLIGENTLY RE-TRANSMITS MEANINGFUL INFORMATION DERIVED FROM RAWAIS DATA IN NETWORK LIMITED AREAS

Directory of Open Access Journals (Sweden)

R. G. V. Meyer

2017-11-01

Full Text Available AIS is a transponder based, anti-collision system used by the majority of ocean traffic. Ships regularly transmit their identity, position and speed. The information used to populate the AIS fields come from ship based sensors, such as GPS, and user populated fields, such as the vessels name and MMSI number. These fields are susceptible to spoofing and can be changed to hide the identity or location of a vessel. This is often done to disguise the vessel as a different class to avoid inspections or to enter a protected area without raising alarms. The AIS system has found great utility in monitoring global shipping trends and traffic but this was never intended when the protocol was designed. Docked vessels still transmit messages regularly that contain no new information. These, and other redundant messages, are still transmitted and stored. In situations where a sensor is remote and has limited access to the Internet this can become costly. The Smart-AIS sensor records all incoming messages locally and makes a decision on whether the message is of special interest or not. Messages of interest are re-transmitted to an external AIS database.

Monitoring severe accidents using AI techniques

Energy Technology Data Exchange (ETDEWEB)

No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

2012-05-15

After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

Monitoring severe accidents using AI techniques

International Nuclear Information System (INIS)

No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

2012-01-01

After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

Enabling technologies and methods for the retro-fitting of AI software into NPPS

International Nuclear Information System (INIS)

Pymm, P.

1994-01-01

Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

Using experimental game theory to transit human values to ethical AI

OpenAIRE

Wang, Yijia; Wan, Yan; Wang, Zhijian

2017-01-01

Knowing the reflection of game theory and ethics, we develop a mathematical representation to bridge the gap between the concepts in moral philosophy (e.g., Kantian and Utilitarian) and AI ethics industry technology standard (e.g., IEEE P7000 standard series for Ethical AI). As an application, we demonstrate how human value can be obtained from the experimental game theory (e.g., trust game experiment) so as to build an ethical AI. Moreover, an approach to test the ethics (rightness or wrongn...

Modulation of the semantic system by word imageability.

Science.gov (United States)

Sabsevitz, D S; Medler, D A; Seidenberg, M; Binder, J R

2005-08-01

A prevailing neurobiological theory of semantic memory proposes that part of our knowledge about concrete, highly imageable concepts is stored in the form of sensory-motor representations. While this theory predicts differential activation of the semantic system by concrete and abstract words, previous functional imaging studies employing this contrast have provided relatively little supporting evidence. We acquired event-related functional magnetic resonance imaging (fMRI) data while participants performed a semantic similarity judgment task on a large number of concrete and abstract noun triads. Task difficulty was manipulated by varying the degree to which the words in the triad were similar in meaning. Concrete nouns, relative to abstract nouns, produced greater activation in a bilateral network of multimodal and heteromodal association areas, including ventral and medial temporal, posterior-inferior parietal, dorsal prefrontal, and posterior cingulate cortex. In contrast, abstract nouns produced greater activation almost exclusively in the left hemisphere in superior temporal and inferior frontal cortex. Increasing task difficulty modulated activation mainly in attention, working memory, and response monitoring systems, with almost no effect on areas that were modulated by imageability. These data provide critical support for the hypothesis that concrete, imageable concepts activate perceptually based representations not available to abstract concepts. In contrast, processing abstract concepts makes greater demands on left perisylvian phonological and lexical retrieval systems. The findings are compatible with dual coding theory and less consistent with single-code models of conceptual representation. The lack of overlap between imageability and task difficulty effects suggests that once the neural representation of a concept is activated, further maintenance and manipulation of that information in working memory does not further increase neural activation in

Accretion in Radiative Equipartition (AiRE) Disks

Energy Technology Data Exchange (ETDEWEB)

Yazdi, Yasaman K.; Afshordi, Niayesh, E-mail: yyazdi@pitp.ca, E-mail: nafshordi@pitp.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada)

2017-07-01

Standard accretion disk theory predicts that the total pressure in disks at typical (sub-)Eddington accretion rates becomes radiation pressure dominated. However, radiation pressure dominated disks are thermally unstable. Since these disks are observed in approximate steady state over the instability timescale, our accretion models in the radiation-pressure-dominated regime (i.e., inner disk) need to be modified. Here, we present a modification to the Shakura and Sunyaev model, where the radiation pressure is in equipartition with the gas pressure in the inner region. We call these flows accretion in radiative equipartition (AiRE) disks. We introduce the basic features of AiRE disks and show how they modify disk properties such as the Toomre parameter and the central temperature. We then show that the accretion rate of AiRE disks is limited from above and below, by Toomre and nodal sonic point instabilities, respectively. The former leads to a strict upper limit on the mass of supermassive black holes as a function of cosmic time (and spin), while the latter could explain the transition between hard and soft states of X-ray binaries.

Development and Validation of the Alcohol Identity Implicit Associations Test (AI-IAT)

Science.gov (United States)

Gray, Heather M.; LaPlante, Debi A.; Bannon, Brittany L.; Ambady, Nalini; Shaffer, Howard J.

2011-01-01

Alcohol identity is the extent to which an individual perceives drinking alcohol to be a defining characteristic of his or her self-identity. Although alcohol identity might play an important role in risky college drinking practices, there is currently no easily administered, implicit measure of this concept. Therefore we developed a computerized implicit measure of alcohol identity (the Alcohol Identity Implicit Associations Test; AI-IAT) and assessed its reliability and predictive validity in relation to risky college drinking practices. One hundred forty-one college students completed the AI-IAT. Again 3- and 6-months later, we administered the AI-IAT and indices of engagement in risky college drinking practices. A subset of participants also completed the previously-validated implicit measure of alcohol identity. Scores on the AI-IAT were stable over time, internally consistent, and positively correlated with the previously-validated measure of alcohol identity. Baseline AI-IAT scores predicted future engagement in risky college drinking practices, even after controlling for standard alcohol consumption measures. We conclude that the AI-IAT reliably measures alcohol identity, a concept that appears to play an important role in risky college drinking practices. PMID:21621924

Combining AI Methods for Learning Bots in a Real-Time Strategy Game

Directory of Open Access Journals (Sweden)

Robin Baumgarten

2009-01-01

Full Text Available We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generate a new plan using a method based on decision tree learning. In addition, we have implemented more sophisticated control over low-level actions that enable the AI-bot to synchronize bombing runs, and used a simulated annealing approach for assigning bombing targets to planes and opponent cities to missiles. We describe how our AI-bot operates, and the experimentation we have performed in order to determine an optimal configuration for it. With this configuration, our AI-bot beats Introversion's finite state machine automated player in 76.7% of 150 matches played. We briefly introduce the notion of ability versus enjoyability and discuss initial results of a survey we conducted with human players.

The effect of word prediction settings (frequency of use) on text input speed in persons with cervical spinal cord injury: a prospective study.

Science.gov (United States)

Pouplin, Samuel; Roche, Nicolas; Antoine, Jean-Yves; Vaugier, Isabelle; Pottier, Sandra; Figere, Marjorie; Bensmail, Djamel

2017-06-01

To determine whether activation of the frequency of use and automatic learning parameters of word prediction software has an impact on text input speed. Forty-five participants with cervical spinal cord injury between C4 and C8 Asia A or B accepted to participate to this study. Participants were separated in two groups: a high lesion group for participants with lesion level is at or above C5 Asia AIS A or B and a low lesion group for participants with lesion is between C6 and C8 Asia AIS A or B. A single evaluation session was carried out for each participant. Text input speed was evaluated during three copying tasks: • without word prediction software (WITHOUT condition) • with automatic learning of words and frequency of use deactivated (NOT_ACTIV condition) • with automatic learning of words and frequency of use activated (ACTIV condition) Results: Text input speed was significantly higher in the WITHOUT than the NOT_ACTIV (pword prediction software with the activation of frequency of use and automatic learning increased text input speed in participants with high-level tetraplegia. For participants with low-level tetraplegia, the use of word prediction software with frequency of use and automatic learning activated only decreased the number of errors. Implications in rehabilitation   Access to technology can be difficult for persons with disabilities such as cervical spinal cord injury (SCI). Several methods have been developed to increase text input speed such as word prediction software.This study show that parameter of word prediction software (frequency of use) affected text input speed in persons with cervical SCI and differed according to the level of the lesion. • For persons with high-level lesion, our results suggest that this parameter must be activated so that text input speed is increased. • For persons with low lesion group, this parameter must be activated so that the numbers of errors are decreased. • In all cases, the

Artemisiae Argyi Folium and its geo-authentic crude drug qi ai

Directory of Open Access Journals (Sweden)

Diangang Liu

2017-01-01

Conclusion: The superior quality of qi ai compared with general AAF may be due to relatively higher contents of bioactive components. This study provides basic information for further study and utilization of AAF and qi ai.

Apolipoprotein A-I metabolism in cynomolgus monkey. Identification and characterization of beta-migrating pools

International Nuclear Information System (INIS)

Melchior, G.W.; Castle, C.K.

1989-01-01

Fresh plasma from control (C) and hypercholesterolemic (HC) cynomolgus monkeys was analyzed by agarose electrophoresis-immunoblotting with antibody to cynomolgus monkey apolipoprotein (apo) A-I. Two bands were evident on the autoradiogram: an alpha-migrating band (high density lipoprotein) and a beta-migrating band that comigrated exactly with cynomolgus monkey low density lipoprotein (LDL). The presence of beta-migrating apo A-I in the plasma of these monkeys was confirmed by Geon-Pevikon preparative electrophoresis, crossed immunoelectrophoresis, and isotope dilution studies in which radiolabeled apo A-I was found to equilibrate also with alpha- and beta-migrating pools of apo A-I in the plasma. Subfractionation of C and HC plasma by agarose column chromatography (Bio-Gel A-0.5M and A-15M) followed by agarose electrophoresis-immunoblotting indicated that the beta-migrating apo A-I in C was relatively homogeneous and eluted with proteins of Mr approximately 50 kD [apo A-I(50 kD)], whereas two beta-migrating fractions were identified in HC, one that eluted with the 50-kD proteins, and the other that eluted in the LDL Mr range [apo A-I(LDL)]. The apo A-I(LDL) was precipitated by antibody to cynomolgus monkey apo B. The apo A-I(50 kD) accounted for 5 +/- 1% (mean +/- SD) of the plasma apo A-I in C plasma, and 15 +/- 7% in HC plasma. No apo A-I(LDL) was detected in C plasma, but that fraction accounted for 9 +/- 7% of the apo A-I in HC plasma. These data establish the presence of multiple pools of apo A-I in the cynomolgus monkey, which must be taken into consideration in any comprehensive model of apo A-I metabolism in this species

General general game AI

OpenAIRE

Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

2016-01-01

Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

Combinatorics on words Christoffel words and repetitions in words

CERN Document Server

Berstel, Jean; Reutenauer, Christophe; Saliola, Franco V

2008-01-01

The two parts of this text are based on two series of lectures delivered by Jean Berstel and Christophe Reutenauer in March 2007 at the Centre de Recherches Mathématiques, Montréal, Canada. Part I represents the first modern and comprehensive exposition of the theory of Christoffel words. Part II presents numerous combinatorial and algorithmic aspects of repetition-free words stemming from the work of Axel Thue-a pioneer in the theory of combinatorics on words. A beginner to the theory of combinatorics on words will be motivated by the numerous examples, and the large variety of exercises, which make the book unique at this level of exposition. The clean and streamlined exposition and the extensive bibliography will also be appreciated. After reading this book, beginners should be ready to read modern research papers in this rapidly growing field and contribute their own research to its development. Experienced readers will be interested in the finitary approach to Sturmian words that Christoffel words offe...

Emotion Oriented Programming: Computational Abstractions for AI Problem Solving

OpenAIRE

Darty , Kevin; Sabouret , Nicolas

2012-01-01

International audience; In this paper, we present a programming paradigm for AI problem solving based on computational concepts drawn from Affective Computing. It is believed that emotions participate in human adaptability and reactivity, in behaviour selection and in complex and dynamic environments. We propose to define a mechanism inspired from this observation for general AI problem solving. To this purpose, we synthesize emotions as programming abstractions that represent the perception ...

The Dilemma of Word Processing

Science.gov (United States)

Kidwell, Richard

1977-01-01

Word processing is a system of communicating which suggests heavy dependence on the use of transcribing machines rather than manual shorthand. The pros and cons of this system are noted, including suggestions for changes in the business education curriculum relevant to the need for shorthand and/or word processing skill development. (SH)

Do older t'ai chi practitioners have better attention and memory function?

Science.gov (United States)

Man, David W K; Tsang, William W N; Hui-Chan, Christina W Y

2010-12-01

Cognitive declines are common in older people and can be a major health issue in an aging world. One type of body-mind exercises, t'ai chi, can be a possible means to help maintaining older adults' cognitive abilities, in addition to beneficial effects of physical exercises. The purpose of this study was to investigate whether t'ai chi practitioners had better attention and memory functions than older people with or without regular exercises. A cross-sectional study examining the relationship between t'ai chi practice and age-, gender- and education-similar older peoples' attention and memory functions. Forty-two (42) community-dwelling elderly subjects, aged 60 or older, recruited from t'ai chi clubs in Hong Kong formed the t'ai chi group. Another 49 elderly having regular exercise habits were recruited from community centers for inclusion in the exercise group. A nonexercise group (normal healthy control) consisting of 44 subjects were also recruited by random selection and through contacting local elderly centers. They were also screened by the Modified Barthel Index, Chinese Mini-mental Status Examination, Geriatric Depression Scale, and evaluated by attention tests (Color Trail Form A-1 and 2) and memory tests (including Rivermead Behavioral Memory Test and The Hong Kong List Learning Test). The main finding was that the three groups differed in attention and memory functions, and the t'ai chi group had demonstrated better performance than the other two groups in most subtests. As a causal relationship cannot be assumed in the present cross-sectional study, future research is required to examine how t'ai chi can improve cognitive function using a randomized control trial as well as determining whether t'ai chi practice can lead to better health status among elderly people.

The Relationships among Cognitive Correlates and Irregular Word, Non-Word, and Word Reading

Science.gov (United States)

Abu-Hamour, Bashir; University, Mu'tah; Urso, Annmarie; Mather, Nancy

2012-01-01

This study explored four hypotheses: (a) the relationships among rapid automatized naming (RAN) and processing speed (PS) to irregular word, non-word, and word reading; (b) the predictive power of various RAN and PS measures, (c) the cognitive correlates that best predicted irregular word, non-word, and word reading, and (d) reading performance of…

Word Domain Disambiguation via Word Sense Disambiguation

Energy Technology Data Exchange (ETDEWEB)

Sanfilippo, Antonio P.; Tratz, Stephen C.; Gregory, Michelle L.

2006-06-04

Word subject domains have been widely used to improve the perform-ance of word sense disambiguation al-gorithms. However, comparatively little effort has been devoted so far to the disambiguation of word subject do-mains. The few existing approaches have focused on the development of al-gorithms specific to word domain dis-ambiguation. In this paper we explore an alternative approach where word domain disambiguation is achieved via word sense disambiguation. Our study shows that this approach yields very strong results, suggesting that word domain disambiguation can be ad-dressed in terms of word sense disam-biguation with no need for special purpose algorithms.

Selective oxidation of methionine residues in apolipoprotein A-I and its potential biological consequences

International Nuclear Information System (INIS)

Panzenboeck, U.; Waldeck, R.; Rye, K.A.; Sloane, T.; Kritharides, L.; Stocker, R.

1998-01-01

The earliest stages of HDL oxidation are accompanied by the oxidation of specific Met residues in apolipoprotein AI and AII and the formation of Met sulfoxides (Met(O)) has been proposed to play a significant role in the reduction and hence detoxification of lipid hydroperoxides associated with HDL. Oxidation of HDL may generally decrease the anti-atherogenic properties of this lipoprotein, although both, the inhibition and the enhancement of cholesterol removal from cells has been reported for different types of oxidation. In light of these findings we have investigated the secondary structure, lipid affinity, LCAT activation and cholesterol-efflux promoting properties of native and selectively oxidized apo A-I(apo A-I +32 , containing Met(O) at Met l12 and Met l48 ) in purified or reconstituted forms. Data obtained by circular dichroism revealed that selective oxidation of Met residues 112 and 148 does not alter alpha helicity of the protein in solution, indicating that this oxidation is not sufficient to influence significantly this type of secondary structure of apo A-I in its 'lipid-free' form. The lipid affinity of native apo A-I and apo A-I +32 was determined as the rate of clearance of DMPC multilamellar to small unilamellar vesicles. Compared with the native protein, apo A-I +32 induced a 2-3 fold faster rate of clearance, suggesting that the increased hydrophilicity due Met(O) increased the rate for protein-lipid interactions. Met residues 112 and 148 reside in the hydrophobic faces of helices 5 and 7, and both these regions have been suggested to be important for both, LCAT activation and cholesterol efflux. Kinetic experiments have revealed that the affinity for LCAT is comparable for HDL reconstituted with either apo A-I or apo A-I +32 . Efflux of [ 3 H]-cholesterol from lipid-laden human monocytederived macrophages to isolated apolipoproteins was enhanced for apo A-I +32 compared with apo A-I, consistent with the DMPC clearance data. Together these

Annealing Induced Softening in Deformed AI-4043 Alloy

International Nuclear Information System (INIS)

Saad, G.; Fawzy, A.; Soliman, H.N.; Mohammed, Gh.; Fayek, S.A.

2011-01-01

The present paper is devoted to study the effect of annealing temperature for different annealing periods of time on the structure and consequently on the tensile properties of Al-4043 alloy. The obtained results showed that the microstructure of AI-4043 alloy is characterized by the presence of spherically shaped Si-particles, which were found to be uniformly distributed within the AI-matrix. Stress-strain characterizations of AI-4043 samples annealed at different temperatures (T a = 573, 673 and 773 K) for different periods of time (t a = 0.5, 1,2.5,5 and 10 h), showed that the tensile parameters; yield stress ε y 0.2 and fracture stress ε f were decreased with increasing Ta and/or ta while the total strain ε T was increased. This was interpreted in terms of growth of Si-particles with increasing T a and/or t a . Attention has been also paid to the role of the minor elements Fe, Cu and Ti on the structure and tensile response behavior of the alloy under investigation

Novel cross-linked alcohol-insoluble solid (CL-AIS) affinity gel from pea pod for pectinesterase purification.

Science.gov (United States)

Wu, Ming-Chang; Lin, Guan-Hui; Wang, Yuh-Tai; Jiang, Chii-Ming; Chang, Hung-Min

2005-10-05

Alcohol-insoluble solids (AIS) from pea pod were cross-linked (CL-AIS) and used as an affinity gel matrix to isolate pectin esterases (PEs) from tendril shoots of chayote (TSC) and jelly fig achenes (JFA), and the results were compared with those isolated by ion-exchange chromatography with a commercial resin. CL-AIS gel matrix in a column displayed poor absorption and purification fold of PE; however, highly methoxylated CL-AIS (HM-CL-AIS), by exposing CL-AIS to methanolic sulfuric acid to increase the degree of esterification (DE) to 92%, facilitated the enzyme purification. The purified TSC PE and JFA PE by the HM-CL-AIS column were proofed as a single band on an SDS-PAGE gel, showing that the HM-CL-AIS column was a good matrix for purification of PE, either with alkaline isoelectric point (pI) (TSC PE) or with acidic pI (JFA PE).

New progress of FEM simulation and AI application in rolling at RAL

International Nuclear Information System (INIS)

Liu Xianghua; Wang Guodong; Zhao Kun

2000-01-01

New progresses on FEM simulation and AI application in rolling have been achieved at RAL recently. The existence and uniqueness of the extreme point of total functional for rolling problem has been proved. Different rolling processes, such as H-beam rolling, ribbing strip rolling, slab sizing, have been solved by our in-house FEM software package. The simulation results have been put into production use to improve the precision of math models. The Artificial Neural Network has been used to predict rolling force, coiling temperature, microstructure and properties of the rolled products. An expert system for deviation diagnoses of strip thickness has been developed for industry use. Synergetic Artificial Intelligence has also been applied to rolling scheduling. We are making continuous efforts to develop AI applications for rolling line co-operating in China steel industry. (author)

Forehearing words: Pre-activation of word endings at word onset.

Science.gov (United States)

Roll, Mikael; Söderström, Pelle; Frid, Johan; Mannfolk, Peter; Horne, Merle

2017-09-29

Occurring at rates up to 6-7 syllables per second, speech perception and understanding involves rapid identification of speech sounds and pre-activation of morphemes and words. Using event-related potentials (ERPs) and functional magnetic resonance imaging (fMRI), we investigated the time-course and neural sources of pre-activation of word endings as participants heard the beginning of unfolding words. ERPs showed a pre-activation negativity (PrAN) for word beginnings (first two segmental phonemes) with few possible completions. PrAN increased gradually as the number of possible completions of word onsets decreased and the lexical frequency of the completions increased. The early brain potential effect for few possible word completions was associated with a blood-oxygen-level-dependent (BOLD) contrast increase in Broca's area (pars opercularis of the left inferior frontal gyrus) and angular gyrus of the left parietal lobe. We suggest early involvement of the left prefrontal cortex in inhibiting irrelevant left parietal activation during lexical selection. The results further our understanding of the importance of Broca's area in rapid online pre-activation of words. Copyright © 2017 The Author(s). Published by Elsevier B.V. All rights reserved.

Prediction of shipboard electromagnetic interference (EMI) problems using artificial intelligence (AI) technology

Science.gov (United States)

Swanson, David J.

1990-08-01

The electromagnetic interference prediction problem is characteristically ill-defined and complicated. Severe EMI problems are prevalent throughout the U.S. Navy, causing both expected and unexpected impacts on the operational performance of electronic combat systems onboard ships. This paper focuses on applying artificial intelligence (AI) technology to the prediction of ship related electromagnetic interference (EMI) problems.

Deploying Embodied AI into Virtual Worlds

Science.gov (United States)

Burden, David J. H.

The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

Computing Facilities for AI: A Survey of Present and Near-Future Options

OpenAIRE

Fahlman, Scott

1981-01-01

At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

Combining AI Methods for Learning Bots in a Real-Time Strategy Game

OpenAIRE

Robin Baumgarten; Simon Colton; Mark Morris

2009-01-01

We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generat...

Notes on the inherently safe core design meeting with the DOE-RRT, AI, GE, W-ARD, EPRI, and ETEC (at AI, Canoga Park, California, November 7-8, 1978)

International Nuclear Information System (INIS)

Jackola, A.S.; Paschall, R.K.

1978-01-01

The primary purpose of the meeting was to familiarize large LMFBR design managers with the capabilities of the Inherent Secondary Shutdown Systems (articulated rod and absorber balls) and to obtain inputs from them. The other purpose of the meeting was for the ISSS designers (AI, GE, and WARD) to present current work status, future plans, and schedules for their respective ISSS tasks

Periodic words connected with the Fibonacci words

Directory of Open Access Journals (Sweden)

G. M. Barabash

2016-06-01

Full Text Available In this paper we introduce two families of periodic words (FLP-words of type 1 and FLP-words of type 2 that are connected with the Fibonacci words and investigated their properties.

In Orbit Validation of the AAUSAT3 SDR based AIS receiver

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter

2013-01-01

During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

Limitations of the Dual-Process-Theory regarding the Writing of Words and Non-Words to Dictation

Science.gov (United States)

Tucha, Oliver; Trumpp, Christian; Lange, Klaus W.

2004-01-01

It is generally assumed that the lexical and phonological systems are involved in writing to dictation. In an experiment concerned with the writing of words and non-words to dictation, the handwriting of female students was registered using a digitising tablet. The data contradict the assumption that the phonological system represents an alexical…

Vers l'integration des textes dans le programme du fran9ais langue ...

African Journals Online (AJOL)

Au Malawi, on enseigne le fran9ais en tant que langue etrangere depuis une quarantaine d'annees .... !'organisation institutionnelle du systeme educatif du Malawi, le palier secondaire en ... Les objectifs du type : rediger une lettre, decrire une .... nouveau (rheme). Charolles souligne qu'il s'agit d'une performance delicate.

SNAP and AI Fuel Summary Report

International Nuclear Information System (INIS)

Lords, R.E.

1994-08-01

The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

AI, Native Supercomputing and The Revival of Moore's Law

OpenAIRE

Lu, Chien-Ping

2017-01-01

Based on Alan Turing's proposition on AI and computing machinery, which shaped Computing as we know it today, the new AI computing machinery should comprise a universal computer and a universal learning machine. The later should understand linear algebra natively to overcome the slowdown of Moore's law. In such a universal learnig machine, a computing unit does not need to keep the legacy of a universal computing core. The data can be distributed to the computing units, and the results can be...

First steps in translating human cognitive processes of cane pruning grapevines into AI rules for automated robotic pruning

Directory of Open Access Journals (Sweden)

Saxton Valerie

2014-01-01

Full Text Available Cane pruning of grapevines is a skilled task for which, internationally, there is a dire shortage of human pruners. As part of a larger project developing an automated robotic pruner, we have used artificial intelligence (AI algorithms to create an expert system for selecting new canes and cutting off unwanted canes. A domain and ontology has been created for AI, which reflects the expertise of expert human pruners. The first step in the creation of an expert system was to generate virtual vines, which were then ‘pruned’ by human pruners and also by the expert system in its infancy. Here we examined the decisions of 12 human pruners, for consistency of decision, on 60 virtual vines. 96.7% of the 12 pruners agreed on at least one cane choice after which there was diminishing agreement on which further canes to select for laying. Our results indicate that techniques developed in computational intelligence can be used to co-ordinate and synthesise the expertise of human pruners into a best practice format. This paper describes first steps in this knowledge elicitation process, and discusses the fit between cane pruning expertise and the expertise that can be elicited using AI based expert system techniques.

Is the motor system necessary for processing action and abstract emotion words? Evidence from focal brain lesions

Directory of Open Access Journals (Sweden)

Felix R. Dreyer

2015-11-01

Full Text Available Neuroimaging and neuropsychological experiments suggest that modality-preferential cortices, including motor- and somatosensory areas contribute to the semantic processing of action related concrete words. In contrast, a possible role of modality-preferential – including sensorimotor – areas in processing abstract meaning remains under debate. However, recent fMRI studies indicate an involvement of the left sensorimotor cortex in the processing of abstract-emotional words (e.g. love. But are these areas indeed necessary for processing action-related and abstract words? The current study now investigates word processing in two patients suffering from focal brain lesion in the left frontocentral motor system. A speeded lexical decision task (LDT on meticulously matched word groups showed that the recognition of nouns from different semantic categories – related to food, animals, tools and abstract-emotional concepts – was differentially affected. Whereas patient HS with a lesion in dorsolateral central sensorimotor cortex next to the hand area showed a category-specific deficit in recognizing tool words, patient CA suffering from lesion centered in the left SMA was primarily impaired in abstract-emotional word processing. These results point to a causal role of the motor cortex in the semantic processing of both action-related object concepts and abstract-emotional concepts and therefore suggest that the motor areas previously found active in action-related and abstract word processing can serve a meaning-specific necessary role in word recognition. The category-specific nature of the observed dissociations is difficult to reconcile with the idea that sensorimotor systems are somehow peripheral or ‘epiphenomenal’ to meaning and concept processing. Rather, our results are consistent with the claim that cognition is grounded in action and perception and based on distributed action perception circuits reaching into sensorimotor areas.

Learning word meanings: Overnight integration and study modality effects

NARCIS (Netherlands)

Ven, F. van der; Takashima, A.; Segers, P.C.J.; Verhoeven, L.T.W.

2015-01-01

According to the complementary learning systems (CLS) account of word learning, novel words are rapidly acquired (learning system 1), but slowly integrated into the mental lexicon (learning system 2). This two-step learning process has been shown to apply to novel word forms. In this study, we

Dissecting phenotypic variation among AIS patients

International Nuclear Information System (INIS)

Wang Minghua; Wang Jiucun; Zhang Zhen; Zhao Zhimin; Zhang Rongmei; Hu Xiaohua; Tan Tao; Luo Shijing; Luo Zewei

2005-01-01

We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg 840 Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

CERN Technical Training: available Places in forthcoming Courses

CERN Multimedia

HR Department

2009-01-01

The following course sessions are scheduled in the framework of the CERN Technical Training Programme 2008 and places are still available. You may find the full updated Technical Training course programme in our web-catalogue (http://cta.cern.ch/cta2/f?p=110:9). OFFICE SOFTWARE WORD 2007 - level 2 : ECDL\t(Français)\t12-13.01\t2 jours EXCEL 2007 - Level 2: ECDL\t(English)\t15-16.01\t2 days Novelties Office 2007: WORD 2007\t(Français)\t19.01\t1 jour Windows Vista\t(Français)\t30.01\t3 heures ½ EXCEL 2007 level 1: ECDL\t(English)\t02-03.02\t2 days WORD 2007 - level 1 : ECDL\t(English)\t05-06.02\t2 days ACCESS 2007 - Level 1 : ECDL\t(Français)\t09-10.02\t2 jours Sharepoint Designer (Frontpage)- Level 1\t(Français)\t12-13.02\t2 jours SOFTWARE AND SYSTEM TECHNOLOGIES Linux System Administration\t(English)\t22-27.01\t4 days Oracle – SQL\t(English)\t02-04.02\t3 days Oracle Databases: Memory Management (10g & 11g) (English)\t05-06.02\t2 days JAVA 2 Enterprise Edition – Part 1: Web Applications\t(English)\t09-10.02\t2 days ...

Future role of AI/Robotics in physical security

International Nuclear Information System (INIS)

Jacobs, J.

1986-06-01

Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (1) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper will discuss the various types of security applications that are presently being considered for the above areas and will briefly describe a few examples of the application of this technology. Examples will include ground mobile platforms carrying alarm assessment and/or surveillance sensors and operating either autonomously or with telepresence by a remote operator. An airborne platform performing similar functions will also be discussed. An application of a type of robot sentry that would be fixed and incorporate very simple portable displays will also be described. A third type of robot, an interior robot, that could be used in sensitive or hazardous areas to do detection and assessment functions will be reviewed

Autonomously generating operations sequences for a Mars Rover using AI-based planning

Science.gov (United States)

Sherwood, Rob; Mishkin, Andrew; Estlin, Tara; Chien, Steve; Backes, Paul; Cooper, Brian; Maxwell, Scott; Rabideau, Gregg

2001-01-01

This paper discusses a proof-of-concept prototype for ground-based automatic generation of validated rover command sequences from highlevel science and engineering activities. This prototype is based on ASPEN, the Automated Scheduling and Planning Environment. This Artificial Intelligence (AI) based planning and scheduling system will automatically generate a command sequence that will execute within resource constraints and satisfy flight rules.

Augmentation index (AI) in a dose–response relationship with smoking habits in males

Science.gov (United States)

Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

2016-01-01

Abstract We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese. This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects’ medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender. Age-adjusted means of AI in males showed a clear dose–response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose–response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake. The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males. PMID:28002323

Evaluation of the free, open source software WordPress as electronic portfolio system in undergraduate medical education.

Science.gov (United States)

Avila, Javier; Sostmann, Kai; Breckwoldt, Jan; Peters, Harm

2016-06-03

Electronic portfolios (ePortfolios) are used to document and support learning activities. E-portfolios with mobile capabilities allow even more flexibility. However, the development or acquisition of ePortfolio software is often costly, and at the same time, commercially available systems may not sufficiently fit the institution's needs. The aim of this study was to design and evaluate an ePortfolio system with mobile capabilities using a commercially free and open source software solution. We created an online ePortfolio environment using the blogging software WordPress based on reported capability features of such software by a qualitative weight and sum method. Technical implementation and usability were evaluated by 25 medical students during their clinical training by quantitative and qualitative means using online questionnaires and focus groups. The WordPress ePortfolio environment allowed students a broad spectrum of activities - often documented via mobile devices - like collection of multimedia evidences, posting reflections, messaging, web publishing, ePortfolio searches, collaborative learning, knowledge management in a content management system including a wiki and RSS feeds, and the use of aid tools for studying. The students' experience with WordPress revealed a few technical problems, and this report provides workarounds. The WordPress ePortfolio was rated positively by the students as a content management system (67 % of the students), for exchange with other students (74 %), as a note pad for reflections (53 %) and for its potential as an information source for assessment (48 %) and exchange with a mentor (68 %). On the negative side, 74 % of the students in this pilot study did not find it easy to get started with the system, and 63 % rated the ePortfolio as not being user-friendly. Qualitative analysis indicated a need for more introductory information and training. It is possible to build an advanced ePortfolio system with mobile

An Internet of Things Approach for Extracting Featured Data Using AIS Database: An Application Based on the Viewpoint of Connected Ships

Directory of Open Access Journals (Sweden)

Wei He

2017-09-01

Full Text Available Automatic Identification System (AIS, as a major data source of navigational data, is widely used in the application of connected ships for the purpose of implementing maritime situation awareness and evaluating maritime transportation. Efficiently extracting featured data from AIS database is always a challenge and time-consuming work for maritime administrators and researchers. In this paper, a novel approach was proposed to extract massive featured data from the AIS database. An Evidential Reasoning rule based methodology was proposed to simulate the procedure of extracting routes from AIS database artificially. First, the frequency distributions of ship dynamic attributes, such as the mean and variance of Speed over Ground, Course over Ground, are obtained, respectively, according to the verified AIS data samples. Subsequently, the correlations between the attributes and belief degrees of the categories are established based on likelihood modeling. In this case, the attributes were characterized into several pieces of evidence, and the evidence can be combined with the Evidential Reasoning rule. In addition, the weight coefficients were trained in a nonlinear optimization model to extract the AIS data more accurately. A real life case study was conducted at an intersection waterway, Yangtze River, Wuhan, China. The results show that the proposed methodology is able to extract data very precisely.

Cracks appear in the AI gravy train

Energy Technology Data Exchange (ETDEWEB)

Mill, J.

1983-10-01

This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

Grammaire progressive du français niveau intermédiaire

CERN Document Server

Grégoire, Maïa

2017-01-01

Quatrième édition de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de Grammaire: une organisation claire : la leçon de grammaire sur la page de gauche; les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues un apprentissage progressif : il suit la progression naturelle des méthodes de français un usage souple : pour la classe ou en auto-apprentissage une préparation adaptée aux certifications : un entreînement efficace pour mieux réussir aux examens NOUVEAU! Appli-web de la Grammaire progressive du français incluse Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales : près de 300 exercices interactifs avec dialogues, instructions, exemples et corrigés ora...

A model of lipid-free apolipoprotein A-I revealed by iterative molecular dynamics simulation.

Directory of Open Access Journals (Sweden)

Xing Zhang

Full Text Available Apolipoprotein A-I (apo A-I, the major protein component of high-density lipoprotein, has been proven inversely correlated to cardiovascular risk in past decades. The lipid-free state of apo A-I is the initial stage which binds to lipids forming high-density lipoprotein. Molecular models of lipid-free apo A-I have been reported by methods like X-ray crystallography and chemical cross-linking/mass spectrometry (CCL/MS. Through structural analysis we found that those current models had limited consistency with other experimental results, such as those from hydrogen exchange with mass spectrometry. Through molecular dynamics simulations, we also found those models could not reach a stable equilibrium state. Therefore, by integrating various experimental results, we proposed a new structural model for lipid-free apo A-I, which contains a bundled four-helix N-terminal domain (1-192 that forms a variable hydrophobic groove and a mobile short hairpin C-terminal domain (193-243. This model exhibits an equilibrium state through molecular dynamics simulation and is consistent with most of the experimental results known from CCL/MS on lysine pairs, fluorescence resonance energy transfer and hydrogen exchange. This solution-state lipid-free apo A-I model may elucidate the possible conformational transitions of apo A-I binding with lipids in high-density lipoprotein formation.

Measuring an artificial intelligence system's performance on a Verbal IQ test for young children

Science.gov (United States)

Ohlsson, Stellan; Sloan, Robert H.; Turán, György; Urasky, Aaron

2017-07-01

We administered the Verbal IQ (VIQ) part of the Wechsler Preschool and Primary Scale of Intelligence (WPPSI-III) to the ConceptNet 4 artificial intelligence (AI) system. The test questions (e.g. "Why do we shake hands?") were translated into ConceptNet 4 inputs using a combination of the simple natural language processing tools that come with ConceptNet together with short Python programs that we wrote. The question answering used a version of ConceptNet based on spectral methods. The ConceptNet system scored a WPPSI-III VIQ that is average for a four-year-old child, but below average for 5-7 year olds. Large variations among subtests indicate potential areas of improvement. In particular, results were strongest for the Vocabulary and Similarities subtests, intermediate for the Information subtest and lowest for the Comprehension and Word Reasoning subtests. Comprehension is the subtest most strongly associated with common sense. The large variations among subtests and ordinary common sense strongly suggest that the WPPSI-III VIQ results do not show that "ConceptNet has the verbal abilities of a four-year-old". Rather, children's IQ tests offer one objective metric for the evaluation and comparison of AI systems. Also, this work continues previous research on psychometric AI.

No specific role for the manual motor system in processing the meanings of words related to the hand

Directory of Open Access Journals (Sweden)

Natasha ePostle

2013-02-01

Full Text Available The present study explored whether semantic and motor systems are functionally interwoven via the use of a dual-task paradigm. According to embodied language accounts that propose an automatic and necessary involvement of the motor system in conceptual processing, concurrent processing of hand-related information should interfere more with hand movements than processing of unrelated body-part (i.e., foot, mouth information. Across three experiments, 100 right-handed participants performed left- or right-hand tapping movements while repeatedly reading action words related to different body-parts, or different body-part names, in both aloud and silent conditions. Concurrent reading of single words related to specific body-parts, or the same words embedded in sentences differing in syntactic and phonological complexity (to manipulate context-relevant processing, and reading while viewing videos of the actions and body-parts described by the target words (to elicit visuomotor associations all interfered with right-hand but not left-hand tapping rate. However, this motor interference was not affected differentially by hand-related stimuli. Thus, the results provide no support for proposals that body-part specific resources in cortical motor systems are shared between overt manual movements and meaning-related processing of words related to the hand.

So Sorry––Never Sorry. Ai Weiwei’s Art between Tradition and Modernity

Directory of Open Access Journals (Sweden)

Tania Becker

2011-12-01

Full Text Available Ai Weiwei’s 艾未未 (b. 1957 artistic expression revolves around his use of traditional Chinese techniques to create new designs and forms, shaping traditional materials into contemporary configurations. In the face of obstruction from state officials and local politicians, Ai Weiwei exposes himself to considerable personal risk in order to continue his activities as an artist and stay loyal to his convictions. This paper examines the roots of Ai Weiwei’s work in Chinese art history and looks at how the artist has deliberately adapted traditional motifs to bring about a sense of alienation. Ai Weiwei’s unique stance between current trends in western art and the Chinese feeling for handicrafts is also explored.

Emerging trends in geospatial artificial intelligence (geoAI): potential applications for environmental epidemiology.

Science.gov (United States)

VoPham, Trang; Hart, Jaime E; Laden, Francine; Chiang, Yao-Yi

2018-04-17

Geospatial artificial intelligence (geoAI) is an emerging scientific discipline that combines innovations in spatial science, artificial intelligence methods in machine learning (e.g., deep learning), data mining, and high-performance computing to extract knowledge from spatial big data. In environmental epidemiology, exposure modeling is a commonly used approach to conduct exposure assessment to determine the distribution of exposures in study populations. geoAI technologies provide important advantages for exposure modeling in environmental epidemiology, including the ability to incorporate large amounts of big spatial and temporal data in a variety of formats; computational efficiency; flexibility in algorithms and workflows to accommodate relevant characteristics of spatial (environmental) processes including spatial nonstationarity; and scalability to model other environmental exposures across different geographic areas. The objectives of this commentary are to provide an overview of key concepts surrounding the evolving and interdisciplinary field of geoAI including spatial data science, machine learning, deep learning, and data mining; recent geoAI applications in research; and potential future directions for geoAI in environmental epidemiology.

The word-length effect and disyllabic words.

Science.gov (United States)

Lovatt, P; Avons, S E; Masterson, J

2000-02-01

Three experiments compared immediate serial recall of disyllabic words that differed on spoken duration. Two sets of long- and short-duration words were selected, in each case maximizing duration differences but matching for frequency, familiarity, phonological similarity, and number of phonemes, and controlling for semantic associations. Serial recall measures were obtained using auditory and visual presentation and spoken and picture-pointing recall. In Experiments 1a and 1b, using the first set of items, long words were better recalled than short words. In Experiments 2a and 2b, using the second set of items, no difference was found between long and short disyllabic words. Experiment 3 confirmed the large advantage for short-duration words in the word set originally selected by Baddeley, Thomson, and Buchanan (1975). These findings suggest that there is no reliable advantage for short-duration disyllables in span tasks, and that previous accounts of a word-length effect in disyllables are based on accidental differences between list items. The failure to find an effect of word duration casts doubt on theories that propose that the capacity of memory span is determined by the duration of list items or the decay rate of phonological information in short-term memory.

Açai (Euterpe oleracea Mart. Upregulates Paraoxonase 1 Gene Expression and Activity with Concomitant Reduction of Hepatic Steatosis in High-Fat Diet-Fed Rats

Directory of Open Access Journals (Sweden)

Renata Rebeca Pereira

2016-01-01

Full Text Available Açai (Euterpe oleracea Mart., a fruit from the Amazon region, has emerged as a promising source of polyphenols. Açai consumption has been increasing owing to ascribed health benefits and antioxidant properties; however, its effects on hepatic injury are limited. In this study, we evaluated the antioxidant effect of filtered açai pulp on the expression of paraoxonase (PON isoforms and PON1 activity in rats with nonalcoholic fatty liver disease (NAFLD. The rats were fed a standard AIN-93M (control diet or a high-fat (HF diet containing 25% soy oil and 1% cholesterol with or without açai pulp (2 g/day for 6 weeks. Our results show that açai pulp prevented low-density lipoprotein (LDL oxidation, increased serum and hepatic PON1 activity, and upregulated the expression of PON1 and ApoA-I in the liver. In HF diet-fed rats, treatment with açai pulp attenuated liver damage, reducing fat infiltration and triglyceride (TG content. In rats receiving açai, increased serum PON1 activity was correlated with a reduction in hepatic steatosis and hepatic injury. These findings suggest the use of açai as a potential therapy for liver injuries, supporting the idea that dietary antioxidants are a promising approach to enhance the defensive systems against oxidative stress.

Statistical Laws Governing Fluctuations in Word Use from Word Birth to Word Death

Science.gov (United States)

Petersen, Alexander M.; Tenenbaum, Joel; Havlin, Shlomo; Stanley, H. Eugene

2012-03-01

We analyze the dynamic properties of 107 words recorded in English, Spanish and Hebrew over the period 1800-2008 in order to gain insight into the coevolution of language and culture. We report language independent patterns useful as benchmarks for theoretical models of language evolution. A significantly decreasing (increasing) trend in the birth (death) rate of words indicates a recent shift in the selection laws governing word use. For new words, we observe a peak in the growth-rate fluctuations around 40 years after introduction, consistent with the typical entry time into standard dictionaries and the human generational timescale. Pronounced changes in the dynamics of language during periods of war shows that word correlations, occurring across time and between words, are largely influenced by coevolutionary social, technological, and political factors. We quantify cultural memory by analyzing the long-term correlations in the use of individual words using detrended fluctuation analysis.

Optimal synthesis of four-bar steering mechanism using AIS and genetic algorithms

Energy Technology Data Exchange (ETDEWEB)

Ettefagh, Mir Mohammad; Javash, Morteza Saeidi [University of Tabriz, Tabriz (Iran, Islamic Republic of)

2014-06-15

Synthesis of four-bar Ackermann steering mechanism was considered as an optimization problem for generating the best function between input and output links. The steering mechanism was designed through two heuristic optimization methods, namely, artificial immune system (AIS) algorithm and genetic algorithm (GA). The optimization was implemented using the two methods, length was selected as optimization parameter in the first method, whereas precision point distribution was considered in the second method. Two of the links in the first method had the same length to achieve a symmetric mechanism; one of these lengths was considered as optimization parameter. Five precision points were considered in the precision point distribution method, one of which was in the straight line condition, whereas the others were symmetric. The obtained results showed that the AIS algorithm can generate the closest function to the desired function in the first method. By contrast, GA can generate the closest function to the desired function with the least error in the second method.

Is processing of symbols and words influenced by writing system? Evidence from Chinese, Korean, English, and Greek.

Science.gov (United States)

Altani, Angeliki; Georgiou, George K; Deng, Ciping; Cho, Jeung-Ryeul; Katopodi, Katerina; Wei, Wei; Protopapas, Athanassios

2017-12-01

We examined cross-linguistic effects in the relationship between serial and discrete versions of digit naming and word reading. In total, 113 Mandarin-speaking Chinese children, 100 Korean children, 112 English-speaking Canadian children, and 108 Greek children in Grade 3 were administered tasks of serial and discrete naming of words and digits. Interrelations among tasks indicated that the link between rapid naming and reading is largely determined by the format of the tasks across orthographies. Multigroup path analyses with discrete and serial word reading as dependent variables revealed commonalities as well as significant differences between writing systems. The path coefficient from discrete digits to discrete words was greater for the more transparent orthographies, consistent with more efficient sight-word processing. The effect of discrete word reading on serial word reading was stronger in alphabetic languages, where there was also a suppressive effect of discrete digit naming. However, the effect of serial digit naming on serial word reading did not differ among the four language groups. This pattern of relationships challenges a universal account of reading fluency acquisition while upholding a universal role of rapid serial naming, further distinguishing between multi-element interword and intraword processing. Copyright © 2017 Elsevier Inc. All rights reserved.

It Takes Two to Tango: Towards Theory of AI's Mind

OpenAIRE

Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

2017-01-01

Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

“Awake” intraoperative functional MRI (ai-fMRI) for mapping the eloquent cortex: Is it possible in awake craniotomy?☆

Science.gov (United States)

Lu, Jun-Feng; Zhang, Han; Wu, Jin-Song; Yao, Cheng-Jun; Zhuang, Dong-Xiao; Qiu, Tian-Ming; Jia, Wen-Bin; Mao, Ying; Zhou, Liang-Fu

2012-01-01

As a promising noninvasive imaging technique, functional MRI (fMRI) has been extensively adopted as a functional localization procedure for surgical planning. However, the information provided by preoperative fMRI (pre-fMRI) is hampered by the brain deformation that is secondary to surgical procedures. Therefore, intraoperative fMRI (i-fMRI) becomes a potential alternative that can compensate for brain shifts by updating the functional localization information during craniotomy. However, previous i-fMRI studies required that patients be under general anesthesia, preventing the wider application of such a technique as the patients cannot perform tasks unless they are awake. In this study, we propose a new technique that combines awake surgery and i-fMRI, named “awake” i-fMRI (ai-fMRI). We introduced ai-fMRI to the real-time localization of sensorimotor areas during awake craniotomy in seven patients. The results showed that ai-fMRI could successfully detect activations in the bilateral primary sensorimotor areas and supplementary motor areas for all patients, indicating the feasibility of this technique in eloquent area localization. The reliability of ai-fMRI was further validated using intraoperative stimulation mapping (ISM) in two of the seven patients. Comparisons between the pre-fMRI-derived localization result and the ai-fMRI derived result showed that the former was subject to a heavy brain shift and led to incorrect localization, while the latter solved that problem. Additionally, the approaches for the acquisition and processing of the ai-fMRI data were fully illustrated and described. Some practical issues on employing ai-fMRI in awake craniotomy were systemically discussed, and guidelines were provided. PMID:24179766

Applying AI techniques to improve alarm display effectiveness

International Nuclear Information System (INIS)

Gross, J.M.; Birrer, S.A.; Crosberg, D.R.

1987-01-01

The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

Rapid and simple colorimetric method for the quantification of AI-2 produced from Salmonella Typhimurium.

Science.gov (United States)

Wattanavanitchakorn, Siriluck; Prakitchaiwattana, Cheunjit; Thamyongkit, Patchanita

2014-04-01

The aim of this study was to evaluate the feasibility of Fe(III) ion reduction for the simple and rapid quantification of autoinducer-2 (AI-2) produced from bacteria using Salmonella Typhimurium as a model. Since the molecular structure of AI-2 is somewhat similar to ascorbic acid it was expected that AI-2 would also act as a reducing agent and reduce Fe(III) ions in the presence of 1,10-phenanthroline to form the colored [(o-phen)3 Fe(II)]SO4 ferroin complex that could be quantified colorimetrically. In support of this, colony rinses and cell free supernatants from cultures of all tested AI-2 producing strains, but not the AI-2 negative Sinorhizobium meliloti, formed a colored complex with a λmax of 510nm. The OD510 values of these culture supernatants or colony rinses were in broad agreement with the % activity observed in the same samples using the standard Vibrio harveyi bioluminescence assay for AI-2 detection, and with previously reported results. This methodology could potentially be developed as an alternative method for the simple and rapid quantification of AI-2 levels produced in bacterial cultures. Copyright © 2014 Elsevier B.V. All rights reserved.

The Activation of Embedded Words in Spoken Word Recognition.

Science.gov (United States)

Zhang, Xujin; Samuel, Arthur G

2015-01-01

The current study investigated how listeners understand English words that have shorter words embedded in them. A series of auditory-auditory priming experiments assessed the activation of six types of embedded words (2 embedded positions × 3 embedded proportions) under different listening conditions. Facilitation of lexical decision responses to targets (e.g., pig) associated with words embedded in primes (e.g., hamster ) indexed activation of the embedded words (e.g., ham ). When the listening conditions were optimal, isolated embedded words (e.g., ham ) primed their targets in all six conditions (Experiment 1a). Within carrier words (e.g., hamster ), the same set of embedded words produced priming only when they were at the beginning or comprised a large proportion of the carrier word (Experiment 1b). When the listening conditions were made suboptimal by expanding or compressing the primes, significant priming was found for isolated embedded words (Experiment 2a), but no priming was produced when the carrier words were compressed/expanded (Experiment 2b). Similarly, priming was eliminated when the carrier words were presented with one segment replaced by noise (Experiment 3). When cognitive load was imposed, priming for embedded words was again found when they were presented in isolation (Experiment 4a), but not when they were embedded in the carrier words (Experiment 4b). The results suggest that both embedded position and proportion play important roles in the activation of embedded words, but that such activation only occurs under unusually good listening conditions.

WordPress as a Content Management System for a Library Web Site: How to Create a Dynamically Generated Subject Guide

OpenAIRE

Joshua Dodson

2008-01-01

This article explains a method of generating dynamic subject guides through the WordPress content management system. This method includes the use of the Exec-PHP WordPress plugin and additional PHP code to create a new category-based loop within the preexisting WordPress loop. Example code and screenshots are provided.

Evaluating a Bilingual Text-Mining System with a Taxonomy of Key Words and Hierarchical Visualization for Understanding Learner-Generated Text

Science.gov (United States)

Kong, Siu Cheung; Li, Ping; Song, Yanjie

2018-01-01

This study evaluated a bilingual text-mining system, which incorporated a bilingual taxonomy of key words and provided hierarchical visualization, for understanding learner-generated text in the learning management systems through automatic identification and counting of matching key words. A class of 27 in-service teachers studied a course…

Rétrospective de la diffusion du français en Espagne

Directory of Open Access Journals (Sweden)

Isabelle Cros

2014-12-01

Full Text Available Le français bénéficia longtemps en Espagne d’une vieille tradition francophile et de la forte implantation de l’Alliance française. Ainsi, il prédomina dans le système éducatif espagnol jusqu’au milieu du 20ème siècle sans intervention de l’État français pour en assurer la diffusion. Son déclin, amorcé sous Franco, nécessita toutefois la mise en place d’une politique linguistique et éducative compensatoire qui aboutit à un premier accord bilatéral favorisant surtout le développement de l’enseignement en français au sein du réseau de la Mission laïque mais qui eut peu d’effets à l’école espagnole où le français fut relégué au rang de deuxième langue étrangère. Cependant, suite à son adhésion à l’Europe, l’Espagne a recréé, en partenariat avec la France, une dynamique pour le français, notamment grâce aux sections bilingues qui connaissent un succès croissant. La langue française, considérée à présent davantage comme une langue utile, de communication et de travail, est enseignée suivant une méthodologie communicative plus adaptée aux réalités socio-économiques.

The x-word and its usage : Taboo words and swearwords in general, and x-words in newspapers

OpenAIRE

Lindahl, Katarina

2008-01-01

All languages have words that are considered taboo – words that are not supposed to be said or used. Taboo words, or swearwords, can be used in many different ways and they can have different meanings depending on what context they appear in. Another aspect of taboo words is the euphemisms that are used in order to avoid obscene speech. This paper will focus on x-words, words like the f-word or the c-word, which replace the words fuck or cunt, but as the study will show they also have other m...

The Activation of Embedded Words in Spoken Word Recognition

Science.gov (United States)

Zhang, Xujin; Samuel, Arthur G.

2015-01-01

The current study investigated how listeners understand English words that have shorter words embedded in them. A series of auditory-auditory priming experiments assessed the activation of six types of embedded words (2 embedded positions × 3 embedded proportions) under different listening conditions. Facilitation of lexical decision responses to targets (e.g., pig) associated with words embedded in primes (e.g., hamster) indexed activation of the embedded words (e.g., ham). When the listening conditions were optimal, isolated embedded words (e.g., ham) primed their targets in all six conditions (Experiment 1a). Within carrier words (e.g., hamster), the same set of embedded words produced priming only when they were at the beginning or comprised a large proportion of the carrier word (Experiment 1b). When the listening conditions were made suboptimal by expanding or compressing the primes, significant priming was found for isolated embedded words (Experiment 2a), but no priming was produced when the carrier words were compressed/expanded (Experiment 2b). Similarly, priming was eliminated when the carrier words were presented with one segment replaced by noise (Experiment 3). When cognitive load was imposed, priming for embedded words was again found when they were presented in isolation (Experiment 4a), but not when they were embedded in the carrier words (Experiment 4b). The results suggest that both embedded position and proportion play important roles in the activation of embedded words, but that such activation only occurs under unusually good listening conditions. PMID:25593407

The LuxS/AI-2 Quorum-Sensing System of Streptococcus pneumoniae Is Required to Cause Disease, and to Regulate Virulence- and Metabolism-Related Genes in a Rat Model of Middle Ear Infection

Directory of Open Access Journals (Sweden)

Mukesh K. Yadav

2018-05-01

Full Text Available Objective:Streptococcus pneumoniae colonizes the nasopharynx of children, and from nasopharynx it could migrate to the middle ear and causes acute otitis media (AOM. During colonization and AOM, the pneumococcus forms biofilms. In vitro biofilm formation requires a functional LuxS/AI-2 quorum-sensing system. We investigated the role of LuxS/AI-2 signaling in pneumococcal middle ear infection, and identified the genes that are regulated by LuxS/AI-2 during pneumococcal biofilm formation.Methods:Streptococcus pneumoniae D39 wild-type and an isogenic D39ΔluxS strain were utilized to evaluate in vitro biofilm formation, and in vivo colonization and epithelial damage using a microtiter plate assay and a rat model of pneumococcal middle ear infection, respectively. Biofilm structures and colonization and epithelial damage were evaluated at the ultrastructural level by scanning electron microscopy and confocal microscopy. Microarrays were used to investigate the global genes that were regulated by LuxS/AI-2 during biofilm formation.Results: The biofilm biomass and density of D39ΔluxS were significantly (p < 0.05 lower than those of D39 wild-type. SEM and confocal microscopy revealed that D39ΔluxS formed thin biofilms in vitro compared with D39 wild-type. The in vivo model of middle ear infection showed that D39ΔluxS resulted in ~60% less (p < 0.05 bacterial colonization than the wild-type. SEM analysis of the rat middle ears revealed dense biofilm-like cell debris deposited on the cilia in wild-type D39-infected rats. However, little cell debris was deposited in the middle ears of the D39ΔluxS-inoculated rats, and the cilia were visible. cDNA-microarray analysis revealed 117 differentially expressed genes in D39ΔluxS compared with D39 wild-type. Among the 66 genes encoding putative proteins and previously characterized proteins, 60 were significantly downregulated, whereas 6 were upregulated. Functional annotation revealed that genes involved in

Some words on Word

NARCIS (Netherlands)

Janssen, Maarten; Visser, A.

In many disciplines, the notion of a word is of central importance. For instance, morphology studies le mot comme tel, pris isol´ement (Mel’ˇcuk, 1993 [74]). In the philosophy of language the word was often considered to be the primary bearer of meaning. Lexicography has as its fundamental role

Emotion words and categories: evidence from lexical decision.

Science.gov (United States)

Scott, Graham G; O'Donnell, Patrick J; Sereno, Sara C

2014-05-01

We examined the categorical nature of emotion word recognition. Positive, negative, and neutral words were presented in lexical decision tasks. Word frequency was additionally manipulated. In Experiment 1, "positive" and "negative" categories of words were implicitly indicated by the blocked design employed. A significant emotion-frequency interaction was obtained, replicating past research. While positive words consistently elicited faster responses than neutral words, only low frequency negative words demonstrated a similar advantage. In Experiments 2a and 2b, explicit categories ("positive," "negative," and "household" items) were specified to participants. Positive words again elicited faster responses than did neutral words. Responses to negative words, however, were no different than those to neutral words, regardless of their frequency. The overall pattern of effects indicates that positive words are always facilitated, frequency plays a greater role in the recognition of negative words, and a "negative" category represents a somewhat disparate set of emotions. These results support the notion that emotion word processing may be moderated by distinct systems.

The deep learning AI playbook strategy for disruptive artificial intelligence

CERN Document Server

Perez, Carlos E

2017-01-01

Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

Analysis of raw AIS spectrum recordings from a LEO satellite

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter

2014-01-01

The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

AI tools in computer based problem solving

Science.gov (United States)

Beane, Arthur J.

1988-01-01

The use of computers to solve value oriented, deterministic, algorithmic problems, has evolved a structured life cycle model of the software process. The symbolic processing techniques used, primarily in research, for solving nondeterministic problems, and those for which an algorithmic solution is unknown, have evolved a different model, much less structured. Traditionally, the two approaches have been used completely independently. With the advent of low cost, high performance 32 bit workstations executing identical software with large minicomputers and mainframes, it became possible to begin to merge both models into a single extended model of computer problem solving. The implementation of such an extended model on a VAX family of micro/mini/mainframe systems is described. Examples in both development and deployment of applications involving a blending of AI and traditional techniques are given.

9-cis-retinoic acid increases apolipoprotein AI secretion and mRNA expression in HepG2 cells.

Science.gov (United States)

Haghpassand, M; Moberly, J B

1995-10-01

HepG2 cells were studied as a model for regulation of hepatic apolipoprotein AI (apo AI) secretion and gene expression by 9-cis-retinoic acid. HepG2 cells cultured on plastic dishes were exposed to 9-cis-retinoic acid (9-cis-RA) for 48 h with a complete media change at 24 h. Apo AI mass in cultured media was determined by ELISA, by quantitative immunoblotting and by steady-state 35S-methionine labeling. Messenger RNA levels were determined by RNase protection using probes for apo AI and the housekeeping gene, glyceraldehyde 3-phosphate dehydrogenase (G3PDH). 9-cis-RA increased secretion of apo AI by 52% at doses of 10 and 1 microM (6.3 +/- 0.6 vs. 4.2 +/- 0.3; P G3PDH mRNA was slightly decreased (14%, P < 0.05). Thus, 9-cis-RA stimulates apo AI expression in HepG2 cells, suggesting a role for retinoids in activating endogenous apo AI gene expression.

Orthographic effects in spoken word recognition: Evidence from Chinese.

Science.gov (United States)

Qu, Qingqing; Damian, Markus F

2017-06-01

Extensive evidence from alphabetic languages demonstrates a role of orthography in the processing of spoken words. Because alphabetic systems explicitly code speech sounds, such effects are perhaps not surprising. However, it is less clear whether orthographic codes are involuntarily accessed from spoken words in languages with non-alphabetic systems, in which the sound-spelling correspondence is largely arbitrary. We investigated the role of orthography via a semantic relatedness judgment task: native Mandarin speakers judged whether or not spoken word pairs were related in meaning. Word pairs were either semantically related, orthographically related, or unrelated. Results showed that relatedness judgments were made faster for word pairs that were semantically related than for unrelated word pairs. Critically, orthographic overlap on semantically unrelated word pairs induced a significant increase in response latencies. These findings indicate that orthographic information is involuntarily accessed in spoken-word recognition, even in a non-alphabetic language such as Chinese.

Finding words in a language that allows words without vowels.

Science.gov (United States)

El Aissati, Abder; McQueen, James M; Cutler, Anne

2012-07-01

Across many languages from unrelated families, spoken-word recognition is subject to a constraint whereby potential word candidates must contain a vowel. This constraint minimizes competition from embedded words (e.g., in English, disfavoring win in twin because t cannot be a word). However, the constraint would be counter-productive in certain languages that allow stand-alone vowelless open-class words. One such language is Berber (where t is indeed a word). Berber listeners here detected words affixed to nonsense contexts with or without vowels. Length effects seen in other languages replicated in Berber, but in contrast to prior findings, word detection was not hindered by vowelless contexts. When words can be vowelless, otherwise universal constraints disfavoring vowelless words do not feature in spoken-word recognition. Copyright © 2012 Elsevier B.V. All rights reserved.

78 FR 63494 - Meeting of the National Coordination Committee on the AI/AN SANE-SART Initiative

Science.gov (United States)

2013-10-24

... National Coordination Committee on the AI/AN SANE--SART Initiative AGENCY: Office for Victims of Crime.../ Alaska Native (AI/AN) Sexual Assault Nurse Examiner (SANE)--Sexual Assault Response Team (SART..., victim-centered responses to sexual violence within AI/AN communities. DATES: The meeting will be held...

Ontological Annotation with WordNet

Energy Technology Data Exchange (ETDEWEB)

Sanfilippo, Antonio P.; Tratz, Stephen C.; Gregory, Michelle L.; Chappell, Alan R.; Whitney, Paul D.; Posse, Christian; Paulson, Patrick R.; Baddeley, Bob; Hohimer, Ryan E.; White, Amanda M.

2006-06-06

Semantic Web applications require robust and accurate annotation tools that are capable of automating the assignment of ontological classes to words in naturally occurring text (ontological annotation). Most current ontologies do not include rich lexical databases and are therefore not easily integrated with word sense disambiguation algorithms that are needed to automate ontological annotation. WordNet provides a potentially ideal solution to this problem as it offers a highly structured lexical conceptual representation that has been extensively used to develop word sense disambiguation algorithms. However, WordNet has not been designed as an ontology, and while it can be easily turned into one, the result of doing this would present users with serious practical limitations due to the great number of concepts (synonym sets) it contains. Moreover, mapping WordNet to an existing ontology may be difficult and requires substantial labor. We propose to overcome these limitations by developing an analytical platform that (1) provides a WordNet-based ontology offering a manageable and yet comprehensive set of concept classes, (2) leverages the lexical richness of WordNet to give an extensive characterization of concept class in terms of lexical instances, and (3) integrates a class recognition algorithm that automates the assignment of concept classes to words in naturally occurring text. The ensuing framework makes available an ontological annotation platform that can be effectively integrated with intelligence analysis systems to facilitate evidence marshaling and sustain the creation and validation of inference models.

Toddlers' sensitivity to within-word coarticulation during spoken word recognition: Developmental differences in lexical competition.

Science.gov (United States)

Zamuner, Tania S; Moore, Charlotte; Desmeules-Trudel, Félix

2016-12-01

To understand speech, listeners need to be able to decode the speech stream into meaningful units. However, coarticulation causes phonemes to differ based on their context. Because coarticulation is an ever-present component of the speech stream, it follows that listeners may exploit this source of information for cues to the identity of the words being spoken. This research investigates the development of listeners' sensitivity to coarticulation cues below the level of the phoneme in spoken word recognition. Using a looking-while-listening paradigm, adults and 2- and 3-year-old children were tested on coarticulation cues that either matched or mismatched the target. Both adults and children predicted upcoming phonemes based on anticipatory coarticulation to make decisions about word identity. The overall results demonstrate that coarticulation cues are a fundamental component of children's spoken word recognition system. However, children did not show the same resolution as adults of the mismatching coarticulation cues and competitor inhibition, indicating that children's processing systems are still developing. Copyright © 2016 Elsevier Inc. All rights reserved.

Rapid interactions between lexical semantic and word form analysis during word recognition in context: evidence from ERPs.

Science.gov (United States)

Kim, Albert; Lai, Vicky

2012-05-01

We used ERPs to investigate the time course of interactions between lexical semantic and sublexical visual word form processing during word recognition. Participants read sentence-embedded pseudowords that orthographically resembled a contextually supported real word (e.g., "She measured the flour so she could bake a ceke…") or did not (e.g., "She measured the flour so she could bake a tont…") along with nonword consonant strings (e.g., "She measured the flour so she could bake a srdt…"). Pseudowords that resembled a contextually supported real word ("ceke") elicited an enhanced positivity at 130 msec (P130), relative to real words (e.g., "She measured the flour so she could bake a cake…"). Pseudowords that did not resemble a plausible real word ("tont") enhanced the N170 component, as did nonword consonant strings ("srdt"). The effect pattern shows that the visual word recognition system is, perhaps, counterintuitively, more rapidly sensitive to minor than to flagrant deviations from contextually predicted inputs. The findings are consistent with rapid interactions between lexical and sublexical representations during word recognition, in which rapid lexical access of a contextually supported word (CAKE) provides top-down excitation of form features ("cake"), highlighting the anomaly of an unexpected word "ceke."

Social interaction facilitates word learning in preverbal infants: Word-object mapping and word segmentation.

Science.gov (United States)

Hakuno, Yoko; Omori, Takahide; Yamamoto, Jun-Ichi; Minagawa, Yasuyo

2017-08-01

In natural settings, infants learn spoken language with the aid of a caregiver who explicitly provides social signals. Although previous studies have demonstrated that young infants are sensitive to these signals that facilitate language development, the impact of real-life interactions on early word segmentation and word-object mapping remains elusive. We tested whether infants aged 5-6 months and 9-10 months could segment a word from continuous speech and acquire a word-object relation in an ecologically valid setting. In Experiment 1, infants were exposed to a live tutor, while in Experiment 2, another group of infants were exposed to a televised tutor. Results indicate that both younger and older infants were capable of segmenting a word and learning a word-object association only when the stimuli were derived from a live tutor in a natural manner, suggesting that real-life interaction enhances the learning of spoken words in preverbal infants. Copyright © 2017 Elsevier Inc. All rights reserved.

Activity of autoinducer two (AI-2) in bacteria isolated from surface ripened cheeses

DEFF Research Database (Denmark)

Gori, Klaus; Jespersen, Lene

2007-01-01

). Corynebacterium casei, Microbacterium barkeri, Microbacterium gubbeenense and S. equorum subsp. linens (all isolated from the smear of surface ripened cheeses) using the AI-2 bioluminescence assay. This indicates that AI-2 signaling could take place between bacteria found in the smear of surface ripened cheeses....

Dry eyes and AIs: If you don't ask you won't find out.

Science.gov (United States)

Inglis, Holly; Boyle, Frances M; Friedlander, Michael L; Watson, Stephanie L

2015-12-01

Our objective was to investigate the hypothesis that women on adjuvant aromatase inhibitors (AIs) for treatment of breast cancer have a higher prevalence of dry eye syndrome (DES) compared with controls. Exposure and control groups were recruited. A cross sectional questionnaire-based study was performed. Demographic data and medical histories were collected. The presence of dry eye syndrome was determined by the ocular surface disease index (OSDI). The Functional Assessment of Cancer Treatment - Endocrine Subscale (FACT-ES) was performed to investigate correlations with other side effects of AIs. 93 exposure group and 100 control group questionnaires were included. The groups were similar in all demographic variables. The prevalence of dry eye syndrome was 35% (exposure) and 18% (control) (p dry eyes. The OSDI score was negatively correlated with the total FACT-ES score and positively correlated with duration of treatment. Our study is the first to use a validated questionnaire to assess for DES in this population. DES is significantly more prevalent in women on AIs compared with controls. This is a newly emerging, and easily treated side effect of AIs. Self-reporting of dry eye symptoms underestimates the prevalence of DES with AIs. We recommend routine screening of patients on AIs with the OSDI with the aim of improving patient quality of life and possibly adherence. Copyright © 2015 Elsevier Ltd. All rights reserved.

Visual word recognition across the adult lifespan.

Science.gov (United States)

Cohen-Shikora, Emily R; Balota, David A

2016-08-01

The current study examines visual word recognition in a large sample (N = 148) across the adult life span and across a large set of stimuli (N = 1,187) in three different lexical processing tasks (pronunciation, lexical decision, and animacy judgment). Although the focus of the present study is on the influence of word frequency, a diverse set of other variables are examined as the word recognition system ages and acquires more experience with language. Computational models and conceptual theories of visual word recognition and aging make differing predictions for age-related changes in the system. However, these have been difficult to assess because prior studies have produced inconsistent results, possibly because of sample differences, analytic procedures, and/or task-specific processes. The current study confronts these potential differences by using 3 different tasks, treating age and word variables as continuous, and exploring the influence of individual differences such as vocabulary, vision, and working memory. The primary finding is remarkable stability in the influence of a diverse set of variables on visual word recognition across the adult age spectrum. This pattern is discussed in reference to previous inconsistent findings in the literature and implications for current models of visual word recognition. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

Slovotvorné „excesy“ ve starší češtině?

Czech Academy of Sciences Publication Activity Database

Nejedlý, Petr

2017-01-01

Roč. 100, č. 5 (2017), s. 322-331 ISSN 0027-8203 R&D Projects: GA ČR(CZ) GA15-00987S Institutional support: RVO:68378092 Keywords : occasional word s * neologisms * word -formative system * lexicon * Old Czech * Middle Czech Subject RIV: AI - Linguistics OBOR OECD: Linguistics

Professional WordPress Plugin Development

CERN Document Server

Williams, Brad; Tadlock, Justin

2011-01-01

Taking WordPress to the next level with advanced plugin developmentWordPress is used to create self-hosted blogs and sites, and it's fast becoming the most popular content management system (CMS) on the Web. Now you can extend it for personal, corporate and enterprise use with advanced plugins and this professional development guide. Learn how to create plugins using the WordPress plugin API: utilize hooks, store custom settings, craft translation files, secure your plugins, set custom user roles, integrate widgets, work with JavaScript and AJAX, create custom post types. You'll find a practic

WordPress 24-Hour Trainer

CERN Document Server

Plumley, George

2011-01-01

The eagerly anticipated second edition, completely updated for WordPress 3.1 As an open source content management system, WordPress allows users to easily build feature-rich web sites with no programming experience. This unique book-and-video package is a friendly, self-paced beginners guide to the latest release of WordPress. Lessons are focused on practical, everyday tasks that users will need to create and maintain their sites: entering new content, creating new pages, managing menus, making content search-engine friendly. Plus you'll find lots of tips based on years of experience teaching

A Few Words about Words | Poster

Science.gov (United States)

By Ken Michaels, Guest Writer In Shakepeare’s play “Hamlet,” Polonius inquires of the prince, “What do you read, my lord?” Not at all pleased with what he’s reading, Hamlet replies, “Words, words, words.”1 I have previously described the communication model in which a sender encodes a message and then sends it via some channel (or medium) to a receiver, who decodes the message

Corticospinal excitability during the processing of handwritten and typed words and non-words.

Science.gov (United States)

Gordon, Chelsea L; Spivey, Michael J; Balasubramaniam, Ramesh

2017-06-09

A number of studies have suggested that perception of actions is accompanied by motor simulation of those actions. To further explore this proposal, we applied Transcranial magnetic stimulation (TMS) to the left primary motor cortex during the observation of handwritten and typed language stimuli, including words and non-word consonant clusters. We recorded motor-evoked potentials (MEPs) from the right first dorsal interosseous (FDI) muscle to measure cortico-spinal excitability during written text perception. We observed a facilitation in MEPs for handwritten stimuli, regardless of whether the stimuli were words or non-words, suggesting potential motor simulation during observation. We did not observe a similar facilitation for the typed stimuli, suggesting that motor simulation was not occurring during observation of typed text. By demonstrating potential simulation of written language text during observation, these findings add to a growing literature suggesting that the motor system plays a strong role in the perception of written language. Copyright © 2017 Elsevier B.V. All rights reserved.

Social coordination in toddler's word learning: interacting systems of perception and action

Science.gov (United States)

Pereira, Alfredo; Smith, Linda; Yu, Chen

2008-06-01

We measured turn-taking in terms of hand and head movements and asked if the global rhythm of the participants' body activity relates to word learning. Six dyads composed of parents and toddlers (M=18 months) interacted in a tabletop task wearing motion-tracking sensors on their hands and head. Parents were instructed to teach the labels of 10 novel objects and the child was later tested on a name-comprehension task. Using dynamic time warping, we compared the motion data of all body-part pairs, within and between partners. For every dyad, we also computed an overall measure of the quality of the interaction, that takes into consideration the state of interaction when the parent uttered an object label and the overall smoothness of the turn-taking. The overall interaction quality measure was correlated with the total number of words learned. In particular, head movements were inversely related to other partner's hand movements, and the degree of bodily coupling of parent and toddler predicted the words that children learned during the interaction. The implications of joint body dynamics to understanding joint coordination of activity in a social interaction, its scaffolding effect on the child's learning and its use in the development of artificial systems are discussed.

Optimizing Limousine Service with AI

OpenAIRE

Chun, Andy Hon Wai

2011-01-01

A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

Novel Blind Recognition Algorithm of Frame Synchronization Words Based on Soft-Decision in Digital Communication Systems.

Science.gov (United States)

Qin, Jiangyi; Huang, Zhiping; Liu, Chunwu; Su, Shaojing; Zhou, Jing

2015-01-01

A novel blind recognition algorithm of frame synchronization words is proposed to recognize the frame synchronization words parameters in digital communication systems. In this paper, a blind recognition method of frame synchronization words based on the hard-decision is deduced in detail. And the standards of parameter recognition are given. Comparing with the blind recognition based on the hard-decision, utilizing the soft-decision can improve the accuracy of blind recognition. Therefore, combining with the characteristics of Quadrature Phase Shift Keying (QPSK) signal, an improved blind recognition algorithm based on the soft-decision is proposed. Meanwhile, the improved algorithm can be extended to other signal modulation forms. Then, the complete blind recognition steps of the hard-decision algorithm and the soft-decision algorithm are given in detail. Finally, the simulation results show that both the hard-decision algorithm and the soft-decision algorithm can recognize the parameters of frame synchronization words blindly. What's more, the improved algorithm can enhance the accuracy of blind recognition obviously.

Words and possible words in early language acquisition.

Science.gov (United States)

Marchetto, Erika; Bonatti, Luca L

2013-11-01

In order to acquire language, infants must extract its building blocks-words-and master the rules governing their legal combinations from speech. These two problems are not independent, however: words also have internal structure. Thus, infants must extract two kinds of information from the same speech input. They must find the actual words of their language. Furthermore, they must identify its possible words, that is, the sequences of sounds that, being morphologically well formed, could be words. Here, we show that infants' sensitivity to possible words appears to be more primitive and fundamental than their ability to find actual words. We expose 12- and 18-month-old infants to an artificial language containing a conflict between statistically coherent and structurally coherent items. We show that 18-month-olds can extract possible words when the familiarization stream contains marks of segmentation, but cannot do so when the stream is continuous. Yet, they can find actual words from a continuous stream by computing statistical relationships among syllables. By contrast, 12-month-olds can find possible words when familiarized with a segmented stream, but seem unable to extract statistically coherent items from a continuous stream that contains minimal conflicts between statistical and structural information. These results suggest that sensitivity to word structure is in place earlier than the ability to analyze distributional information. The ability to compute nontrivial statistical relationships becomes fully effective relatively late in development, when infants have already acquired a considerable amount of linguistic knowledge. Thus, mechanisms for structure extraction that do not rely on extensive sampling of the input are likely to have a much larger role in language acquisition than general-purpose statistical abilities. Copyright © 2013. Published by Elsevier Inc.

Representation Learning of Logic Words by an RNN: From Word Sequences to Robot Actions

Directory of Open Access Journals (Sweden)

Tatsuro Yamada

2017-12-01

Full Text Available An important characteristic of human language is compositionality. We can efficiently express a wide variety of real-world situations, events, and behaviors by compositionally constructing the meaning of a complex expression from a finite number of elements. Previous studies have analyzed how machine-learning models, particularly neural networks, can learn from experience to represent compositional relationships between language and robot actions with the aim of understanding the symbol grounding structure and achieving intelligent communicative agents. Such studies have mainly dealt with the words (nouns, adjectives, and verbs that directly refer to real-world matters. In addition to these words, the current study deals with logic words, such as “not,” “and,” and “or” simultaneously. These words are not directly referring to the real world, but are logical operators that contribute to the construction of meaning in sentences. In human–robot communication, these words may be used often. The current study builds a recurrent neural network model with long short-term memory units and trains it to learn to translate sentences including logic words into robot actions. We investigate what kind of compositional representations, which mediate sentences and robot actions, emerge as the network's internal states via the learning process. Analysis after learning shows that referential words are merged with visual information and the robot's own current state, and the logical words are represented by the model in accordance with their functions as logical operators. Words such as “true,” “false,” and “not” work as non-linear transformations to encode orthogonal phrases into the same area in a memory cell state space. The word “and,” which required a robot to lift up both its hands, worked as if it was a universal quantifier. The word “or,” which required action generation that looked apparently random, was represented as an

Visual Word Recognition Across the Adult Lifespan

Science.gov (United States)

Cohen-Shikora, Emily R.; Balota, David A.

2016-01-01

The current study examines visual word recognition in a large sample (N = 148) across the adult lifespan and across a large set of stimuli (N = 1187) in three different lexical processing tasks (pronunciation, lexical decision, and animacy judgments). Although the focus of the present study is on the influence of word frequency, a diverse set of other variables are examined as the system ages and acquires more experience with language. Computational models and conceptual theories of visual word recognition and aging make differing predictions for age-related changes in the system. However, these have been difficult to assess because prior studies have produced inconsistent results, possibly due to sample differences, analytic procedures, and/or task-specific processes. The current study confronts these potential differences by using three different tasks, treating age and word variables as continuous, and exploring the influence of individual differences such as vocabulary, vision, and working memory. The primary finding is remarkable stability in the influence of a diverse set of variables on visual word recognition across the adult age spectrum. This pattern is discussed in reference to previous inconsistent findings in the literature and implications for current models of visual word recognition. PMID:27336629

Constitution d’un Corpus de Français Langue Etrangère destiné aux Apprenants Allemands

Directory of Open Access Journals (Sweden)

Fauth Camille

2014-07-01

Nationale de la Recherche et Deutsche Forschungsgemeinschaft attribué à l’équipe Parole du LORIA UMR 7503, Nancy – France et à l’Equipe de Linguistique Computationnelle et de Phonétique FR 4.7 de l’Université de la Sarre Sarrebruck – Allemagne dans lequel le français et l’allemand sont des langues cibles. Pour la paire allemand-français, peu de corpus parallèles sont disponibles. Nous présentons ici l’élaboration d’un corpus de productions orales de locuteurs natifs et non natifs pour la paire allemand-français. Notre corpus entend mettre au jour les déviations phonétiques et phonologiques que les locuteurs allemands produisent lorsqu’ils apprennent le français. Ce travail s’insère dans un projet plus global, Ce projet entend étudier les difficultés que les locuteurs français rencontrent lorsqu’ils apprennent l’allemand, et réciproquement. Aussi, cinquante locuteurs allemands seront recrutés dans des milieux universitaires et scolaires (niveau lycée en Allemagne et cinquante locuteurs français dans les mêmes milieux en France. Il s’agit pour les deux populations de produire d’une part le corpus en langue étrangère (en langue française pour les locuteurs allemands et en langue allemande pour les locuteurs français mais également le corpus en langue maternelle (en allemand pour les allemands et en français pour les français. Les corpus ainsi obtenus devraient nous permettre d’identifier les difficultés que les locuteurs allemands ou français rencontrent lorsqu’ils apprennent le français ou l’allemand. Les données de contrôle sont doubles puisque l’on pourra à la fois se référer aux productions des apprenants dans leur langue maternelle (ici l’allemand, mais également à celles de locuteurs natifs (ici germanophones. Nous ne présenterons ici que la constitution du corpus en français.

Pavlovian, Skinner, and Other Behaviourists' Contributions to AI. Chapter 9

Science.gov (United States)

Kosinski, Withold; Zaczek-Chrzanowska, Dominika

2007-01-01

A version of the definition of intelligent behaviour will be supplied in the context of real and artificial systems. Short presentation of principles of learning, starting with Pavlovian s classical conditioning through reinforced response and operant conditioning of Thorndike and Skinner and finishing with cognitive learning of Tolman and Bandura will be given. The most important figures within behaviourism, especially those with contribution to AI, will be described. Some tools of artificial intelligence that act according to those principles will be presented. An attempt will be made to show when some simple rules for behaviour modifications can lead to a complex intelligent behaviour.

How AI localisation in plant tissues determines the targeted pest spectrum of different chemistries

DEFF Research Database (Denmark)

Buchholz, Anke; Trapp, Stefan

penetration as first crucial step can be modified by formulation whereas the active ingredient (AI) distribution within cells is usually solely determined by physicochemical properties. This passive AI distribution was calculated with the Fick-Nernst-Planck equation implemented in a cell model....... The predictions were compared to the measured biological effects against three different arthropods. Test compounds differed in log P (-0.1 to 4.3) and pKa (4.1 to 10.7). Efficacies in different bioassays are discussed with the postulated cellular AI localisation and the individual feeding behaviour...

Recurrent Partial Words

Directory of Open Access Journals (Sweden)

Francine Blanchet-Sadri

2011-08-01

Full Text Available Partial words are sequences over a finite alphabet that may contain wildcard symbols, called holes, which match or are compatible with all letters; partial words without holes are said to be full words (or simply words. Given an infinite partial word w, the number of distinct full words over the alphabet that are compatible with factors of w of length n, called subwords of w, refers to a measure of complexity of infinite partial words so-called subword complexity. This measure is of particular interest because we can construct partial words with subword complexities not achievable by full words. In this paper, we consider the notion of recurrence over infinite partial words, that is, we study whether all of the finite subwords of a given infinite partial word appear infinitely often, and we establish connections between subword complexity and recurrence in this more general framework.

Automated Information System (AIS) Alarm System

International Nuclear Information System (INIS)

Hunteman, W.

1997-01-01

The Automated Information Alarm System is a joint effort between Los Alamos National Laboratory, Lawrence Livermore National Laboratory, and Sandia National Laboratory to demonstrate and implement, on a small-to-medium sized local area network, an automated system that detects and automatically responds to attacks that use readily available tools and methodologies. The Alarm System will sense or detect, assess, and respond to suspicious activities that may be detrimental to information on the network or to continued operation of the network. The responses will allow stopping, isolating, or ejecting the suspicious activities. The number of sensors, the sensitivity of the sensors, the assessment criteria, and the desired responses may be set by the using organization to meet their local security policies

Automated Information System (AIS) Alarm System

Energy Technology Data Exchange (ETDEWEB)

Hunteman, W.

1997-05-01

The Automated Information Alarm System is a joint effort between Los Alamos National Laboratory, Lawrence Livermore National Laboratory, and Sandia National Laboratory to demonstrate and implement, on a small-to-medium sized local area network, an automated system that detects and automatically responds to attacks that use readily available tools and methodologies. The Alarm System will sense or detect, assess, and respond to suspicious activities that may be detrimental to information on the network or to continued operation of the network. The responses will allow stopping, isolating, or ejecting the suspicious activities. The number of sensors, the sensitivity of the sensors, the assessment criteria, and the desired responses may be set by the using organization to meet their local security policies.

Effects of Word Width and Word Length on Optimal Character Size for Reading of Horizontally Scrolling Japanese Words.

Science.gov (United States)

Teramoto, Wataru; Nakazaki, Takuyuki; Sekiyama, Kaoru; Mori, Shuji

2016-01-01

The present study investigated, whether word width and length affect the optimal character size for reading of horizontally scrolling Japanese words, using reading speed as a measure. In Experiment 1, three Japanese words, each consisting of four Hiragana characters, sequentially scrolled on a display screen from right to left. Participants, all Japanese native speakers, were instructed to read the words aloud as accurately as possible, irrespective of their order within the sequence. To quantitatively measure their reading performance, we used rapid serial visual presentation paradigm, where the scrolling rate was increased until the participants began to make mistakes. Thus, the highest scrolling rate at which the participants' performance exceeded 88.9% correct rate was calculated for each character size (0.3°, 0.6°, 1.0°, and 3.0°) and scroll window size (5 or 10 character spaces). Results showed that the reading performance was highest in the range of 0.6° to 1.0°, irrespective of the scroll window size. Experiment 2 investigated whether the optimal character size observed in Experiment 1 was applicable for any word width and word length (i.e., the number of characters in a word). Results showed that reading speeds were slower for longer than shorter words and the word width of 3.6° was optimal among the word lengths tested (three, four, and six character words). Considering that character size varied depending on word width and word length in the present study, this means that the optimal character size can be changed by word width and word length in scrolling Japanese words.

Abelian primitive words

OpenAIRE

Domaratzki, Michael; Rampersad, Narad

2011-01-01

We investigate Abelian primitive words, which are words that are not Abelian powers. We show that unlike classical primitive words, the set of Abelian primitive words is not context-free. We can determine whether a word is Abelian primitive in linear time. Also different from classical primitive words, we find that a word may have more than one Abelian root. We also consider enumeration problems and the relation to the theory of codes. Peer reviewed

Effects of word width and word length on optimal character size for reading of horizontally scrolling Japanese words

Directory of Open Access Journals (Sweden)

Wataru eTeramoto

2016-02-01

Full Text Available The present study investigated whether word width and length affect the optimal character size for reading of horizontally scrolling Japanese words, using reading speed as a measure. In Experiment 1, three Japanese words, each consisting of 4 Hiragana characters, sequentially scrolled on a display screen from right to left. Participants, all Japanese native speakers, were instructed to read the words aloud as accurately as possible, irrespective of their order within the sequence. To quantitatively measure their reading performance, we used rapid serial visual presentation paradigm, where the scrolling rate was increased until the participants began to make mistakes. Thus, the highest scrolling rate at which the participants’ performance exceeded 88.9% correct rate was calculated for each character size (0.3, 0.6, 1.0, and 3.0° and scroll window size (5 or 10 character spaces. Results showed that the reading performance was highest in the range of 0.6° to 1.0°, irrespective of the scroll window size. Experiment 2 investigated whether the optimal character size observed in Experiment 1 was applicable for any word width and word length (i.e., the number of characters in a word. Results showed that reading speeds were slower for longer than shorter words and the word width of 3.6° was optimal among the word lengths tested (3, 4, and 6 character words. Considering that character size varied depending on word width and word length in the present study, this means that the optimal character size can be changed by word width and word length.

AI (artificial intelligence) in histopathology--from image analysis to automated diagnosis.

Science.gov (United States)

Kayser, Klaus; Görtler, Jürgen; Bogovac, Milica; Bogovac, Aleksandar; Goldmann, Torsten; Vollmer, Ekkehard; Kayser, Gian

2009-01-01

education in anatomy and pathology. First attempts to introduce them into routine work have been reported. Application of AI has been established by automated immunohistochemical measurement systems (EAMUS, www.diagnomX.eu). The performance of automated diagnosis has been reported for a broad variety of organs at sensitivity and specificity levels >85%). The implementation of a complete connected AI supported system is in its childhood. Application of AI in digital tissue--based diagnosis will allow the pathologists to work as supervisors and no longer as primary "water carriers". Its accurate use will give them the time needed to concentrating on difficult cases for the benefit of their patients.

CERN Technical Training: available Places in forthcoming Courses

CERN Multimedia

2008-01-01

The following course sessions are scheduled in the framework of the CERN Technical Training Program 2008 and places are still available. You may find the full updated Technical Training course program in our web-catalogue (http://cta.cern.ch/cta2/f?p=110:9). OFFICE SOFTWARE Sharepoint Collaboration Worskpace\t(Français) 07-08.04\t2 jours CERN EDMS MTF in practice (English)\t09.04\t0.5 day Word 2007 : Niveau 1 ECDL (Français) 10-11.04\t2 jours Indico - Meeting Organization\t(Français)\t18.04\t1 day Indico – Conference Organization\t(Français)\t18.04\t1 day Word 2007: Niveau 2 ECDL\t(Français)\t28-29.04\t2 jours Excel 2007 – Niveau 2 ECDL (Français)\t05-06.05\t2 jours In Design: Introduction (Français)\t13-14.05\t2 jours Sharepoint Collaboration Worskpace\t(English)\t19-20.05\t2 days Sharepoint Designer (Frontpage) – Level 1 ECDL\t(English)\t29-30.05\t2 days SOFTWARE AND SYSTEM TECHNOLOGIES C++ Programming Part 1 – Java 2 Enterprise Edition: Part 2 Enterprise JavaBeans (English)\t14-16.04 3 days Oracle SQL (En...

Augmentation index (AI) in a dose-response relationship with smoking habits in males: The Tanushimaru study.

Science.gov (United States)

Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

2016-12-01

We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese.This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects' medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender.Age-adjusted means of AI in males showed a clear dose-response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose-response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake.The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males.

Protection level of AI H5N1 vaccine clade 2.1.3 commercial against AI H5N1 clade 2.3.2 virus from Ducks to SPF chicken in laboratory conditions

Directory of Open Access Journals (Sweden)

Indriani R

2015-03-01

Full Text Available Highly Pathogenic Avian Influenza (HPAI subtype H5N1 clade 2.3.2 has infected chickens in farms, causing mortality and a decrease in egg production. Vaccination is one of the strategies to control disease of AI subtype H5N1. AI H5N1 clade 2.1.3 vaccine is available commercially. The effectiveness of two vaccines of AI H5N1 clade 2.1.3 (product A and B, and AI H5N1 clade 2.3.2 (Sukoharjo against AI H5N1 clade 2.3.2 (Sukoharjo virus SPF chickens was tested in laboratory. Four groups of SPF chickens were used in this study, there were (1 vaccinated with H5N1 clade 2.1.3 (product A, (2 vaccinated with H5N1 clade 2.1.3 (product B, (3 vaccinated with AI H5N1 clade 2.3.2 and (4 unvaccinated (as a control. Each vaccinated group consisted of 10 chicken except 8 chicken for control group. SPF chicken were vaccinated with 1 dose of vaccine at 3 weeks olds, and then after 3 weeks post vaccination (at 6 weeks olds. All group of chicken were challenged with 106 EID50 per 0.1 ml via intranasal. The results showed, chicken vaccinated with H5N1 clade 2.1.3 product A and B gave 100 and 80% protection respectively, but showed challenged virus shedding, whereas vaccine of H5N1 clade 2.3.2 gave 100% protection from mortality and without virus shedding. Vaccines of AI H5N1 clade 2.1.3 product A was better than vaccine product B, and when chicken vaccinated against H5N1 clade 2.3.2, H5N1 clade 2.3.2 vaccine was the best to be used. In order to protect chicken from AI subtype H5N1 clade 2.1.3 and 2.3.2 in the field, a bivalent vaccine of H5N1 clade 2.1.3 and 2.3.2 subtypes should be developed.

Os efeitos do método Ai Chi em pacientes portadoras da síndrome fibromiálgica The effect of Ai Chi method in fybromialgic patients

Directory of Open Access Journals (Sweden)

Jacqueline Soares de Santana

2010-06-01

Full Text Available O objetivo do estudo é demonstrar os efeitos do método Ai Chi como forma alternativa de abordagem hidroterapêutica em pacientes portadoras da síndrome fibromiálgica. Foram estudados dez pacientes; quatro fizeram parte do grupo experimento e cinco, do grupo controle, com uma desistência. As pacientes foram avaliadas através do Questionário de Impacto da Fibromialgia (QIF e da Escala de Intensidade e Índice de dor nos Pontos Sensíveis. Foram realizadas duas avaliações, uma antes e outra após o tratamento. As pacientes foram submetidas a dez sessões do método Ai Chi, com duração de quarenta minutos. Houve melhora na intensidade da dor, de acordo com a escala da intensidade de dor nos pontos sensíveis, após a intervenção; já a qualidade de vida manteve-se sem alteração. Na qualidade de vida, observou-se que os grupos obtiveram resultados semelhantes; isso se deve ao fato que as pacientes não apresentaram melhora no seu estado depressivo. No índice dos pontos sensíveis, verificou-se diferença entre os grupos. A explicação para essa diferença deve-se possivelmente aos benefícios da imersão em água aquecida e aos efeitos do método Ai Chi. Não houve diferença significativa entre os grupos, o que pode ser atribuído às limitações do estudo. Desta forma, torna-se relevante a realização de novos estudos referentes à aplicação do método Ai Chi em pacientes portadoras da síndrome fibromiálgica.The objective of this article is to show the effect of the Ai Chi method, as an alternative form of hydrotherapeutic approach in fibromyalgia syndrome patients. Ten patients were studied, four were part of the experiment group and five of the control group, with one desistance. The patients were evaluated through the Fibromyalgia Impact Questionnaire (QIF and Scale of Intensity and Index of pain in Sensible Points. Two evaluations were performed, before and after the treatment. The patients were submitted to ten sessions

Short communication: The role of autoinducer 2 (AI-2) on antibiotic resistance regulation in an Escherichia coli strain isolated from a dairy cow with mastitis.

Science.gov (United States)

Xue, Ting; Yu, Lumin; Shang, Fei; Li, Wenchang; Zhang, Ming; Ni, Jingtian; Chen, Xiaolin

2016-06-01

Extended spectrum β-lactamase (ESBL)-positive Escherichia coli is a major etiological organism responsible for bovine mastitis. The autoinducer 2 (AI-2) quorum sensing system is widely present in many species of gram-negative and gram-positive bacteria and has been proposed to be involved in interspecies communication. In E. coli model strains, the functional mechanisms of AI-2 have been well studied; however, in clinical antibiotic-resistant E. coli strains, whether AI-2 affects the expression of antibiotic resistance genes has not been reported. In this study, we report that exogenous AI-2 increased the antibiotic resistance of a clinical E. coli strain isolated from a dairy cow with mastitis by upregulating the expression of TEM-type enzyme in an LsrR (LuxS regulated repressor)-dependent manner. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

AI-2 quorum-sensing inhibitors affect the starvation response and reduce virulence in several Vibrio species, most likely by interfering with LuxPQ.

Science.gov (United States)

Brackman, Gilles; Celen, Shari; Baruah, Kartik; Bossier, Peter; Van Calenbergh, Serge; Nelis, Hans J; Coenye, Tom

2009-12-01

The increase of disease outbreaks caused by Vibrio species in aquatic organisms as well as in humans, together with the emergence of antibiotic resistance in Vibrio species, has led to a growing interest in alternative disease control measures. Quorum sensing (QS) is a mechanism for regulating microbial gene expression in a cell density-dependent way. While there is good evidence for the involvement of auto-inducer 2 (AI-2)-based interspecies QS in the control of virulence in multiple Vibrio species, only few inhibitors of this system are known. From the screening of a small panel of nucleoside analogues for their ability to disturb AI-2-based QS, an adenosine derivative with a p-methoxyphenylpropionamide moiety at C-3' emerged as a promising hit. Its mechanism of inhibition was elucidated by measuring the effect on bioluminescence in a series of Vibrio harveyi AI-2 QS mutants. Our results indicate that this compound, as well as a truncated analogue lacking the adenine base, block AI-2-based QS without interfering with bacterial growth. The active compounds affected neither the bioluminescence system as such nor the production of AI-2, but most likely interfered with the signal transduction pathway at the level of LuxPQ in V. harveyi. The most active nucleoside analogue (designated LMC-21) was found to reduce the Vibrio species starvation response, to affect biofilm formation in Vibrio anguillarum, Vibrio vulnificus and Vibrio cholerae, to reduce pigment and protease production in V. anguillarum, and to protect gnotobiotic Artemia from V. harveyi-induced mortality.

Universal Lyndon Words

OpenAIRE

Carpi, Arturo; Fici, Gabriele; Holub, Stepan; Oprsal, Jakub; Sciortino, Marinella

2014-01-01

A word $w$ over an alphabet $\\Sigma$ is a Lyndon word if there exists an order defined on $\\Sigma$ for which $w$ is lexicographically smaller than all of its conjugates (other than itself). We introduce and study \\emph{universal Lyndon words}, which are words over an $n$-letter alphabet that have length $n!$ and such that all the conjugates are Lyndon words. We show that universal Lyndon words exist for every $n$ and exhibit combinatorial and structural properties of these words. We then defi...

Word skipping: effects of word length, predictability, spelling and reading skill.

Science.gov (United States)

Slattery, Timothy J; Yates, Mark

2017-08-31

Readers eyes often skip over words as they read. Skipping rates are largely determined by word length; short words are skipped more than long words. However, the predictability of a word in context also impacts skipping rates. Rayner, Slattery, Drieghe and Liversedge (2011) reported an effect of predictability on word skipping for even long words (10-13 characters) that extend beyond the word identification span. Recent research suggests that better readers and spellers have an enhanced perceptual span (Veldre & Andrews, 2014). We explored whether reading and spelling skill interact with word length and predictability to impact word skipping rates in a large sample (N=92) of average and poor adult readers. Participants read the items from Rayner et al. (2011) while their eye movements were recorded. Spelling skill (zSpell) was assessed using the dictation and recognition tasks developed by Sally Andrews and colleagues. Reading skill (zRead) was assessed from reading speed (words per minute) and accuracy of three 120 word passages each with 10 comprehension questions. We fit linear mixed models to the target gaze duration data and generalized linear mixed models to the target word skipping data. Target word gaze durations were significantly predicted by zRead while, the skipping likelihoods were significantly predicted by zSpell. Additionally, for gaze durations, zRead significantly interacted with word predictability as better readers relied less on context to support word processing. These effects are discussed in relation to the lexical quality hypothesis and eye movement models of reading.

Novel Blind Recognition Algorithm of Frame Synchronization Words Based on Soft-Decision in Digital Communication Systems.

Directory of Open Access Journals (Sweden)

Jiangyi Qin

Full Text Available A novel blind recognition algorithm of frame synchronization words is proposed to recognize the frame synchronization words parameters in digital communication systems. In this paper, a blind recognition method of frame synchronization words based on the hard-decision is deduced in detail. And the standards of parameter recognition are given. Comparing with the blind recognition based on the hard-decision, utilizing the soft-decision can improve the accuracy of blind recognition. Therefore, combining with the characteristics of Quadrature Phase Shift Keying (QPSK signal, an improved blind recognition algorithm based on the soft-decision is proposed. Meanwhile, the improved algorithm can be extended to other signal modulation forms. Then, the complete blind recognition steps of the hard-decision algorithm and the soft-decision algorithm are given in detail. Finally, the simulation results show that both the hard-decision algorithm and the soft-decision algorithm can recognize the parameters of frame synchronization words blindly. What's more, the improved algorithm can enhance the accuracy of blind recognition obviously.

Expert system in PNC, 4

International Nuclear Information System (INIS)

Yamamoto, Fumio; Nakazawa, Hiroaki

1990-01-01

We have been developing an operation assisting system, partially supported by AI system, for uranium enrichment plant. The AI system is a proto-type system aiming a final one which can be applied to any future large uranium enrichment plant and also not only to specific operational area but also to complex and multi-phenomenon operational area. An existing AI system, for example facility diagnostic system that utilizes the result of CCT(Cause Consequence Tree) analysis as knowledge base, has weakness in flexibility and potentiality. To build AI system, we have developed the most suitable knowledge representations using deep knowledge for each facility or operation of uranium enrichment plant. This paper describes our AI proto-type system adopting several knowledge representations that can represent an uranium enrichment plant's operation with deep knowledge. (author)

Comparing different kinds of words and word-word relations to test an habituation model of priming.

Science.gov (United States)

Rieth, Cory A; Huber, David E

2017-06-01

Huber and O'Reilly (2003) proposed that neural habituation exists to solve a temporal parsing problem, minimizing blending between one word and the next when words are visually presented in rapid succession. They developed a neural dynamics habituation model, explaining the finding that short duration primes produce positive priming whereas long duration primes produce negative repetition priming. The model contains three layers of processing, including a visual input layer, an orthographic layer, and a lexical-semantic layer. The predicted effect of prime duration depends both on this assumed representational hierarchy and the assumption that synaptic depression underlies habituation. The current study tested these assumptions by comparing different kinds of words (e.g., words versus non-words) and different kinds of word-word relations (e.g., associative versus repetition). For each experiment, the predictions of the original model were compared to an alternative model with different representational assumptions. Experiment 1 confirmed the prediction that non-words and inverted words require longer prime durations to eliminate positive repetition priming (i.e., a slower transition from positive to negative priming). Experiment 2 confirmed the prediction that associative priming increases and then decreases with increasing prime duration, but remains positive even with long duration primes. Experiment 3 replicated the effects of repetition and associative priming using a within-subjects design and combined these effects by examining target words that were expected to repeat (e.g., viewing the target word 'BACK' after the prime phrase 'back to'). These results support the originally assumed representational hierarchy and more generally the role of habituation in temporal parsing and priming. Copyright © 2017 Elsevier Inc. All rights reserved.

The role of native-language phonology in the auditory word identification and visual word recognition of Russian-English bilinguals.

Science.gov (United States)

Shafiro, Valeriy; Kharkhurin, Anatoliy V

2009-03-01

Does native language phonology influence visual word processing in a second language? This question was investigated in two experiments with two groups of Russian-English bilinguals, differing in their English experience, and a monolingual English control group. Experiment 1 tested visual word recognition following semantic categorization of words containing four phonological vowel contrasts (/i/-/u/,/I/-/A/,/i/-/I/,/epsilon/-/ae/). Experiment 2 assessed auditory identification accuracy of words containing these four contrasts. Both bilingual groups demonstrated reduced accuracy in auditory identification of two English vowel contrasts absent in their native phonology (/i/-/I/,epsilon/-/ae/). For late- bilinguals, auditory identification difficulty was accompanied by poor visual word recognition for one difficult contrast (/i/-/I/). Bilinguals' visual word recognition moderately correlated with their auditory identification of difficult contrasts. These results indicate that native language phonology can play a role in visual processing of second language words. However, this effect may be considerably constrained by orthographic systems of specific languages.

Signal Words

Science.gov (United States)

SIGNAL WORDS TOPIC FACT SHEET NPIC fact sheets are designed to answer questions that are commonly asked by the ... making decisions about pesticide use. What are Signal Words? Signal words are found on pesticide product labels, ...

AI and simulation: What can they learn from each other

Science.gov (United States)

Colombano, Silvano P.

1988-01-01

Simulation and Artificial Intelligence share a fertile common ground both from a practical and from a conceptual point of view. Strengths and weaknesses of both Knowledge Based System and Modeling and Simulation are examined and three types of systems that combine the strengths of both technologies are discussed. These types of systems are a practical starting point, however, the real strengths of both technologies will be exploited only when they are combined in a common knowledge representation paradigm. From an even deeper conceptual point of view, one might even argue that the ability to reason from a set of facts (i.e., Expert System) is less representative of human reasoning than the ability to make a model of the world, change it as required, and derive conclusions about the expected behavior of world entities. This is a fundamental problem in AI, and Modeling Theory can contribute to its solution. The application of Knowledge Engineering technology to a Distributed Processing Network Simulator (DPNS) is discussed.

Automating Ontological Annotation with WordNet

Energy Technology Data Exchange (ETDEWEB)

Sanfilippo, Antonio P.; Tratz, Stephen C.; Gregory, Michelle L.; Chappell, Alan R.; Whitney, Paul D.; Posse, Christian; Paulson, Patrick R.; Baddeley, Bob L.; Hohimer, Ryan E.; White, Amanda M.

2006-01-22

Semantic Web applications require robust and accurate annotation tools that are capable of automating the assignment of ontological classes to words in naturally occurring text (ontological annotation). Most current ontologies do not include rich lexical databases and are therefore not easily integrated with word sense disambiguation algorithms that are needed to automate ontological annotation. WordNet provides a potentially ideal solution to this problem as it offers a highly structured lexical conceptual representation that has been extensively used to develop word sense disambiguation algorithms. However, WordNet has not been designed as an ontology, and while it can be easily turned into one, the result of doing this would present users with serious practical limitations due to the great number of concepts (synonym sets) it contains. Moreover, mapping WordNet to an existing ontology may be difficult and requires substantial labor. We propose to overcome these limitations by developing an analytical platform that (1) provides a WordNet-based ontology offering a manageable and yet comprehensive set of concept classes, (2) leverages the lexical richness of WordNet to give an extensive characterization of concept class in terms of lexical instances, and (3) integrates a class recognition algorithm that automates the assignment of concept classes to words in naturally occurring text. The ensuing framework makes available an ontological annotation platform that can be effectively integrated with intelligence analysis systems to facilitate evidence marshaling and sustain the creation and validation of inference models.

Processing negative valence of word pairs that include a positive word.

Science.gov (United States)

Itkes, Oksana; Mashal, Nira

2016-09-01

Previous research has suggested that cognitive performance is interrupted by negative relative to neutral or positive stimuli. We examined whether negative valence affects performance at the word or phrase level. Participants performed a semantic decision task on word pairs that included either a negative or a positive target word. In Experiment 1, the valence of the target word was congruent with the overall valence conveyed by the word pair (e.g., fat kid). As expected, response times were slower in the negative condition relative to the positive condition. Experiment 2 included target words that were incongruent with the overall valence of the word pair (e.g., fat salary). Response times were longer for word pairs whose overall valence was negative relative to positive, even though these word pairs included a positive word. Our findings support the Cognitive Primacy Hypothesis, according to which emotional valence is extracted after conceptual processing is complete.

BanII dimorphic site located in the third intron of the human apolipoprotein AI (APOA1) gene

Energy Technology Data Exchange (ETDEWEB)

Coleman, R T; Kresnak, M T; Frossard, P M

1988-02-11

A 0.7kb fragment generated by AvaII digestion of pBL13AI, a 0.965kb full-length human apolipoprotein AI cDNA was cloned into the EcoRI site of pBR322. The apoAI cDNA was isolated from a lambdagt10 human fetal liver cDNA library. BanII (GPuGCPyC) (International Biotechnologies, Inc.) identifies two invariant bands at 1122bp and 417bp, and a single two-allele polymorphism with bands at either 274bp or 452bp. The human apolipoprotein AI-CIII-AIV gene complex has been localized on the long arm of chromosome 11 by Southern blot analysis of human-chinese hamster cell hybrids. Co-dominant segregation has been observed in two families (13 individuals). The BanII restriction map was constructed from DNA sequence data of the human apoAI gene. The 452bp fragment is generated by the loss of a BanII dimorphic site in the third intron of the apoAI gene, between the 178bp and the 274bp fragments.

Ixpantepec Nieves Mixtec Word Prosody

Science.gov (United States)

Carroll, Lucien Serapio

This dissertation presents a phonological description and acoustic analysis of the word prosody of Ixpantepec Nieves Mixtec, which involves both a complex tone system and a default stress system. The analysis of Nieves Mixtec word prosody is complicated by a close association between morphological structure and prosodic structure, and by the interactions between word prosody and phonation type, which has both contrastive and non-contrastive roles in the phonology. I contextualize these systems within the phonology of Nieves Mixtec as a whole, within the literature on other Mixtec varieties, and within the literature on cross-linguistic prosodic typology. The literature on prosodic typology indicates that stress is necessarily defined abstractly, as structured prominence realized differently in each language. Descriptions of stress in other Mixtec varieties widely report default stress on the initial syllable of the canonical bimoraic root, though some descriptions suggest final stress or mobile stress. I first present phonological evidence---from distributional restrictions, phonological processes, and loanword adaptation---that Nieves Mixtec word prosody does involve a stress system, based on trochaic feet aligned to the root. I then present an acoustic study comparing stressed syllables to unstressed syllables, for ten potential acoustic correlates of stress. The results indicate that the acoustic correlates of stress in Nieves Mixtec include segmental duration, intensity and periodicity. Building on analyses of other Mixtec tone systems, I show that the distribution of tone and the tone processes in Nieves Mixtec support an analysis in which morae may bear H, M or L tone, where M tone is underlyingly unspecified, and each morpheme may sponsor a final +H or +L floating tone. Bimoraic roots thus host up to two linked tones and one floating tone, while monomoraic clitics host just one linked tone and one floating tone, and tonal morphemes are limited to a single

The 2010 Mario AI Championship: Level Generation Track

DEFF Research Database (Denmark)

Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.

2011-01-01

The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

The development of written word processing: the case of deaf children The development of written word processing: the case of deaf children

Directory of Open Access Journals (Sweden)

Jacqueline Leybaert

2008-04-01

Full Text Available Reading is a highly complex, flexible and sophisticated cognitive activity, and word recognition constitutes only a small and limited part of the whole process. It seems however that for various reasons, word recognition is worth studying separately from other components. Considering that writing systems are secondary codes representing the language, word recognition mechanisms may appear as an interface between printed material and general language capabilities, and thus, specific difficulties in reading and spelling acquisition should be iodated at the level of isolated word identification (see e. g. Crowder, 1982 for discussion. Moreover, it appears that a prominent characteristic of poor readers is their lack of efficiency in the processing of isolated words (Mitche11,1982; Stanovich, 1982. And finally, word recognition seems to be a more automatic and less controlled component of the whole reading process. Reading is a highly complex, flexible and sophisticated cognitive activity, and word recognition constitutes only a small and limited part of the whole process. It seems however that for various reasons, word recognition is worth studying separately from other components. Considering that writing systems are secondary codes representing the language, word recognition mechanisms may appear as an interface between printed material and general language capabilities, and thus, specific difficulties in reading and spelling acquisition should be iodated at the level of isolated word identification (see e. g. Crowder, 1982 for discussion. Moreover, it appears that a prominent characteristic of poor readers is their lack of efficiency in the processing of isolated words (Mitche11,1982; Stanovich, 1982. And finally, word recognition seems to be a more automatic and less controlled component of the whole reading process.

Synthesized and characterization of AI and Gd substitute ferrite for microwave

International Nuclear Information System (INIS)

Sudjono, Hans K.; Muljadi; Soepriyanto, Syony

2000-01-01

Ferrite for microwave components has been synthesized from garnet ceramics (YIG)substituted by AI and Gd. Magnetic permeability and magnetic polarization changes according to the AI 3+ ion addition. XRD is performed to determined the sintering products at various temperatures. For some samples the magnetic property and performance in microwave region was tested. The testing is conducted in the form of completely assembled circulator which gives data on isolation, insertion loss when microwave circuit analyzer was employed. Due to high level of porosity insertion lost is still to large, improved process is necessary

AIS radiometry and the problem of contamination from mixed spectral orders

Science.gov (United States)

Conel, J. E.; Adams, S.; Alley, R. E.; Hoover, G.; Schultz, S.

1988-01-01

The spectral radiance of test areas under solar illumination is ascertained in view of Airborne Imaging Spectrometer (AIS) data from Mono Lake, CA, establishing an atmospheric correction method for major absorbers on the basis of the spectrometric data themselves. The apparent low contrast of all atmospheric absorption bands leads to a study of contamination from overlapping spectral orders in the AIS data; this contamination is found unambiguously above 1500 nm with a magnitude that is a factor of 1.5-2.0 greater than the expected uncontaminated signal alone.

Finding words in a language that allows words without vowels

NARCIS (Netherlands)

El Aissati, A.; McQueen, J.M.; Cutler, A.

2012-01-01

Across many languages from unrelated families, spoken-word recognition is subject to a constraint whereby potential word candidates must contain a vowel. This constraint minimizes competition from embedded words (e.g., in English, disfavoring win in twin because t cannot be a word). However, the

Dynamics of Semantic and Word-Formation Subsystems of the Russian Language: Historical Dynamics of the Word Family

Directory of Open Access Journals (Sweden)

Olga Ivanovna Dmitrieva

2015-09-01

Full Text Available The article provides comprehensive justification of the principles and methods of the synchronic and diachronic research of word-formation subsystems of the Russian language. The authors also study the ways of analyzing historical dynamics of word family as the main macro-unit of word-formation system. In the field of analysis there is a family of words with the stem 'ход-' (the meaning of 'motion', word-formation of which is investigated in different periods of the Russian literary language. Significance of motion-verbs in the process of forming a language picture of the world determined the character and the structure of this word family as one of the biggest in the history of the Russian language. In the article a structural and semantic dynamics of the word family 'ход-' is depicted. The results of the study show that in the ancient period the prefixes of verbal derivatives were formed, which became the apex-branched derivational paradigms existing in modern Russian. The old Russian period of language development is characterized by the appearance of words with connotative meaning (with suffixes -ishk-, -ichn-, as well as the words with possessive semantics (with suffixes –ev-, -sk-. In this period the verbs with the postfix -cz also supplement the analyzed word family. The period of formation of the National Russian language was marked by the loss of a large number of abstract nouns and the appearance of neologisms from some old Russian abstract nouns. The studied family in the modern Russian language is characterized by the following processes: the appearance of terms, the active semantic derivation, the weakening of word-formation variability, the semantic differentiation of duplicate units, the development of subsystem of words with connotative meanings, and the preservation of derivatives in all functional styles.

Novel word retention in sequential bilingual children.

Science.gov (United States)

Kan, Pui Fong

2014-03-01

Children's ability to learn and retain new words is fundamental to their vocabulary development. This study examined word retention in children learning a home language (L1) from birth and a second language (L2) in preschool settings. Participants were presented with sixteen novel words in L1 and in L2 and were tested for retention after either a 2-month or a 4-month delay. Results showed that children retained more words in L1 than in L2 for both of the retention interval conditions. In addition, children's word retention was associated with their existing language knowledge and their fast-mapping performance within and across language. The patterns of association, however, were different between L1 and L2. These findings suggest that children's word retention might be related to the interactions of various components that are operating within a dynamic system.

Don’t words come easy?A psychophysical exploration of word superiority

Directory of Open Access Journals (Sweden)

Randi eStarrfelt

2013-09-01

Full Text Available Words are made of letters, and yet sometimes it is easier to identify a word than a single letter. This word superiority effect (WSE has been observed when written stimuli are presented very briefly or degraded by visual noise. We compare performance with letters and words in three experiments, to explore the extents and limits of the WSE. Using a carefully controlled list of three letter words, we show that a word superiority effect can be revealed in vocal reaction times even to undegraded stimuli. With a novel combination of psychophysics and mathematical modelling, we further show that the typical WSE is specifically reflected in perceptual processing speed: single words are simply processed faster than single letters. Intriguingly, when multiple stimuli are presented simultaneously, letters are perceived more easily than words, and this is reflected both in perceptual processing speed and visual short term memory capacity. So, even if single words come easy, there is a limit to the word superiority effect.

Purification and Characterization of BmooAi: A New Toxin from Bothrops moojeni Snake Venom That Inhibits Platelet Aggregation

Directory of Open Access Journals (Sweden)

Mayara Ribeiro de Queiroz

2014-01-01

Full Text Available In this paper, we describe the purification/characterization of BmooAi, a new toxin from Bothrops moojeni that inhibits platelet aggregation. The purification of BmooAi was carried out through three chromatographic steps (ion-exchange on a DEAE-Sephacel column, molecular exclusion on a Sephadex G-75 column, and reverse-phase HPLC chromatography on a C2/C18 column. BmooAi was homogeneous by SDS-PAGE and shown to be a single-chain protein of 15,000 Da. BmooAi was analysed by MALDI-TOF Spectrometry and revealed two major components with molecular masses 7824.4 and 7409.2 as well as a trace of protein with a molecular mass of 15,237.4 Da. Sequencing of BmooAi by Edman degradation showed two amino acid sequences: IRDFDPLTNAPENTA and ETEEGAEEGTQ, which revealed no homology to any known toxin from snake venom. BmooAi showed a rather specific inhibitory effect on platelet aggregation induced by collagen, adenosine diphosphate, or epinephrine in human platelet-rich plasma in a dose-dependent manner, whereas it had little or no effect on platelet aggregation induced by ristocetin. The effect on platelet aggregation induced by BmooAi remained active even when heated to 100°C. BmooAi could be of medical interest as a new tool for the development of novel therapeutic agents for the prevention and treatment of thrombotic disorders.

Don't words come easy? A psychophysical exploration of word superiority

DEFF Research Database (Denmark)

Starrfelt, Randi; Petersen, Anders; Vangkilde, Signe Allerup

2013-01-01

Words are made of letters, and yet sometimes it is easier to identify a word than a single letter. This word superiority effect (WSE) has been observed when written stimuli are presented very briefly or degraded by visual noise. We compare performance with letters and words in three experiments, ...... and visual short term memory capacity. So, even if single words come easy, there is a limit to the word superiority effect....

PER Estimation of AIS in Inland Rivers based on Three Dimensional Ray Tracking

Directory of Open Access Journals (Sweden)

F. Ma

2014-03-01

Full Text Available The Automatic Identification System (AIS is an important maritime safety device, which is populous in inland rivers. Compared with that in open sea, the Package Error Rate (PER of AIS in inland river has increased sharply due to its complex environment. With the help of hardware in loop simulation, it is possible to make statistical calculation on the PER under a given field strength and describe the data by quadratic rational fraction. Meanwhile, in the three dimensional software environments, the signal field strength is able to be calculated by the ray tracking method, which exhausts all the possible propagation paths, including direct way, reflection, diffractions, and the other medium attenuation matters. Beyond that, in the model, the propagation geography information in inland rivers is required to be simplified in some way, or the computation of the ray tracking is too hard to get. The paper set the Changjiang Wuhan channel as the field testing region, and all the deviations are less than 5% in sunny weather, which proves the method accurate and effective.

Changing word usage predicts changing word durations in New Zealand English.

Science.gov (United States)

Sóskuthy, Márton; Hay, Jennifer

2017-09-01

This paper investigates the emergence of lexicalized effects of word usage on word duration by looking at parallel changes in usage and duration over 130years in New Zealand English. Previous research has found that frequent words are shorter, informative words are longer, and words in utterance-final position are also longer. It has also been argued that some of these patterns are not simply online adjustments, but are incorporated into lexical representations. While these studies tend to focus on the synchronic aspects of such patterns, our corpus shows that word-usage patterns and word durations are not static over time. Many words change in duration and also change with respect to frequency, informativity and likelihood of occurring utterance-finally. Analysis of changing word durations over this time period shows substantial patterns of co-adaptation between word usage and word durations. Words that are increasing in frequency are becoming shorter. Words that are increasing/decreasing in informativity show a change in the same direction in duration (e.g. increasing informativity is associated with increasing duration). And words that are increasingly appearing utterance-finally are lengthening. These effects exist independently of the local effects of the predictors. For example, words that are increasing utterance-finally lengthen in all positions, including utterance-medially. We show that these results are compatible with a number of different views about lexical representations, but they cannot be explained without reference to a production-perception loop that allows speakers to update their representations dynamically on the basis of their experience. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

Face recognition system and method using face pattern words and face pattern bytes

Science.gov (United States)

Zheng, Yufeng

2014-12-23

The present invention provides a novel system and method for identifying individuals and for face recognition utilizing facial features for face identification. The system and method of the invention comprise creating facial features or face patterns called face pattern words and face pattern bytes for face identification. The invention also provides for pattern recognitions for identification other than face recognition. The invention further provides a means for identifying individuals based on visible and/or thermal images of those individuals by utilizing computer software implemented by instructions on a computer or computer system and a computer readable medium containing instructions on a computer system for face recognition and identification.

A WORD-OF-MOUSE APPROACH FOR WORD-OF-MOUTH MEASUREMENT

OpenAIRE

Andreia Gabriela ANDREI

2012-01-01

Despite of the fact that word-of-mouth phenomenon gained unseen dimensions, only few studies have focused on its measurement and only three of them developed a word-of-mouth construct. Our study develops a bi-dimensional scale which assigns usual word-of-mouth mechanisms available in online networking sites (eg: Recommend, Share, Like, Comment) into the WOM (+) - positive word-of-mouth valence dimension - respectively into the WOM (-) - negative word-of-mouth valence dimension. We adapted e-W...

An Empirical Study of AI Population Dynamics with Million-agent Reinforcement Learning

OpenAIRE

Yang, Yaodong; Yu, Lantao; Bai, Yiwei; Wang, Jun; Zhang, Weinan; Wen, Ying; Yu, Yong

2017-01-01

In this paper, we conduct an empirical study on discovering the ordered collective dynamics obtained by a population of artificial intelligence (AI) agents. Our intention is to put AI agents into a simulated natural context, and then to understand their induced dynamics at the population level. In particular, we aim to verify if the principles developed in the real world could also be used in understanding an artificially-created intelligent population. To achieve this, we simulate a large-sc...

Right word making sense of the words that confuse

CERN Document Server

Morrison, Elizabeth

2012-01-01

'Affect' or 'effect'? 'Right', 'write' or 'rite'? English can certainly be a confusing language, whether you're a native speaker or learning it as a second language. 'The Right Word' is the essential reference to help people master its subtleties and avoid making mistakes. Divided into three sections, it first examines homophones - those tricky words that sound the same but are spelled differently - then looks at words that often confuse before providing a list of commonly misspelled words.

Smashing WordPress Themes Making WordPress Beautiful

CERN Document Server

Hedengren, Thord Daniel

2011-01-01

The ultimate guide to WordPress Themes - one of the hottest topics on the web today WordPress is so much more than a blogging platform, and Smashing WordPress Themes teaches readers how to make it look any way they like - from a corporate site, to a photography gallery and moreWordPress is one of the hottest tools on the web today and is used by sites including The New York Times, Rolling Stone, flickr, CNN, NASA and of course Smashing MagazineBeautiful full colour throughout - web designers expect nothing lessSmashing Magazine will fully support this book by by promoting it through their webs

Monitoring Severe Accidents Using AI Techniques

International Nuclear Information System (INIS)

No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

2011-01-01

It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

Sub-word image clustering in Farsi printed books

Science.gov (United States)

Soheili, Mohammad Reza; Kabir, Ehsanollah; Stricker, Didier

2015-02-01

Most OCR systems are designed for the recognition of a single page. In case of unfamiliar font faces, low quality papers and degraded prints, the performance of these products drops sharply. However, an OCR system can use redundancy of word occurrences in large documents to improve recognition results. In this paper, we propose a sub-word image clustering method for the applications dealing with large printed documents. We assume that the whole document is printed by a unique unknown font with low quality print. Our proposed method finds clusters of equivalent sub-word images with an incremental algorithm. Due to the low print quality, we propose an image matching algorithm for measuring the distance between two sub-word images, based on Hamming distance and the ratio of the area to the perimeter of the connected components. We built a ground-truth dataset of more than 111000 sub-word images to evaluate our method. All of these images were extracted from an old Farsi book. We cluster all of these sub-words, including isolated letters and even punctuation marks. Then all centers of created clusters are labeled manually. We show that all sub-words of the book can be recognized with more than 99.7% accuracy by assigning the label of each cluster center to all of its members.

Integration of AI-2 Based Cell-Cell Signaling with Metabolic Cues in Escherichia coli.

Directory of Open Access Journals (Sweden)

Arindam Mitra

Full Text Available The quorum sensing molecule Autoinducer-2 (AI-2 is generated as a byproduct of activated methyl cycle by the action of LuxS in Escherichia coli. AI-2 is synthesized, released and later internalized in a cell-density dependent manner. Here, by mutational analysis of the genes, uvrY and csrA, we describe a regulatory circuit of accumulation and uptake of AI-2. We constructed a single-copy chromosomal luxS-lacZ fusion in a luxS + merodiploid strain and evaluated its relative expression in uvrY and csrA mutants. At the entry of stationary phase, the expression of the fusion and AI-2 accumulation was positively regulated by uvrY and negatively regulated by csrA respectively. A deletion of csrA altered message stability of the luxS transcript and CsrA protein exhibited weak binding to 5' luxS regulatory region. DNA protein interaction and chromatin immunoprecipitation analysis confirmed direct interaction of UvrY with the luxS promoter. Additionally, reduced expression of the fusion in hfq deletion mutant suggested involvement of small RNA interactions in luxS regulation. In contrast, the expression of lsrA operon involved in AI-2 uptake, is negatively regulated by uvrY and positively by csrA in a cell-density dependent manner. The dual role of csrA in AI-2 synthesis and uptake suggested a regulatory crosstalk of cell signaling with carbon regulation in Escherichia coli. We found that the cAMP-CRP mediated catabolite repression of luxS expression was uvrY dependent. This study suggests that luxS expression is complex and regulated at the level of transcription and translation. The multifactorial regulation supports the notion that cell-cell communication requires interaction and integration of multiple metabolic signals.

Words don't come easy

DEFF Research Database (Denmark)

Starrfelt, Randi

of reading, and with the use of functional imaging techniques. Extant evidence for (and against) cerebral specialization for visual word recognition is briefly reviewed and found inconclusive.                       Study I is a case study of a patient with a very selective alexia and agraphia affecting...... and object processing, may explain the pattern of activations found in our and other functional imaging studies of the visual word form area.                       Study III reports a patient (NN) with pure alexia. NN is not impaired in object recognition, but his deficit(s) affects processing speed...... reading and writing of letters and words but not numbers. This study raised questions of "where" in the cognitive system such a deficit may arise, and whether it can be attributed to a deficit in a system specialized for reading or letter knowledge. The following studies investigated these questions...

AI's Philosophical Underpinnings: A Thinking Person's Walk through the Twists and Turns of Artificial Intelligence's Meandering Path

Science.gov (United States)

Colombano, Silvano; Norvig, Peter (Technical Monitor)

2000-01-01

Few human endeavors can be viewed both as extremely successful and unsuccessful at the same time. This is typically the case when goals have not been well defined or have been shifting in time. This has certainly been true of Artificial Intelligence (AI). The nature of intelligence has been the object of much thought and speculation throughout the history of philosophy. It is in the nature of philosophy that real headway is sometimes made only when appropriate tools become available. Similarly the computer, coupled with the ability to program (at least in principle) any function, appeared to be the tool that could tackle the notion of intelligence. To suit the tool, the problem of the nature of intelligence was soon sidestepped in favor of this notion: If a probing conversation with a computer could not be distinguished from a conversation with a human, then AI had been achieved. This notion became known as the Turing test, after the mathematician Alan Turing who proposed it in 1950. Conceptually rich and interesting, these early efforts gave rise to a large portion of the field's framework. Key to AI, rather than the 'number crunching' typical of computers until then, was viewed as the ability to manipulate symbols and make logical inferences. To facilitate these tasks, AI languages such as LISP and Prolog were invented and used widely in the field. One idea that emerged and enabled some success with real world problems was the notion that 'most intelligence' really resided in knowledge. A phrase attributed to Feigenbaum, one of the pioneers, was 'knowledge is the power.' With this premise, the problem is shifted from 'how do we solve problems' to 'how do we represent knowledge.' A good knowledge representation scheme could allow one to draw conclusions from given premises. Such schemes took forms such as rules,frames and scripts. It allowed the building of what became known as expert systems or knowledge based systems (KBS).

Auditory word recognition is not more sensitive to word-initial than to word-final stimulus information

NARCIS (Netherlands)

Vlugt, van der M.J.; Nooteboom, S.G.

1986-01-01

Several accounts of human recognition of spoken words a.!!llign special importance to stimulus-word onsets. The experiment described here was d~igned to find out whether such a word-beginning superiority effect, which ill supported by experimental evidence of various kinds, is due to a special

Swapping the N- and C-terminal domains of human apolipoprotein E3 and AI reveals insights into their structure/activity relationship.

Directory of Open Access Journals (Sweden)

Mark T Lek

Full Text Available Apolipoprotein (apo E3 and apoAI are exchangeable apolipoproteins that play a dominant role in regulating plasma lipoprotein metabolism. ApoE3 (299 residues is composed of an N-terminal (NT domain bearing a 4-helix bundle and a C-terminal (CT domain bearing a series of amphipathic α-helices. ApoAI (243 residues also comprises a highly helical NT domain and a less structured CT tail. The objective of this study was to understand their structural and functional role by generating domain swapped chimeras: apoE3-NT/apoAI-CT and apoAI-NT/apoE-CT. The bacterially overexpressed chimeras were purified by affinity chromatography and their identity confirmed by immunoblotting and mass spectrometry. Their α-helical content was comparable to that of the parent proteins. ApoE3-NT/apoAI-CT retained the denaturation profile of apoE3 NT domain, with apoAI CT tail eliciting a relatively unstructured state; its lipid binding ability improved dramatically compared to apoE3 indicative of a significant role of apoAI CT tail in lipid binding interaction. The LDL receptor interaction and ability to promote ABCA1-mediated cholesterol efflux of apoE3-NT/apoAI-CT was comparable to that of apoE3. In contrast, apoAI-NT/apoE-CT elicited an unfolding pattern and lipid binding ability that were similar to that of apoAI. As expected, DMPC/apoAI-NT/apoE-CT discoidal particles did not elicit LDLr binding ability, and promoted SR-B1 mediated cellular uptake of lipids to a limited extent. However, apoAI-NT/apoE-CT displayed an enhanced ability to promote cholesterol efflux compared to apoAI, indicative of a significant role for apoE CT domain in mediating this function. Together, these results indicate that the functional attributes of apoAI and apoE3 can be conferred on each other and that NT-CT domain interactions significantly modulate their structure and function.

Microstructural studies of suck cast (Zr-SS)-3 and 5 AI alloys for nuclear metallic waste form

International Nuclear Information System (INIS)

Kumar, P.; Das, N.; Sengupta, P.; Arya, A.; Dey, G.K.

2015-01-01

Management of radioactive metallic waste using 'alloy melting route' is currently being investigated. For disposal of Zr and SS base nuclear metallic wastes, Zr-stainless steel (SS) hybrid alloys are being considered as baseline alloys for developing metallic-waste-form (MWF) alloys. In this context Zr-16 wt. %55 has been selected for MWF alloy in our previous study. In present study, to include amorphous phase in this alloy, 3 and 5 wt. % Al has been added in order to improve desirable properties and useful features of MWF and the two alloys have been prepared by suck casting techniques. Microstructure of these alloys have been investigated by optical and electron microscopy which shows occurrence of two different phases, e.g. dark grey and white phases, in (Zr-16 SS)-3 Al and three different phases, e.g. grey, dark grey and white phases in (Zr-16 SS)-5 AI. Electron diffraction and X-ray diffraction (XRD) analyses of these two alloy specimens revealed the occurrence of Zr (Fe, Cr, AI) (dark grey) and Zr 2 (Fe, Cr, AI) (white) phases in (Zr-16 SS)-3 Al whereas, Zr (Fe, Cr, AI) (dark grey), Zr 2 (Fe, Cr, AI) (grey) and Zr 3 (Fe, Cr, AI) (white) phases were found in (Zr-16 SS)-5 AI. In addition, presence of amorphous phase was indicated by XRD analysis that could be confirmed by transmission electron microscopy of these two alloys. (author)

Effects of providing word sounds during printed word learning

NARCIS (Netherlands)

Reitsma, P.; Dongen, van A.J.N.; Custers, E.

1984-01-01

The purpose of this study was to explore the effects of the availability of the spoken sound of words along with the printed forms during reading practice. Firstgrade children from two normal elementary schools practised reading several unfamiliar words in print. For half of the printed words the

LE CINÉMA FRANÇAIS EN ROUMANIE DANS L’ENTRE-DEUX-GUERRES

Directory of Open Access Journals (Sweden)

Georgiana MEDREA

2013-05-01

Full Text Available Avant même d’aborder la nature des films français importés en Roumanie dans l’entre-deux-guerres, il convient de situer cette production cinématographique dans l’ensemble de celles présentes sur le marché roumain, ce que permettent documents et articles critiques contemporains. La diversité des mises en scène et des acteurs, la variété des sujets traités plaisent à un large public. La plus grande place que connaît le cinéma français en Roumanie dans les années trente est sans doute due,également, à la présence, dans le monde cinématographique français, d’artistes roumains qui manifestent un souci d’intégration dans une culture d’accueil qu’ils admirent. Les exemplesde coopérations franco-roumaines sont nombreuses, jusqu’à se manifester parfois sous la forme de coproductions

Lack of genomic evidence of AI-2 receptors suggests a non-quorum sensing role for luxS in most bacteria.

Science.gov (United States)

Rezzonico, Fabio; Duffy, Brion

2008-09-20

Great excitement accompanied discoveries over the last decade in several Gram-negative and Gram-positive bacteria of the LuxS protein, which catalyzes production of the AI-2 autoinducer molecule for a second quorum sensing system (QS-2). Since the luxS gene was found to be widespread among the most diverse bacterial taxa, it was hypothesized that AI-2 may constitute the basis of a universal microbial language, a kind of bacterial Esperanto. Many of the studies published in this field have drawn a direct correlation between the occurrence of the luxS gene in a given organism and the presence and functionality of a QS-2 therein. However, rarely hathe existence of potential AI-2 receptors been examined. This is important, since it is now well recognized that LuxS also holds a central role as a metabolic enzyme in the activated methyl cycle which is responsible for the generation of S-adenosyl-L-methionine, the major methyl donor in the cell. In order to assess whether the role of LuxS in these bacteria is indeed related to AI-2 mediated quorum sensing we analyzed genomic databases searching for established AI-2 receptors (i.e., LuxPQ-receptor of Vibrio harveyi and Lsr ABC-transporter of Salmonella typhimurium) and other presumed QS-related proteins and compared the outcome with published results about the role of QS-2 in these organisms. An unequivocal AI-2 related behavior was restricted primarily to organisms bearing known AI-2 receptor genes, while phenotypes of luxS mutant bacteria lacking these genes could often be explained simply by assuming deficiencies in sulfur metabolism. Genomic analysis shows that while LuxPQ is restricted to Vibrionales, the Lsr-receptor complex is mainly present in pathogenic bacteria associated with endotherms. This suggests that QS-2 may play an important role in interactions with animal hosts. In most other species, however, the role of LuxS appears to be limited to metabolism, although in a few cases the presence of yet unknown

Lack of genomic evidence of AI-2 receptors suggests a non-quorum sensing role for luxS in most bacteria

Directory of Open Access Journals (Sweden)

Duffy Brion

2008-09-01

Full Text Available Abstract Background Great excitement accompanied discoveries over the last decade in several Gram-negative and Gram-positive bacteria of the LuxS protein, which catalyzes production of the AI-2 autoinducer molecule for a second quorum sensing system (QS-2. Since the luxS gene was found to be widespread among the most diverse bacterial taxa, it was hypothesized that AI-2 may constitute the basis of a universal microbial language, a kind of bacterial Esperanto. Many of the studies published in this field have drawn a direct correlation between the occurrence of the luxS gene in a given organism and the presence and functionality of a QS-2 therein. However, rarely hathe existence of potential AI-2 receptors been examined. This is important, since it is now well recognized that LuxS also holds a central role as a metabolic enzyme in the activated methyl cycle which is responsible for the generation of S-adenosyl-L-methionine, the major methyl donor in the cell. Results In order to assess whether the role of LuxS in these bacteria is indeed related to AI-2 mediated quorum sensing we analyzed genomic databases searching for established AI-2 receptors (i.e., LuxPQ-receptor of Vibrio harveyi and Lsr ABC-transporter of Salmonella typhimurium and other presumed QS-related proteins and compared the outcome with published results about the role of QS-2 in these organisms. An unequivocal AI-2 related behavior was restricted primarily to organisms bearing known AI-2 receptor genes, while phenotypes of luxS mutant bacteria lacking these genes could often be explained simply by assuming deficiencies in sulfur metabolism. Conclusion Genomic analysis shows that while LuxPQ is restricted to Vibrionales, the Lsr-receptor complex is mainly present in pathogenic bacteria associated with endotherms. This suggests that QS-2 may play an important role in interactions with animal hosts. In most other species, however, the role of LuxS appears to be limited to metabolism

AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp.

Science.gov (United States)

Moslehi-Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

2009-11-15

Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2-like molecule was investigated in four strains of Lactobacillus spp. at standard growth conditions using Vibrio harveyi bioluminescence assay. Species variation in AI-2 activity was observed. AI-2 activity started at early-exponential growth phase and increased during the mid-exponential phase concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic shocks (pH 5.0, 4.0 and 3.0) and to pH 6.5 as control, measuring AI-2 activity and transcription of the luxS gene. AI-2 activity increased by lowering the pH in a dose dependent manner and was negatively influenced by acid adaptation. In both species, the luxS gene was repressed after exposure to pH 6.5 as control. However, after acidic shock (pH 4.0) a transient response of luxS gene was observed and the transcription augmented over time, reaching a maximum level and decreased subsequently. Acid adaptation of cells attenuated the transcription of this gene. Based on the observations done in the present study, the luxS gene appears to have a clear role in acidic stress response in probiotic lactobacilli. This might be important in the survival of these bacteria during the passage

Word-level recognition of multifont Arabic text using a feature vector matching approach

Science.gov (United States)

Erlandson, Erik J.; Trenkle, John M.; Vogt, Robert C., III

1996-03-01

Many text recognition systems recognize text imagery at the character level and assemble words from the recognized characters. An alternative approach is to recognize text imagery at the word level, without analyzing individual characters. This approach avoids the problem of individual character segmentation, and can overcome local errors in character recognition. A word-level recognition system for machine-printed Arabic text has been implemented. Arabic is a script language, and is therefore difficult to segment at the character level. Character segmentation has been avoided by recognizing text imagery of complete words. The Arabic recognition system computes a vector of image-morphological features on a query word image. This vector is matched against a precomputed database of vectors from a lexicon of Arabic words. Vectors from the database with the highest match score are returned as hypotheses for the unknown image. Several feature vectors may be stored for each word in the database. Database feature vectors generated using multiple fonts and noise models allow the system to be tuned to its input stream. Used in conjunction with database pruning techniques, this Arabic recognition system has obtained promising word recognition rates on low-quality multifont text imagery.

Infants Track Word Forms in Early Word-Object Associations

Science.gov (United States)

Zamuner, Tania S.; Fais, Laurel; Werker, Janet F.

2014-01-01

A central component of language development is word learning. One characterization of this process is that language learners discover objects and then look for word forms to associate with these objects (Mcnamara, 1984; Smith, 2000). Another possibility is that word forms themselves are also important, such that once learned, hearing a familiar…

Development of lexical-semantic language system: N400 priming effect for spoken words in 18- and 24-month old children.

Science.gov (United States)

Rämä, Pia; Sirri, Louah; Serres, Josette

2013-04-01

Our aim was to investigate whether developing language system, as measured by a priming task for spoken words, is organized by semantic categories. Event-related potentials (ERPs) were recorded during a priming task for spoken words in 18- and 24-month-old monolingual French learning children. Spoken word pairs were either semantically related (e.g., train-bike) or unrelated (e.g., chicken-bike). The results showed that the N400-like priming effect occurred in 24-month-olds over the right parietal-occipital recording sites. In 18-month-olds the effect was observed similarly to 24-month-olds only in those children with higher word production ability. The results suggest that words are categorically organized in the mental lexicon of children at the age of 2 years and even earlier in children with a high vocabulary. Copyright © 2013 Elsevier Inc. All rights reserved.

Grammaire progressive du français corrigés : niveau intermédiaire

CERN Document Server

Thiévenaz, Odile

2017-01-01

Quatrième édition des corrigés de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de grammaire: Une organisation claire : la leçon de grammaire sur la page de gauche, les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues Un apprentissage progressif : il suit la progression naturelle des méthodes de français Un usage souple : pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens NOUVEAU!​ Appli-Web de la Grammaire progressive du français Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales: près de 300 exercices interactifs avec dialogues, instructions, exemples et corri...

Fragments of a Forgotten Aiōn. An Outline of a Gnostic Myth

Directory of Open Access Journals (Sweden)

Ezio Albrile

2005-07-01

Full Text Available Gnostics regard the cosmos as the result of an «error» or of a hybris begotten in the transcendent world. Reality is perceived as a great dream intentionally moulded by the Demiurge in order to forget the Light concealed in the creations. By consequence, the power of the Demiurge consists precisely in being the creator and keeper of a level of existence limited in space and time. Gnostic imagination plastically depicts the homicide and ignorant Demiurge with the features of an abnormous creature with the head of a lion and wings, enveloped in the coils of a snake. Thus, Gnostics reinterpreted a key figure in the syncretic pantheon of late Hellenism, i. e. Aiōn, the god of endless eternity, the Saeculum, the Iranic  Zurwān, the Jewish ‘Olām. This means that Aiōn involved contacts with two different visions: the Aiōnes are the creations that populate the gnostic plērōma, immortal and eternal entities, and outside the plērōma the demiurgic Aiōn arises as the result of a divine «fault», a monstrous being whose somatic features can be found in the Orphic and Mithriac iconography.

Exploring AI Language Assistants with Primary EFL Students

Science.gov (United States)

Underwood, Joshua

2017-01-01

The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

Word segmentation by alternating colors facilitates eye guidance in Chinese reading.

Science.gov (United States)

Zhou, Wei; Wang, Aiping; Shu, Hua; Kliegl, Reinhold; Yan, Ming

2018-02-12

During sentence reading, low spatial frequency information afforded by spaces between words is the primary factor for eye guidance in spaced writing systems, whereas saccade generation for unspaced writing systems is less clear and under debate. In the present study, we investigated whether word-boundary information, provided by alternating colors (consistent or inconsistent with word-boundary information) influences saccade-target selection in Chinese. In Experiment 1, as compared to a baseline (i.e., uniform color) condition, word segmentation with alternating color shifted fixation location towards the center of words. In contrast, incorrect word segmentation shifted fixation location towards the beginning of words. In Experiment 2, we used a gaze-contingent paradigm to restrict the color manipulation only to the upcoming parafoveal words and replicated the results, including fixation location effects, as observed in Experiment 1. These results indicate that Chinese readers are capable of making use of parafoveal word-boundary knowledge for saccade generation, even if such information is unfamiliar to them. The present study provides novel support for the hypothesis that word segmentation is involved in the decision about where to fixate next during Chinese reading.

The new fluorescence enhancement system Eu3+-ARADE-HMTM-AI3+ and its analytical application

International Nuclear Information System (INIS)

Wenwu Quin; Weisheng Liu; Tianlin Yang

2004-01-01

A new bis-Schiff base ligand, N,N -bis-(4-N-aminothiourea-2-amylidene)-4,4 -diaminodiphenyl ether (ARADE), was synthesized. Its complex with Eu 3+ in DMF emits the intrinsic fluorescence of Eu 3+ . The fluorescence intensity of the Eu 3+ -ARADE system was enhanced about 60-fold by the addition of hexamethylene tetramine (NMTM) and potash alum. This is a new fluorescence enhancement phenomenon. The excitation and emission wavelengths are 375 nm and 615 nm, respectively. Under optimal conditions, the fluorescence intensities vary linearly with the concentration of Eu 3+ in the range of 7.8x10 -9 -1.75x10 -5 mol L -1 with a detection limit of 5.2x10 -9 mol L -1 , or with the concentration of Al 3+ in the range of 3.1x10 -7 -9.7x10 -5 mol-L -1 with a detection limit of 2.7x10 -7 mol L -1 . The interferences of some rare earth metals and other inorganic ions were described. This method was applied to the determination of Eu 3+ in high purity yttrium oxide and the analysis of AI 3+ in alloy steel standard samples. The mechanism of fluorescence enhancement was also studied. (author)

Positive words or negative words: whose valence strength are we more sensitive to?

Science.gov (United States)

Yang, Jiemin; Zeng, Jing; Meng, Xianxin; Zhu, Liping; Yuan, Jiajin; Li, Hong; Yusoff, Nasir

2013-10-02

The present study investigates the human brains' sensitivity to the valence strength of emotionally positive and negative chinese words. Event-Related Potentials were recorded, in two different experimental sessions, for Highly Positive (HP), Mildly Positive (MP) and neutral (NP) words and for Highly Negative (HN), Mildly Negative (MN) and neutral (NN) words, while subjects were required to count the number of words, irrespective of word meanings. The results showed a significant emotion effect in brain potentials for both HP and MP words, and the emotion effect occurred faster for HP words than MP words: HP words elicited more negative deflections than NP words in N2 (250-350 ms) and P3 (350-500 ms) amplitudes, while MP words elicited a significant emotion effect in P3, but not in N2, amplitudes. By contrast, HN words elicited larger amplitudes than NN words in N2 but not in P3 amplitudes, whereas MN words produced no significant emotion effect across N2 and P3 components. Moreover, the size of emotion-neutral differences in P3 amplitudes was significantly larger for MP compared to MN words. Thus, the human brain is reactive to both highly and mildly positive words, and this reactivity increased with the positive valence strength of the words. Conversely, the brain is less reactive to the valence of negative relative to positive words. These results suggest that human brains are equipped with increased sensitivity to the valence strength of positive compared to negative words, a type of emotional stimuli that are well known for reduced arousal. © 2013 Elsevier B.V. All rights reserved.

Competition between multiple words for a referent in cross-situational word learning

Science.gov (United States)

Benitez, Viridiana L.; Yurovsky, Daniel; Smith, Linda B.

2016-01-01

Three experiments investigated competition between word-object pairings in a cross-situational word-learning paradigm. Adults were presented with One-Word pairings, where a single word labeled a single object, and Two-Word pairings, where two words labeled a single object. In addition to measuring learning of these two pairing types, we measured competition between words that refer to the same object. When the word-object co-occurrences were presented intermixed in training (Experiment 1), we found evidence for direct competition between words that label the same referent. Separating the two words for an object in time eliminated any evidence for this competition (Experiment 2). Experiment 3 demonstrated that adding a linguistic cue to the second label for a referent led to different competition effects between adults who self-reported different language learning histories, suggesting both distinctiveness and language learning history affect competition. Finally, in all experiments, competition effects were unrelated to participants’ explicit judgments of learning, suggesting that competition reflects the operating characteristics of implicit learning processes. Together, these results demonstrate that the role of competition between overlapping associations in statistical word-referent learning depends on time, the distinctiveness of word-object pairings, and language learning history. PMID:27087742

Sistema de monitoreo de embarcaciones de pesca artesanal de Anconcito, provincia de Santa Elena, Ecuador, utilizando tecnología AIS - Automatic Identification System

Directory of Open Access Journals (Sweden)

Ashley Avilés Bastidas

2017-06-01

Full Text Available Ante la evidente crisis que se está presentando en Ecuador debido al incremento en los índices de robos en altamar, principalmente de los motores fuera de borda de las lanchas de pesca artesanal, es necesario implementar un sistema de control eficaz que ofrezca seguridad para la comunidad pesquera; con este fin se propone un sistema de detección de embarcaciones de pesca artesanal con tecnología AIS. En este estudio se explican todos los beneficios que ofrece esta tecnología que actualmente se usa para el monitoreo de buques, así como las aplicaciones para un sistema de monitoreo de embarcaciones pequeñas, las clases de equipos disponibles y sus principales características. Con este objetivo se propone el diseño de una red que permita ubicar las embarcaciones de la comunidad pesquera de Anconcito, que es una de las zonas más afectadas por la delincuencia. Además, se anticipan los resultados esperados con este diseño y varias alternativas técnicas para mejorar la cobertura del sistema. Abstract Given the evident crisis that is occurring in Ecuador due to the increase in the rates of robberies on the high seas, mainly of the outboard motorboats of the artisanal fishing boats, it is necessary to implement an effective control system that provides security for the fishing community. To this end, a system of detection of artisanal fishing vessels with AIS technology is proposed. In this study, all the benefits of this technology are explained which is currently used for monitoring ships, as well as the applications for a monitoring system of small boats, the kinds of equipment available and their main characteristics. With this objective, the design of a network that allows locate the vessels of the fishing community of Anconcito, which is one of the areas most affected by crime, is proposed. In addition, the expected results with this design and several technical alternatives to improve the coverage of the system are anticipated.

Defining a Conceptual Topography of Word Concreteness: Clustering Properties of Emotion, Sensation, and Magnitude among 750 English Words

Directory of Open Access Journals (Sweden)

Joshua Troche

2017-10-01

Full Text Available Cognitive science has a longstanding interest in the ways that people acquire and use abstract vs. concrete words (e.g., truth vs. piano. One dominant theory holds that abstract and concrete words are subserved by two parallel semantic systems. We recently proposed an alternative account of abstract-concrete word representation premised upon a unitary, high dimensional semantic space wherein word meaning is nested. We hypothesize that a range of cognitive and perceptual dimensions (e.g., emotion, time, space, color, size, visual form bound this space, forming a conceptual topography. Here we report a normative study where we examined the clustering properties of a sample of English words (N = 750 spanning a spectrum of concreteness in a continuous manner from highly abstract to highly concrete. Participants (N = 328 rated each target word on a range of 14 cognitive dimensions (e.g., color, emotion, valence, polarity, motion, space. The dimensions reduced to three factors: Endogenous factor, Exogenous factor, and Magnitude factor. Concepts were plotted in a unified, multimodal space with concrete and abstract concepts along a continuous continuum. We discuss theoretical implications and practical applications of this dataset. These word norms are freely available for download and use at http://www.reilly-coglab.com/data/.

Defining a Conceptual Topography of Word Concreteness: Clustering Properties of Emotion, Sensation, and Magnitude among 750 English Words.

Science.gov (United States)

Troche, Joshua; Crutch, Sebastian J; Reilly, Jamie

2017-01-01

Cognitive science has a longstanding interest in the ways that people acquire and use abstract vs. concrete words (e.g., truth vs. piano). One dominant theory holds that abstract and concrete words are subserved by two parallel semantic systems. We recently proposed an alternative account of abstract-concrete word representation premised upon a unitary, high dimensional semantic space wherein word meaning is nested. We hypothesize that a range of cognitive and perceptual dimensions (e.g., emotion, time, space, color, size, visual form) bound this space, forming a conceptual topography. Here we report a normative study where we examined the clustering properties of a sample of English words ( N = 750) spanning a spectrum of concreteness in a continuous manner from highly abstract to highly concrete. Participants ( N = 328) rated each target word on a range of 14 cognitive dimensions (e.g., color, emotion, valence, polarity, motion, space). The dimensions reduced to three factors: Endogenous factor, Exogenous factor, and Magnitude factor. Concepts were plotted in a unified, multimodal space with concrete and abstract concepts along a continuous continuum. We discuss theoretical implications and practical applications of this dataset. These word norms are freely available for download and use at http://www.reilly-coglab.com/data/.

Word Similarity from Dictionaries: Inferring Fuzzy Measures from Fuzzy Graphs

Directory of Open Access Journals (Sweden)

Vicenc Torra

2008-01-01

Full Text Available WORD SIMILARITY FROM DICTIONARIES: INFERRING FUZZY MEASURES FROM FUZZY GRAPHS The computation of similarities between words is a basic element of information retrieval systems, when retrieval is not solely based on word matching. In this work we consider a measure between words based on dictionaries. This is achieved assuming that a dictionary is formalized as a fuzzy graph. We show that the approach permits to compute measures not only for pairs of words but for sets of them.

PERFORMATIVITAS DALAM MANGA SHONEN-AI: SEKAIICHI HATSUKOI, HENSHIN DEKINAI DAN HIMANANODE HAJIMETE MIMASHITA

OpenAIRE

Savitri Paramita, Ni Made

2014-01-01

This research underlies the analysis on the performance and performativity of characters in shonen-ai: Sekaiichi Hatsukoi, Henshin Dekinai, and Himananode Hajimete Mimashita manga. Characterization in shonen-ai manga is based on the characters’ role within the same-sex relationship, which are the male role (seme) and the female role (uke). The character of Seme tends to be aggressive, protective, smart, good looking, and unemotional. On the other hand, Uke is feminine, smaller, physically wea...

Intransparent German number words complicate transcoding - a translingual comparison with Japanese.

Science.gov (United States)

Moeller, Korbinian; Zuber, Julia; Olsen, Naoko; Nuerk, Hans-Christoph; Willmes, Klaus

2015-01-01

Superior early numerical competencies of children in several Asian countries have (amongst others) been attributed to the higher transparency of their number word systems. Here, we directly investigated this claim by evaluating whether Japanese children's transcoding performance when writing numbers to dictation (e.g., "twenty five" → 25) was less error prone than that of German-speaking children - both in general as well as when considering language-specific attributes of the German number word system such as the inversion property, in particular. In line with this hypothesis we observed that German-speaking children committed more transcoding errors in general than their Japanese peers. Moreover, their error pattern reflected the specific inversion intransparency of the German number-word system. Inversion errors in transcoding represented the most prominent error category in German-speaking children, but were almost absent in Japanese-speaking children. We conclude that the less transparent German number-word system complicates the acquisition of the correspondence between symbolic Arabic numbers and their respective verbal number words.

Computing with Words Principal Concepts and Ideas

CERN Document Server

Zadeh, Lotfi A

2012-01-01

In essence, Computing with Words (CWW) is a system of computation in which the objects of computation are predominantly words, phrases and propositions drawn from a natural language. CWW is based on fuzzy logic. In science there is a deep-seated tradition of according much more respect to numbers than to words. In a fundamental way, CWW is a challenge to this tradition. What is not widely recognized is that, today, words are used in place of numbers in a wide variety of applications ranging from digital cameras and household appliances to fraud detection systems, biomedical instrumentation and subway trains.  CWW offers a unique capability—the capability to precisiate natural language. Unprecisiated (raw) natural language cannot be computed with. A key concept which underlies precisiation of meaning is that of the meaning postulate: A proposition, p, is a restriction on the values which a variable, X—a variable which is implicit in p—is allowed to take. CWW has an important ramification for mathema...

BioWord: A sequence manipulation suite for Microsoft Word

Directory of Open Access Journals (Sweden)

Anzaldi Laura J

2012-06-01

Full Text Available Abstract Background The ability to manipulate, edit and process DNA and protein sequences has rapidly become a necessary skill for practicing biologists across a wide swath of disciplines. In spite of this, most everyday sequence manipulation tools are distributed across several programs and web servers, sometimes requiring installation and typically involving frequent switching between applications. To address this problem, here we have developed BioWord, a macro-enabled self-installing template for Microsoft Word documents that integrates an extensive suite of DNA and protein sequence manipulation tools. Results BioWord is distributed as a single macro-enabled template that self-installs with a single click. After installation, BioWord will open as a tab in the Office ribbon. Biologists can then easily manipulate DNA and protein sequences using a familiar interface and minimize the need to switch between applications. Beyond simple sequence manipulation, BioWord integrates functionality ranging from dyad search and consensus logos to motif discovery and pair-wise alignment. Written in Visual Basic for Applications (VBA as an open source, object-oriented project, BioWord allows users with varying programming experience to expand and customize the program to better meet their own needs. Conclusions BioWord integrates a powerful set of tools for biological sequence manipulation within a handy, user-friendly tab in a widely used word processing software package. The use of a simple scripting language and an object-oriented scheme facilitates customization by users and provides a very accessible educational platform for introducing students to basic bioinformatics algorithms.

BioWord: A sequence manipulation suite for Microsoft Word

Science.gov (United States)

2012-01-01

Background The ability to manipulate, edit and process DNA and protein sequences has rapidly become a necessary skill for practicing biologists across a wide swath of disciplines. In spite of this, most everyday sequence manipulation tools are distributed across several programs and web servers, sometimes requiring installation and typically involving frequent switching between applications. To address this problem, here we have developed BioWord, a macro-enabled self-installing template for Microsoft Word documents that integrates an extensive suite of DNA and protein sequence manipulation tools. Results BioWord is distributed as a single macro-enabled template that self-installs with a single click. After installation, BioWord will open as a tab in the Office ribbon. Biologists can then easily manipulate DNA and protein sequences using a familiar interface and minimize the need to switch between applications. Beyond simple sequence manipulation, BioWord integrates functionality ranging from dyad search and consensus logos to motif discovery and pair-wise alignment. Written in Visual Basic for Applications (VBA) as an open source, object-oriented project, BioWord allows users with varying programming experience to expand and customize the program to better meet their own needs. Conclusions BioWord integrates a powerful set of tools for biological sequence manipulation within a handy, user-friendly tab in a widely used word processing software package. The use of a simple scripting language and an object-oriented scheme facilitates customization by users and provides a very accessible educational platform for introducing students to basic bioinformatics algorithms. PMID:22676326

BioWord: a sequence manipulation suite for Microsoft Word.

Science.gov (United States)

Anzaldi, Laura J; Muñoz-Fernández, Daniel; Erill, Ivan

2012-06-07

The ability to manipulate, edit and process DNA and protein sequences has rapidly become a necessary skill for practicing biologists across a wide swath of disciplines. In spite of this, most everyday sequence manipulation tools are distributed across several programs and web servers, sometimes requiring installation and typically involving frequent switching between applications. To address this problem, here we have developed BioWord, a macro-enabled self-installing template for Microsoft Word documents that integrates an extensive suite of DNA and protein sequence manipulation tools. BioWord is distributed as a single macro-enabled template that self-installs with a single click. After installation, BioWord will open as a tab in the Office ribbon. Biologists can then easily manipulate DNA and protein sequences using a familiar interface and minimize the need to switch between applications. Beyond simple sequence manipulation, BioWord integrates functionality ranging from dyad search and consensus logos to motif discovery and pair-wise alignment. Written in Visual Basic for Applications (VBA) as an open source, object-oriented project, BioWord allows users with varying programming experience to expand and customize the program to better meet their own needs. BioWord integrates a powerful set of tools for biological sequence manipulation within a handy, user-friendly tab in a widely used word processing software package. The use of a simple scripting language and an object-oriented scheme facilitates customization by users and provides a very accessible educational platform for introducing students to basic bioinformatics algorithms.

Eye movements and word skipping during reading: Effects of word length and predictability

Science.gov (United States)

Rayner, Keith; Slattery, Timothy J.; Drieghe, Denis; Liversedge, Simon P.

2012-01-01

The extent to which target words were predictable from prior context was varied: half of the target words were predictable and the other half were unpredictable. In addition, the length of the target word varied: the target words were short (4–6 letters), medium (7–9 letters), or long (10–12 letters). Length and predictability both yielded strong effects on the probability of skipping the target words and on the amount of time readers fixated the target words (when they were not skipped). However, there was no interaction in any of the measures examined for either skipping or fixation time. The results demonstrate that word predictability (due to contextual constraint) and word length have strong and independent influences on word skipping and fixation durations. Furthermore, since the long words extended beyond the word identification span, the data indicate that skipping can occur on the basis of partial information in relation to word identity. PMID:21463086

Word Pocket Guide

CERN Document Server

Glenn, Walter

2004-01-01

Millions of people use Microsoft Word every day and, chances are, you're one of them. Like most Word users, you've attained a certain level of proficiency--enough to get by, with a few extra tricks and tips--but don't get the opportunity to probe much further into the real power of Word. And Word is so rich in features that regardless of your level of expertise, there's always more to master. If you've ever wanted a quick answer to a nagging question or had the thought that there must be a better way, then this second edition of Word Pocket Guide is just what you need. Updated for Word 2003

Thiophenone Attenuates Enteropathogenic Escherichia coli O103:H2 Virulence by Interfering with AI-2 Signaling.

Science.gov (United States)

Witsø, Ingun Lund; Valen Rukke, Håkon; Benneche, Tore; Aamdal Scheie, Anne

2016-01-01

Interference with bacterial quorum sensing communication provides an anti-virulence strategy to control pathogenic bacteria. Here, using the Enteropathogenic E. coli (EPEC) O103:H2, we showed for the first time that thiophenone TF101 reduced expression of lsrB; the gene encoding the AI-2 receptor. Combined results of transcriptional and phenotypic analyses suggested that TF101 interfere with AI-2 signalling, possibly by competing with AI-2 for binding to LsrB. This is supported by in silico docking prediction of thiophenone TF101 in the LsrB pocket. Transcriptional analyses furthermore showed that thiophenone TF101 interfered with expression of the virulence genes eae and fimH. In addition, TF101 reduced AI-2 induced E. coli adhesion to colorectal adenocarcinoma cells. TF101, on the other hand, did not affect epinephrine or norepinephrine enhanced E. coli adhesion. Overall, our results showed that thiophenone TF101 interfered with virulence expression in E. coli O103:H2, suggestedly by interfering with AI-2 mediated quorum sensing. We thus conclude that thiophenone TF101 might represent a promising future anti-virulence agent in the fight against pathogenic E. coli.

Does "a picture is worth 1000 words" apply to iconic Chinese words? Relationship of Chinese words and pictures.

Science.gov (United States)

Lo, Shih-Yu; Yeh, Su-Ling

2018-05-29

The meaning of a picture can be extracted rapidly, but the form-to-meaning relationship is less obvious for printed words. In contrast to English words that follow grapheme-to-phoneme correspondence rule, the iconic nature of Chinese words might predispose them to activate their semantic representations more directly from their orthographies. By using the paradigm of repetition blindness (RB) that taps into the early level of word processing, we examined whether Chinese words activate their semantic representations as directly as pictures do. RB refers to the failure to detect the second occurrence of an item when it is presented twice in temporal proximity. Previous studies showed RB for semantically related pictures, suggesting that pictures activate their semantic representations directly from their shapes and thus two semantically related pictures are represented as repeated. However, this does not apply to English words since no RB was found for English synonyms. In this study, we replicated the semantic RB effect for pictures, and further showed the absence of semantic RB for Chinese synonyms. Based on our findings, it is suggested that Chinese words are processed like English words, which do not activate their semantic representations as directly as pictures do.

WordPress Bible

CERN Document Server

Brazell, Aaron

2010-01-01

The WordPress Bible provides a complete and thorough guide to the largest self hosted blogging tool. This guide starts by covering the basics of WordPress such as installing and the principles of blogging, marketing and social media interaction, but then quickly ramps the reader up to more intermediate to advanced level topics such as plugins, WordPress Loop, themes and templates, custom fields, caching, security and more. The WordPress Bible is the only complete resource one needs to learning WordPress from beginning to end.

Usability of EFBs for Viewing NOTAMs and AIS/MET Data Link Messages

Science.gov (United States)

Evans, Emory T.; Young, Steven D.; Daniels, Tammi S.; Myer, Robert R.

2014-01-01

Electronic Flight Bags (EFB) are increasingly integral to flight deck information management. A piloted simulation study was conducted at NASA Langley Research Center, one aspect of which was to evaluate the usability and acceptability of EFBs for viewing and managing Notices to Airmen (NOTAMs) and data linked aeronautical information services (AIS) and meteorological information (MET). The study simulated approaches and landings at Memphis International Airport (KMEM) using various flight scenarios and weather conditions. Ten two-pilot commercial airline crews participated, utilizing the Cockpit Motion Facility's Research Flight Deck (CMF/RFD) simulator. Each crew completed approximately two dozen flights over a two day period. Two EFBs were installed, one for each pilot. Study data were collected in the form of questionnaire/interview responses, audio/video recordings, oculometer recordings, and aircraft/system state data. Preliminary usability results are reported primarily based on pilot interviews and responses to questions focused on ease of learning, ease of use, usefulness, satisfaction, and acceptability. Analysis of the data from the other objective measures (e.g., oculometer) is ongoing and will be reported in a future publication. This paper covers how the EFB functionality was set up for the study; the NOTAM, AIS/MET data link, and weather messages that were presented; questionnaire results; selected pilot observations; and conclusions.

Açai Palm Fruit (Euterpe oleracea Mart.) Pulp Improves Survival of Flies on a High Fat Diet

OpenAIRE

Sun, Xiaoping; Seeberger, Jeanne; Alberico, Thomas; Wang, Chunxu; Wheeler, Charles T.; Schauss, Alexander G.; Zou, Sige

2010-01-01

Reducing oxidative damage is thought to be an effective aging intervention. Açai, a fruit indigenous to the Amazon, is rich in phytochemicals that possesses high anti-oxidant activities, and has anti-inflammatory, anti-cancer and anti-cardiovascular disease properties. However, little is known about its potential anti-aging properties especially at the organismal level. Here we evaluated the effect of açai pulp on modulating lifespan in Drosophila melanogaster. We found that açai supplementat...

Word Similarity From Dictionaries: Inferring Fuzzy Measures From Fuzzy Graphs

Directory of Open Access Journals (Sweden)

Torra

2008-01-01

Full Text Available The computation of similarities between words is a basic element of information retrieval systems, when retrieval is not solely based on word matching. In this work we consider a measure between words based on dictionaries. This is achieved assuming that a dictionary is formalized as a fuzzy graph. We show that the approach permits to compute measures not only for pairs of words but for sets of them.

Molecular characterization of AI viruses from poultry and wild bird surveillance in Denmark

DEFF Research Database (Denmark)

Larsen, Lars Erik; Krog, Jesper Schak; Madsen, Jesper J.

Infection with avian influenza virus (AIV) in poultry may cause devastating disease although the same virus may not cause disease in wild birds. Since AI viruses can be exchanged between poultry and wild birds, surveillance in wild birds provides important knowledge for control of disease...... in poultry. AIV’s from the Danish wild bird active surveillance were characterized, focusing on viruses from 2012, and from outbreaks of AI in poultry in Denmark. The matrix (M) gene from more than 50 viruses of different subtypes and the hemagglutinin (HA) gene from more than 30 subtype H5 low pathogenic...... viruses were sequenced and compared by alignment and phylogenetic analyses. The aim was to evaluate: the origin of viruses from outbreaks of AI in Danish poultry, the design of active surveillance in Denmark, and the suitability of the molecular diagnostic RT-PCR tests employed. All M-genes from Danish...

[Application prospect of human-artificial intelligence system in future manned space flight].

Science.gov (United States)

Wei, Jin-he

2003-01-01

To make the manned space flight more efficient and safer, a concept of human-artificial (AI) system is proposed in the present paper. The task of future manned space flight and the technique requirement with respect to the human-AI system development were analyzed. The main points are as follows: 1)Astronaut and AI are complementary to each other functionally; 2) Both symbol AI and connectionist AI should be included in the human-AI system, but expert system and Soar-like system are used mainly inside the cabin, the COG-like robots are mainly assigned for EVA either in LEO flight or on the surface of Moon or Mars; 3) The human-AI system is hierarchical in nature with astronaut at the top level; 4) The complex interfaces between astronaut and AI are the key points for running the system reliably and efficiently. As the importance of human-AI system in future manned space flight and the complexity of related technology, it is suggested that the R/D should be planned as early as possible.

De l’harmonie dans la construction des mots français

Directory of Open Access Journals (Sweden)

Roché Michel

2016-01-01

Full Text Available La formation des gentilés, particulièrement sensible aux contraintes d’euphonie, permet de mettre en évidence, pour le français, deux manifestations complémentaires de la contrainte dissimilative. L’une, négative, tend à éviter la consécution à faible distance du même phonème ou de deux phonèmes proches. Elle explique la sous-représentation des deux principaux suffixes, -ais et -ois, après une accroche en sifflante, à cause de la sifflante conte-nue par le suffixe au féminin, ainsi que la sous-représentation de -ais après /E/ et de -ois après /A/. L’autre, positive, favorise entre les voyelles une harmonie fondée sur les contrastes. De-vant les suffixes dont la voyelle est une voyelle d’avant moyenne ou haute (-ais, -ain, -in, -ier…, sont privilégiés les radicaux dont la dernière voyelle est une voyelle d’arrière moyenne ou basse, et de préférence un /O/ plutôt qu’un /A/. Devant les suffixes dont la voyelle est une voyelles d’arrière moyenne ou basse (-ois, -ot, -on, -and, -at, -ard…, sont privilégiés les radi-caux dont la dernière voyelle est une voyelle d’avant moyenne ou haute, et de préférence un /i/ plutôt qu’un /E/. Pour cela, un yod au contact du suffixe joue le même rôle qu’un /i/ dans la syllabe précédente. Cette harmonie est obtenue soit par la sélection du suffixe, soit par un aménagement – substitution, épenthèse, troncation, insertion d’un interfixe, etc. – du radical fourni par la base. On observe d’autre part une harmonisation de l’accroche consonantique du radical avec la voyelle du suffixe. Devant -ois, sont privilégiées les attaques en labiale ou en vélaire, en accord avec le double caractère du /w/ propre à ce suffixe. Devant -ais et -ain, ce sont les attaques en dentale. Devant -ot, -on, -and, -at, -ard, la tendance à rapprocher l’articu-lation de la consonne de celle de la voyelle peut aller jusqu’aux vélaires mais elle s’arrête sou

Sensor assignment to mission in AI-TECD

Science.gov (United States)

Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan

2016-05-01

Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

On avoided words, absent words, and their application to biological sequence analysis.

Science.gov (United States)

Almirantis, Yannis; Charalampopoulos, Panagiotis; Gao, Jia; Iliopoulos, Costas S; Mohamed, Manal; Pissis, Solon P; Polychronopoulos, Dimitris

2017-01-01

The deviation of the observed frequency of a word w from its expected frequency in a given sequence x is used to determine whether or not the word is avoided . This concept is particularly useful in DNA linguistic analysis. The value of the deviation of w , denoted by [Formula: see text], effectively characterises the extent of a word by its edge contrast in the context in which it occurs. A word w of length [Formula: see text] is a [Formula: see text]-avoided word in x if [Formula: see text], for a given threshold [Formula: see text]. Notice that such a word may be completely absent from x . Hence, computing all such words naïvely can be a very time-consuming procedure, in particular for large k . In this article, we propose an [Formula: see text]-time and [Formula: see text]-space algorithm to compute all [Formula: see text]-avoided words of length k in a given sequence of length n over a fixed-sized alphabet. We also present a time-optimal [Formula: see text]-time algorithm to compute all [Formula: see text]-avoided words (of any length) in a sequence of length n over an integer alphabet of size [Formula: see text]. In addition, we provide a tight asymptotic upper bound for the number of [Formula: see text]-avoided words over an integer alphabet and the expected length of the longest one. We make available an implementation of our algorithm. Experimental results, using both real and synthetic data, show the efficiency and applicability of our implementation in biological sequence analysis. The systematic search for avoided words is particularly useful for biological sequence analysis. We present a linear-time and linear-space algorithm for the computation of avoided words of length k in a given sequence x . We suggest a modification to this algorithm so that it computes all avoided words of x , irrespective of their length, within the same time complexity. We also present combinatorial results with regards to avoided words and absent words.

S-aryl-L-cysteine sulphoxides and related organosulphur compounds alter oral biofilm development and AI-2-based cell-cell communication.

Science.gov (United States)

Kasper, S H; Samarian, D; Jadhav, A P; Rickard, A H; Musah, R A; Cady, N C

2014-11-01

To design and synthesize a library of structurally related, small molecules related to homologues of compounds produced by the plant Petiveria alliacea and determine their ability to interfere with AI-2 cell-cell communication and biofilm formation by oral bacteria. Many human diseases are associated with persistent bacterial biofilms. Oral biofilms (dental plaque) are problematic as they are often associated with tooth decay, periodontal disease and systemic disorders such as heart disease and diabetes. Using a microplate-based approach, a bio-inspired small molecule library was screened for anti-biofilm activity against the oral species Streptococcus mutans UA159, Streptococcus sanguis 10556 and Actinomyces oris MG1. To complement the static screen, a flow-based BioFlux microfluidic system screen was also performed under conditions representative of the human oral cavity. Several compounds were found to display biofilm inhibitory activity in all three of the oral bacteria tested. These compounds were also shown to inhibit bioluminescence by Vibrio harveyi and were thus inferred to be quorum sensing (QS) inhibitors. Due to the structural similarity of these compounds to each other, and to key molecules in AI-2 biosynthetic pathways, we propose that these molecules potentially reduce biofilm formation via antagonism of QS or QS-related pathways. This study highlights the potential for a non-antimicrobial-based strategy, focused on AI-2 cell-cell signalling, to control the development of dental plaque. Considering that many bacterial species use AI-2 cell-cell signalling, as well as the increased concern of the use of antimicrobials in healthcare products, such an anti-biofilm approach could also be used to control biofilms in environments beyond the human oral cavity. © 2014 The Society for Applied Microbiology.

Auditory word recognition: extrinsic and intrinsic effects of word frequency.

Science.gov (United States)

Connine, C M; Titone, D; Wang, J

1993-01-01

Two experiments investigated the influence of word frequency in a phoneme identification task. Speech voicing continua were constructed so that one endpoint was a high-frequency word and the other endpoint was a low-frequency word (e.g., best-pest). Experiment 1 demonstrated that ambiguous tokens were labeled such that a high-frequency word was formed (intrinsic frequency effect). Experiment 2 manipulated the frequency composition of the list (extrinsic frequency effect). A high-frequency list bias produced an exaggerated influence of frequency; a low-frequency list bias showed a reverse frequency effect. Reaction time effects were discussed in terms of activation and postaccess decision models of frequency coding. The results support a late use of frequency in auditory word recognition.

Brain activation during word identification and word recognition

DEFF Research Database (Denmark)

Jernigan, Terry L.; Ostergaard, Arne L.; Law, Ian

1998-01-01

Previous memory research has suggested that the effects of prior study observed in priming tasks are functionally, and neurobiologically, distinct phenomena from the kind of memory expressed in conventional (explicit) memory tests. Evidence for this position comes from observed dissociations...... between memory scores obtained with the two kinds of tasks. However, there is continuing controversy about the meaning of these dissociations. In recent studies, Ostergaard (1998a, Memory Cognit. 26:40-60; 1998b, J. Int. Neuropsychol. Soc., in press) showed that simply degrading visual word stimuli can...... dramatically alter the degree to which word priming shows a dissociation from word recognition; i.e., effects of a number of factors on priming paralleled their effects on recognition memory tests when the words were degraded at test. In the present study, cerebral blood flow changes were measured while...

Assessing the Usefulness of Google Books’ Word Frequencies for Psycholinguistic Research on Word Processing

Science.gov (United States)

Brysbaert, Marc; Keuleers, Emmanuel; New, Boris

2011-01-01

In this Perspective Article we assess the usefulness of Google's new word frequencies for word recognition research (lexical decision and word naming). We find that, despite the massive corpus on which the Google estimates are based (131 billion words from books published in the United States alone), the Google American English frequencies explain 11% less of the variance in the lexical decision times from the English Lexicon Project (Balota et al., 2007) than the SUBTLEX-US word frequencies, based on a corpus of 51 million words from film and television subtitles. Further analyses indicate that word frequencies derived from recent books (published after 2000) are better predictors of word processing times than frequencies based on the full corpus, and that word frequencies based on fiction books predict word processing times better than word frequencies based on the full corpus. The most predictive word frequencies from Google still do not explain more of the variance in word recognition times of undergraduate students and old adults than the subtitle-based word frequencies. PMID:21713191

The assisting system for uranium enrichment plant operation

International Nuclear Information System (INIS)

Nakazawa, Hiroaki; Yamamoto, Fumio

1990-01-01

We have been developing an operation assisting system, partially supported by AI system, for uranium enrichment plant. The AI system is a proto-type system aiming a final one which can be applied to any future large uranium enrichment plant and also not only to specific operational area but also to complex and multi-phenomenon operational area. An existing AI system, for example facility diagnostic system that utilizes the result of CCT analysis as knowledge base, has weakness in flexibility and potentiality. To build AI system, we have developed the most suitable knowledge representations using deep knowledge for each facility or operation of uranium enrichment plant. This paper describes our AI proto-type system adopting several knowledge representations that can represent an uranium enrichment plant's operation with deep knowledge. (author)

A Real Time AI Approach to Discrimination Boost Phase Optical Sensor Systems in SDI Architectures

Science.gov (United States)

Sloggett, David R.

1990-04-01

are resolved by sensor systems feature data can be extracted on individual objects that can be used by the defence system to attempt to discriminate between warheads, decoys and other penetration aids. This paper reviews work that has arisen from joint US SDIO and UK MOD research programmes into the feasibility of Theatre Missile Defence (TMD) systems that would be suitable for deploy ment and operation in a European theatre. The paper focuses on the problems of threat classification and discrimination in TtD systems and highlights the role of optical sensors. The paper discusses the integration of data derived from optical and radar sensors 6 and expands upon work previously reported into the use of an Artificial Intelligence (AI) approach to object classification and discrimination.

Chinese Learners of English See Chinese Words When Reading English Words.

Science.gov (United States)

Ma, Fengyang; Ai, Haiyang

2018-06-01

The present study examines when second language (L2) learners read words in the L2, whether the orthography and/or phonology of the translation words in the first language (L1) is activated and whether the patterns would be modulated by the proficiency in the L2. In two experiments, two groups of Chinese learners of English immersed in the L1 environment, one less proficient and the other more proficient in English, performed a translation recognition task. In this task, participants judged whether pairs of words, with an L2 word preceding an L1 word, were translation words or not. The critical conditions compared the performance of learners to reject distractors that were related to the translation word (e.g., , pronounced as /bei 1/) of an L2 word (e.g., cup) in orthography (e.g., , bad in Chinese, pronounced as /huai 4/) or phonology (e.g., , sad in Chinese, pronounced as /bei 1/). Results of Experiment 1 showed less proficient learners were slower and less accurate to reject translation orthography distractors, as compared to unrelated controls, demonstrating a robust translation orthography interference effect. In contrast, their performance was not significantly different when rejecting translation phonology distractors, relative to unrelated controls, showing no translation phonology interference. The same patterns were observed in more proficient learners in Experiment 2. Together, these results suggest that when Chinese learners of English read English words, the orthographic information, but not the phonological information of the Chinese translation words is activated. In addition, this activation is not modulated by L2 proficiency.

Intransparent German number words complicate transcoding - A translingual comparison with Japanese

Directory of Open Access Journals (Sweden)

Korbinian eMoeller

2015-06-01

Full Text Available Superior early numerical competencies of children in several Asian countries have (amongst others been attributed to the higher transparency of their number word systems. Here, we directly investigated this claim by evaluating whether Japanese children’s transcoding performance when writing numbers to dictation (e.g., twenty five  25 was less error prone than that of German-speaking children; both in general as well as when considering language-specific attributes of the German number word system such as the inversion property, in particular. In line with this hypothesis we observed that German-speaking children committed more transcoding errors in general than their Japanese peers. Moreover, their error pattern reflected the specific inversion intransparency of the German number-word system. Inversion errors in transcoding represented the most prominent error category in German-speaking children, but were almost absent in Japanese-speaking children. We conclude that the less transparent German number-word system complicates the acquisition of the correspondence between symbolic Arabic numbers and their respective verbal number words.

Polychronous Zirconology of Navysh Volcanics of the Ai Formation (Southern Urals)

Science.gov (United States)

Krasnobaev, A. A.; Puchkov, V. N.; Sergeeva, N. D.

2018-01-01

In order to resolve the age of Navysh volcanics (NV), which is usually attributed to the Lower Riphean of the Ai Formation, we have used geochronological, petrologic, and mineralogical methods of zirconology, apart from the SHRIMP isotopic data of single zircon grains. Moreover, TIMS isotope age analyses have been conducted, the results of which can be regarded as both controlling and providing the most correct information. The TIMS and SHRIMP data make it possible to suggest a polychronous character of the NV, which include not only Riphean, but also Paleozoic groups of volcanics. In this situation, an assessment of the scales of such polychroneity of NV and, correspondingly, of the Ai Formation as a whole becomes urgent.

Activation of words with phonological overlap

Directory of Open Access Journals (Sweden)

Claudia K. Friedrich

2013-08-01

Full Text Available Multiple lexical representations overlapping with the input (cohort neighbors are temporarily activated in the listener’s mental lexicon when speech unfolds in time. Activation for cohort neighbors appears to rapidly decline as soon as there is mismatch with the input. However, it is a matter of debate whether or not they are completely excluded from further processing. We recorded behavioral data and event-related brain potentials (ERPs in auditory-visual word onset priming during a lexical decision task. As primes we used the first two syllables of spoken German words. In a carrier word condition, the primes were extracted from spoken versions of the target words (ano-ANORAK 'anorak'. In a cohort neighbor condition, the primes were taken from words that overlap with the target word up to the second nucleus (ana- taken from ANANAS 'pineapple'. Relative to a control condition, where primes and targets were unrelated, lexical decision responses for cohort neighbors were delayed. This reveals that cohort neighbors are disfavored by the decision processes at the behavioral front end. In contrast, left-anterior ERPs reflected long-lasting facilitated processing of cohort neighbors. We interpret these results as evidence for extended parallel processing of cohort neighbors. That is, in parallel to the preparation and elicitation of delayed lexical decision responses to cohort neighbors, aspects of the processing system appear to keep track of those less efficient candidates.

Word learning mechanisms.

Science.gov (United States)

He, Angela Xiaoxue; Arunachalam, Sudha

2017-07-01

How do children acquire the meanings of words? Many word learning mechanisms have been proposed to guide learners through this challenging task. Despite the availability of rich information in the learner's linguistic and extralinguistic input, the word-learning task is insurmountable without such mechanisms for filtering through and utilizing that information. Different kinds of words, such as nouns denoting object concepts and verbs denoting event concepts, require to some extent different kinds of information and, therefore, access to different kinds of mechanisms. We review some of these mechanisms to examine the relationship between the input that is available to learners and learners' intake of that input-that is, the organized, interpreted, and stored representations they form. We discuss how learners segment individual words from the speech stream and identify their grammatical categories, how they identify the concepts denoted by these words, and how they refine their initial representations of word meanings. WIREs Cogn Sci 2017, 8:e1435. doi: 10.1002/wcs.1435 This article is categorized under: Linguistics > Language Acquisition Psychology > Language. © 2017 Wiley Periodicals, Inc.

Diapo, applying advanced AI methods to diagnosis of PWR reactor coolant pump

International Nuclear Information System (INIS)

Porcheron, M.; Ricard, B.

1993-01-01

Electricite de France has decided to increase the capabilities of its monitoring and diagnostic architecture with the development of an AI system for reactor coolant pump diagnostic support. This development is carried out with the cooperation of the equipment constructor Jeumont Schneider Industries. This diagnostic system will eventually be included in an integrated surveillance architecture. We present the architecture of the system and the basics of the knowledge model used. Main data for diagnosis are provided by sensor data issued by the pump monitoring system. Diagnostic reasoning is based on the cooperation of two main activities : a heuristic search among typical symptomatic situations that leads to the formulation of hypotheses and a ''deep'' causal analysis that consists in backtracking from identified situations up to initial faults or causes. This approach is well fitted to field expert reasoning, and provides powerful diagnostic capabilities that help to overcome conventional limitations of expert systems entirely based on heuristic knowledge. (authors). 9 figs., 11 refs

WordPress Bible

CERN Document Server

Brazell, Aaron

2011-01-01

Get the latest word on the biggest self-hosted blogging tool on the marketWithin a week of the announcement of WordPress 3.0, it had been downloaded over a million times. Now you can get on the bandwagon of this popular open-source blogging tool with WordPress Bible, 2nd Edition. Whether you're a casual blogger or programming pro, this comprehensive guide covers the latest version of WordPress, from the basics through advanced application development. If you want to thoroughly learn WordPress, this is the book you need to succeed.Explores the principles of blogging, marketing, and social media

GPU: the biggest key processor for AI and parallel processing

Science.gov (United States)

Baji, Toru

2017-07-01

Two types of processors exist in the market. One is the conventional CPU and the other is Graphic Processor Unit (GPU). Typical CPU is composed of 1 to 8 cores while GPU has thousands of cores. CPU is good for sequential processing, while GPU is good to accelerate software with heavy parallel executions. GPU was initially dedicated for 3D graphics. However from 2006, when GPU started to apply general-purpose cores, it was noticed that this architecture can be used as a general purpose massive-parallel processor. NVIDIA developed a software framework Compute Unified Device Architecture (CUDA) that make it possible to easily program the GPU for these application. With CUDA, GPU started to be used in workstations and supercomputers widely. Recently two key technologies are highlighted in the industry. The Artificial Intelligence (AI) and Autonomous Driving Cars. AI requires a massive parallel operation to train many-layers of neural networks. With CPU alone, it was impossible to finish the training in a practical time. The latest multi-GPU system with P100 makes it possible to finish the training in a few hours. For the autonomous driving cars, TOPS class of performance is required to implement perception, localization, path planning processing and again SoC with integrated GPU will play a key role there. In this paper, the evolution of the GPU which is one of the biggest commercial devices requiring state-of-the-art fabrication technology will be introduced. Also overview of the GPU demanding key application like the ones described above will be introduced.

Functional Neuroanatomy of Contextual Acquisition of Concrete and Abstract Words

Science.gov (United States)

Mestres-Misse, Anna; Munte, Thomas F.; Rodriguez-Fornells, Antoni

2009-01-01

The meaning of a novel word can be acquired by extracting it from linguistic context. Here we simulated word learning of new words associated to concrete and abstract concepts in a variant of the human simulation paradigm that provided linguistic context information in order to characterize the brain systems involved. Native speakers of Spanish…

Predicting Vessel Trajectories from Ais Data Using R

Science.gov (United States)

2017-06-01

Source: Hampton (2009). A vessel operator with AIS is able to get useful information about the other vessels in the area by selecting a vessel icon ...random forest model on our computer. All calculations are done on a MacBook-Pro with 2.7GHz quad-core Intel Core i7, and 16GB of memory . H2O allows us

Spatial attention in written word perception

Directory of Open Access Journals (Sweden)

Veronica eMontani

2014-02-01

Full Text Available The role of attention in visual word recognition and reading aloud is a long debated issue. Studies of both developmental and acquired reading disorders provide growing evidence that spatial attention is critically involved in word reading, in particular for the phonological decoding of unfamiliar letter strings. However, studies on healthy participants have produced contrasting results. The aim of this study was to investigate how the allocation of spatial attention may influence the perception of letter strings in skilled readers. High frequency words, low frequency words and pseudowords were briefly and parafoveally presented either in the left or the right visual field. Attentional allocation was modulated by the presentation of a spatial cue before the target string. Accuracy in reporting the target string was modulated by the spatial cue but this effect varied with the type of string. For unfamiliar strings, processing was facilitated when attention was focused on the string location and hindered when it was diverted from the target. This finding is consistent the assumptions of the CDP+ model of reading aloud, as well as with familiarity sensitivity models that argue for a flexible use of attention according with the specific requirements of the string. Moreover, we found that processing of high-frequency words was facilitated by an extra-large focus of attention. The latter result is consistent with the hypothesis that a broad distribution of attention is the default mode during reading of familiar words because it might optimally engage the broad receptive fields of the highest detectors in the hierarchical system for visual word recognition.