WorldWideScience

Sample records for word ai systems

  1. DESIGNING AI TEACHER ASSISTANT ON ONLINE-COURSE BASED ON WORD2VEC TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    Pavel Aleksandrovich Rozhkin

    2018-05-01

    Full Text Available The purpose of this work is to develop an AI teacher assistant, who can find answers to online course participants questions among answers previously published at the training forum. Currently, there are already successful experiments on the use of artificial intelligence systems (IBM WATSON in online training. In this paper, we investigate the possibility of constructing such a system using word2vec technology. A two-stage method for finding an answer to a question is constructed. Method use word2vec technology for vector representation of questions and answers. At the first stage, the subject matter of the issue is determined and, if it corresponds to the theme of the forum, then the articles most relevant to the question are searched. A real situation was simulated with 16 themes and 80 answers to possible questions within the section of the online course “Linear Algebra and Geometry”. The question-answer system was designed and its performance was evaluated. The parameters have been chosen to achieve the best result. In 83% of the cases, the relevant answer to the formulated question was contained among the top 3 responses that the system offered. The issues of further development of applied approaches and increasing utility of the constructed question-answer system are considered. Purpose: developing an AI teacher assistant, who can find answers to online course participants questions among answers previously published at the training forum. Methodology: vectorization of questions and answers, neural network classification of the subject matter, construction of the answers rating. Results: acceptable accuracy in finding a relevant answer to a question are received. Practical implications: The results of the research can be used as a basis for designing an AI teacher assistant in online courses.

  2. A Play on Words: Using Cognitive Computing as a Basis for AI Solvers in Word Puzzles

    Science.gov (United States)

    Manzini, Thomas; Ellis, Simon; Hendler, James

    2015-12-01

    In this paper we offer a model, drawing inspiration from human cognition and based upon the pipeline developed for IBM's Watson, which solves clues in a type of word puzzle called syllacrostics. We briefly discuss its situation with respect to the greater field of artificial general intelligence (AGI) and how this process and model might be applied to other types of word puzzles. We present an overview of a system that has been developed to solve syllacrostics.

  3. Ai

    African Journals Online (AJOL)

    :=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

  4. Launching AI in NASA ground systems

    Science.gov (United States)

    Perkins, Dorothy C.; Truszkowski, Walter F.

    1990-01-01

    This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

  5. AI systems approach in particle accelerators

    International Nuclear Information System (INIS)

    Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.

    1992-01-01

    The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

  6. [Artificial intelligence] AI for protection systems

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, R.; Johns, A.

    1997-12-31

    The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

  7. Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

    Science.gov (United States)

    2014-08-01

    Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

  8. Automated Information System (AIS) Alarm System

    Energy Technology Data Exchange (ETDEWEB)

    Hunteman, W.

    1997-05-01

    The Automated Information Alarm System is a joint effort between Los Alamos National Laboratory, Lawrence Livermore National Laboratory, and Sandia National Laboratory to demonstrate and implement, on a small-to-medium sized local area network, an automated system that detects and automatically responds to attacks that use readily available tools and methodologies. The Alarm System will sense or detect, assess, and respond to suspicious activities that may be detrimental to information on the network or to continued operation of the network. The responses will allow stopping, isolating, or ejecting the suspicious activities. The number of sensors, the sensitivity of the sensors, the assessment criteria, and the desired responses may be set by the using organization to meet their local security policies.

  9. Automated Information System (AIS) Alarm System

    International Nuclear Information System (INIS)

    Hunteman, W.

    1997-01-01

    The Automated Information Alarm System is a joint effort between Los Alamos National Laboratory, Lawrence Livermore National Laboratory, and Sandia National Laboratory to demonstrate and implement, on a small-to-medium sized local area network, an automated system that detects and automatically responds to attacks that use readily available tools and methodologies. The Alarm System will sense or detect, assess, and respond to suspicious activities that may be detrimental to information on the network or to continued operation of the network. The responses will allow stopping, isolating, or ejecting the suspicious activities. The number of sensors, the sensitivity of the sensors, the assessment criteria, and the desired responses may be set by the using organization to meet their local security policies

  10. A framework for AI-based nuclear design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1991-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  11. Framework for AI-based nuclear reactor design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1992-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  12. AI User Support System for SAP ERP

    Science.gov (United States)

    Vlasov, Vladimir; Chebotareva, Victoria; Rakhimov, Marat; Kruglikov, Sergey

    2017-10-01

    An intelligent system for SAP ERP user support is proposed in this paper. It enables automatic replies on users’ requests for support, saving time for problem analysis and resolution and improving responsiveness for end users. The system is based on an ensemble of machine learning algorithms of multiclass text classification, providing efficient question understanding, and a special framework for evidence retrieval, providing the best answer derivation.

  13. Companion Cognitive Systems: A Step toward Human-Level AI

    OpenAIRE

    Forbus, Kenneth D.; Hinrichs, Thomas R.

    2006-01-01

    We are developing Companion Cognitive Systems, a new kind of software that can be effectively treated as a collaborator. Aside from their potential utility, we believe this effort is important because it focuses on three key problems that must be solved to achieve human-level AI: Robust reasoning and learning, interactivity, and longevity. We describe the ideas we are using to develop the first architecture for Companions: analogical processing, grounded in cognitive science for reasoning and...

  14. 10 CFR 1017.28 - Processing on Automated Information Systems (AIS).

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Processing on Automated Information Systems (AIS). 1017.28... UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION Physical Protection Requirements § 1017.28 Processing on Automated Information Systems (AIS). UCNI may be processed or produced on any AIS that complies with the guidance in OMB...

  15. Alarm processing system using AI techniques for nuclear power plant

    International Nuclear Information System (INIS)

    Yang, Joon On; Chang, Soon Heung

    1990-01-01

    An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

  16. Fully automatic AI-based leak detection system

    Energy Technology Data Exchange (ETDEWEB)

    Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)

    2010-09-15

    This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

  17. Development of an advanced educational system using AI techniques

    International Nuclear Information System (INIS)

    Yoshimura, Seiichi

    1990-01-01

    This paper describes an advanced educational system that realizes effective education using AI techniques. The system is composed of three devices. One is a knowledge-processing computer that evaluates the operator's knowledge level and presents educational materials. Another is a computer for displaying transients. The other is a computer for voice input and output. The educational materials utilize cause-and-effect relationships. The relationships enable to perform effective education by pointing out the parts the operator failed to understand. An evaluation test was performed by actually operating the system. As a result, the system's fundamental characteristics, such as the ease of understanding the relationships, and the usefulness of the advanced evaluation of the operator's knowledge level, were evaluated highly. (author)

  18. Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    Directory of Open Access Journals (Sweden)

    Stephen Fox

    2017-06-01

    Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

  19. AI empowered context-aware smart system for medication adherence

    Directory of Open Access Journals (Sweden)

    Qiong Wu

    2017-06-01

    Full Text Available Purpose – Poor medication adherence leads to high hospital admission rate and heavy amount of health-care cost. To cope with this problem, various electronic pillboxes have been proposed to improve the medication adherence rate. However, most of the existing electronic pillboxes use time-based reminders which may often lead to ineffective reminding if the reminders are triggered at inopportune moments, e.g. user is sleeping or eating. Design/methodology/approach – In this paper, the authors propose an AI-empowered context-aware smart pillbox system. The pillbox system collects real-time sensor data from a smart home environment and analyzes the user’s contextual information through a computational abstract argumentation-based activity classifier. Findings – Based on user’s different contextual states, the smart pillbox will generate reminders at appropriate time and on appropriate devices. Originality/value – This paper presents a novel context-aware smart pillbox system that uses argumentation-based activity recognition and reminder generation.

  20. Building regional early flood warning systems by AI techniques

    Science.gov (United States)

    Chang, F. J.; Chang, L. C.; Amin, M. Z. B. M.

    2017-12-01

    Building early flood warning system is essential for the protection of the residents against flood hazards and make actions to mitigate the losses. This study implements AI technology for forecasting multi-step-ahead regional flood inundation maps during storm events. The methodology includes three major schemes: (1) configuring the self-organizing map (SOM) to categorize a large number of regional inundation maps into a meaningful topology; (2) building dynamic neural networks to forecast multi-step-ahead average inundated depths (AID); and (3) adjusting the weights of the selected neuron in the constructed SOM based on the forecasted AID to obtain real-time regional inundation maps. The proposed models are trained, and tested based on a large number of inundation data sets collected in regions with the most frequent and serious flooding in the river basin. The results appear that the SOM topological relationships between individual neurons and their neighbouring neurons are visible and clearly distinguishable, and the hybrid model can continuously provide multistep-ahead visible regional inundation maps with high resolution during storm events, which have relatively small RMSE values and high R2 as compared with numerical simulation data sets. The computing time is only few seconds, and thereby leads to real-time regional flood inundation forecasting and make early flood inundation warning system. We demonstrate that the proposed hybrid ANN-based model has a robust and reliable predictive ability and can be used for early warning to mitigate flood disasters.

  1. On how AI & Law can help autonomous systems obey the law: a position paper

    NARCIS (Netherlands)

    Prakken, Hendrik

    2016-01-01

    In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

  2. Teaching AI Search Algorithms in a Web-Based Educational System

    Science.gov (United States)

    Grivokostopoulou, Foteini; Hatzilygeroudis, Ioannis

    2013-01-01

    In this paper, we present a way of teaching AI search algorithms in a web-based adaptive educational system. Teaching is based on interactive examples and exercises. Interactive examples, which use visualized animations to present AI search algorithms in a step-by-step way with explanations, are used to make learning more attractive. Practice…

  3. Application of artificial intelligence (AI) methods for designing and analysis of reconfigurable cellular manufacturing system (RCMS)

    CSIR Research Space (South Africa)

    Xing, B

    2009-12-01

    Full Text Available This work focuses on the design and control of a novel hybrid manufacturing system: Reconfigurable Cellular Manufacturing System (RCMS) by using Artificial Intelligence (AI) approach. It is hybrid as it combines the advantages of Cellular...

  4. Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

    Science.gov (United States)

    Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

    1987-01-01

    In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

  5. Artificial intelligence (AI) systems for interpreting complex medical datasets.

    Science.gov (United States)

    Altman, R B

    2017-05-01

    Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

  6. An AI-based layout design system for nuclear power plants

    International Nuclear Information System (INIS)

    Fujita, Kikuo; Akagi, Shinsuke; Nakatogawa, Tetsundo; Tanaka, Kazuo; Takeuchi, Makoto.

    1991-01-01

    An AI-based layout design system for nuclear power plants has been developed. The design of the layout of nuclear power plants is a time-consuming task requiring expertise, in which a lot of machinery and equipment must be arranged in a plant building considering various kinds of design constraints, i.e. spatial, functional, economical etc. Computer aided layout design systems have been widely expected and the application of AI technology is expected as a promising approach for the synthesis phase of this task. In this paper, we present an approach to the layout design of nuclear power plants based on a constraint-directed search; one of the AI techniques. In addition, we show how it was implemented with an object-oriented programming technique and give an example of its application. (author)

  7. The Army word recognition system

    Science.gov (United States)

    Hadden, David R.; Haratz, David

    1977-01-01

    The application of speech recognition technology in the Army command and control area is presented. The problems associated with this program are described as well as as its relevance in terms of the man/machine interactions, voice inflexions, and the amount of training needed to interact with and utilize the automated system.

  8. AIS as key component in modern vessel traffic management and information systems

    Energy Technology Data Exchange (ETDEWEB)

    Lamers, W. [DaimlerChrysler Aerospace AG (DASA), Ulm (Germany)

    1999-07-01

    The objective of this paper is to provide information in respect to universal shipborne identification system (UAIS) as main sensor in various vessel traffic applications. The presented paper will give general information concerning AIS functionality and the standardisation process. Based on experience from recent projects and various IALA working group activities, a typical future VTMIS architectures is also presented being based on AIS as key sensor. The required key performance of AIS associated with the HW components will be described. The results from European technology study Indris are presented and discussed. Finally, a summary and conclusion from the presented material will complete the technical paper. The elaboration of this presentation has been carried out as a joint task between Mr. Andre van Berg, MDS Suedafrika und Mr. Walter Lamers, DASA Ulm. (orig.)

  9. AI-based adaptive control and design of autopilot system

    Indian Academy of Sciences (India)

    The objective of this paper is to design an autopilot system for unmanned aerial vehicle (UAV) to control the speed and altitude using electronic throttle control system (ETCS) and elevator, respectively. A DC servo motor is used for designing of ETCS to control the throttle position for appropriate amount of air mass flow.

  10. Three IQs of AI Systems and their Testing Methods

    OpenAIRE

    Liu, Feng; Shi, Yong; Liu, Ying

    2017-01-01

    The rapid development of artificial intelligence has brought the artificial intelligence threat theory as well as the problem about how to evaluate the intelligence level of intelligent products. Both need to find a quantitative method to evaluate the intelligence level of intelligence systems, including human intelligence. Based on the standard intelligence system and the extended Von Neumann architecture, this paper proposes General IQ, Service IQ and Value IQ evaluation methods for intelli...

  11. Development of X-ray diffractometers XD-D1 AI qualitative analysis system

    International Nuclear Information System (INIS)

    Arai, Hiroshi; Uota, Atsushi; Ishida, Hidenobu

    1994-01-01

    Qualitative X-ray diffraction is a very important analytical method, however, it is also very difficult to perform and needs some special skills. Also, the analysis accuracy depends on the operators' knowledge of qualitative analysis. In order that even a beginner analyst can obtain accurate results, we have developed the 'XD-D1 AI Qualitative Analysis System'. This system can support analytical operations with the experts' knowledge made available by AI techniques. Systematizing the experts' knowledge, we applied the system to our expert shell 'GENZO-I/PRO'. This system enabled a beginner analyst to get the same results as a specialist would get. In this paper, we will describe the process of system design, system construction and an example analysis. (author)

  12. An artificial intelligence (AI) NOx/heat rate optimization system for Ontario Hydro`s fossil generating stations

    Energy Technology Data Exchange (ETDEWEB)

    Luk, J.; Frank, A.; Bodach, P. [Ontario Hydro, Toronto, ON (Canada); Warriner, G. [Radian International, Tucker, GA (United States); Noblett, J. [Radian International, Austin, TX (United States); Slatsky, M. [Southern Company, Birmingham, AL (United States)

    1999-08-01

    Artificial intelligence (AI)-based software packages which can optimize power plant operations that improves heat rate and also reduces nitrogen oxide emissions are now commonly available for commercial use. This paper discusses the implementation of the AI-based NOx and Heat Rate Optimization System at Ontario Hydro`s generation stations, emphasizing the current AI Optimization Project at Units 5 and 6 of the Lakeview Generating Station. These demonstration programs are showing promising results in NOx reduction and plant performance improvement. The availability of the plant Digital Control System (DCS) in implementing AI optimization in a closed-loop system was shown to be an important criterion for success. Implementation of AI technology at other Ontario Hydro fossil generating units as part of the overall NOx emission reduction system is envisaged to coincide with the retrofit of the original plant control system with the latest DCS systems. 14 refs., 3 figs.

  13. THE SPECIAL STATUS OF EXOGENOUS WORD-FORMATION WITHIN THE GERMAN WORD-FORMATION SYSTEM

    OpenAIRE

    Zhilyuk Sergey Aleksandrovich

    2014-01-01

    The article presents the properties of exogenous word-formation system taking into account the existence of two word-formation systems in modern German. On the basis of foreign research which reveal modern trends in German word-formation connected with the internationalization and the development of new European Latin language. The author defines key features of exogenous word-formation, i.e. foreign origin of wordformation units, unmotivated units, unmotivated interchange in base and affixes...

  14. Treat a new and efficient match algorithm for AI production system

    CERN Document Server

    Miranker, Daniel P

    1988-01-01

    TREAT: A New and Efficient Match Algorithm for AI Production Systems describes the architecture and software systems embodying the DADO machine, a parallel tree-structured computer designed to provide significant performance improvements over serial computers of comparable hardware complexity in the execution of large expert systems implemented in production system form.This book focuses on TREAT as a match algorithm for executing production systems that is presented and comparatively analyzed with the RETE match algorithm. TREAT, originally designed specifically for the DADO machine architect

  15. Agricultural Innovation Systems (AIS): A Study of Stakeholders and Their Relations in System of Rice Intensification (SRI)

    Science.gov (United States)

    Suchiradipta, Bhattacharjee; Raj, Saravanan

    2015-01-01

    Purpose: This paper identifies the stakeholders of System of Rice Intensification (SRI), their roles and actions and the supporting and enabling environment of innovation in the state as the elements of the Agricultural Innovation Systems (AIS) in SRI in Tripura state of India and studies the relationship matrix among the stakeholders.…

  16. Artificial intelligence/expert (AI/EX) systems for steelworks pollution control

    Energy Technology Data Exchange (ETDEWEB)

    Schofield, N.; Le Louer, P.; Mirabile, D.; Hubner, R. [Corus UK Ltd., Rotherham (United Kingdom)

    2002-07-01

    The objectives of this project have been to develop and apply artificial intelligence and expert system (AI/EX) methods to improve the control and operational performance of steelworks' pollution control equipment and to assess the viability and benefits of using such systems in dynamic process plant applications. Four distinct sub-projects were carried out: an expert system incorporating knowledge-based rules and neural network simulations has been developed by Corus which provides plant personnel with a real-time condition monitoring tool for the plant. Abnormalities with plant operation are now instantly recognised and alarmed, allowing prioritised maintenance to increase plant availability. The LECES project focused on studies concerning three different sites in order to evaluate predictive emission monitoring systems using neural networks to replace conventional instrumental and controls in steelworks' combustion systems. VAI developed a software template for pollution control expert systems to demonstrate the transferability of AI/EX technology. This has been done through the development of a validated process database containing data from the Corus sub-project and the subsequent integration of this data with dynamic emission models to produce rules for input to an evaluation database. CSM developed a fuzzy logic controlled process management system applied to the biological treatment of coke-oven waste water. A pilot plant has been installed and results on simulations performed using the fuzzy logic system linked to a neural network simulator show that it is possible to obtain great advantages in the biological pilot plant performance.

  17. THE SPECIAL STATUS OF EXOGENOUS WORD-FORMATION WITHIN THE GERMAN WORD-FORMATION SYSTEM

    Directory of Open Access Journals (Sweden)

    Zhilyuk Sergey Aleksandrovich

    2014-06-01

    Full Text Available The article presents the properties of exogenous word-formation system taking into account the existence of two word-formation systems in modern German. On the basis of foreign research which reveal modern trends in German word-formation connected with the internationalization and the development of new European Latin language. The author defines key features of exogenous word-formation, i.e. foreign origin of wordformation units, unmotivated units, unmotivated interchange in base and affixes as well as limited distribution rules in combination with German word-formation. The article analyzes various approaches to word-division, as well as motivated and unmotivated interchange of consonants in bases and in affixes. Unmotivated interchange showcases a special status of the exogenous word-formation within German. Another item covered by the article is the issue of confix. The article has opinions of researchers about correctness of its separation and a list of its features. The author presents his definition of confix: a confix is a bound exogenous word-formation unit with a certain lexical and semantic meaning and joining other units directly or indirectly (through linking morpheme -o-, which is able to make a base. Moreover, some confixes are able to participate at word-combination and have unlimited distribution. So far, confix showcases the integration of exogenous word-formation and traditional German word-formation. The research proves the special status of exogenous word-formation in German. Its results can be used as a base for further analysis of co-existing word-formation systems in German and determination of their characteristic features.

  18. JACOS: AI-based simulation system for man-machine system behavior in NPP

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawase, Katsumi [CSK Corp., Tokyo (Japan); Komiya, Akitoshi [Computer Associated Laboratory, Inc., Hitachinaka, Ibaraki (Japan)

    2001-08-01

    A prototype of a computer simulation system named JACOS (JAERI COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of a nuclear power plant. The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also taken into account. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. This report is prepared as User's Manual for JACOS. The first chapter of this report describes both operator and plant models in detail. The second chapter includes instructive descriptions for program installation, building of a knowledge base for operator model, execution of simulation and analysis of simulation results. The examples of simulation with JACOS are shown in the third chapter. (author)

  19. JACOS: AI-based simulation system for man-machine system behavior in NPP

    International Nuclear Information System (INIS)

    Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya; Komiya, Akitoshi

    2001-08-01

    A prototype of a computer simulation system named JACOS (JAERI COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of a nuclear power plant. The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also taken into account. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. This report is prepared as User's Manual for JACOS. The first chapter of this report describes both operator and plant models in detail. The second chapter includes instructive descriptions for program installation, building of a knowledge base for operator model, execution of simulation and analysis of simulation results. The examples of simulation with JACOS are shown in the third chapter. (author)

  20. AIS authentication

    CERN Multimedia

    2006-01-01

    Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

  1. Optimal selection of LQR parameter using AIS for LFC in a multi-area power system

    Directory of Open Access Journals (Sweden)

    Muhammad Abdillah

    2016-12-01

    Full Text Available This paper proposes a method to optimize the parameter of the linear quadratic regulator (LQR using artificial immune system (AIS via clonal selection. The parameters of LQR utilized in this paper are the weighting matrices Q and R. The optimal LQR control for load frequency control (LFC is installed on each area as a decentralized control scheme. The aim of this control design is to improve the dynamic performance of LFC automatically when unexpected load change occurred on power system network. The change of load demands 0.01 p.u used as a disturbance is applied to LFC in Area 1. The proposed method guarantees the stability of the overall closed-loop system. The simulation result shows that the proposed method can reduce the overshoot of the system and compress the time response to steady-state which is better compared to trial error method (TEM and without optimal LQR control.

  2. Making Agricultural Innovation Systems (AIS Work for Development in Tropical Countries

    Directory of Open Access Journals (Sweden)

    Philipp Aerni

    2015-01-01

    Full Text Available Agricultural innovation in low-income tropical countries contributes to a more effective and sustainable use of natural resources and reduces hunger and poverty through economic development in rural areas. Yet, despite numerous recent public and private initiatives to develop capacities for agricultural innovation, such initiatives are often not well aligned with national efforts to revive existing Agricultural Innovation Systems (AIS. In an effort to improve coordination and responsiveness of Capacity Development (CD initiatives, the G20 Agriculture Ministers requested the Food and Agriculture Organization of the United Nations (FAO to lead the development of a Tropical Agricultural Platform (TAP, which is designed to improve coherence and coordination of CD for agricultural innovation in the tropics. This paper presents a summary of the results obtained from three regional needs assessments undertaken by TAP and its partners. The surveyed tropical regions were Southeast Asia, Sub-Saharan Africa and Central America. The findings reveal a mismatch in all three regions between the external supply of primarily individual CD and the actual demand for institutional CD. The misalignment might be addressed by strengthening south-south and triangular collaboration and by improving the institutional capacities that would render national AIS more demand-oriented and responsive to the needs of smallholders in domestic agriculture.

  3. A nuclear decision support system built with a real-time process control AI shell

    International Nuclear Information System (INIS)

    Nevins, M.A.

    1990-01-01

    Managing large nuclear power plants is generally approached by creating separate management teams to handle major functional areas such as operations, maintenance, training and engineering. While this approach facilitates a general understanding of the specific functions and problem areas of a nuclear plant, such broad definitions diminish the integration of information needed to understand the overall problem domain. One solution utilizes a decision support system that integrates a real-time process control AI shell, relational database manager, graphic depiction of the real-time events, and distributed knowledge bases that reside within each of the departments. The goal is to create a living model between plant components, procedures, tech specs, specific functions, maintenance and training requirements. This paper describes such a model, called Engineering Model and Simulation System (EMASS)

  4. The application of AI-based refueling control system to the Fugen NPP

    International Nuclear Information System (INIS)

    Maeda, Koichi; Nakamura, Shinji; Kawasaki, Noboru; Nanko, Takashi; Nishimura, Hiroshi; Tanaka, Koichi

    1996-01-01

    In a refueling operation of the Advanced Thermal Reactor Fugen, it is essential to precisely handle fuel assemblies to guarantee quality and from the standpoint of safety guard. In order to plan and execute efficient operations, knowledge of experienced operators based on experiences is required. Therefore, an automatic control system based on the Artificial Intelligence (AI) technology has been developed, and has been put into operation in actual refueling operations. This system prepares an optimum refueling plan, controls the fuel handling facilities by that plan, displays and prints out the history of transfer and storage of items by automatically sampled data on a work station, a network to express fuel handling facilities and operational rules acquired through operating experiences. The development of this system has made it possible to optimize refueling schedule, save control labor of items and improve reliability of refueling. Firstly the development started the off-line system that prepares optimum refueling plan and gives to the operator step by step instructions for operation, secondly developed the on-line system that automatically controls facilities by that plan. The development of this system started in 1989, the off-line system has been put into practical operation in the 17th refueling in 1991, the 22nd (12th annual inspection) refueling in 1995 has been done by using the on-line system automatically

  5. Performance testing of real-time AI systems using the activation framework

    International Nuclear Information System (INIS)

    Becker, L.; Duckworth, J.; Laznovsky, A.; Green, P.

    1992-01-01

    This paper describes methods for automated performance testing of real-time artificial intelligence systems using the Activation Framework software development tool. The Activation Framework is suitable for applications such as the diagnosis of power system failures, which require the interpretation of large volumes of data in real-time. The Activation Framework consists of tools for compiling groups of Expert Systems rules into executable code modules, for automatically generating code modules from high level system configuration descriptions, and for automatically generating command files for program compilation and linking. It includes an operating system environment which provides the code which is common from one real-time AI applications to the next. It also includes mechanisms, described here, for automatic performance testing. The principal emphasis of this paper is on a rule based language which is used to capture performance specifications. This specification is compiled into code modules which are used to automatically test the system. This testing can validate that the system meets performance requirements during development and after maintenance. A large number of tests can be randomly generated and executed and the correctness of the outputs automatically validated. The paper also describes graph directed testing methods to minimize the number of test runs required

  6. The development of AI-based refueling control system to the FUGEN NPP

    International Nuclear Information System (INIS)

    Nanko, Takashi; Tanaka, Koichi.

    1996-01-01

    Since even skilled workers spent a considerable time to perform the refueling work previously, an automatic control system was developed by using φNET, an AI tool and its application to refueling works was started in practice. In this system, the optimum plan for the refueling work was constructed using a network which allows to present the equipments to handle the fuel, as well as the operational roles obtained from the worker's experiences. Based on the plan, the instruments concerned were automatically operated to collect the data on the actual operation, the expression and/or printing was made on the movement histories of the articles and the status of their storages. By the development of the system, optimization of refueling works, rationalization of the management and the improvement of reliability for the works became possible. The development was performed in the following two steps; the first was development of an off-line system providing an operational guidance ot the operator according to the optimum operation plan and the second was development of an on-line system which allows to automatically control the instruments according to the operational plan. The off-line system has been put into practice since 1991 and the automatic operation of refueling has been started with the on-line system from 1995. (M.N.)

  7. PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL ...

    African Journals Online (AJOL)

    PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL PRODUCTION SYSTEMS. P. de V. Booysen. University of Natal, King George V Avenue, Durban. (Key words: .... inherent in biotic simplification is the danger of increased susceptibility of the abiotic component to degradation. So as the agriculturalist ...

  8. Detection of possible AI-2-mediated quorum sensing system in commensal intestinal bacteria.

    Science.gov (United States)

    Lukás, F; Gorenc, G; Kopecný, J

    2008-01-01

    The Vibrio harveyi strain BB170-autoinducer bioassay was used to detect possible quorum sensing autoinducer-2 molecule (AI-2) in culture fluids of commensal intestinal bacteria. Culture fluids of Bacteroides vulgatus, Clostridium proteoclasticum, Escherichia coli, Eubacterium rectale, Lachnospira multipara, Pseudobutyrivibrio ruminis, Roseburia intestinalis, Ruminococcus albus and Ruminococcus flavefaciens contained AI-2-like molecules. The PCR bands from some of the tested strains could be also amplified using primers designed for the luxS gene. These findings suggest that AI-2 is present in the gastrointestinal tract; however, it has not yet been proved whether it is used for bacterial cell-to-cell communication.

  9. Beyond AI: Multi-Intelligence (MI) Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    OpenAIRE

    Stephen Fox

    2017-01-01

    Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...

  10. Flood AI: An Intelligent Systems for Discovery and Communication of Disaster Knowledge

    Science.gov (United States)

    Demir, I.; Sermet, M. Y.

    2017-12-01

    Communities are not immune from extreme events or natural disasters that can lead to large-scale consequences for the nation and public. Improving resilience to better prepare, plan, recover, and adapt to disasters is critical to reduce the impacts of extreme events. The National Research Council (NRC) report discusses the topic of how to increase resilience to extreme events through a vision of resilient nation in the year 2030. The report highlights the importance of data, information, gaps and knowledge challenges that needs to be addressed, and suggests every individual to access the risk and vulnerability information to make their communities more resilient. This project presents an intelligent system, Flood AI, for flooding to improve societal preparedness by providing a knowledge engine using voice recognition, artificial intelligence, and natural language processing based on a generalized ontology for disasters with a primary focus on flooding. The knowledge engine utilizes the flood ontology and concepts to connect user input to relevant knowledge discovery channels on flooding by developing a data acquisition and processing framework utilizing environmental observations, forecast models, and knowledge bases. Communication channels of the framework includes web-based systems, agent-based chat bots, smartphone applications, automated web workflows, and smart home devices, opening the knowledge discovery for flooding to many unique use cases.

  11. A Real Time AI Approach to Discrimination Boost Phase Optical Sensor Systems in SDI Architectures

    Science.gov (United States)

    Sloggett, David R.

    1990-04-01

    are resolved by sensor systems feature data can be extracted on individual objects that can be used by the defence system to attempt to discriminate between warheads, decoys and other penetration aids. This paper reviews work that has arisen from joint US SDIO and UK MOD research programmes into the feasibility of Theatre Missile Defence (TMD) systems that would be suitable for deploy ment and operation in a European theatre. The paper focuses on the problems of threat classification and discrimination in TtD systems and highlights the role of optical sensors. The paper discusses the integration of data derived from optical and radar sensors 6 and expands upon work previously reported into the use of an Artificial Intelligence (AI) approach to object classification and discrimination.

  12. The new fluorescence enhancement system Eu3+-ARADE-HMTM-AI3+ and its analytical application

    International Nuclear Information System (INIS)

    Wenwu Quin; Weisheng Liu; Tianlin Yang

    2004-01-01

    A new bis-Schiff base ligand, N,N -bis-(4-N-aminothiourea-2-amylidene)-4,4 -diaminodiphenyl ether (ARADE), was synthesized. Its complex with Eu 3+ in DMF emits the intrinsic fluorescence of Eu 3+ . The fluorescence intensity of the Eu 3+ -ARADE system was enhanced about 60-fold by the addition of hexamethylene tetramine (NMTM) and potash alum. This is a new fluorescence enhancement phenomenon. The excitation and emission wavelengths are 375 nm and 615 nm, respectively. Under optimal conditions, the fluorescence intensities vary linearly with the concentration of Eu 3+ in the range of 7.8x10 -9 -1.75x10 -5 mol L -1 with a detection limit of 5.2x10 -9 mol L -1 , or with the concentration of Al 3+ in the range of 3.1x10 -7 -9.7x10 -5 mol-L -1 with a detection limit of 2.7x10 -7 mol L -1 . The interferences of some rare earth metals and other inorganic ions were described. This method was applied to the determination of Eu 3+ in high purity yttrium oxide and the analysis of AI 3+ in alloy steel standard samples. The mechanism of fluorescence enhancement was also studied. (author)

  13. Google Earth Visualizations of the Marine Automatic Identification System (AIS): Monitoring Ship Traffic in National Marine Sanctuaries

    Science.gov (United States)

    Schwehr, K.; Hatch, L.; Thompson, M.; Wiley, D.

    2007-12-01

    The Automatic Identification System (AIS) is a new technology that provides ship position reports with location, time, and identity information without human intervention from ships carrying the transponders to any receiver listening to the broadcasts. In collaboration with the USCG's Research and Development Center, NOAA's Stellwagen Bank National Marine Sanctuary (SBNMS) has installed 3 AIS receivers around Massachusetts Bay to monitor ship traffic transiting the sanctuary and surrounding waters. The SBNMS and the USCG also worked together propose the shifting the shipping lanes (termed the traffic separation scheme; TSS) that transit the sanctuary slightly to the north to reduce the probability of ship strikes of whales that frequent the sanctuary. Following approval by the United Nation's International Maritime Organization, AIS provided a means for NOAA to assess changes in the distribution of shipping traffic caused by formal change in the TSS effective July 1, 2007. However, there was no easy way to visualize this type of time series data. We have created a software package called noaadata-py to process the AIS ship reports and produce KML files for viewing in Google Earth. Ship tracks can be shown changing over time to allow the viewer to feel the motion of traffic through the sanctuary. The ship tracks can also be gridded to create ship traffic density reports for specified periods of time. The density is displayed as map draped on the sea surface or as vertical histogram columns. Additional visualizations such as bathymetry images, S57 nautical charts, and USCG Marine Information for Safety and Law Enforcement (MISLE) can be combined with the ship traffic visualizations to give a more complete picture of the maritime environment. AIS traffic analyses have the potential to give managers throughout NOAA's National Marine Sanctuaries an improved ability to assess the impacts of ship traffic on the marine resources they seek to protect. Viewing ship traffic

  14. The Simulation of a Major Automated Information System (AIS) on a Microcomputer

    Science.gov (United States)

    1984-03-01

    The AIS would be selected from a public zec cor application. Rationale for this choice are: a. Many public sector organizations have a far richer...19. Boehm, Barry W. and others, Characteristics of Software Quality, North-Holland, 1978. 20. Freeman, Peter and Wasserman, Anthony I., Tutorial on

  15. LuxS/AI-2 system is involved in antibiotic susceptibility and autolysis in Staphylococcus aureus NCTC 8325.

    Science.gov (United States)

    Xue, Ting; Zhao, Liping; Sun, Baolin

    2013-01-01

    Current treatment for Staphylococcus aureus infections relies heavily upon the cell wall synthesis inhibitor antibiotics such as penicillin, oxacillin, vancomycin and teicoplanin. Increasing antibiotic resistance requires the development of new approaches to combating infection. Autoinducer-2 (AI-2) exists widely both in Gram-negative and Gram-positive pathogens and is suggested as a universal language for intraspecies and interspecies communication. This study demonstrates the association between AI-2 signalling and cell wall synthesis inhibitor antibiotic susceptibility in S. aureus. In addition, a luxS mutant exhibited decreased autolysis and upregulated vancomycin resistance-associated VraRS two-component regulatory system. This finding may provide novel clues for antimicrobial therapy in S. aureus infection. Copyright © 2012 Elsevier B.V. and the International Society of Chemotherapy. All rights reserved.

  16. Methods of defining ontologies, word disambiguation methods, computer systems, and articles of manufacture

    Science.gov (United States)

    Sanfilippo, Antonio P [Richland, WA; Tratz, Stephen C [Richland, WA; Gregory, Michelle L [Richland, WA; Chappell, Alan R [Seattle, WA; Whitney, Paul D [Richland, WA; Posse, Christian [Seattle, WA; Baddeley, Robert L [Richland, WA; Hohimer, Ryan E [West Richland, WA

    2011-10-11

    Methods of defining ontologies, word disambiguation methods, computer systems, and articles of manufacture are described according to some aspects. In one aspect, a word disambiguation method includes accessing textual content to be disambiguated, wherein the textual content comprises a plurality of words individually comprising a plurality of word senses, for an individual word of the textual content, identifying one of the word senses of the word as indicative of the meaning of the word in the textual content, for the individual word, selecting one of a plurality of event classes of a lexical database ontology using the identified word sense of the individual word, and for the individual word, associating the selected one of the event classes with the textual content to provide disambiguation of a meaning of the individual word in the textual content.

  17. Electronic Control System Of Home Appliances Using Speech Command Words

    Directory of Open Access Journals (Sweden)

    Aye Min Soe

    2015-06-01

    Full Text Available Abstract The main idea of this paper is to develop a speech recognition system. By using this system smart home appliances are controlled by spoken words. The spoken words chosen for recognition are Fan On Fan Off Light On Light Off TV On and TV Off. The input of the system takes speech signals to control home appliances. The proposed system has two main parts speech recognition and smart home appliances electronic control system. Speech recognition is implemented in MATLAB environment. In this process it contains two main modules feature extraction and feature matching. Mel Frequency Cepstral Coefficients MFCC is used for feature extraction. Vector Quantization VQ approach using clustering algorithm is applied for feature matching. In electrical home appliances control system RF module is used to carry command signal from PC to microcontroller wirelessly. Microcontroller is connected to driver circuit for relay and motor. The input commands are recognized very well. The system is a good performance to control home appliances by spoken words.

  18. AI and health

    OpenAIRE

    Martin Anderson

    2018-01-01

    ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

  19. Formal languages, automata and numeration systems introduction to combinatorics on words

    CERN Document Server

    Rigo, Michel

    2014-01-01

    Formal Languages, Automaton and Numeration Systems presents readers with a review of research related to formal language theory, combinatorics on words or numeration systems, such as Words, DLT (Developments in Language Theory), ICALP, MFCS (Mathematical Foundation of Computer Science), Mons Theoretical Computer Science Days, Numeration, CANT (Combinatorics, Automata and Number Theory). Combinatorics on words deals with problems that can be stated in a non-commutative monoid, such as subword complexity of finite or infinite words, construction and properties of infinite words, unavoidabl

  20. AI and Mathematical Education

    Directory of Open Access Journals (Sweden)

    Angel Garrido

    2012-01-01

    Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

  1. Automatic Prompt System in the Process of Mapping plWordNet on Princeton WordNet

    Directory of Open Access Journals (Sweden)

    Paweł Kędzia

    2015-06-01

    Full Text Available Automatic Prompt System in the Process of Mapping plWordNet on Princeton WordNet The paper offers a critical evaluation of the power and usefulness of an automatic prompt system based on the extended Relaxation Labelling algorithm in the process of (manual mapping plWordNet on Princeton WordNet. To this end the results of manual mapping – that is inter-lingual relations between plWN and PWN synsets – are juxtaposed with the automatic prompts that were generated for the source language synsets to be mapped. We check the number and type of inter-lingual relations introduced on the basis of automatic prompts and the distance of the respective prompt synsets from the actual target language synsets.

  2. Performance Support Systems: Integrating AI, Hypermedia, and CBT to Enhance User Performance.

    Science.gov (United States)

    McGraw, Karen L.

    1994-01-01

    Examines the use of a performance support system (PSS) to enhance user performance on an operational system. Highlights include background information that describes the stimulus for PSS development; discussion of the major PSS components and the technology they require; and discussion of the design of a PSS for a complex database system.…

  3. Modulation of the semantic system by word imageability.

    Science.gov (United States)

    Sabsevitz, D S; Medler, D A; Seidenberg, M; Binder, J R

    2005-08-01

    A prevailing neurobiological theory of semantic memory proposes that part of our knowledge about concrete, highly imageable concepts is stored in the form of sensory-motor representations. While this theory predicts differential activation of the semantic system by concrete and abstract words, previous functional imaging studies employing this contrast have provided relatively little supporting evidence. We acquired event-related functional magnetic resonance imaging (fMRI) data while participants performed a semantic similarity judgment task on a large number of concrete and abstract noun triads. Task difficulty was manipulated by varying the degree to which the words in the triad were similar in meaning. Concrete nouns, relative to abstract nouns, produced greater activation in a bilateral network of multimodal and heteromodal association areas, including ventral and medial temporal, posterior-inferior parietal, dorsal prefrontal, and posterior cingulate cortex. In contrast, abstract nouns produced greater activation almost exclusively in the left hemisphere in superior temporal and inferior frontal cortex. Increasing task difficulty modulated activation mainly in attention, working memory, and response monitoring systems, with almost no effect on areas that were modulated by imageability. These data provide critical support for the hypothesis that concrete, imageable concepts activate perceptually based representations not available to abstract concepts. In contrast, processing abstract concepts makes greater demands on left perisylvian phonological and lexical retrieval systems. The findings are compatible with dual coding theory and less consistent with single-code models of conceptual representation. The lack of overlap between imageability and task difficulty effects suggests that once the neural representation of a concept is activated, further maintenance and manipulation of that information in working memory does not further increase neural activation in

  4. Adding Learning to Knowledge-Based Systems: Taking the "Artificial" Out of AI

    Science.gov (United States)

    Daniel L. Schmoldt

    1997-01-01

    Both, knowledge-based systems (KBS) development and maintenance require time-consuming analysis of domain knowledge. Where example cases exist, KBS can be built, and later updated, by incorporating learning capabilities into their architecture. This applies to both supervised and unsupervised learning scenarios. In this paper, the important issues for learning systems-...

  5. SHARP: A multi-mission AI system for spacecraft telemetry monitoring and diagnosis

    Science.gov (United States)

    Lawson, Denise L.; James, Mark L.

    1989-01-01

    The Spacecraft Health Automated Reasoning Prototype (SHARP) is a system designed to demonstrate automated health and status analysis for multi-mission spacecraft and ground data systems operations. Telecommunications link analysis of the Voyager II spacecraft is the initial focus for the SHARP system demonstration which will occur during Voyager's encounter with the planet Neptune in August, 1989, in parallel with real-time Voyager operations. The SHARP system combines conventional computer science methodologies with artificial intelligence techniques to produce an effective method for detecting and analyzing potential spacecraft and ground systems problems. The system performs real-time analysis of spacecraft and other related telemetry, and is also capable of examining data in historical context. A brief introduction is given to the spacecraft and ground systems monitoring process at the Jet Propulsion Laboratory. The current method of operation for monitoring the Voyager Telecommunications subsystem is described, and the difficulties associated with the existing technology are highlighted. The approach taken in the SHARP system to overcome the current limitations is also described, as well as both the conventional and artificial intelligence solutions developed in SHARP.

  6. Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

    OpenAIRE

    Yampolskiy, Roman V.; Spellchecker, M. S.

    2016-01-01

    In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

  7. UFC advisor: An AI-based system for the automatic test environment

    Science.gov (United States)

    Lincoln, David T.; Fink, Pamela K.

    1990-01-01

    The Air Logistics Command within the Air Force is responsible for maintaining a wide variety of aircraft fleets and weapon systems. To maintain these fleets and systems requires specialized test equipment that provides data concerning the behavior of a particular device. The test equipment is used to 'poke and prod' the device to determine its functionality. The data represent voltages, pressures, torques, temperatures, etc. and are called testpoints. These testpoints can be defined numerically as being in or out of limits/tolerance. Some test equipment is termed 'automatic' because it is computer-controlled. Due to the fact that effective maintenance in the test arena requires a significant amount of expertise, it is an ideal area for the application of knowledge-based system technology. Such a system would take testpoint data, identify values out-of-limits, and determine potential underlying problems based on what is out-of-limits and how far. This paper discusses the application of this technology to a device called the Unified Fuel Control (UFC) which is maintained in this manner.

  8. Behaviour based Mobile Robot Navigation Technique using AI System: Experimental Investigation on Active Media Pioneer Robot

    Directory of Open Access Journals (Sweden)

    S. Parasuraman, V.Ganapathy

    2012-10-01

    Full Text Available A key issue in the research of an autonomous robot is the design and development of the navigation technique that enables the robot to navigate in a real world environment. In this research, the issues investigated and methodologies established include (a Designing of the individual behavior and behavior rule selection using Alpha level fuzzy logic system  (b Designing of the controller, which maps the sensors input to the motor output through model based Fuzzy Logic Inference System and (c Formulation of the decision-making process by using Alpha-level fuzzy logic system. The proposed method is applied to Active Media Pioneer Robot and the results are discussed and compared with most accepted methods. This approach provides a formal methodology for representing and implementing the human expert heuristic knowledge and perception-based action in mobile robot navigation. In this approach, the operational strategies of the human expert driver are transferred via fuzzy logic to the robot navigation in the form of a set of simple conditional statements composed of linguistic variables.Keywards: Mobile robot, behavior based control, fuzzy logic, alpha level fuzzy logic, obstacle avoidance behavior and goal seek behavior

  9. Artificial Intelligence Study (AIS).

    Science.gov (United States)

    1987-02-01

    ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

  10. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2011-01-01

    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  11. The Relevance of AI Research to CAI.

    Science.gov (United States)

    Kearsley, Greg P.

    This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

  12. One Language, Two Number-Word Systems and Many Problems: Numerical Cognition in the Czech Language

    Science.gov (United States)

    Pixner, S.; Zuber, J.; Hermanova, V.; Kaufmann, L.; Nuerk, H.-C.; Moeller, K.

    2011-01-01

    Comparing numerical performance between different languages does not only mean comparing different number-word systems, but also implies a comparison of differences regarding culture or educational systems. The Czech language provides the remarkable opportunity to disentangle this confound as there exist two different number-word systems within…

  13. One language, two number-word systems and many problems: numerical cognition in the Czech language.

    Science.gov (United States)

    Pixner, S; Zuber, J; Heřmanová, V; Kaufmann, L; Nuerk, H-C; Moeller, K

    2011-01-01

    Comparing numerical performance between different languages does not only mean comparing different number-word systems, but also implies a comparison of differences regarding culture or educational systems. The Czech language provides the remarkable opportunity to disentangle this confound as there exist two different number-word systems within the same language: for instance, "25" can be either coded in non-inverted order "dvadsetpät" [twenty-five] or in inverted order "pätadvadset" [five-and-twenty]. To investigate the influence of the number-word system on basic numerical processing within one culture, 7-year-old Czech-speaking children had to perform a transcoding task (i.e., writing Arabic numbers to dictation) in both number-word systems. The observed error pattern clearly indicated that the structure of the number-word system determined transcoding performance reliably: In the inverted number-word system about half of all errors were inversion-related. In contrast, hardly any inversion-related errors occurred in the non-inverted number-word system. We conclude that the development of numerical cognition does not only depend on cultural or educational differences, but is indeed related to the structure and transparency of a given number-word system. Copyright © 2011 Elsevier Ltd. All rights reserved.

  14. Development of AI (Artificial Intelligence)-based simulation system for man-machine system behavior in accidental situations of nuclear power plant

    International Nuclear Information System (INIS)

    Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya; Kawase, Katumi.

    1996-01-01

    A prototype version of a computer simulation system named JACOS (JAeri COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of an NPP (nuclear power plant). The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also modeled. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. Some simulations of incidents were performed to verify the human model. It was found that AI-techniques used in the human model are suitable to simulate the operator's cognitive behavior in an NPP accident. The models of cognitive characteristics were investigated in the effects on simulated results of cognitive behaviors. (author)

  15. Discoveries in the Solar System: Spreading the Good Word

    Science.gov (United States)

    Radebaugh, Jani

    2015-11-01

    Solar system exploration in recent years has completely captured the interest of the public worldwide, and we as scientists can play a unique role in disseminating this information. The public wants to hear from us about the latest results from the Pluto flyby, to see the newest Titan image, to hear stories of the plucky Philae comet lander and to hear our thoughts on the Earth-like exoplanet, even if we are not directly involved in these missions or discoveries. They trust us, because they know our background makes us viable judges of the value of these endeavors. The public relies on us to distill the material, which is typically science-jargon-rich, into something inspiring and digestible by them in the time they have available. The best way to start reaching out is to find and distribute what most excites us, because it is clearly obvious when we’re truly excited about something as opposed to just regurgitating the latest and greatest. If you like the latest picture from MSL because it looks like your back yard, show a picture of the two next to each other. We should be familiar with, and even solicit, the different outreach platforms, such as such as social media of various kinds, public talks in all shapes and forms, news venues, including radio and TV, and popular articles. Finally, we need to know our audience, prepare and practice. I have never given the exact same outreach talk twice, because the audience is always slightly different. The last two public talks I gave were carefully worded, practiced and even partly memorized, which gave me an edge of preparedness that allowed me to be more dynamic. Being involved in outreach, in the best way for you, will make you happier and better focused in your research, will ensure the public supports NASA, and will make a positive impact in the lives of many people.

  16. Dynamic burstiness of word-occurrence and network modularity in textbook systems

    Science.gov (United States)

    Cui, Xue-Mei; Yoon, Chang No; Youn, Hyejin; Lee, Sang Hoon; Jung, Jean S.; Han, Seung Kee

    2017-12-01

    We show that the dynamic burstiness of word occurrence in textbook systems is attributed to the modularity of the word association networks. At first, a measure of dynamic burstiness is introduced to quantify burstiness of word occurrence in a textbook. The advantage of this measure is that the dynamic burstiness is decomposable into two contributions: one coming from the inter-event variance and the other from the memory effects. Comparing network structures of physics textbook systems with those of surrogate random textbooks without the memory or variance effects are absent, we show that the network modularity increases systematically with the dynamic burstiness. The intra-connectivity of individual word representing the strength of a tie with which a node is bound to a module accordingly increases with the dynamic burstiness, suggesting individual words with high burstiness are strongly bound to one module. Based on the frequency and dynamic burstiness, physics terminology is classified into four categories: fundamental words, topical words, special words, and common words. In addition, we test the correlation between the dynamic burstiness of word occurrence and network modularity using a two-state model of burst generation.

  17. The Use of Hospital Information Systems Data Base with Word Processing and Other Medical Records System Applications

    OpenAIRE

    Rusnak, James E.

    1982-01-01

    The approach frequently used to introduce computer technology into a hospital Medical Records Department is to implement a Word Processing System. Word processing is a form of computer system application that is intended to improve the department's productivity by improving the medical information transcription process. The effectiveness of the Word Processing System may be further enhanced by installing system facilities to provide access to data processing file information in the Hospital's...

  18. T'ai Chi

    Science.gov (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  19. Modeling Progress in AI

    OpenAIRE

    Brundage, Miles

    2015-01-01

    Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

  20. Short-term retention of pictures and words: evidence for dual coding systems.

    Science.gov (United States)

    Pellegrino, J W; Siegel, A W; Dhawan, M

    1975-03-01

    The recall of picture and word triads was examined in three experiments that manipulated the type of distraction in a Brown-Peterson short-term retention task. In all three experiments recall of pictures was superior to words under auditory distraction conditions. Visual distraction produced high performance levels with both types of stimuli, whereas combined auditory and visual distraction significantly reduced picture recall without further affecting word recall. The results were interpreted in terms of the dual coding hypothesis and indicated that pictures are encoded into separate visual and acoustic processing systems while words are primarily acoustically encoded.

  1. Words, Words, Words: English, Vocabulary.

    Science.gov (United States)

    Lamb, Barbara

    The Quinmester course on words gives the student the opportunity to increase his proficiency by investigating word origins, word histories, morphology, and phonology. The course includes the following: dictionary skills and familiarity with the "Oxford,""Webster's Third," and "American Heritage" dictionaries; word…

  2. Why Don't Accounting Students like AIS?

    Science.gov (United States)

    Vatanasakdakul, Savanid; Aoun, Chadi

    2011-01-01

    Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

  3. Organisational intelligence and distributed AI

    OpenAIRE

    Kirn, Stefan

    1995-01-01

    The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

  4. AIS Ship Traffic: Hawaii: 2011-2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  5. National AIS at 1 Minute Intervals

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

  6. Areal Informations Systemet - AIS

    DEFF Research Database (Denmark)

    Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

    Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

  7. A Text Steganographic System Based on Word Length Entropy Rate

    Directory of Open Access Journals (Sweden)

    Francis Xavier Kofi Akotoye

    2017-10-01

    Full Text Available The widespread adoption of electronic distribution of material is accompanied by illicit copying and distribution. This is why individuals, businesses and governments have come to think of how to protect their work, prevent such illicit activities and trace the distribution of a document. It is in this context that a lot of attention is being focused on steganography. Implementing steganography in text document is not an easy undertaking considering the fact that text document has very few places in which to embed hidden data. Any minute change introduced to text objects can easily be noticed thus attracting attention from possible hackers. This study investigates the possibility of embedding data in text document by employing the entropy rate of the constituent characters of words not less than four characters long. The scheme was used to embed bits in text according to the alphabetic structure of the words, the respective characters were compared with their neighbouring characters and if the first character was alphabetically lower than the succeeding character according to their ASCII codes, a zero bit was embedded otherwise 1 was embedded after the characters had been transposed. Before embedding, the secret message was encrypted with a secret key to add a layer of security to the secret message to be embedded, and then a pseudorandom number was generated from the word counts of the text which was used to paint the starting point of the embedding process. The embedding capacity of the scheme was relatively high compared with the space encoding and semantic method.

  8. Parts-of-speech systems and word order

    DEFF Research Database (Denmark)

    Hengeveld, Kees; Rijkhoff, Jan; Siewierska, Anna

    2004-01-01

    are rather restricted in these languages. Counterexamples to the latter claim all involve cases in which identifiability is ensured by morphological rather than syntactic means. This shows that there is a balanced trade-off between the syntactic, morphological, and lexical structure of a language.......), the identifiability of these slots is ensured by the nature of the lexical items (e.g. adjectives) themselves. As a result, word order possibilities are relatively unrestricted in these languages. In languages in which lexical items are not specialized for certain syntactic slots, in that these items combine...

  9. MassAI

    DEFF Research Database (Denmark)

    2011-01-01

    A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

  10. Artificial intelligence. Fears of an AI pioneer.

    Science.gov (United States)

    Russell, Stuart; Bohannon, John

    2015-07-17

    From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

  11. Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)

    OpenAIRE

    Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

  12. Learning game AI programming with Lua

    CERN Document Server

    Young, David

    2014-01-01

    If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

  13. An automatic system for Turkish word recognition using Discrete Wavelet Neural Network based on adaptive entropy

    International Nuclear Information System (INIS)

    Avci, E.

    2007-01-01

    In this paper, an automatic system is presented for word recognition using real Turkish word signals. This paper especially deals with combination of the feature extraction and classification from real Turkish word signals. A Discrete Wavelet Neural Network (DWNN) model is used, which consists of two layers: discrete wavelet layer and multi-layer perceptron. The discrete wavelet layer is used for adaptive feature extraction in the time-frequency domain and is composed of Discrete Wavelet Transform (DWT) and wavelet entropy. The multi-layer perceptron used for classification is a feed-forward neural network. The performance of the used system is evaluated by using noisy Turkish word signals. Test results showing the effectiveness of the proposed automatic system are presented in this paper. The rate of correct recognition is about 92.5% for the sample speech signals. (author)

  14. Object words modulate the activity of the mirror neuron system during action imitation.

    Science.gov (United States)

    Wu, Haiyan; Tang, Honghong; Ge, Yue; Yang, Suyong; Mai, Xiaoqin; Luo, Yue-Jia; Liu, Chao

    2017-11-01

    Although research has demonstrated that the mirror neuron system (MNS) plays a crucial role in both action imitation and action-related semantic processing, whether action-related words can inversely modulate the MNS activity remains unclear. Here, three types of task-irrelevant words (body parts, verbs, and manufactured objects) were presented to examine the modulation effect of these words on the MNS activity during action observation and imitation. Twenty-two participants were recruited for the fMRI scanning and remaining data from 19 subjects were reported here. Brain activity results showed that word types elicited different modulation effects over nodes of the MNS (i.e., the right inferior frontal gyrus, premotor cortex, inferior parietal lobule, and STS), especially during the imitation stage. Compared with other word conditions, action imitation following manufactured objects words induced stronger activation in these brain regions during the imitation stage. These results were consistent in both task-dependent and -independent ROI analysis. Our findings thus provide evidence for the unique effect of object words on the MNS during imitation of action, which may also confirm the key role of goal inference in action imitation.

  15. AIS ASM Operational Integration Plan

    Science.gov (United States)

    2013-08-01

    Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

  16. General general game AI

    OpenAIRE

    Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

    2016-01-01

    Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

  17. Risk Reducing Effect of AIS Implementation on Collision Risk

    DEFF Research Database (Denmark)

    Lützen, Marie; Friis-Hansen, Peter

    2003-01-01

    AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

  18. Discussion on AI Technology in Information Library Design

    OpenAIRE

    日比野, 省三; Shozo, HIBINO; 中京大学社会学部

    1987-01-01

    This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

  19. Word classes

    DEFF Research Database (Denmark)

    Rijkhoff, Jan

    2007-01-01

    in grammatical descriptions of some 50 languages, which together constitute a representative sample of the world’s languages (Hengeveld et al. 2004: 529). It appears that there are both quantitative and qualitative differences between word class systems of individual languages. Whereas some languages employ...... a parts-of-speech system that includes the categories Verb, Noun, Adjective and Adverb, other languages may use only a subset of these four lexical categories. Furthermore, quite a few languages have a major word class whose members cannot be classified in terms of the categories Verb – Noun – Adjective...... – Adverb, because they have properties that are strongly associated with at least two of these four traditional word classes (e.g. Adjective and Adverb). Finally, this article discusses some of the ways in which word class distinctions interact with other grammatical domains, such as syntax and morphology....

  20. AI 3D Cybug Gaming

    OpenAIRE

    Ahmed, Zeeshan

    2010-01-01

    In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

  1. A Business Application of the System Dynamics Approach: Word-of-Mouth and Its Effect in an Online Environment

    Directory of Open Access Journals (Sweden)

    Shirley Ye Sheng

    2012-06-01

    Full Text Available In this article, we illustrate the use of system dynamics modeling approach to study a complex system: word-of-mouth. Word-of-mouth plays an important role in reducing risk and uncertainty in purchase and consumption. Most of the prior research on word-of-mouth focused on studying either the factors that trigger consumers’ participation (sending or receiving in word-of-mouth activities or the impact word-of-mouth information has on consumers’ buying decisions. The relationship between the two decision processes, however, is recursive and dynamic. Most prior studies have not focused on a recursive relationship. Our objective is to present a system dynamics model for the study of the relationship between the buying decision and the decision to participate in word-of-mouth communication. We also discuss how system dynamics modeling can be used in other complex problems in business such as the creation of a global business.

  2. AI, automation and the Flight Telerobotic Servicer

    Science.gov (United States)

    Goforth, Andre; Dominy, Robert

    1988-01-01

    A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

  3. An efficient word typing P300-BCI system using a modified T9 interface and random forest classifier.

    Science.gov (United States)

    Akram, Faraz; Han, Seung Moo; Kim, Tae-Seong

    2015-01-01

    A typical P300-based spelling brain computer interface (BCI) system types a single character with a character presentation paradigm and a P300 classification system. Lately, a few attempts have been made to type a whole word with the help of a smart dictionary that suggests some candidate words with the input of a few initial characters. In this paper, we propose a novel paradigm utilizing initial character typing with word suggestions and a novel P300 classifier to increase word typing speed and accuracy. The novel paradigm involves modifying the Text on 9 keys (T9) interface, which is similar to the keypad of a mobile phone used for text messaging. Users can type the initial characters using a 3×3 matrix interface and an integrated custom-built dictionary that suggests candidate words as the user types the initials. Then the user can select one of the given suggestions to complete word typing. We have adopted a random forest classifier, which significantly improves P300 classification accuracy by combining multiple decision trees. We conducted experiments with 10 subjects using the proposed BCI system. Our proposed paradigms significantly reduced word typing time and made word typing more convenient by outputting complete words with only a few initial character inputs. The conventional spelling system required an average time of 3.47 min per word while typing 10 random words, whereas our proposed system took an average time of 1.67 min per word, a 51.87% improvement, for the same words under the same conditions. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. Man-machine communication in reactor control using AI methods

    International Nuclear Information System (INIS)

    Klebau, J.; Lindner, A.; Fiedler, U.

    1987-01-01

    In the last years the interest in process control has expecially focused on problems of man-machine communication. It depends on its great importance to process performance and user acceptance. Advanced computerized operator aids, e.g. in nuclear power plants, are as well as their man-machine interface. In the Central Institute for Nuclear Research in Rossendorf a computerized operator support system for nuclear power plants is designed, which is involved in a decentralized process automation system. A similar but simpler system, the Hierarchical Informational System (HIS) at the Rossendorf Research Reactor, works with a computer controlled man-machine interface, based on menu. In the special case of the disturbance analysis program SAAP-2, which is included in the HIS, the limits of menu techniques are obviously. Therefore it seems to be necessary and with extended hard- and software possible to realize an user controlled natural language interface using Artificial Intelligence (AI) methods. The draft of such a system is described. It should be able to learn during a teaching phase all phrases and their meanings. The system will work on the basis of a self-organizing, associative data structure. It is used to recognize a great amount of words which are used in language analysis. Error recognition and, if possible, correction is done by means of a distance function in the word set. Language analysis should be carried out with a simplified word class controlled functional analysis. With this interface it is supposed to get experience in intelligent man-machine communication to enhance operational safety in future. (author)

  5. Sistema de monitoreo de embarcaciones de pesca artesanal de Anconcito, provincia de Santa Elena, Ecuador, utilizando tecnología AIS - Automatic Identification System

    Directory of Open Access Journals (Sweden)

    Ashley Avilés Bastidas

    2017-06-01

    Full Text Available Ante la evidente crisis que se está presentando en Ecuador debido al incremento en los índices de robos en altamar, principalmente de los motores fuera de borda de las lanchas de pesca artesanal, es necesario implementar un sistema de control eficaz que ofrezca seguridad para la comunidad pesquera; con este fin se propone un sistema de detección de embarcaciones de pesca artesanal con tecnología AIS. En este estudio se explican todos los beneficios que ofrece esta tecnología que actualmente se usa para el monitoreo de buques, así como las aplicaciones para un sistema de monitoreo de embarcaciones pequeñas, las clases de equipos disponibles y sus principales características. Con este objetivo se propone el diseño de una red que permita ubicar las embarcaciones de la comunidad pesquera de Anconcito, que es una de las zonas más afectadas por la delincuencia. Además, se anticipan los resultados esperados con este diseño y varias alternativas técnicas para mejorar la cobertura del sistema. Abstract Given the evident crisis that is occurring in Ecuador due to the increase in the rates of robberies on the high seas, mainly of the outboard motorboats of the artisanal fishing boats, it is necessary to implement an effective control system that provides security for the fishing community. To this end, a system of detection of artisanal fishing vessels with AIS technology is proposed. In this study, all the benefits of this technology are explained which is currently used for monitoring ships, as well as the applications for a monitoring system of small boats, the kinds of equipment available and their main characteristics. With this objective, the design of a network that allows locate the vessels of the fishing community of Anconcito, which is one of the areas most affected by crime, is proposed. In addition, the expected results with this design and several technical alternatives to improve the coverage of the system are anticipated.

  6. Model of the Dynamic Construction Process of Texts and Scaling Laws of Words Organization in Language Systems.

    Science.gov (United States)

    Li, Shan; Lin, Ruokuang; Bian, Chunhua; Ma, Qianli D Y; Ivanov, Plamen Ch

    2016-01-01

    Scaling laws characterize diverse complex systems in a broad range of fields, including physics, biology, finance, and social science. The human language is another example of a complex system of words organization. Studies on written texts have shown that scaling laws characterize the occurrence frequency of words, words rank, and the growth of distinct words with increasing text length. However, these studies have mainly concentrated on the western linguistic systems, and the laws that govern the lexical organization, structure and dynamics of the Chinese language remain not well understood. Here we study a database of Chinese and English language books. We report that three distinct scaling laws characterize words organization in the Chinese language. We find that these scaling laws have different exponents and crossover behaviors compared to English texts, indicating different words organization and dynamics of words in the process of text growth. We propose a stochastic feedback model of words organization and text growth, which successfully accounts for the empirically observed scaling laws with their corresponding scaling exponents and characteristic crossover regimes. Further, by varying key model parameters, we reproduce differences in the organization and scaling laws of words between the Chinese and English language. We also identify functional relationships between model parameters and the empirically observed scaling exponents, thus providing new insights into the words organization and growth dynamics in the Chinese and English language.

  7. Model of the Dynamic Construction Process of Texts and Scaling Laws of Words Organization in Language Systems.

    Directory of Open Access Journals (Sweden)

    Shan Li

    Full Text Available Scaling laws characterize diverse complex systems in a broad range of fields, including physics, biology, finance, and social science. The human language is another example of a complex system of words organization. Studies on written texts have shown that scaling laws characterize the occurrence frequency of words, words rank, and the growth of distinct words with increasing text length. However, these studies have mainly concentrated on the western linguistic systems, and the laws that govern the lexical organization, structure and dynamics of the Chinese language remain not well understood. Here we study a database of Chinese and English language books. We report that three distinct scaling laws characterize words organization in the Chinese language. We find that these scaling laws have different exponents and crossover behaviors compared to English texts, indicating different words organization and dynamics of words in the process of text growth. We propose a stochastic feedback model of words organization and text growth, which successfully accounts for the empirically observed scaling laws with their corresponding scaling exponents and characteristic crossover regimes. Further, by varying key model parameters, we reproduce differences in the organization and scaling laws of words between the Chinese and English language. We also identify functional relationships between model parameters and the empirically observed scaling exponents, thus providing new insights into the words organization and growth dynamics in the Chinese and English language.

  8. AI its nature and future

    CERN Document Server

    Boden, Margaret A

    2016-01-01

    least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

  9. Nursery words and hypocorisms among Germanic kinship terms

    DEFF Research Database (Denmark)

    Hansen, Bjarne Simmelkjær Sandgaard

    2018-01-01

    By using Jakobson’s (1960: 127-130) criteria for determining the nursery-word sta-tus of a given lexeme, I argue in this article that, even if we should no longer re-gard PG *aiþīn-/-ōn- ‘mother’ (Goth. aiþei), *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ as nursery words...

  10. Some words on Word

    NARCIS (Netherlands)

    Janssen, Maarten; Visser, A.

    In many disciplines, the notion of a word is of central importance. For instance, morphology studies le mot comme tel, pris isol´ement (Mel’ˇcuk, 1993 [74]). In the philosophy of language the word was often considered to be the primary bearer of meaning. Lexicography has as its fundamental role

  11. Integrating the Wall Street Journal into AIS Courses

    Science.gov (United States)

    Kohlmeyer, James M., III

    2008-01-01

    While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

  12. Application of AI techniques to a voice-actuated computer system for reconstructing and displaying magnetic resonance imaging data

    Science.gov (United States)

    Sherley, Patrick L.; Pujol, Alfonso, Jr.; Meadow, John S.

    1990-07-01

    To provide a means of rendering complex computer architectures languages and input/output modalities transparent to experienced and inexperienced users research is being conducted to develop a voice driven/voice response computer graphics imaging system. The system will be used for reconstructing and displaying computed tomography and magnetic resonance imaging scan data. In conjunction with this study an artificial intelligence (Al) control strategy was developed to interface the voice components and support software to the computer graphics functions implemented on the Sun Microsystems 4/280 color graphics workstation. Based on generated text and converted renditions of verbal utterances by the user the Al control strategy determines the user''s intent and develops and validates a plan. The program type and parameters within the plan are used as input to the graphics system for reconstructing and displaying medical image data corresponding to that perceived intent. If the plan is not valid the control strategy queries the user for additional information. The control strategy operates in a conversation mode and vocally provides system status reports. A detailed examination of the various AT techniques is presented with major emphasis being placed on their specific roles within the total control strategy structure. 1.

  13. Face recognition system and method using face pattern words and face pattern bytes

    Science.gov (United States)

    Zheng, Yufeng

    2014-12-23

    The present invention provides a novel system and method for identifying individuals and for face recognition utilizing facial features for face identification. The system and method of the invention comprise creating facial features or face patterns called face pattern words and face pattern bytes for face identification. The invention also provides for pattern recognitions for identification other than face recognition. The invention further provides a means for identifying individuals based on visible and/or thermal images of those individuals by utilizing computer software implemented by instructions on a computer or computer system and a computer readable medium containing instructions on a computer system for face recognition and identification.

  14. Universal brain systems for recognizing word shapes and handwriting gestures during reading.

    Science.gov (United States)

    Nakamura, Kimihiro; Kuo, Wen-Jui; Pegado, Felipe; Cohen, Laurent; Tzeng, Ovid J L; Dehaene, Stanislas

    2012-12-11

    Do the neural circuits for reading vary across culture? Reading of visually complex writing systems such as Chinese has been proposed to rely on areas outside the classical left-hemisphere network for alphabetic reading. Here, however, we show that, once potential confounds in cross-cultural comparisons are controlled for by presenting handwritten stimuli to both Chinese and French readers, the underlying network for visual word recognition may be more universal than previously suspected. Using functional magnetic resonance imaging in a semantic task with words written in cursive font, we demonstrate that two universal circuits, a shape recognition system (reading by eye) and a gesture recognition system (reading by hand), are similarly activated and show identical patterns of activation and repetition priming in the two language groups. These activations cover most of the brain regions previously associated with culture-specific tuning. Our results point to an extended reading network that invariably comprises the occipitotemporal visual word-form system, which is sensitive to well-formed static letter strings, and a distinct left premotor region, Exner's area, which is sensitive to the forward or backward direction with which cursive letters are dynamically presented. These findings suggest that cultural effects in reading merely modulate a fixed set of invariant macroscopic brain circuits, depending on surface features of orthographies.

  15. Using Analysis Increments (AI) to Estimate and Correct Systematic Errors in the Global Forecast System (GFS) Online

    Science.gov (United States)

    Bhargava, K.; Kalnay, E.; Carton, J.; Yang, F.

    2017-12-01

    Systematic forecast errors, arising from model deficiencies, form a significant portion of the total forecast error in weather prediction models like the Global Forecast System (GFS). While much effort has been expended to improve models, substantial model error remains. The aim here is to (i) estimate the model deficiencies in the GFS that lead to systematic forecast errors, (ii) implement an online correction (i.e., within the model) scheme to correct GFS following the methodology of Danforth et al. [2007] and Danforth and Kalnay [2008, GRL]. Analysis Increments represent the corrections that new observations make on, in this case, the 6-hr forecast in the analysis cycle. Model bias corrections are estimated from the time average of the analysis increments divided by 6-hr, assuming that initial model errors grow linearly and first ignoring the impact of observation bias. During 2012-2016, seasonal means of the 6-hr model bias are generally robust despite changes in model resolution and data assimilation systems, and their broad continental scales explain their insensitivity to model resolution. The daily bias dominates the sub-monthly analysis increments and consists primarily of diurnal and semidiurnal components, also requiring a low dimensional correction. Analysis increments in 2015 and 2016 are reduced over oceans, which is attributed to improvements in the specification of the SSTs. These results encourage application of online correction, as suggested by Danforth and Kalnay, for mean, seasonal and diurnal and semidiurnal model biases in GFS to reduce both systematic and random errors. As the error growth in the short-term is still linear, estimated model bias corrections can be added as a forcing term in the model tendency equation to correct online. Preliminary experiments with GFS, correcting temperature and specific humidity online show reduction in model bias in 6-hr forecast. This approach can then be used to guide and optimize the design of sub

  16. The LuxS/AI-2 Quorum-Sensing System of Streptococcus pneumoniae Is Required to Cause Disease, and to Regulate Virulence- and Metabolism-Related Genes in a Rat Model of Middle Ear Infection

    Directory of Open Access Journals (Sweden)

    Mukesh K. Yadav

    2018-05-01

    Full Text Available Objective:Streptococcus pneumoniae colonizes the nasopharynx of children, and from nasopharynx it could migrate to the middle ear and causes acute otitis media (AOM. During colonization and AOM, the pneumococcus forms biofilms. In vitro biofilm formation requires a functional LuxS/AI-2 quorum-sensing system. We investigated the role of LuxS/AI-2 signaling in pneumococcal middle ear infection, and identified the genes that are regulated by LuxS/AI-2 during pneumococcal biofilm formation.Methods:Streptococcus pneumoniae D39 wild-type and an isogenic D39ΔluxS strain were utilized to evaluate in vitro biofilm formation, and in vivo colonization and epithelial damage using a microtiter plate assay and a rat model of pneumococcal middle ear infection, respectively. Biofilm structures and colonization and epithelial damage were evaluated at the ultrastructural level by scanning electron microscopy and confocal microscopy. Microarrays were used to investigate the global genes that were regulated by LuxS/AI-2 during biofilm formation.Results: The biofilm biomass and density of D39ΔluxS were significantly (p < 0.05 lower than those of D39 wild-type. SEM and confocal microscopy revealed that D39ΔluxS formed thin biofilms in vitro compared with D39 wild-type. The in vivo model of middle ear infection showed that D39ΔluxS resulted in ~60% less (p < 0.05 bacterial colonization than the wild-type. SEM analysis of the rat middle ears revealed dense biofilm-like cell debris deposited on the cilia in wild-type D39-infected rats. However, little cell debris was deposited in the middle ears of the D39ΔluxS-inoculated rats, and the cilia were visible. cDNA-microarray analysis revealed 117 differentially expressed genes in D39ΔluxS compared with D39 wild-type. Among the 66 genes encoding putative proteins and previously characterized proteins, 60 were significantly downregulated, whereas 6 were upregulated. Functional annotation revealed that genes involved in

  17. Code AI Personal Web Pages

    Science.gov (United States)

    Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

    1998-01-01

    The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

  18. Do handwritten words magnify lexical effects in visual word recognition?

    Science.gov (United States)

    Perea, Manuel; Gil-López, Cristina; Beléndez, Victoria; Carreiras, Manuel

    2016-01-01

    An examination of how the word recognition system is able to process handwritten words is fundamental to formulate a comprehensive model of visual word recognition. Previous research has revealed that the magnitude of lexical effects (e.g., the word-frequency effect) is greater with handwritten words than with printed words. In the present lexical decision experiments, we examined whether the quality of handwritten words moderates the recruitment of top-down feedback, as reflected in word-frequency effects. Results showed a reading cost for difficult-to-read and easy-to-read handwritten words relative to printed words. But the critical finding was that difficult-to-read handwritten words, but not easy-to-read handwritten words, showed a greater word-frequency effect than printed words. Therefore, the inherent physical variability of handwritten words does not necessarily boost the magnitude of lexical effects.

  19. Social coordination in toddler's word learning: interacting systems of perception and action

    Science.gov (United States)

    Pereira, Alfredo; Smith, Linda; Yu, Chen

    2008-06-01

    We measured turn-taking in terms of hand and head movements and asked if the global rhythm of the participants' body activity relates to word learning. Six dyads composed of parents and toddlers (M=18 months) interacted in a tabletop task wearing motion-tracking sensors on their hands and head. Parents were instructed to teach the labels of 10 novel objects and the child was later tested on a name-comprehension task. Using dynamic time warping, we compared the motion data of all body-part pairs, within and between partners. For every dyad, we also computed an overall measure of the quality of the interaction, that takes into consideration the state of interaction when the parent uttered an object label and the overall smoothness of the turn-taking. The overall interaction quality measure was correlated with the total number of words learned. In particular, head movements were inversely related to other partner's hand movements, and the degree of bodily coupling of parent and toddler predicted the words that children learned during the interaction. The implications of joint body dynamics to understanding joint coordination of activity in a social interaction, its scaffolding effect on the child's learning and its use in the development of artificial systems are discussed.

  20. SDI satellite autonomy using AI and Ada

    Science.gov (United States)

    Fiala, Harvey E.

    1990-01-01

    The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

  1. Word Frequencies in Written and Spoken English

    African Journals Online (AJOL)

    R.B. Ruthven

    data of the corpus and includes more formal audio material (lectures, TV and ... meticulous word-class tagging of nouns, adjectives, verbs etc., this book is not limited to word ... Fréquences d'utilisation des mots en français écrit contemporain.

  2. Managing bioengineering complexity with AI techniques.

    Science.gov (United States)

    Beal, Jacob; Adler, Aaron; Yaman, Fusun

    2016-10-01

    Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  3. Is processing of symbols and words influenced by writing system? Evidence from Chinese, Korean, English, and Greek.

    Science.gov (United States)

    Altani, Angeliki; Georgiou, George K; Deng, Ciping; Cho, Jeung-Ryeul; Katopodi, Katerina; Wei, Wei; Protopapas, Athanassios

    2017-12-01

    We examined cross-linguistic effects in the relationship between serial and discrete versions of digit naming and word reading. In total, 113 Mandarin-speaking Chinese children, 100 Korean children, 112 English-speaking Canadian children, and 108 Greek children in Grade 3 were administered tasks of serial and discrete naming of words and digits. Interrelations among tasks indicated that the link between rapid naming and reading is largely determined by the format of the tasks across orthographies. Multigroup path analyses with discrete and serial word reading as dependent variables revealed commonalities as well as significant differences between writing systems. The path coefficient from discrete digits to discrete words was greater for the more transparent orthographies, consistent with more efficient sight-word processing. The effect of discrete word reading on serial word reading was stronger in alphabetic languages, where there was also a suppressive effect of discrete digit naming. However, the effect of serial digit naming on serial word reading did not differ among the four language groups. This pattern of relationships challenges a universal account of reading fluency acquisition while upholding a universal role of rapid serial naming, further distinguishing between multi-element interword and intraword processing. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Human-Assisted AI: an Intelligence Augmentation Approach

    OpenAIRE

    Alicea, Bradly

    2018-01-01

    As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

  5. Signal Words

    Science.gov (United States)

    SIGNAL WORDS TOPIC FACT SHEET NPIC fact sheets are designed to answer questions that are commonly asked by the ... making decisions about pesticide use. What are Signal Words? Signal words are found on pesticide product labels, ...

  6. WORD LEVEL DISCRIMINATIVE TRAINING FOR HANDWRITTEN WORD RECOGNITION

    NARCIS (Netherlands)

    Chen, W.; Gader, P.

    2004-01-01

    Word level training refers to the process of learning the parameters of a word recognition system based on word level criteria functions. Previously, researchers trained lexicon­driven handwritten word recognition systems at the character level individually. These systems generally use statistical

  7. Is the motor system necessary for processing action and abstract emotion words? Evidence from focal brain lesions

    Directory of Open Access Journals (Sweden)

    Felix R. Dreyer

    2015-11-01

    Full Text Available Neuroimaging and neuropsychological experiments suggest that modality-preferential cortices, including motor- and somatosensory areas contribute to the semantic processing of action related concrete words. In contrast, a possible role of modality-preferential – including sensorimotor – areas in processing abstract meaning remains under debate. However, recent fMRI studies indicate an involvement of the left sensorimotor cortex in the processing of abstract-emotional words (e.g. love. But are these areas indeed necessary for processing action-related and abstract words? The current study now investigates word processing in two patients suffering from focal brain lesion in the left frontocentral motor system. A speeded lexical decision task (LDT on meticulously matched word groups showed that the recognition of nouns from different semantic categories – related to food, animals, tools and abstract-emotional concepts – was differentially affected. Whereas patient HS with a lesion in dorsolateral central sensorimotor cortex next to the hand area showed a category-specific deficit in recognizing tool words, patient CA suffering from lesion centered in the left SMA was primarily impaired in abstract-emotional word processing. These results point to a causal role of the motor cortex in the semantic processing of both action-related object concepts and abstract-emotional concepts and therefore suggest that the motor areas previously found active in action-related and abstract word processing can serve a meaning-specific necessary role in word recognition. The category-specific nature of the observed dissociations is difficult to reconcile with the idea that sensorimotor systems are somehow peripheral or ‘epiphenomenal’ to meaning and concept processing. Rather, our results are consistent with the claim that cognition is grounded in action and perception and based on distributed action perception circuits reaching into sensorimotor areas.

  8. Expanding the Possibilities of AIS Data with Heuristics

    Directory of Open Access Journals (Sweden)

    Bjørnar Brende Smestad

    2017-06-01

    Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

  9. AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

    1991-01-01

    This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

  10. Experimental demonstration of improved fiber nonlinearity tolerance for unique-word DFT-spread OFDM systems.

    Science.gov (United States)

    Chen, Xi; Li, An; Gao, Guanjun; Shieh, William

    2011-12-19

    In this paper we experimentally demonstrate transmission performance of optical DFT-spread OFDM systems in comparison with conventional OFDM systems. A 440.8-Gb/s superchannel consisting of 8 x 55.1-Gb/s densely-spaced DFT-S OFDM signal is successfully received after 1120-km transmission with a spectral efficiency of 3.5 b/s/Hz. It is shown that DFT-S OFDM can achieve an improvement of 1 dB in Q factor and 1 dB in launch power over conventional OFDM. Additionally, unique word aided phase estimation algorithm is proposed and demonstrated enabling extremely long OFDM symbol transmission.

  11. Application of AI methods to aircraft guidance and control

    Science.gov (United States)

    Hueschen, Richard M.; Mcmanus, John W.

    1988-01-01

    A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

  12. harnessing_ai_20180319.pptx

    OpenAIRE

    Johnson, Matthew

    2018-01-01

    There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

  13. NASA space station automation: AI-based technology review

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

  14. QML-AiNet: An immune network approach to learning qualitative differential equation models.

    Science.gov (United States)

    Pang, Wei; Coghill, George M

    2015-02-01

    In this paper, we explore the application of Opt-AiNet, an immune network approach for search and optimisation problems, to learning qualitative models in the form of qualitative differential equations. The Opt-AiNet algorithm is adapted to qualitative model learning problems, resulting in the proposed system QML-AiNet. The potential of QML-AiNet to address the scalability and multimodal search space issues of qualitative model learning has been investigated. More importantly, to further improve the efficiency of QML-AiNet, we also modify the mutation operator according to the features of discrete qualitative model space. Experimental results show that the performance of QML-AiNet is comparable to QML-CLONALG, a QML system using the clonal selection algorithm (CLONALG). More importantly, QML-AiNet with the modified mutation operator can significantly improve the scalability of QML and is much more efficient than QML-CLONALG.

  15. AI techniques in geomagnetic storm forecasting

    Science.gov (United States)

    Lundstedt, Henrik

    This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

  16. WordPress as a Content Management System for a Library Web Site: How to Create a Dynamically Generated Subject Guide

    OpenAIRE

    Joshua Dodson

    2008-01-01

    This article explains a method of generating dynamic subject guides through the WordPress content management system. This method includes the use of the Exec-PHP WordPress plugin and additional PHP code to create a new category-based loop within the preexisting WordPress loop. Example code and screenshots are provided.

  17. Optimizing Limousine Service with AI

    OpenAIRE

    Chun, Andy Hon Wai

    2011-01-01

    A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

  18. A Review of Future and Ethical Perspectives of Robotics and AI

    OpenAIRE

    Jim Torresen

    2018-01-01

    In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to ...

  19. No specific role for the manual motor system in processing the meanings of words related to the hand

    Directory of Open Access Journals (Sweden)

    Natasha ePostle

    2013-02-01

    Full Text Available The present study explored whether semantic and motor systems are functionally interwoven via the use of a dual-task paradigm. According to embodied language accounts that propose an automatic and necessary involvement of the motor system in conceptual processing, concurrent processing of hand-related information should interfere more with hand movements than processing of unrelated body-part (i.e., foot, mouth information. Across three experiments, 100 right-handed participants performed left- or right-hand tapping movements while repeatedly reading action words related to different body-parts, or different body-part names, in both aloud and silent conditions. Concurrent reading of single words related to specific body-parts, or the same words embedded in sentences differing in syntactic and phonological complexity (to manipulate context-relevant processing, and reading while viewing videos of the actions and body-parts described by the target words (to elicit visuomotor associations all interfered with right-hand but not left-hand tapping rate. However, this motor interference was not affected differentially by hand-related stimuli. Thus, the results provide no support for proposals that body-part specific resources in cortical motor systems are shared between overt manual movements and meaning-related processing of words related to the hand.

  20. Calibrating AIS images using the surface as a reference

    Science.gov (United States)

    Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

    1987-01-01

    A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

  1. AI-guided parameter optimization in inverse treatment planning

    International Nuclear Information System (INIS)

    Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

    2003-01-01

    An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

  2. AiGERM: A logic programming front end for GERM

    Science.gov (United States)

    Hashim, Safaa H.

    1990-01-01

    AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

  3. Discovering Knowledge from AIS Database for Application in VTS

    Science.gov (United States)

    Tsou, Ming-Cheng

    The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

  4. Ada in AI or AI in Ada. On developing a rationale for integration

    Science.gov (United States)

    Collard, Philippe E.; Goforth, Andre

    1988-01-01

    The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

  5. Application of AI technology to nuclear plant operations

    International Nuclear Information System (INIS)

    Sackett, J.I.

    1988-01-01

    In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

  6. Archiving AIS messages in a Geo-DBMS

    NARCIS (Netherlands)

    Meijers, B.M.; Quak, C.W.; van Oosterom, P.J.M.; Bregt, Arnold; Sarjakoski, Tapani; Lammeren, Ron van; Rip, Frans

    2017-01-01

    This paper reports on the result of two studies for using a geographical database management system for archiving Automated Identification System (AIS) message data. In this paper, we analyse the storage (using MongoDB and PostgreSQL) and we give a more in-depth description of a possible data model

  7. Evaluation of the free, open source software WordPress as electronic portfolio system in undergraduate medical education.

    Science.gov (United States)

    Avila, Javier; Sostmann, Kai; Breckwoldt, Jan; Peters, Harm

    2016-06-03

    Electronic portfolios (ePortfolios) are used to document and support learning activities. E-portfolios with mobile capabilities allow even more flexibility. However, the development or acquisition of ePortfolio software is often costly, and at the same time, commercially available systems may not sufficiently fit the institution's needs. The aim of this study was to design and evaluate an ePortfolio system with mobile capabilities using a commercially free and open source software solution. We created an online ePortfolio environment using the blogging software WordPress based on reported capability features of such software by a qualitative weight and sum method. Technical implementation and usability were evaluated by 25 medical students during their clinical training by quantitative and qualitative means using online questionnaires and focus groups. The WordPress ePortfolio environment allowed students a broad spectrum of activities - often documented via mobile devices - like collection of multimedia evidences, posting reflections, messaging, web publishing, ePortfolio searches, collaborative learning, knowledge management in a content management system including a wiki and RSS feeds, and the use of aid tools for studying. The students' experience with WordPress revealed a few technical problems, and this report provides workarounds. The WordPress ePortfolio was rated positively by the students as a content management system (67 % of the students), for exchange with other students (74 %), as a note pad for reflections (53 %) and for its potential as an information source for assessment (48 %) and exchange with a mentor (68 %). On the negative side, 74 % of the students in this pilot study did not find it easy to get started with the system, and 63 % rated the ePortfolio as not being user-friendly. Qualitative analysis indicated a need for more introductory information and training. It is possible to build an advanced ePortfolio system with mobile

  8. rTMS on left prefrontal cortex contributes to memories for positive emotional cues: a comparison between pictures and words.

    Science.gov (United States)

    Balconi, M; Cobelli, C

    2015-02-26

    The present research explored the cortical correlates of emotional memories in response to words and pictures. Subjects' performance (Accuracy Index, AI; response times, RTs; RTs/AI) was considered when a repetitive Transcranial Magnetic Stimulation (rTMS) was applied on the left dorsolateral prefrontal cortex (LDLPFC). Specifically, the role of LDLPFC was tested by performing a memory task, in which old (previously encoded targets) and new (previously not encoded distractors) emotional pictures/words had to be recognized. Valence (positive vs. negative) and arousing power (high vs. low) of stimuli were also modulated. Moreover, subjective evaluation of emotional stimuli in terms of valence/arousal was explored. We found significant performance improving (higher AI, reduced RTs, improved general performance) in response to rTMS. This "better recognition effect" was only related to specific emotional features, that is positive high arousal pictures or words. Moreover no significant differences were found between stimulus categories. A direct relationship was also observed between subjective evaluation of emotional cues and memory performance when rTMS was applied to LDLPFC. Supported by valence and approach model of emotions, we supposed that a left lateralized prefrontal system may induce a better recognition of positive high arousal words, and that evaluation of emotional cue is related to prefrontal activation, affecting the recognition memories of emotions. Copyright © 2014 IBRO. Published by Elsevier Ltd. All rights reserved.

  9. USACE AIS Transmit Technical Support Summary Report

    Science.gov (United States)

    2014-09-01

    the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

  10. Proceedings of conference on AI applications in physical sciences

    International Nuclear Information System (INIS)

    1993-01-01

    A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

  11. Present status of application of AI in nuclear industry

    International Nuclear Information System (INIS)

    Kitamura, Masaharu

    1989-01-01

    Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

  12. Evaluating a Bilingual Text-Mining System with a Taxonomy of Key Words and Hierarchical Visualization for Understanding Learner-Generated Text

    Science.gov (United States)

    Kong, Siu Cheung; Li, Ping; Song, Yanjie

    2018-01-01

    This study evaluated a bilingual text-mining system, which incorporated a bilingual taxonomy of key words and provided hierarchical visualization, for understanding learner-generated text in the learning management systems through automatic identification and counting of matching key words. A class of 27 in-service teachers studied a course…

  13. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    2010-01-01

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

  14. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

  15. Adaptive Motion Gaming AI for Health Promotion

    OpenAIRE

    Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

    2017-01-01

    This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

  16. Beyond AI: Artificial Dreams Conference

    CERN Document Server

    Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide

    2015-01-01

    This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

  17. Word form Encoding in Chinese Word Naming and Word Typing

    Science.gov (United States)

    Chen, Jenn-Yeu; Li, Cheng-Yi

    2011-01-01

    The process of word form encoding was investigated in primed word naming and word typing with Chinese monosyllabic words. The target words shared or did not share the onset consonants with the prime words. The stimulus onset asynchrony (SOA) was 100 ms or 300 ms. Typing required the participants to enter the phonetic letters of the target word,…

  18. Procedure for Marine Traffic Simulation with AIS Data

    Directory of Open Access Journals (Sweden)

    Rina Miyake

    2015-03-01

    Full Text Available It is essential to evaluate safety of marine traffic for the improvement of efficiency and safety of marine traffic. Spread of AIS makes observation of actual marine traffic more easily and faster than before. Besides, description of collision avoidance behaviours of ships are indispensable to simulate a realistic marine traffic. It is important to develop and implement an algorithm of collision avoidance corresponding to a target traffic or target area into the marine traffic simulation because actual actions for collision avoidance depend on circumstances where ships are sailing. The authors developed an automated marine traffic simulation system with AIS data. And in this paper, we proposed a series of systematic procedures for marine traffic simulation including analysing for collision avoidance behaviours using AIS data.

  19. The precision of mapping between number words and the approximate number system predicts children's formal math abilities.

    Science.gov (United States)

    Libertus, Melissa E; Odic, Darko; Feigenson, Lisa; Halberda, Justin

    2016-10-01

    Children can represent number in at least two ways: by using their non-verbal, intuitive approximate number system (ANS) and by using words and symbols to count and represent numbers exactly. Furthermore, by the time they are 5years old, children can map between the ANS and number words, as evidenced by their ability to verbally estimate numbers of items without counting. How does the quality of the mapping between approximate and exact numbers relate to children's math abilities? The role of the ANS-number word mapping in math competence remains controversial for at least two reasons. First, previous work has not examined the relation between verbal estimation and distinct subtypes of math abilities. Second, previous work has not addressed how distinct components of verbal estimation-mapping accuracy and variability-might each relate to math performance. Here, we addressed these gaps by measuring individual differences in ANS precision, verbal number estimation, and formal and informal math abilities in 5- to 7-year-old children. We found that verbal estimation variability, but not estimation accuracy, predicted formal math abilities, even when controlling for age, expressive vocabulary, and ANS precision, and that it mediated the link between ANS precision and overall math ability. These findings suggest that variability in the ANS-number word mapping may be especially important for formal math abilities. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. The Precision of Mapping Between Number Words and the Approximate Number System Predicts Children’s Formal Math Abilities

    Science.gov (United States)

    Libertus, Melissa E.; Odic, Darko; Feigenson, Lisa; Halberda, Justin

    2016-01-01

    Children can represent number in at least two ways: by using their non-verbal, intuitive Approximate Number System (ANS), and by using words and symbols to count and represent numbers exactly. Further, by the time they are five years old, children can map between the ANS and number words, as evidenced by their ability to verbally estimate numbers of items without counting. How does the quality of the mapping between approximate and exact numbers relate to children’s math abilities? The role of the ANS-number word mapping in math competence remains controversial for at least two reasons. First, previous work has not examined the relation between verbal estimation and distinct subtypes of math abilities. Second, previous work has not addressed how distinct components of verbal estimation – mapping accuracy and variability – might each relate to math performance. Here, we address these gaps by measuring individual differences in ANS precision, verbal number estimation, and formal and informal math abilities in 5- to 7-year-old children. We found that verbal estimation variability, but not estimation accuracy, predicted formal math abilities even when controlling for age, expressive vocabulary, and ANS precision, and that it mediated the link between ANS precision and overall math ability. These findings suggest that variability in the ANS-number word mapping may be especially important for formal math abilities. PMID:27348475

  1. Novel Blind Recognition Algorithm of Frame Synchronization Words Based on Soft-Decision in Digital Communication Systems.

    Directory of Open Access Journals (Sweden)

    Jiangyi Qin

    Full Text Available A novel blind recognition algorithm of frame synchronization words is proposed to recognize the frame synchronization words parameters in digital communication systems. In this paper, a blind recognition method of frame synchronization words based on the hard-decision is deduced in detail. And the standards of parameter recognition are given. Comparing with the blind recognition based on the hard-decision, utilizing the soft-decision can improve the accuracy of blind recognition. Therefore, combining with the characteristics of Quadrature Phase Shift Keying (QPSK signal, an improved blind recognition algorithm based on the soft-decision is proposed. Meanwhile, the improved algorithm can be extended to other signal modulation forms. Then, the complete blind recognition steps of the hard-decision algorithm and the soft-decision algorithm are given in detail. Finally, the simulation results show that both the hard-decision algorithm and the soft-decision algorithm can recognize the parameters of frame synchronization words blindly. What's more, the improved algorithm can enhance the accuracy of blind recognition obviously.

  2. Selection of words for implementation of the Picture Exchange Communication System - PECS in non-verbal autistic children.

    Science.gov (United States)

    Ferreira, Carine; Bevilacqua, Monica; Ishihara, Mariana; Fiori, Aline; Armonia, Aline; Perissinoto, Jacy; Tamanaha, Ana Carina

    2017-03-09

    It is known that some autistic individuals are considered non-verbal, since they are unable to use verbal language and barely use gestures to compensate for the absence of speech. Therefore, these individuals' ability to communicate may benefit from the use of the Picture Exchange Communication System - PECS. The objective of this study was to verify the most frequently used words in the implementation of PECS in autistic children, and on a complementary basis, to analyze the correlation between the frequency of these words and the rate of maladaptive behaviors. This is a cross-sectional study. The sample was composed of 31 autistic children, twenty-five boys and six girls, aged between 5 and 10 years old. To identify the most frequently used words in the initial period of implementation of PECS, the Vocabulary Selection Worksheet was used. And to measure the rate of maladaptive behaviors, we applied the Autism Behavior Checklist (ABC). There was a significant prevalence of items in the category "food", followed by "activities" and "beverages". There was no correlation between the total amount of items identified by the families and the rate of maladaptive behaviors. The categories of words most mentioned by the families could be identified, and it was confirmed that the level of maladaptive behaviors did not interfere directly in the preparation of the vocabulary selection worksheet for the children studied.

  3. Novel Blind Recognition Algorithm of Frame Synchronization Words Based on Soft-Decision in Digital Communication Systems.

    Science.gov (United States)

    Qin, Jiangyi; Huang, Zhiping; Liu, Chunwu; Su, Shaojing; Zhou, Jing

    2015-01-01

    A novel blind recognition algorithm of frame synchronization words is proposed to recognize the frame synchronization words parameters in digital communication systems. In this paper, a blind recognition method of frame synchronization words based on the hard-decision is deduced in detail. And the standards of parameter recognition are given. Comparing with the blind recognition based on the hard-decision, utilizing the soft-decision can improve the accuracy of blind recognition. Therefore, combining with the characteristics of Quadrature Phase Shift Keying (QPSK) signal, an improved blind recognition algorithm based on the soft-decision is proposed. Meanwhile, the improved algorithm can be extended to other signal modulation forms. Then, the complete blind recognition steps of the hard-decision algorithm and the soft-decision algorithm are given in detail. Finally, the simulation results show that both the hard-decision algorithm and the soft-decision algorithm can recognize the parameters of frame synchronization words blindly. What's more, the improved algorithm can enhance the accuracy of blind recognition obviously.

  4. Reading is fundamentally similar across disparate writing systems: A systematic characterization of how words and characters influence eye movements in Chinese reading

    Science.gov (United States)

    Li, Xingshan; Bicknell, Klinton; Liu, Pingping; Wei, Wei; Rayner, Keith

    2013-01-01

    While much previous work on reading in languages with alphabetic scripts has suggested that reading is word-based, reading in Chinese has been argued to be less reliant on words. This is primarily because in the Chinese writing system words are not spatially segmented, and characters are themselves complex visual objects. Here, we present a systematic characterization of the effects of a wide range of word and character properties on eye movements in Chinese reading, using a set of mixed-effects regression models. The results reveal a rich pattern of effects of the properties of the current, previous, and next words on a range of reading measures, which is strikingly similar to the pattern of effects of word properties reported in spaced alphabetic languages. This finding provides evidence that reading shares a word-based core and may be fundamentally similar across languages with highly dissimilar scripts. We show that these findings are robust to the inclusion of character properties in the regression models, and are equally reliable when dependent measures are defined in terms of characters rather than words, providing strong evidence that word properties have effects in Chinese reading above and beyond characters. This systematic characterization of the effects of word and character properties in Chinese advances our knowledge of the processes underlying reading and informs the future development of models of reading. More generally, however, this work suggests that differences in script may not alter the fundamental nature of reading. PMID:23834023

  5. Integrated Health Care Barcelona Esquerra (Ais-Be: A Global View of Organisational Development, Re-Engineering of Processes and Improvement of the Information Systems. The Role of the Tertiary University Hospital in the Transformation

    Directory of Open Access Journals (Sweden)

    David Font

    2016-05-01

    Full Text Available The Integrated Health Area “Barcelona Esquerra” ('Área Integral de Salud de Barcelona Esquerra' – AIS-BE, which covers a population of 524,000 residents in Barcelona city, is running a project to improve healthcare quality and efficiency based on co-ordination between the different suppliers in its area through the participation of their professionals. Endowed with an Organisational Model that seeks decision-taking that starts out from clinical knowledge and from Information Systems tools that facilitate this co-ordination (an interoperability platform and a website it presents important results in its structured programmes that have been implemented such as the Reorganisation of Emergency Care, Screening for Colorectal Cancer, the Onset of type 2 Diabetes Mellitus, Teledermatology and the Development of Cross-sectional Healthcare Policies for Care in Chronicity.

  6. AI tools in computer based problem solving

    Science.gov (United States)

    Beane, Arthur J.

    1988-01-01

    The use of computers to solve value oriented, deterministic, algorithmic problems, has evolved a structured life cycle model of the software process. The symbolic processing techniques used, primarily in research, for solving nondeterministic problems, and those for which an algorithmic solution is unknown, have evolved a different model, much less structured. Traditionally, the two approaches have been used completely independently. With the advent of low cost, high performance 32 bit workstations executing identical software with large minicomputers and mainframes, it became possible to begin to merge both models into a single extended model of computer problem solving. The implementation of such an extended model on a VAX family of micro/mini/mainframe systems is described. Examples in both development and deployment of applications involving a blending of AI and traditional techniques are given.

  7. The hidden dangers of experimenting in distributed AI

    NARCIS (Netherlands)

    Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.

    2006-01-01

    Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

  8. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, S.A.

    1984-04-25

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

  9. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Erickson, S.A.

    1984-01-01

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

  10. JGOMAS: New Approach to AI Teaching

    Science.gov (United States)

    Barella, A.; Valero, S.; Carrascosa, C.

    2009-01-01

    This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

  11. Adaptive game AI with dynamic scripting

    NARCIS (Netherlands)

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

  12. Development and application of AI technology to plant operation and support

    International Nuclear Information System (INIS)

    Sackett, J.I.; Mott, J.E.

    1989-01-01

    This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

  13. Nonlinear study of AI Velorum

    International Nuclear Information System (INIS)

    Cox, A.N.; Hodson, S.W.

    1979-01-01

    Using results from earlier studies of double-mode dwarf Cepheids by Cox, King, and Hodson, hydrodynamic calculations were undertaken for AI Vel. The earlier derived evolution theory mass of 1.8 M sub solar, a luminosity of of 23 L sub solar and a T/sub e/ of 7500 0 K give the observed period of 0.11 day and the observed period ratio PI 1 /PI 0 = 0.773. A cooler T/sub e/ than the observed one (7620 0 K) was used because 7620 0 K is beyond the fundamental pulsation mode blue edge. The composition used is X = 0.70 Z = 0.01. This lower than normal Z is necessary to make the period ratio as large as observed. The goal is to see if double-mode behavior, due to either mode switching or a permanent state, can be predicted for the model. Progress in converging the model to a periodic pulsation solution by the von Sengbusch--Stellingwerf relaxation method will be reported. 17 references

  14. Identify Web-page Content meaning using Knowledge based System for Dual Meaning Words

    OpenAIRE

    Sinha, Sukanta; Dattagupta, Rana; Mukhopadhyay, Debajyoti

    2012-01-01

    Meaning of Web-page content plays a big role while produced a search result from a search engine. Most of the cases Web-page meaning stored in title or meta-tag area but those meanings do not always match with Web-page content. To overcome this situation we need to go through the Web-page content to identify the Web-page meaning. In such cases, where Webpage content holds dual meaning words that time it is really difficult to identify the meaning of the Web-page. In this paper, we are introdu...

  15. A Review of Future and Ethical Perspectives of Robotics and AI

    Directory of Open Access Journals (Sweden)

    Jim Torresen

    2018-01-01

    Full Text Available In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to avoid a dystopian future. References to recent initiatives to outline ethical guidelines for both the design of systems and how they should operate are included.

  16. "All-In-One Test" (AI1)

    DEFF Research Database (Denmark)

    Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

    2013-01-01

    by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

  17. Health Information in French (français)

    Science.gov (United States)

    ... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

  18. Periodic words connected with the Fibonacci words

    Directory of Open Access Journals (Sweden)

    G. M. Barabash

    2016-06-01

    Full Text Available In this paper we introduce two families of periodic words (FLP-words of type 1 and FLP-words of type 2 that are connected with the Fibonacci words and investigated their properties.

  19. Learning words

    DEFF Research Database (Denmark)

    Jaswal, Vikram K.; Hansen, Mikkel

    2006-01-01

    Children tend to infer that when a speaker uses a new label, the label refers to an unlabeled object rather than one they already know the label for. Does this inference reflect a default assumption that words are mutually exclusive? Or does it instead reflect the result of a pragmatic reasoning...... process about what the speaker intended? In two studies, we distinguish between these possibilities. Preschoolers watched as a speaker pointed toward (Study 1) or looked at (Study 2) a familiar object while requesting the referent for a new word (e.g. 'Can you give me the blicket?'). In both studies......, despite the speaker's unambiguous behavioral cue indicating an intent to refer to a familiar object, children inferred that the novel label referred to an unfamiliar object. These results suggest that children expect words to be mutually exclusive even when a speaker provides some kinds of pragmatic...

  20. AIS reception from a CubeSat in LEO

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2013-01-01

    The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

  1. AI mass spectrometers for space shuttle health monitoring

    Science.gov (United States)

    Adams, F. W.

    1991-01-01

    The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

  2. Development of lexical-semantic language system: N400 priming effect for spoken words in 18- and 24-month old children.

    Science.gov (United States)

    Rämä, Pia; Sirri, Louah; Serres, Josette

    2013-04-01

    Our aim was to investigate whether developing language system, as measured by a priming task for spoken words, is organized by semantic categories. Event-related potentials (ERPs) were recorded during a priming task for spoken words in 18- and 24-month-old monolingual French learning children. Spoken word pairs were either semantically related (e.g., train-bike) or unrelated (e.g., chicken-bike). The results showed that the N400-like priming effect occurred in 24-month-olds over the right parietal-occipital recording sites. In 18-month-olds the effect was observed similarly to 24-month-olds only in those children with higher word production ability. The results suggest that words are categorically organized in the mental lexicon of children at the age of 2 years and even earlier in children with a high vocabulary. Copyright © 2013 Elsevier Inc. All rights reserved.

  3. Cracks appear in the AI gravy train

    Energy Technology Data Exchange (ETDEWEB)

    Mill, J.

    1983-10-01

    This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

  4. AI applications in sheet metal forming

    CERN Document Server

    Hussein, Hussein

    2017-01-01

    This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

  5. A Preliminary Analysis of Human Factors Affecting the Recognition Accuracy of a Discrete Word Recognizer for C3 Systems.

    Science.gov (United States)

    1983-03-01

    acoustic wave pattern and, if so, word recognitios would be a sliple matter of the voice recogniticn system scanning the pattern, comparing the slmple...State scalc=s. There were no tire limits Lrposed fer completion of the form. Although many of the iters have face validity as measures of anxiety, the...to avoia facing a crisis 1 2 c 4 cr diff1culty 1. I feel olue 1 2 4 !E. I am content 1 2 4 !7. Sore unirrortant thought runs 1 2 - 4 tnroug!3 ry rrinQ

  6. Adaptive game AI with dynamic scripting

    OpenAIRE

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

  7. Research Directions for AI in Computer Games

    OpenAIRE

    Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian

    2001-01-01

    The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

  8. SODA-IIoT4Factory: Blockchain to keep the A.I. of your Intrusion Detection System up-to-date

    OpenAIRE

    Planchon , Frederic; Costa , Fernand; Nicaise , Vincent; Bouzerna , Nabil

    2017-01-01

    International audience; Co-designed with FPC Ingénierie, SODA-IIoT4Factory offers a secure way to update CyPRES rule engines & cyber security/attack models.CyPRES is an intelligent IDS that strengthens industrial information systems. It learns then verifies the operation and behaviour of the system to the lowest level of detail. It detects the first signs of attacks before damage is incurred.

  9. AIS Algorithm for Smart Antenna Application in WLAN

    Directory of Open Access Journals (Sweden)

    Evizal Abdul Kadir

    2015-07-01

    Full Text Available Increasing numbers of wireless local area networks (WLAN replacing wired networks have an impact on wireless network systems, causing issues such as interference. The smart antenna system is a method to overcome interference issues in WLANs. This paper proposes an artificial immune system (AIS for a switch beam smart antenna system. A directional antenna is introduced to aim the beam at the desired user. The antenna consists of 8 directional antennas, each of which covers 45 degrees, thus creating an omnidirectional configuration of which the beams cover 360 degrees. To control the beam switching, an inexpensive PIC 16F877 microchip was used. An AIS algorithm was implemented in the microcontroller, which uses the received radio signal strength of the mobile device as reference. This is compared for each of the eight beams, after which the AIS algorithm selects the strongest signal received by the system and the microcontroller will then lock to the desired beam. In the experiment a frequency of 2.4 GHz (ISM band was used for transmitting and receiving. A test of the system was conducted in an outdoor environment. The results show that the switch beam smart antenna worked fine based on locating the mobile device.

  10. Le sort des répudiations musulmanes dans l’ordre juridique français. Droit et idéologie(s Muslim Repudiations in the French Legal System: Law and Ideologies

    Directory of Open Access Journals (Sweden)

    Marie-Claude Najm

    2010-07-01

    Full Text Available Mode de dissolution du mariage exclusivement tributaire de la volonté unilatérale du mari, la répudiation islamique heurte le principe d’égalité des époux qui fait partie des valeurs fondamentales du droit français. Quel est alors le sort réservé, dans l’ordre juridique français, aux répudiations prononcées à l’étranger en application du droit musulman ? À cet égard, l’évolution de la jurisprudence française au cours des trente dernières années révèle un durcissement des exigences de l’ordre public, au terme d’un parcours erratique oscillant entre la reconnaissance et le rejet. Cette évolution en dents de scie qui semble aujourd’hui stabilisée n’est pas réellement surprenante, tant les impératifs en jeu sont délicats à mettre en œuvre. En effet, l’accueil réservé à la répudiation de droit musulman en France dévoile, au-delà de la technique juridique, un double conflit de valeurs. Sur le terrain du droit international privé, il met en lumière le tiraillement entre deux impératifs : celui de préserver la cohésion et les valeurs de l’ordre juridique français d’une part, celui de favoriser l’harmonie internationale des solutions d’autre part. Ensuite et surtout, sur un terrain proprement idéologique, la question touche à la conception même que l’on se fait des droits de l’homme dans les relations entre systèmes juridiques de traditions culturelles différentes ; elle oppose alors les tenants du relativisme culturel à ceux qui prônent la vocation des droits de l’homme à l’universalité.A form of marriage dissolution initiated exclusively and unilaterally by the husband, Islamic repudiation tests the principle of equality between spouses that figures among the fundamental values of French law. What status does French law accord repudiations pronounced abroad under Islamic law? The development of French jurisprudence on this question over the past thirty years shows a

  11. Does "Word Coach" Coach Words?

    Science.gov (United States)

    Cobb, Tom; Horst, Marlise

    2011-01-01

    This study reports on the design and testing of an integrated suite of vocabulary training games for Nintendo[TM] collectively designated "My Word Coach" (Ubisoft, 2008). The games' design is based on a wide range of learning research, from classic studies on recycling patterns to frequency studies of modern corpora. Its general usage…

  12. Study on Turn-to-turn Short Circuit On一line Monitoring System for Dry一type Ai r一core Reactor

    Directory of Open Access Journals (Sweden)

    GAO Zi-wei

    2017-04-01

    Full Text Available The change of current value caused by turn-to-turn short circuit of dry-type air-core reactor is so little that failure detection is difficult to be carried out. In order to solve this problem,a new on-line monitoring system based on impedance variation of turn-to-turn short circuit is proposed. The numerical method is applied to analyze the variation of equivalent resistance and equivalent reactance when dry-type air-core reactor winding short circuit happens in different places,and the monitoring method based on harmonic analysis method and quasi- synchronization sampling method is analyzed by theory. The hardware system,which takes single-chip microcomputer as the core of data processing and logic control,completes data acquisition of voltage signal and current signal of the reactor. In the respect of software design,the impedance variation will be uploaded to the PC after it has been calculated by using the above monitoring method,and then monitoring of turn-to-turn short circuit fault will be realized. Finally,the design of on-line monitoring system is studied by testing. The research result shows that,the equivalent resistance increases and the equivalent reactance decreases when turn-to-turn short circuit occurs,and the variation of equivalent resistance is more obvious than equivalent reactance. The experiment results prove that this monitoring method is true and the on-line monitoring system is feasible.

  13. Silicate liquid immiscibility in magmas and in the system K2O-FeO-AI2O3-SiO2: an example of serendipity

    Science.gov (United States)

    Roedder, E.

    1978-01-01

    The concept of silicate liquid immiscibility was invoked early in the history of petrology to explain certain pairs of compositionally divergent rocks, but. as a result of papers by Greig (Am. J. Sci. 13, 1-44, 133-154) and Bowen (The Evolution of the Igneous Rocks), it fell into disfavor for many years. The discovery of immiscibility in geologically reasonable temperature ranges and compositions in experimental work on the system K2O-FeO-Al2O3-SiO2, and of evidence for immiscibility in a variety of lunar and terrestrial rocks, has reinstated the process. Phase equilibria in the high-silica corner of the tetrahedron representing the system K2O- FeO-Al2O3-SiO2 are presented, in the form of constant FeO sections through the tetrahedron, at 10% increments. Those sections, showing the tentative relationships of the primary phase volumes, are based on 5631 quenching runs on 519 compositions, made in metallic iron containers in pure nitrogen. Thirteen crystalline compounds are involved, of which at least six show two or more crystal modifica-tions. Two separate phase volumes, in each of which two immiscible liquids, one iron-rich and the other iron-poor, are present at the liquidus. One of these volumes is entirely within the quaternary system, astride the 1:1 K2O:Al2O3 plane. No quaternary compounds as such have been found, but evidence does point toward at least partial quaternary solid solution, with rapidly lowering liquidus temperatures, from K2O??Al2O3?? 2SiO2 ('potash nepheline', kalsilite. kaliophilite) to the isostructural compound K2O??FeO??3SiO2, and from K2O??Al2O3??4SiO2 (leucite) to the isostructural compound K2O??FeO??5SiO2, Both of these series apparently involve substitution, in tetrahedral coordination. of a ferrous iron and a silicon ion for two aluminum ions. Some of the 'impurities' found in analyses of the natural phases may reflect these substitutions. As a result of the geometry of the immiscibility volume located entirely within the quaternary

  14. Word wheels

    CERN Document Server

    Clark, Kathryn

    2013-01-01

    Targeting the specific problems learners have with language structure, these multi-sensory exercises appeal to all age groups including adults. Exercises use sight, sound and touch and are also suitable for English as an Additional Lanaguage and Basic Skills students.Word Wheels includes off-the-shelf resources including lesson plans and photocopiable worksheets, an interactive CD with practice exercises, and support material for the busy teacher or non-specialist staff, as well as homework activities.

  15. Computing with Words in Decision support Systems: An overview on Models and Applications

    Directory of Open Access Journals (Sweden)

    Luis Martinez

    2010-10-01

    Full Text Available Decision making is inherent to mankind, as human beings daily face situations in which they should choose among different alternatives by means of reasoning and mental processes. Many of these decision problems are under uncertain environments with vague and imprecise information. This type of information is usually modelled by linguistic information because of the common use of language by the experts involved in the given decision situations, originating linguistic decision making. The use of linguistic information in decision making demands processes of Computing with Words to solve the related decision problems. Different methodologies and approaches have been proposed to accomplish such processes in an accurate and interpretable way. The good performance of linguistic computing dealing with uncertainty has caused a spread use of it in different types of decision based applications. This paper overviews the more significant and extended linguistic computing models due to its key role in linguistic decision making and a wide range of the most recent applications of linguistic decision support models.

  16. AI Tools Bridge Technology Gap.

    Science.gov (United States)

    Rauch-Hindin, Wendy

    1985-01-01

    This second part of a report on artificial intelligence focuses on the development of expert systems in a variety of applications, from engineering to science, and details expectations for implementation of these systems. (JN)

  17. Stroop color-word interference and electroencephalogram activation: evidence for age-related decline of the anterior attention system.

    Science.gov (United States)

    West, R; Bell, M A

    1997-07-01

    Groups of healthy, community-dwelling younger and older adults performed a Stroop task in which color and word could be congruent or incongruent and spatially integrated or separated. During the task, continuous electroencephalogram (EEG) was recorded from frontal, parietal, and occipital regions. The magnitude of the Stroop interference effect and task-related EEG activation was greater for older than younger adults when stimuli were integrated. This effect was significant over medial and lateral frontal and parietal, but not occipital, regions. In comparison, interference and EEG activation did not differ for younger and older adults when stimuli were separated. These findings support the hypothesis that the anterior attention system is more sensitive to the effects of increasing age than the posterior attention system.

  18. Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

    CERN Document Server

    Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

    2013-01-01

    Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

  19. Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

    NARCIS (Netherlands)

    Roets, F.; Oberlander, K.C.; Dreyer, L.L.

    2012-01-01

    South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

  20. Use of AI-1024 and AI-4096 analyzers in multiple regimes

    International Nuclear Information System (INIS)

    Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

    1975-01-01

    The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

  1. Tweeting AI: Perceptions of Lay vs Expert Twitterati

    OpenAIRE

    Manikonda, Lydia; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

  2. Strategic Team AI Path Plans: Probabilistic Pathfinding

    Directory of Open Access Journals (Sweden)

    Tng C. H. John

    2008-01-01

    Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

  3. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-01-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

  4. Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1990-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

  5. AI Researchers, Video Games Are Your Friends!

    OpenAIRE

    Togelius, Julian

    2016-01-01

    If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

  6. Word Domain Disambiguation via Word Sense Disambiguation

    Energy Technology Data Exchange (ETDEWEB)

    Sanfilippo, Antonio P.; Tratz, Stephen C.; Gregory, Michelle L.

    2006-06-04

    Word subject domains have been widely used to improve the perform-ance of word sense disambiguation al-gorithms. However, comparatively little effort has been devoted so far to the disambiguation of word subject do-mains. The few existing approaches have focused on the development of al-gorithms specific to word domain dis-ambiguation. In this paper we explore an alternative approach where word domain disambiguation is achieved via word sense disambiguation. Our study shows that this approach yields very strong results, suggesting that word domain disambiguation can be ad-dressed in terms of word sense disam-biguation with no need for special purpose algorithms.

  7. The Dilemma of Word Processing

    Science.gov (United States)

    Kidwell, Richard

    1977-01-01

    Word processing is a system of communicating which suggests heavy dependence on the use of transcribing machines rather than manual shorthand. The pros and cons of this system are noted, including suggestions for changes in the business education curriculum relevant to the need for shorthand and/or word processing skill development. (SH)

  8. Functional subdivisions in low-frequency primary auditory cortex (AI).

    Science.gov (United States)

    Wallace, M N; Palmer, A R

    2009-04-01

    We wished to test the hypothesis that there are modules in low-frequency AI that can be identified by their responsiveness to communication calls or particular regions of space. Units were recorded in anaesthetised guinea pig AI and stimulated with conspecific vocalizations and a virtual motion stimulus (binaural beats) presented via a closed sound system. Recording tracks were mainly oriented orthogonally to the cortical surface. Some of these contained units that were all time-locked to the structure of the chutter call (14/22 tracks) and/or the purr call (12/22 tracks) and/or that had a preference for stimuli from a particular region of space (8/20 tracks with four contralateral, two ipsilateral and two midline), or where there was a strong asymmetry in the response to beats of different direction (two tracks). We conclude that about half of low-frequency AI is organized into modules that are consistent with separate "what" and "where" pathways.

  9. SNAP and AI Fuel Summary Report

    International Nuclear Information System (INIS)

    Lords, R.E.

    1994-08-01

    The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

  10. Moving Word Learning to a Novel Space: A Dynamic Systems View of Referent Selection and Retention

    Science.gov (United States)

    Samuelson, Larissa K.; Kucker, Sarah C.; Spencer, John P.

    2017-01-01

    Theories of cognitive development must address both the issue of how children bring their knowledge to bear on behavior in-the-moment, and how knowledge changes over time. We argue that seeking answers to these questions requires an appreciation of the dynamic nature of the developing system in its full, reciprocal complexity. We illustrate this…

  11. Prospecting the future with AI

    Directory of Open Access Journals (Sweden)

    Julian Gonzalez

    2009-12-01

    Full Text Available If we were able to foresee the future, we could be prepared to reduce the impact of bad situations as well as getting the most of profiting periods. Our world is a dynamic system that evolves as time goes by. The number of variables that can influence in future situations outnumbers our capacity of prediction at a first glance. This article will show an alternative way to foresee potential future scenarios based on human experts’ opinion, what can be considered as aknowledge modeling tool.

  12. Alleged nursery words and hypocorisms among Germanic kinship terms

    DEFF Research Database (Denmark)

    Hansen, Bjarne Simmelkjær Sandgaard

    2017-01-01

    By (re-)evaluating the etymologies of the three Proto-Germanic kinship terms *aiþīn-/-ōn- ‘mother’, *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ that are all claimed by at least some etymological handbooks to be nursery words or hypocorisms, I contend that we must abandon their nurs......By (re-)evaluating the etymologies of the three Proto-Germanic kinship terms *aiþīn-/-ōn- ‘mother’, *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ that are all claimed by at least some etymological handbooks to be nursery words or hypocorisms, I contend that we must abandon...... their nursery-word interpretations and rather regard them as inherited words derived from known Indo-European lexical material in a way that reveals important information on the Old Germanic society and its family pattern....

  13. STAR - A computer language for hybrid AI applications

    Science.gov (United States)

    Borchardt, G. C.

    1986-01-01

    Constructing Artificial Intelligence application systems which rely on both symbolic and non-symbolic processing places heavy demands on the communication of data between dissimilar languages. This paper describes STAR (Simple Tool for Automated Reasoning), a computer language for the development of AI application systems which supports the transfer of data structures between a symbolic level and a non-symbolic level defined in languages such as FORTRAN, C and PASCAL. The organization of STAR is presented, followed by the description of an application involving STAR in the interpretation of airborne imaging spectrometer data.

  14. The Development of AI in Medicine and the Research Environment of the SPHINX Project at the Start of the 1980s.

    Science.gov (United States)

    Fieschi, M

    2012-01-01

    To review the history of AI in Medicine in the 1980's, placing the SPHINX system in the context of other research in this field. Summarize the main systems for AI in medicine developed in the 1970-1980 decade and their relationship to the development of clinical decision-making and consultation systems The approaches taken by AI in medicine research groups is compared and contrasted to those of others using statistical and logical methods for representing clinical inferences, and the different AI approaches are summarized, and related to the architecture and systems implementation of SPHINX CONCLUSION: The SPHINX system combined a number of advanced representational and inference choices from AI in designing a decision- support system for clinical consultation in the 1980s. The context within which the system was developed is outlined and related to the historical evolution of AI in medicine during that decade.

  15. A regulator's viewpoint on the use of AI in the nuclear industry

    International Nuclear Information System (INIS)

    Wainwright, N.

    1995-01-01

    The regulatory position within the UK places the responsibility for safety on a nuclear site with the licensee. The licensee must produce a safety case that demonstrates that the plant is safe. Assessment of this safety case is performed by the regulator in the Health and Safety Executive (HSE) using HSE's published Safety Assessment Principles. This paper presents the personal views of a regulator on the use of artificial intelligence (AI) in the nuclear industry. The AI-based system considered are restricted to expert systems, neural networks and fuzzy logic. Some of the safety issues are discussed. The particular concerns associated with software-based systems are compounded by some of the inherent problems of AI-based systems. Such is the nature of these concerns that an acceptable safety case will be difficult to mount for safety systems and post-accident monitoring systems. However, given the present maturity of the technology, acceptable safety cases might be formulated in the areas of operator advisory systems designed to reduce accident frequencies, and robotics where dose reduction is important. There are also arguments that suggests that suitable safety cases could be formulated for AI-based plant control systems. Nevertheless, AI-based systems should be treated with caution - further research is required into suitable designs and safety demonstration techniques. (author)

  16. Modern data-driven decision support systems: the role of computing with words and computational linguistics

    Science.gov (United States)

    Kacprzyk, Janusz; Zadrożny, Sławomir

    2010-05-01

    We present how the conceptually and numerically simple concept of a fuzzy linguistic database summary can be a very powerful tool for gaining much insight into the very essence of data. The use of linguistic summaries provides tools for the verbalisation of data analysis (mining) results which, in addition to the more commonly used visualisation, e.g. via a graphical user interface, can contribute to an increased human consistency and ease of use, notably for supporting decision makers via the data-driven decision support system paradigm. Two new relevant aspects of the analysis are also outlined which were first initiated by the authors. First, following Kacprzyk and Zadrożny, it is further considered how linguistic data summarisation is closely related to some types of solutions used in natural language generation (NLG). This can make it possible to use more and more effective and efficient tools and techniques developed in NLG. Second, similar remarks are given on relations to systemic functional linguistics. Moreover, following Kacprzyk and Zadrożny, comments are given on an extremely relevant aspect of scalability of linguistic summarisation of data, using a new concept of a conceptual scalability.

  17. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    Energy Technology Data Exchange (ETDEWEB)

    Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

    2017-04-15

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  18. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    International Nuclear Information System (INIS)

    Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

    2017-01-01

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  19. Comparing response options for the International Outcome Inventory for Hearing Aids (IOI-HA) and for Alternative Interventions (IOI-AI) daily-use items.

    Science.gov (United States)

    Laplante-Lévesque, Ariane; Hickson, Louise; Worrall, Linda

    2012-10-01

    This study investigated how clients quantify use of hearing rehabilitation. Comparisons focused on the daily-use item of the International Outcome Inventory for Hearing Aids (IOI-HA), and for Alternative Interventions (IOI-AI). Adults with hearing impairment completed the original versions of the IOI-HA and the IOI-AI daily-use item which has five numerical response options (e.g. 1-4 hours/day) and a modified version with five word response options (e.g. 'Sometimes'). Respondents completed both IOI versions immediately after intervention completion and three months later. In total, 64 people who had obtained hearing aids completed both IOI-HA versions and 27 people who had participated in communication programs completed both IOI-AI versions. Participants reported higher scores on the modified (word) daily-use item than on the original (number) daily-use item. Participants who completed the IOI-AI did so significantly more than participants who completed the IOI-HA. This was true both after intervention completion and three months later. This study showed that comparisons between IOI-HA and IOI-AI daily-use item scores should be made with caution. Word daily-use response options are recommended for the IOI-AI (i.e. Never; Rarely; Sometimes; Often; and Almost always).

  20. Abelian primitive words

    OpenAIRE

    Domaratzki, Michael; Rampersad, Narad

    2011-01-01

    We investigate Abelian primitive words, which are words that are not Abelian powers. We show that unlike classical primitive words, the set of Abelian primitive words is not context-free. We can determine whether a word is Abelian primitive in linear time. Also different from classical primitive words, we find that a word may have more than one Abelian root. We also consider enumeration problems and the relation to the theory of codes. Peer reviewed

  1. Deploying Embodied AI into Virtual Worlds

    Science.gov (United States)

    Burden, David J. H.

    The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

  2. The Potential of AI Techniques for Remote Sensing

    Science.gov (United States)

    Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

    1984-01-01

    The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

  3. AI in space: Past, present, and possible futures

    Science.gov (United States)

    Rose, Donald D.; Post, Jonathan V.

    1992-01-01

    While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

  4. Monitoring severe accidents using AI techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

    2012-01-01

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  5. Monitoring severe accidents using AI techniques

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

    2012-05-15

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  6. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  7. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  8. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  9. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  10. Dicty_cDB: FC-AI21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  11. Pavlovian, Skinner, and Other Behaviourists' Contributions to AI. Chapter 9

    Science.gov (United States)

    Kosinski, Withold; Zaczek-Chrzanowska, Dominika

    2007-01-01

    A version of the definition of intelligent behaviour will be supplied in the context of real and artificial systems. Short presentation of principles of learning, starting with Pavlovian s classical conditioning through reinforced response and operant conditioning of Thorndike and Skinner and finishing with cognitive learning of Tolman and Bandura will be given. The most important figures within behaviourism, especially those with contribution to AI, will be described. Some tools of artificial intelligence that act according to those principles will be presented. An attempt will be made to show when some simple rules for behaviour modifications can lead to a complex intelligent behaviour.

  12. A study on the applications of AI in finishing of additive manufacturing parts

    Science.gov (United States)

    Fathima Patham, K.

    2017-06-01

    Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

  13. Do adolescent idiopathic scoliosis (AIS neglect proprioceptive information in sensory integration of postural control?

    Directory of Open Access Journals (Sweden)

    Christine Assaiante

    Full Text Available INTRODUCTION: It has been reported that AIS rely much more on ankle proprioception to control the amplitude of the balance control commands as compared to age-matched healthy adolescents. Our hypothesis was that AIS do not neglect proprioceptive information to control posture probably because of their vestibular deficits. We investigated the proprioceptive contribution to postural control in AIS which expresses spinal deformity during a crucial transitional period of ontogenesis. METHODS: 10 adolescents with idiopathic scoliosis (AIS with moderate spinal deformity (10° 35° and 10 control adolescents (CA had to maintain vertical stance while very slow oscillations in the frontal plane (below the detection threshold of the semicircular canal system were applied to the support with the eyes open and closed. Postural orientation and segmental stabilisation were analysed at head, shoulder, trunk and pelvis levels. RESULTS: Scoliosis did not affect vertical orientation control and segmental stabilization strategies. Vision improves postural control in both CA and AIS, which seem more dependent on visual cues than adults. CONCLUSIONS: AIS as CA were unable to control efficiently their postural orientation on the basis of the proprioceptive cues, the only sensory information available in the EC situation, whereas in the same condition healthy young adults present no difficulty to achieve the postural control. This suggests that AIS as CA transitory neglect proprioceptive information to control their posture. These results and previous studies suggest the existence of different afferent pathways for proprioceptive information subserving different parts in sensory integration of postural control. We conclude that the static proprioceptive system is not affected by the idiopathic scoliosis, while the dynamic proprioceptive system would be mainly affected.

  14. Adolescent idiopathic scoliosis (AIS, environment, exposome and epigenetics: a molecular perspective of postnatal normal spinal growth and the etiopathogenesis of AIS with consideration of a network approach and possible implications for medical therapy

    Directory of Open Access Journals (Sweden)

    Burwell R Geoffrey

    2011-12-01

    Full Text Available Abstract Genetic factors are believed to play an important role in the etiology of adolescent idiopathic scoliosis (AIS. Discordant findings for monozygotic (MZ twins with AIS show that environmental factors including different intrauterine environments are important in etiology, but what these environmental factors may be is unknown. Recent evidence for common chronic non-communicable diseases suggests epigenetic differences may underlie MZ twin discordance, and be the link between environmental factors and phenotypic differences. DNA methylation is one important epigenetic mechanism operating at the interface between genome and environment to regulate phenotypic plasticity with a complex regulation across the genome during the first decade of life. The word exposome refers to the totality of environmental exposures from conception onwards, comprising factors in external and internal environments. The word exposome is used here also in relation to physiologic and etiopathogenetic factors that affect normal spinal growth and may induce the deformity of AIS. In normal postnatal spinal growth we propose a new term and concept, physiologic growth-plate exposome for the normal processes particularly of the internal environments that may have epigenetic effects on growth plates of vertebrae. In AIS, we propose a new term and concept pathophysiologic scoliogenic exposome for the abnormal processes in molecular pathways particularly of the internal environment currently expressed as etiopathogenetic hypotheses; these are suggested to have deforming effects on the growth plates of vertebrae at cell, tissue, structure and/or organ levels that are considered to be epigenetic. New research is required for chromatin modifications including DNA methylation in AIS subjects and vertebral growth plates excised at surgery. In addition, consideration is needed for a possible network approach to etiopathogenesis by constructing AIS diseasomes. These approaches may

  15. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  16. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  17. Developing Pokemon AI For Finding Comfortable Settings

    OpenAIRE

    Panumate, Chetprayoon; Iida, Hiroyuki

    2016-01-01

    This paper explores an innovative way to find a comfortable setting of video games. Pokemon is chosen as benchmark and game refinement measure is employed for the assessment. The number of Pokemon that one trainer can carry (i.e., setting with n=6) has never been changed after the first episode of Pokemon was released in 1996. Pokemon battle is simulated and various AIs are developed for the experiments. The results show that the original setting is the best for many players of various levels.

  18. Applying AI tools to operational space environmental analysis

    Science.gov (United States)

    Krajnak, Mike; Jesse, Lisa; Mucks, John

    1995-01-01

    The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

  19. Recurrent Partial Words

    Directory of Open Access Journals (Sweden)

    Francine Blanchet-Sadri

    2011-08-01

    Full Text Available Partial words are sequences over a finite alphabet that may contain wildcard symbols, called holes, which match or are compatible with all letters; partial words without holes are said to be full words (or simply words. Given an infinite partial word w, the number of distinct full words over the alphabet that are compatible with factors of w of length n, called subwords of w, refers to a measure of complexity of infinite partial words so-called subword complexity. This measure is of particular interest because we can construct partial words with subword complexities not achievable by full words. In this paper, we consider the notion of recurrence over infinite partial words, that is, we study whether all of the finite subwords of a given infinite partial word appear infinitely often, and we establish connections between subword complexity and recurrence in this more general framework.

  20. Dissecting phenotypic variation among AIS patients

    International Nuclear Information System (INIS)

    Wang Minghua; Wang Jiucun; Zhang Zhen; Zhao Zhimin; Zhang Rongmei; Hu Xiaohua; Tan Tao; Luo Shijing; Luo Zewei

    2005-01-01

    We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg 840 Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

  1. Monitoring Severe Accidents Using AI Techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

    2011-01-01

    It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

  2. Vorschlag zur Erarbeitung einer operationalen Fremdwortdefinition (A Proposal for Establishing a Functional System for Defining Foreign Words)

    Science.gov (United States)

    Schank, Gerd

    1974-01-01

    In order to define words borrowed from other languages, dialects or varieties within a dialect, a synchronic definition, including the degree of integration into the borrowing language, is more useful and flexible than the traditional etymological approach. (Text is in German.) (TL)

  3. AI model for computer games based on case based reasoning and AI planning

    NARCIS (Netherlands)

    Menkovski, V.; Metafas, D.

    2008-01-01

    Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

  4. AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

    Science.gov (United States)

    Goldstein, Ira P.; Miller, Mark L.

    The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

  5. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-06-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (1) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper will discuss the various types of security applications that are presently being considered for the above areas and will briefly describe a few examples of the application of this technology. Examples will include ground mobile platforms carrying alarm assessment and/or surveillance sensors and operating either autonomously or with telepresence by a remote operator. An airborne platform performing similar functions will also be discussed. An application of a type of robot sentry that would be fixed and incorporate very simple portable displays will also be described. A third type of robot, an interior robot, that could be used in sensitive or hazardous areas to do detection and assessment functions will be reviewed

  6. Universal Lyndon Words

    OpenAIRE

    Carpi, Arturo; Fici, Gabriele; Holub, Stepan; Oprsal, Jakub; Sciortino, Marinella

    2014-01-01

    A word $w$ over an alphabet $\\Sigma$ is a Lyndon word if there exists an order defined on $\\Sigma$ for which $w$ is lexicographically smaller than all of its conjugates (other than itself). We introduce and study \\emph{universal Lyndon words}, which are words over an $n$-letter alphabet that have length $n!$ and such that all the conjugates are Lyndon words. We show that universal Lyndon words exist for every $n$ and exhibit combinatorial and structural properties of these words. We then defi...

  7. Pathologies of AI: Responsible use of artificial intelligence in professional work

    NARCIS (Netherlands)

    Stamper, R.K.

    1988-01-01

    Although the AI paradigm is useful for building knowledge-based systems for the applied natural sciences, there are dangers when it is extended into the domains of business, law and other social systems. It is misleading to treat knowledge as a commodity that can be separated from the context in

  8. A Few Words about Words | Poster

    Science.gov (United States)

    By Ken Michaels, Guest Writer In Shakepeare’s play “Hamlet,” Polonius inquires of the prince, “What do you read, my lord?” Not at all pleased with what he’s reading, Hamlet replies, “Words, words, words.”1 I have previously described the communication model in which a sender encodes a message and then sends it via some channel (or medium) to a receiver, who decodes the message

  9. Towards a science of integrated AI and Robotics

    OpenAIRE

    Rajan, Kanna; Saffiotti, Alessandro

    2017-01-01

    The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

  10. Humans and Machines in the Evolution of AI in Korea

    OpenAIRE

    Zhang, Byoung-Tak

    2016-01-01

    Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

  11. AI Reloaded: Objectives, Potentials, and Challenges of the Novel Field of Brain-Like Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Rosemarie Velik

    2012-11-01

    Full Text Available The general objective of Artificial Intelligence (AI is to make machines – particularly computers – do things that require intelligence when done by humans. In the last 60 years, AI has significantly progressed and today forms an important part of industry and technology. However, despite the many successes, fundamental questions concerning the creation of human-level intelligence in machines still remain open and will probably not be answerable when continuing on the current, mainly mathematic-algorithmically-guided path of AI. With the novel discipline of
    Brain-Like Artificial Intelligence, one potential way out of this dilemma has been suggested. Brain-Like AI aims at analyzing and deciphering the working mechanisms of the brain and translating this knowledge into implementable AI architectures with the objective to develop in this way more efficient, flexible, and capable technical systems This article aims at giving a review about this young and still heterogeneous and dynamic research field.

  12. Applying AI techniques to improve alarm display effectiveness

    International Nuclear Information System (INIS)

    Gross, J.M.; Birrer, S.A.; Crosberg, D.R.

    1987-01-01

    The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

  13. The implementation of AI technologies in computer wargames

    Science.gov (United States)

    Tiller, John A.

    2004-08-01

    Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

  14. Little AI: Playing a constructivist robot

    Science.gov (United States)

    Georgeon, Olivier L.

    Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated "baby robot". The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player's commands. The player must learn, at the same time, the functioning of the robot's body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937), [1]).

  15. AI based HealthCare Platform for Real Time, Predictive and Prescriptive Analytics using Reactive Programming

    Science.gov (United States)

    Kaur, Jagreet; Singh Mann, Kulwinder, Dr.

    2018-01-01

    AI in Healthcare needed to bring real, actionable insights and Individualized insights in real time for patients and Doctors to support treatment decisions., We need a Patient Centred Platform for integrating EHR Data, Patient Data, Prescriptions, Monitoring, Clinical research and Data. This paper proposes a generic architecture for enabling AI based healthcare analytics Platform by using open sources Technologies Apache beam, Apache Flink Apache Spark, Apache NiFi, Kafka, Tachyon, Gluster FS, NoSQL- Elasticsearch, Cassandra. This paper will show the importance of applying AI based predictive and prescriptive analytics techniques in Health sector. The system will be able to extract useful knowledge that helps in decision making and medical monitoring in real-time through an intelligent process analysis and big data processing.

  16. Identification of AI-2 Quorum Sensing Inhibitors in Vibrio harveyi Through Structure-Based Virtual Screening.

    Science.gov (United States)

    Jiang, Tianyu; Zhu, Peng; Du, Lupei; Li, Minyong

    2018-01-01

    Quorum sensing (QS) is a cell-to-cell communication system that regulates gene expression as a result of the production and perception of signal molecules called autoinducers (AIs). AI-2 is a QS autoinducer produced by both Gram-negative and Gram-positive bacteria, in which it regulates intraspecies and interspecies communication. The identification of QS inhibitors is considered a promising strategy for the development of anti-virulence drugs with reduced selective pressure for resistance. Here we describe a high-throughput virtual screening approach to identify AI-2 quorum sensing inhibitors on the basis of Vibrio harveyi LuxPQ crystal structure. Seven potent inhibitors with IC 50 values in the micromolar range were selected with no effect or low effect on V. harveyi growth rate.

  17. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  18. Dicty_cDB: FC-AI18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  19. Dicty_cDB: FC-AI03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  20. Combinatorics on words Christoffel words and repetitions in words

    CERN Document Server

    Berstel, Jean; Reutenauer, Christophe; Saliola, Franco V

    2008-01-01

    The two parts of this text are based on two series of lectures delivered by Jean Berstel and Christophe Reutenauer in March 2007 at the Centre de Recherches Mathématiques, Montréal, Canada. Part I represents the first modern and comprehensive exposition of the theory of Christoffel words. Part II presents numerous combinatorial and algorithmic aspects of repetition-free words stemming from the work of Axel Thue-a pioneer in the theory of combinatorics on words. A beginner to the theory of combinatorics on words will be motivated by the numerous examples, and the large variety of exercises, which make the book unique at this level of exposition. The clean and streamlined exposition and the extensive bibliography will also be appreciated. After reading this book, beginners should be ready to read modern research papers in this rapidly growing field and contribute their own research to its development. Experienced readers will be interested in the finitary approach to Sturmian words that Christoffel words offe...

  1. On universal partial words

    OpenAIRE

    Chen, Herman Z. Q.; Kitaev, Sergey; Mütze, Torsten; Sun, Brian Y.

    2016-01-01

    A universal word for a finite alphabet $A$ and some integer $n\\geq 1$ is a word over $A$ such that every word in $A^n$ appears exactly once as a subword (cyclically or linearly). It is well-known and easy to prove that universal words exist for any $A$ and $n$. In this work we initiate the systematic study of universal partial words. These are words that in addition to the letters from $A$ may contain an arbitrary number of occurrences of a special `joker' symbol $\\Diamond\

  2. Word 2013 for dummies

    CERN Document Server

    Gookin, Dan

    2013-01-01

    This bestselling guide to Microsoft Word is the first and last word on Word 2013 It's a whole new Word, so jump right into this book and learn how to make the most of it. Bestselling For Dummies author Dan Gookin puts his usual fun and friendly candor back to work to show you how to navigate the new features of Word 2013. Completely in tune with the needs of the beginning user, Gookin explains how to use Word 2013 quickly and efficiently so that you can spend more time working on your projects and less time trying to figure it all out. Walks you through the capabilit

  3. From Word Alignment to Word Senses, via Multilingual Wordnets

    Directory of Open Access Journals (Sweden)

    Dan Tufis

    2006-05-01

    Full Text Available Most of the successful commercial applications in language processing (text and/or speech dispense with any explicit concern on semantics, with the usual motivations stemming from the computational high costs required for dealing with semantics, in case of large volumes of data. With recent advances in corpus linguistics and statistical-based methods in NLP, revealing useful semantic features of linguistic data is becoming cheaper and cheaper and the accuracy of this process is steadily improving. Lately, there seems to be a growing acceptance of the idea that multilingual lexical ontologisms might be the key towards aligning different views on the semantic atomic units to be used in characterizing the general meaning of various and multilingual documents. Depending on the granularity at which semantic distinctions are necessary, the accuracy of the basic semantic processing (such as word sense disambiguation can be very high with relatively low complexity computing. The paper substantiates this statement by presenting a statistical/based system for word alignment and word sense disambiguation in parallel corpora. We describe a word alignment platform which ensures text pre-processing (tokenization, POS-tagging, lemmatization, chunking, sentence and word alignment as required by an accurate word sense disambiguation.

  4. Planning chemical syntheses with deep neural networks and symbolic AI

    Science.gov (United States)

    Segler, Marwin H. S.; Preuss, Mike; Waller, Mark P.

    2018-03-01

    To plan the syntheses of small organic molecules, chemists use retrosynthesis, a problem-solving technique in which target molecules are recursively transformed into increasingly simpler precursors. Computer-aided retrosynthesis would be a valuable tool but at present it is slow and provides results of unsatisfactory quality. Here we use Monte Carlo tree search and symbolic artificial intelligence (AI) to discover retrosynthetic routes. We combined Monte Carlo tree search with an expansion policy network that guides the search, and a filter network to pre-select the most promising retrosynthetic steps. These deep neural networks were trained on essentially all reactions ever published in organic chemistry. Our system solves for almost twice as many molecules, thirty times faster than the traditional computer-aided search method, which is based on extracted rules and hand-designed heuristics. In a double-blind AB test, chemists on average considered our computer-generated routes to be equivalent to reported literature routes.

  5. Age and helium content of the eclipsing binary AI Phoenicis

    International Nuclear Information System (INIS)

    VandenBerg, D.A.; Hrivnak, B.J.

    1985-01-01

    Comparisons of new theoretical isochrones for heavy-element abundances Z = 0.0169 (solar) and Z = 0.04 with recently published parameters of AI Phoenicis suggest that this system has an age of approximately (3.6 +- 0.7) x 10 9 yr and a helium content of Y = 0.38 +- 0.05. The indicated uncertainty is largely due to the lack of precise knowledge about the metallicity of the binary, since the fits to the data by both sets of isochrones are exceedingly good. The high helium content, which is required in order to reproduce the observed mass-luminosity relation, is suggested to be comparable with the values generally derived for binaries if the latter are adjusted to take into account the effect of the new Los Alamos opacities

  6. Prediction of shipboard electromagnetic interference (EMI) problems using artificial intelligence (AI) technology

    Science.gov (United States)

    Swanson, David J.

    1990-08-01

    The electromagnetic interference prediction problem is characteristically ill-defined and complicated. Severe EMI problems are prevalent throughout the U.S. Navy, causing both expected and unexpected impacts on the operational performance of electronic combat systems onboard ships. This paper focuses on applying artificial intelligence (AI) technology to the prediction of ship related electromagnetic interference (EMI) problems.

  7. Autonomously generating operations sequences for a Mars Rover using AI-based planning

    Science.gov (United States)

    Sherwood, Rob; Mishkin, Andrew; Estlin, Tara; Chien, Steve; Backes, Paul; Cooper, Brian; Maxwell, Scott; Rabideau, Gregg

    2001-01-01

    This paper discusses a proof-of-concept prototype for ground-based automatic generation of validated rover command sequences from highlevel science and engineering activities. This prototype is based on ASPEN, the Automated Scheduling and Planning Environment. This Artificial Intelligence (AI) based planning and scheduling system will automatically generate a command sequence that will execute within resource constraints and satisfy flight rules.

  8. Vers l'integration des textes dans le programme du fran9ais langue ...

    African Journals Online (AJOL)

    Au Malawi, on enseigne le fran9ais en tant que langue etrangere depuis une quarantaine d'annees .... !'organisation institutionnelle du systeme educatif du Malawi, le palier secondaire en ... Les objectifs du type : rediger une lettre, decrire une .... nouveau (rheme). Charolles souligne qu'il s'agit d'une performance delicate.

  9. Understanding Medical Words

    Science.gov (United States)

    ... Bar Home Current Issue Past Issues Understanding Medical Words Past Issues / Summer 2009 Table of Contents For ... Medicine that teaches you about many of the words related to your health care Do you have ...

  10. Ai Weiwei - 21. sajandi märter? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

  11. Brosimacutins A-I, nine new flavonoids from Brosimum acutifolium.

    Science.gov (United States)

    Takashima, Junko; Ohsaki, Ayumi

    2002-12-01

    Nine new flavonoids, brosimacutins A-I (1-9), and four known flavonoids were isolated from the bark of Brosimum acutifolium, a Brazilian folk medicine ("Mururé"). Their structures were elucidated by spectroscopic methods, including 2D NMR. Brosimacutins A-I possess differentially functionalized isoprene units at C-8.

  12. An Immune Agent for Web-Based AI Course

    Science.gov (United States)

    Gong, Tao; Cai, Zixing

    2006-01-01

    To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

  13. the Lexique kikongo–français by

    African Journals Online (AJOL)

    Gilles-Maurice de Schryver

    français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

  14. Radioimmunoassay of apolipoprotein A-I of rat serum

    International Nuclear Information System (INIS)

    Fainaru, M.; Havel, R.J.; Felker, T.E.

    1976-01-01

    A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

  15. Little AI: Playing a constructivist robot

    Directory of Open Access Journals (Sweden)

    Olivier L. Georgeon

    2017-01-01

    Full Text Available Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated “baby robot”. The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player’s commands. The player must learn, at the same time, the functioning of the robot’s body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937, [1].

  16. GPU: the biggest key processor for AI and parallel processing

    Science.gov (United States)

    Baji, Toru

    2017-07-01

    Two types of processors exist in the market. One is the conventional CPU and the other is Graphic Processor Unit (GPU). Typical CPU is composed of 1 to 8 cores while GPU has thousands of cores. CPU is good for sequential processing, while GPU is good to accelerate software with heavy parallel executions. GPU was initially dedicated for 3D graphics. However from 2006, when GPU started to apply general-purpose cores, it was noticed that this architecture can be used as a general purpose massive-parallel processor. NVIDIA developed a software framework Compute Unified Device Architecture (CUDA) that make it possible to easily program the GPU for these application. With CUDA, GPU started to be used in workstations and supercomputers widely. Recently two key technologies are highlighted in the industry. The Artificial Intelligence (AI) and Autonomous Driving Cars. AI requires a massive parallel operation to train many-layers of neural networks. With CPU alone, it was impossible to finish the training in a practical time. The latest multi-GPU system with P100 makes it possible to finish the training in a few hours. For the autonomous driving cars, TOPS class of performance is required to implement perception, localization, path planning processing and again SoC with integrated GPU will play a key role there. In this paper, the evolution of the GPU which is one of the biggest commercial devices requiring state-of-the-art fabrication technology will be introduced. Also overview of the GPU demanding key application like the ones described above will be introduced.

  17. Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  18. WordPress Bible

    CERN Document Server

    Brazell, Aaron

    2010-01-01

    The WordPress Bible provides a complete and thorough guide to the largest self hosted blogging tool. This guide starts by covering the basics of WordPress such as installing and the principles of blogging, marketing and social media interaction, but then quickly ramps the reader up to more intermediate to advanced level topics such as plugins, WordPress Loop, themes and templates, custom fields, caching, security and more. The WordPress Bible is the only complete resource one needs to learning WordPress from beginning to end.

  19. Word/sub-word lattices decomposition and combination for speech recognition

    OpenAIRE

    Le , Viet-Bac; Seng , Sopheap; Besacier , Laurent; Bigi , Brigitte

    2008-01-01

    International audience; This paper presents the benefit of using multiple lexical units in the post-processing stage of an ASR system. Since the use of sub-word units can reduce the high out-of-vocabulary rate and improve the lack of text resources in statistical language modeling, we propose several methods to decompose, normalize and combine word and sub-word lattices generated from different ASR systems. By using a sub-word information table, every word in a lattice can be decomposed into ...

  20. AI and simulation: What can they learn from each other

    Science.gov (United States)

    Colombano, Silvano P.

    1988-01-01

    Simulation and Artificial Intelligence share a fertile common ground both from a practical and from a conceptual point of view. Strengths and weaknesses of both Knowledge Based System and Modeling and Simulation are examined and three types of systems that combine the strengths of both technologies are discussed. These types of systems are a practical starting point, however, the real strengths of both technologies will be exploited only when they are combined in a common knowledge representation paradigm. From an even deeper conceptual point of view, one might even argue that the ability to reason from a set of facts (i.e., Expert System) is less representative of human reasoning than the ability to make a model of the world, change it as required, and derive conclusions about the expected behavior of world entities. This is a fundamental problem in AI, and Modeling Theory can contribute to its solution. The application of Knowledge Engineering technology to a Distributed Processing Network Simulator (DPNS) is discussed.

  1. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  2. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  3. Dicty_cDB: FC-AI19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  4. Dicty_cDB: FC-AI14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  5. Dicty_cDB: FC-AI15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  6. Dicty_cDB: FC-AI24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  7. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  8. Dicty_cDB: FC-AI09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  9. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  10. Dicty_cDB: FC-AI08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  11. Niche as a determinant of word fate in online groups.

    Directory of Open Access Journals (Sweden)

    Eduardo G Altmann

    2011-05-01

    Full Text Available Patterns of word use both reflect and influence a myriad of human activities and interactions. Like other entities that are reproduced and evolve, words rise or decline depending upon a complex interplay between their intrinsic properties and the environments in which they function. Using Internet discussion communities as model systems, we define the concept of a word niche as the relationship between the word and the characteristic features of the environments in which it is used. We develop a method to quantify two important aspects of the size of the word niche: the range of individuals using the word and the range of topics it is used to discuss. Controlling for word frequency, we show that these aspects of the word niche are strong determinants of changes in word frequency. Previous studies have already indicated that word frequency itself is a correlate of word success at historical time scales. Our analysis of changes in word frequencies over time reveals that the relative sizes of word niches are far more important than word frequencies in the dynamics of the entire vocabulary at shorter time scales, as the language adapts to new concepts and social groupings. We also distinguish endogenous versus exogenous factors as additional contributors to the fates of words, and demonstrate the force of this distinction in the rise of novel words. Our results indicate that short-term nonstationarity in word statistics is strongly driven by individual proclivities, including inclinations to provide novel information and to project a distinctive social identity.

  12. The Staggered Spondaic Word Test. A ten-minute look at the central nervous system through the ears.

    Science.gov (United States)

    Katz, J; Smith, P S

    1991-01-01

    We have described three major groupings that encompass most auditory processing difficulties. While the problems may be superimposed upon one another in any individual client, each diagnostic sign is closely associated with particular communication and learning disorders. In addition, these behaviors may be related back to the functional anatomy of the regions that are implicated by the SSW test. The auditory-decoding group is deficient in rapid analysis of speech. The vagueness of speech sound knowledge is thought to lead to auditory misunderstanding and confusion. In early life, this may be reflected in the child's articulation. Poor phonic skills that result from this deficit are thought to contribute to their limited reading and spelling abilities. The auditory tolerance-fading memory group is often thought to have severe auditory-processing problems because those in it are highly distracted by background sounds and have poor auditory memories. However, school performance is not far from grade level, and the resulting reading disabilities stem more from limited comprehension than from an inability to sound out the words. Distractibility and poor auditory memory could contribute to the apparent weakness in reading comprehension. Many of the characteristics of the auditory tolerance-fading memory group are similar to those of attention deficit disorder cases. Both groups are associated anatomically with the AC region. The auditory integration cases can be divided into two subgroups. In the first, the subjects exhibit the most severe reading and spelling problems of the three major categories. These individuals closely resemble the classical dyslexics. We presume that this disorder represents a major disruption in auditory-visual integration. The second subgroup has much less severe learning difficulties, which closely follow the pattern of dysfunction of the auditory tolerance-fading memory group. The excellent physiological procedures to which we have been

  13. Word Similarity from Dictionaries: Inferring Fuzzy Measures from Fuzzy Graphs

    Directory of Open Access Journals (Sweden)

    Vicenc Torra

    2008-01-01

    Full Text Available WORD SIMILARITY FROM DICTIONARIES: INFERRING FUZZY MEASURES FROM FUZZY GRAPHS The computation of similarities between words is a basic element of information retrieval systems, when retrieval is not solely based on word matching. In this work we consider a measure between words based on dictionaries. This is achieved assuming that a dictionary is formalized as a fuzzy graph. We show that the approach permits to compute measures not only for pairs of words but for sets of them.

  14. Word Pocket Guide

    CERN Document Server

    Glenn, Walter

    2004-01-01

    Millions of people use Microsoft Word every day and, chances are, you're one of them. Like most Word users, you've attained a certain level of proficiency--enough to get by, with a few extra tricks and tips--but don't get the opportunity to probe much further into the real power of Word. And Word is so rich in features that regardless of your level of expertise, there's always more to master. If you've ever wanted a quick answer to a nagging question or had the thought that there must be a better way, then this second edition of Word Pocket Guide is just what you need. Updated for Word 2003

  15. Baby's first 10 words.

    Science.gov (United States)

    Tardif, Twila; Fletcher, Paul; Liang, Weilan; Zhang, Zhixiang; Kaciroti, Niko; Marchman, Virginia A

    2008-07-01

    Although there has been much debate over the content of children's first words, few large sample studies address this question for children at the very earliest stages of word learning. The authors report data from comparable samples of 265 English-, 336 Putonghua- (Mandarin), and 369 Cantonese-speaking 8- to 16-month-old infants whose caregivers completed MacArthur-Bates Communicative Development Inventories and reported them to produce between 1 and 10 words. Analyses of individual words indicated striking commonalities in the first words that children learn. However, substantive cross-linguistic differences appeared in the relative prevalence of common nouns, people terms, and verbs as well as in the probability that children produced even one of these word types when they had a total of 1-3, 4-6, or 7-10 words in their vocabularies. These data document cross-linguistic differences in the types of words produced even at the earliest stages of vocabulary learning and underscore the importance of parental input and cross-linguistic/cross-cultural variations in children's early word-learning.

  16. Word 2010 Bible

    CERN Document Server

    Tyson, Herb

    2010-01-01

    In-depth guidance on Word 2010 from a Microsoft MVP. Microsoft Word 2010 arrives with many changes and improvements, and this comprehensive guide from Microsoft MVP Herb Tyson is your expert, one-stop resource for it all. Master Word's new features such as a new interface and customized Ribbon, major new productivity-boosting collaboration tools, how to publish directly to blogs, how to work with XML, and much more. Follow step-by-step instructions and best practices, avoid pitfalls, discover practical workarounds, and get the very most out of your new Word 2010 with this packed guide. Coverag

  17. Recent progresses on AI-2 bacterial quorum sensing inhibitors.

    Science.gov (United States)

    Zhu, Peng; Li, Minyong

    2012-01-01

    Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

  18. Creating an AI modeling application for designers and developers

    Science.gov (United States)

    Houlette, Ryan; Fu, Daniel; Jensen, Randy

    2003-09-01

    Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

  19. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  20. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    The AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  1. Quality measures and assurance for AI (Artificial Intelligence) software

    Science.gov (United States)

    Rushby, John

    1988-01-01

    This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

  2. Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS. The MAGI mission is to use the Wave Glider to sample the late summer chlorophyll bloom that develops near...

  3. Novel word retention in sequential bilingual children.

    Science.gov (United States)

    Kan, Pui Fong

    2014-03-01

    Children's ability to learn and retain new words is fundamental to their vocabulary development. This study examined word retention in children learning a home language (L1) from birth and a second language (L2) in preschool settings. Participants were presented with sixteen novel words in L1 and in L2 and were tested for retention after either a 2-month or a 4-month delay. Results showed that children retained more words in L1 than in L2 for both of the retention interval conditions. In addition, children's word retention was associated with their existing language knowledge and their fast-mapping performance within and across language. The patterns of association, however, were different between L1 and L2. These findings suggest that children's word retention might be related to the interactions of various components that are operating within a dynamic system.

  4. Arabic word recognizer for mobile applications

    Science.gov (United States)

    Khanna, Nitin; Abdollahian, Golnaz; Brame, Ben; Boutin, Mireille; Delp, Edward J.

    2011-03-01

    When traveling in a region where the local language is not written using a "Roman alphabet," translating written text (e.g., documents, road signs, or placards) is a particularly difficult problem since the text cannot be easily entered into a translation device or searched using a dictionary. To address this problem, we are developing the "Rosetta Phone," a handheld device (e.g., PDA or mobile telephone) capable of acquiring an image of the text, locating the region (word) of interest within the image, and producing both an audio and a visual English interpretation of the text. This paper presents a system targeted for interpreting words written in Arabic script. The goal of this work is to develop an autonomous, segmentation-free Arabic phrase recognizer, with computational complexity low enough to deploy on a mobile device. A prototype of the proposed system has been deployed on an iPhone with a suitable user interface. The system was tested on a number of noisy images, in addition to the images acquired from the iPhone's camera. It identifies Arabic words or phrases by extracting appropriate features and assigning "codewords" to each word or phrase. On a dictionary of 5,000 words, the system uniquely mapped (word-image to codeword) 99.9% of the words. The system has a 82% recognition accuracy on images of words captured using the iPhone's built-in camera.

  5. Learning word meanings: Overnight integration and study modality effects

    NARCIS (Netherlands)

    Ven, F. van der; Takashima, A.; Segers, P.C.J.; Verhoeven, L.T.W.

    2015-01-01

    According to the complementary learning systems (CLS) account of word learning, novel words are rapidly acquired (learning system 1), but slowly integrated into the mental lexicon (learning system 2). This two-step learning process has been shown to apply to novel word forms. In this study, we

  6. Emotion Oriented Programming: Computational Abstractions for AI Problem Solving

    OpenAIRE

    Darty , Kevin; Sabouret , Nicolas

    2012-01-01

    International audience; In this paper, we present a programming paradigm for AI problem solving based on computational concepts drawn from Affective Computing. It is believed that emotions participate in human adaptability and reactivity, in behaviour selection and in complex and dynamic environments. We propose to define a mechanism inspired from this observation for general AI problem solving. To this purpose, we synthesize emotions as programming abstractions that represent the perception ...

  7. It Takes Two to Tango: Towards Theory of AI's Mind

    OpenAIRE

    Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

    2017-01-01

    Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

  8. AI, Native Supercomputing and The Revival of Moore's Law

    OpenAIRE

    Lu, Chien-Ping

    2017-01-01

    Based on Alan Turing's proposition on AI and computing machinery, which shaped Computing as we know it today, the new AI computing machinery should comprise a universal computer and a universal learning machine. The later should understand linear algebra natively to overcome the slowdown of Moore's law. In such a universal learnig machine, a computing unit does not need to keep the legacy of a universal computing core. The data can be distributed to the computing units, and the results can be...

  9. ai (Euterpe oleracea Mart. Upregulates Paraoxonase 1 Gene Expression and Activity with Concomitant Reduction of Hepatic Steatosis in High-Fat Diet-Fed Rats

    Directory of Open Access Journals (Sweden)

    Renata Rebeca Pereira

    2016-01-01

    Full Text Available Açai (Euterpe oleracea Mart., a fruit from the Amazon region, has emerged as a promising source of polyphenols. Açai consumption has been increasing owing to ascribed health benefits and antioxidant properties; however, its effects on hepatic injury are limited. In this study, we evaluated the antioxidant effect of filtered açai pulp on the expression of paraoxonase (PON isoforms and PON1 activity in rats with nonalcoholic fatty liver disease (NAFLD. The rats were fed a standard AIN-93M (control diet or a high-fat (HF diet containing 25% soy oil and 1% cholesterol with or without açai pulp (2 g/day for 6 weeks. Our results show that açai pulp prevented low-density lipoprotein (LDL oxidation, increased serum and hepatic PON1 activity, and upregulated the expression of PON1 and ApoA-I in the liver. In HF diet-fed rats, treatment with açai pulp attenuated liver damage, reducing fat infiltration and triglyceride (TG content. In rats receiving açai, increased serum PON1 activity was correlated with a reduction in hepatic steatosis and hepatic injury. These findings suggest the use of açai as a potential therapy for liver injuries, supporting the idea that dietary antioxidants are a promising approach to enhance the defensive systems against oxidative stress.

  10. AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

    Directory of Open Access Journals (Sweden)

    Endang W. Bachtiar

    2014-07-01

    Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

  11. Highlights on artificial insemination (AI technology in the pig

    Directory of Open Access Journals (Sweden)

    Tarek Khalifa

    2014-03-01

    Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

  12. The Relationships among Cognitive Correlates and Irregular Word, Non-Word, and Word Reading

    Science.gov (United States)

    Abu-Hamour, Bashir; University, Mu'tah; Urso, Annmarie; Mather, Nancy

    2012-01-01

    This study explored four hypotheses: (a) the relationships among rapid automatized naming (RAN) and processing speed (PS) to irregular word, non-word, and word reading; (b) the predictive power of various RAN and PS measures, (c) the cognitive correlates that best predicted irregular word, non-word, and word reading, and (d) reading performance of…

  13. Word of Jeremiah - Word of God

    DEFF Research Database (Denmark)

    Holt, Else Kragelund

    2007-01-01

    The article examines the relationship between God, prophet and the people in the Book of Jeremiah. The analysis shows a close connection, almost an identification, between the divine word (and consequently God himself) and the prophet, so that the prophet becomes a metaphor for God. This is done...

  14. Ship Emission Inventories in Estuary of the Yangtze River Using Terrestrial AIS Data

    Directory of Open Access Journals (Sweden)

    Xin Yao

    2016-12-01

    Full Text Available Estuary forms a transition zone between inland river and open sea. In China, the estuary of the Yangtze River plays a vital role in connecting the inland and oversea shipping, and witnesses heavy vessel traffic in the recent decades. Nowadays, more attentions have been directed to the issue of ship pollution in busy waterways. In order to investigate the ship emission inventory, this paper presents an Automatic Identification System(AIS based method. AIS data is the realistic data of vessel traffic including dynamic information (position, speed, course, etc. and static information (ship type, dimensions, name, etc.. According to ship dimensions, the power of engines is estimated for different ship types. By using AIS based bottom-up approach, ship emission inventories and shares of air pollutants and GHGs (Greenhouse gases are developed. Spatial distribution of ship emissions is illustrated in the form of heat map. As a case study, the emission inventories are analyzed using AIS data of 2010 in the estuary, and following results are made:(1 shares of the emission are cruise ships 6.59%, bulk carriers 5.16%, container ships 52.96%, tankers 15.16%, fishing ships 9.16%, other ships 10.97%; (2 CO2 is the dominant part of the emission. (3 Areas of highest emission intensity are generally clustered around the South Channel, the North Channel and ports in the vicinity. The proposed method is promising because it is derived from the AIS data which contains not only real data of individual ship but also vessel traffic situation in the study area. It can server as a reference for other researchers and policy makers working in this field.

  15. Word Processing for All.

    Science.gov (United States)

    Abbott, Chris

    1991-01-01

    Pupils with special educational needs are finding that the use of word processors can give them a new confidence and pride in their own abilities. This article describes the use of such devices as the "mouse," on-screen word lists, spell checkers, and overlay keyboards. (JDD)

  16. Word Translation Entropy

    DEFF Research Database (Denmark)

    Schaeffer, Moritz; Dragsted, Barbara; Hvelplund, Kristian Tangsgaard

    This study reports on an investigation into the relationship between the number of translation alternatives for a single word and eye movements on the source text. In addition, the effect of word order differences between source and target text on eye movements on the source text is studied. In p...

  17. Nine Words - Nine Columns

    DEFF Research Database (Denmark)

    Trempe Jr., Robert B.; Buthke, Jan

    2016-01-01

    of computational and mechanical processes towards an anesthetic. Each team received a single word, translating and evolving that word first into a double-curved computational surface, next a ruled computational surface, and then a physically shaped foam mold via a 6-axis robot. The foam molds then operated...

  18. Flexible Word Classes

    DEFF Research Database (Denmark)

    • First major publication on the phenomenon • Offers cross-linguistic, descriptive, and diverse theoretical approaches • Includes analysis of data from different language families and from lesser studied languages This book is the first major cross-linguistic study of 'flexible words', i.e. words...... that cannot be classified in terms of the traditional lexical categories Verb, Noun, Adjective or Adverb. Flexible words can - without special morphosyntactic marking - serve in functions for which other languages must employ members of two or more of the four traditional, 'specialised' word classes. Thus......, flexible words are underspecified for communicative functions like 'predicating' (verbal function), 'referring' (nominal function) or 'modifying' (a function typically associated with adjectives and e.g. manner adverbs). Even though linguists have been aware of flexible world classes for more than...

  19. WordPress Bible

    CERN Document Server

    Brazell, Aaron

    2011-01-01

    Get the latest word on the biggest self-hosted blogging tool on the marketWithin a week of the announcement of WordPress 3.0, it had been downloaded over a million times. Now you can get on the bandwagon of this popular open-source blogging tool with WordPress Bible, 2nd Edition. Whether you're a casual blogger or programming pro, this comprehensive guide covers the latest version of WordPress, from the basics through advanced application development. If you want to thoroughly learn WordPress, this is the book you need to succeed.Explores the principles of blogging, marketing, and social media

  20. Ontological Annotation with WordNet

    Energy Technology Data Exchange (ETDEWEB)

    Sanfilippo, Antonio P.; Tratz, Stephen C.; Gregory, Michelle L.; Chappell, Alan R.; Whitney, Paul D.; Posse, Christian; Paulson, Patrick R.; Baddeley, Bob; Hohimer, Ryan E.; White, Amanda M.

    2006-06-06

    Semantic Web applications require robust and accurate annotation tools that are capable of automating the assignment of ontological classes to words in naturally occurring text (ontological annotation). Most current ontologies do not include rich lexical databases and are therefore not easily integrated with word sense disambiguation algorithms that are needed to automate ontological annotation. WordNet provides a potentially ideal solution to this problem as it offers a highly structured lexical conceptual representation that has been extensively used to develop word sense disambiguation algorithms. However, WordNet has not been designed as an ontology, and while it can be easily turned into one, the result of doing this would present users with serious practical limitations due to the great number of concepts (synonym sets) it contains. Moreover, mapping WordNet to an existing ontology may be difficult and requires substantial labor. We propose to overcome these limitations by developing an analytical platform that (1) provides a WordNet-based ontology offering a manageable and yet comprehensive set of concept classes, (2) leverages the lexical richness of WordNet to give an extensive characterization of concept class in terms of lexical instances, and (3) integrates a class recognition algorithm that automates the assignment of concept classes to words in naturally occurring text. The ensuing framework makes available an ontological annotation platform that can be effectively integrated with intelligence analysis systems to facilitate evidence marshaling and sustain the creation and validation of inference models.

  1. Automating Ontological Annotation with WordNet

    Energy Technology Data Exchange (ETDEWEB)

    Sanfilippo, Antonio P.; Tratz, Stephen C.; Gregory, Michelle L.; Chappell, Alan R.; Whitney, Paul D.; Posse, Christian; Paulson, Patrick R.; Baddeley, Bob L.; Hohimer, Ryan E.; White, Amanda M.

    2006-01-22

    Semantic Web applications require robust and accurate annotation tools that are capable of automating the assignment of ontological classes to words in naturally occurring text (ontological annotation). Most current ontologies do not include rich lexical databases and are therefore not easily integrated with word sense disambiguation algorithms that are needed to automate ontological annotation. WordNet provides a potentially ideal solution to this problem as it offers a highly structured lexical conceptual representation that has been extensively used to develop word sense disambiguation algorithms. However, WordNet has not been designed as an ontology, and while it can be easily turned into one, the result of doing this would present users with serious practical limitations due to the great number of concepts (synonym sets) it contains. Moreover, mapping WordNet to an existing ontology may be difficult and requires substantial labor. We propose to overcome these limitations by developing an analytical platform that (1) provides a WordNet-based ontology offering a manageable and yet comprehensive set of concept classes, (2) leverages the lexical richness of WordNet to give an extensive characterization of concept class in terms of lexical instances, and (3) integrates a class recognition algorithm that automates the assignment of concept classes to words in naturally occurring text. The ensuing framework makes available an ontological annotation platform that can be effectively integrated with intelligence analysis systems to facilitate evidence marshaling and sustain the creation and validation of inference models.

  2. How to define a word in a lexical network?

    Directory of Open Access Journals (Sweden)

    Dorota Sikora

    2012-01-01

    Full Text Available As underlined in Wierzbicka (1996: 239, a «linguistic definition is a scientific hypothesis about the concept encoded in a given word». The present paper focuses on the problem of what such hypothesis is about. Lexicon of any language is structured with a set of connections relating lexical items. That is to say that speakers of any language need to master not only separate words, but rather a cluster of connected senses. If so, then a lexical definition should lay out the concept the word lexicalizes in the way that gives access to the whole grasp of its conceptual, paradigmatic and syntagmatic relations. We discuss the topic of definitional structures developed in the context of the French Lexical Network (Réseau Lexical du Français.

  3. The Atomics International (AI) prototype large breeder reactor (PLBR)

    International Nuclear Information System (INIS)

    McDonald, J.S.; Campise, A.V.; Brunings, J.

    1978-01-01

    The AI-PLBR breeder plant design prepared for ERDA and EPRI is of 1000 MWe size, utilizing a loop-type sodium system configuration and producing 2200 psig/850 0 F steam. A 'bullseye' core geometry type sodium system configuration and is employed with Pu0 2 -UO 2 fuel and UO 2 fertile material. The reactor outlet coolant temperature is 930 0 F. A modified 'A'-frame refueling system is employed, which is capable of handling 1/3 of a core loading in 12 days. An inducer-type mechanical pump is used in the primary circuit because of its excellent NPSH characteristics. Hockey sticks steam generators are used to produce near-fossil steam conditions at the turbine throttle. The balance of plant (BOP) design was developed by the architectural-engineering firm of Burns and Roe. It includes Allis-Chalmers - KWU 1800-rpm tandem-compound turbine, selected with high-,intermediate-, and two double-flow low-pressure cylinders equipped with two moisture separator cyclones. A design feature to enhance the licensability of the reference design is the three-level Decay Heat Removal System (DHRS), which consists of normal, backup, and diverse decay heat removal paths. The Atomics International PLBR design illustrated the technical soundness of the LMFBR system for meeting the world's long-term electrical energy supply needs. The design includes design features to assure licensability and innovative engineering features to enhance reliability, constructability, economics, and U.S. utility grid compatibility. The design concept provides a sound basis for the future detailed design of a prototype plant and subsequent development of larger LMFBR plants. (author)

  4. Formal Safety Assessment (FSA for Analysis of Ship Collision Using AIS Data

    Directory of Open Access Journals (Sweden)

    Muhammad Badrus Zaman

    2015-03-01

    Full Text Available Currently, Maritime safety is the best issue in the world. International Maritime organization (IMO have recommended FSA methodology to enhance maritime safety. In this paper, the research conducted in the Malacca Strait. Malacca Strait is an area that has a high risk for shipping navigation. Many accidents occur in the area are like collision, fire, grounding and so on. Therefore a study on improving safety in this area is very important. it is to produce an output that can be used to provide input to the master and multiple stakeholders to improve safety on board at the time of sailing. In this study, AIS is used as a data source. Sea condition data collected actual traffic through the Automatic Identification System (AIS equipment installed at Kobe University, Japan, and Universiti Teknologi Malaysia (UTM in Johor, Malaysia. The data is applied to define a method with the help of Geographic Information Systems (GIS.

  5. A photometric and spectroscopic study of the early-type binary AI Crucis

    International Nuclear Information System (INIS)

    Bell, S.A.; Kilkenny, D.; Malcolm, G.J.

    1987-01-01

    New Stroemgren photometry and medium-dispersion spectroscopy of the early-type eclipsing binary AI Cru are presented. The masses and radii of the two components are found to be (9.8 +-0.5) and (5.8 +-0.3) solar masses and (4.9 +- 0.1) and (4.4 +- 0.1) solar radii, respectively. The semi-detached nature of the system is confirmed and by comparison with stationary models by previous authors it is shown that AI Cru has probably passed through the rapid phase of Case A mass transfer. It is suggested that the original system may have had a period of about 1.3 day and that the roles of the current primary and secondary components were at that time reversed. (author)

  6. Computational intelligence from AI to BI to NI

    Science.gov (United States)

    Werbos, Paul J.

    2015-05-01

    This paper gives highlights of the history of the neural network field, stressing the fundamental ideas which have been in play. Early neural network research was motivated mainly by the goals of artificial intelligence (AI) and of functional neuroscience (biological intelligence, BI), but the field almost died due to frustrations articulated in the famous book Perceptrons by Minsky and Papert. When I found a way to overcome the difficulties by 1974, the community mindset was very resistant to change; it was not until 1987/1988 that the field was reborn in a spectacular way, leading to the organized communities now in place. Even then, it took many more years to establish crossdisciplinary research in the types of mathematical neural networks needed to really understand the kind of intelligence we see in the brain, and to address the most demanding engineering applications. Only through a new (albeit short-lived) funding initiative, funding crossdisciplinary teams of systems engineers and neuroscientists, were we able to fund the critical empirical demonstrations which put our old basic principle of "deep learning" firmly on the map in computer science. Progress has rightly been inhibited at times by legitimate concerns about the "Terminator threat" and other possible abuses of technology. This year, at SPIE, in the quantum computing track, we outline the next stage ahead of us in breaking out of the box, again and again, and rising to fundamental challenges and opportunities still ahead of us.

  7. Recalling taboo and nontaboo words.

    Science.gov (United States)

    Jay, Timothy; Caldwell-Harris, Catherine; King, Krista

    2008-01-01

    People remember emotional and taboo words better than neutral words. It is well known that words that are processed at a deep (i.e., semantic) level are recalled better than words processed at a shallow (i.e., purely visual) level. To determine how depth of processing influences recall of emotional and taboo words, a levels of processing paradigm was used. Whether this effect holds for emotional and taboo words has not been previously investigated. Two experiments demonstrated that taboo and emotional words benefit less from deep processing than do neutral words. This is consistent with the proposal that memories for taboo and emotional words are a function of the arousal level they evoke, even under shallow encoding conditions. Recall was higher for taboo words, even when taboo words were cued to be recalled after neutral and emotional words. The superiority of taboo word recall is consistent with cognitive neuroscience and brain imaging research.

  8. Word learning mechanisms.

    Science.gov (United States)

    He, Angela Xiaoxue; Arunachalam, Sudha

    2017-07-01

    How do children acquire the meanings of words? Many word learning mechanisms have been proposed to guide learners through this challenging task. Despite the availability of rich information in the learner's linguistic and extralinguistic input, the word-learning task is insurmountable without such mechanisms for filtering through and utilizing that information. Different kinds of words, such as nouns denoting object concepts and verbs denoting event concepts, require to some extent different kinds of information and, therefore, access to different kinds of mechanisms. We review some of these mechanisms to examine the relationship between the input that is available to learners and learners' intake of that input-that is, the organized, interpreted, and stored representations they form. We discuss how learners segment individual words from the speech stream and identify their grammatical categories, how they identify the concepts denoted by these words, and how they refine their initial representations of word meanings. WIREs Cogn Sci 2017, 8:e1435. doi: 10.1002/wcs.1435 This article is categorized under: Linguistics > Language Acquisition Psychology > Language. © 2017 Wiley Periodicals, Inc.

  9. 77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2012-11-15

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting... Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative... violence within AI/AN communities. Dates and Locations: The meeting will be held on the reservation of the...

  10. Data of evolutionary structure change: 1AIFL-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /ss_2> 0 n> 1AIF L...n> 1AIFLn> VSSSI----SSSNL 2AI0 Ln> 2AI0L...1AIFL-2AI0L 1AIF 2AI0 L L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...line> SER CA 273 SER CA 260 ASN CA 337 LEU CA 408

  11. Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  12. Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  13. Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  14. Words that Pop!

    Science.gov (United States)

    Russell, Shirley

    1988-01-01

    To excite students' appreciation of language, comic book words--onomatopoeia--are a useful tool. Exercises and books are suggested. A list of books for adults and children is recommended, and a reproducible page is provided. (JL)

  15. Decorporation: officially a word.

    Science.gov (United States)

    Fisher, D R

    2000-05-01

    This note is the brief history of a word. Decorporation is a scientific term known to health physicists who have an interest in the removal of internally deposited radionuclides from the body after an accidental or inadvertent intake. Although the word decorporation appears many times in the radiation protection literature, it was only recently accepted by the editors of the Oxford English Dictionary as an entry for their latest edition.

  16. Decorporation: Officially a word

    International Nuclear Information System (INIS)

    Fisher, D.R.

    2000-01-01

    This note is the brief history of a word. Decorporation is a scientific term known to health physicists who have an interest in the removal of internally deposited radionuclides from the body after an accidental or inadvertent intake. Although the word decorporation appears many times in the radiation protection literature, it was only recently accepted by the editors of the Oxford English Dictionary as an entry for their latest edition

  17. Decorporation: Officially a word

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    2000-05-01

    This note is the brief history of a word. Decorporation is a scientific term known to health physicists who have an interest in the removal of internally deposited radionuclides from the body after an accidental or inadvertent intake. Although the word decorporation appears many times in the radiation protection literature, it was only recently accepted by the editors of the Oxford English Dictionary as an entry for their latest edition.

  18. Decorporation: Officially a word

    International Nuclear Information System (INIS)

    Fisher, Darrell R.

    1999-01-01

    This note is the brief history of a word. Decorporation is a scientific term known to health physicists who have an interest in the removal of internally deposited radionuclides from the body after an accidental or inadvertent intake. Although the word decorporation appears many times in the radiation protection literature, it was only recently accepted by the editors of the Oxford English Dictionary as an entry for their latest edition

  19. Analysis of raw AIS spectrum recordings from a LEO satellite

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2014-01-01

    The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

  20. Towards AI-powered personalization in MOOC learning

    Science.gov (United States)

    Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

    2017-12-01

    Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

  1. New progress of FEM simulation and AI application in rolling at RAL

    International Nuclear Information System (INIS)

    Liu Xianghua; Wang Guodong; Zhao Kun

    2000-01-01

    New progresses on FEM simulation and AI application in rolling have been achieved at RAL recently. The existence and uniqueness of the extreme point of total functional for rolling problem has been proved. Different rolling processes, such as H-beam rolling, ribbing strip rolling, slab sizing, have been solved by our in-house FEM software package. The simulation results have been put into production use to improve the precision of math models. The Artificial Neural Network has been used to predict rolling force, coiling temperature, microstructure and properties of the rolled products. An expert system for deviation diagnoses of strip thickness has been developed for industry use. Synergetic Artificial Intelligence has also been applied to rolling scheduling. We are making continuous efforts to develop AI applications for rolling line co-operating in China steel industry. (author)

  2. Sonority and early words

    DEFF Research Database (Denmark)

    Kjærbæk, Laila; Boeg Thomsen, Ditte; Lambertsen, Claus

    2015-01-01

    Syllables play an important role in children’s early language acquisition, and children appear to rely on clear syllabic structures as a key to word acquisition (Vihman 1996; Oller 2000). However, not all languages present children with equally clear cues to syllabic structure, and since the spec......Syllables play an important role in children’s early language acquisition, and children appear to rely on clear syllabic structures as a key to word acquisition (Vihman 1996; Oller 2000). However, not all languages present children with equally clear cues to syllabic structure, and since...... acquisition therefore presents us with the opportunity to examine how children respond to the task of word learning when the input language offers less clear cues to syllabic structure than usually seen. To investigate the sound structure in Danish children’s lexical development, we need a model of syllable......-29 months. For the two children, the phonetic structure of the first ten words to occur is compared with that of the last ten words to occur before 30 months of age, and with that of ten words in between. Measures related to the sonority envelope, viz. sonority types and in particular sonority rises...

  3. Application of Artificial Intelligence (AI) Programming Techniques to Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1989-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within-Visual-Range (WVR) air combat engagements is discussed. The application of AI methods for development and implementation of the TDG is presented. The history of the Adaptive Maneuvering Logic (AML) program is traced and current versions of the AML program are compared and contrasted with the TDG system. The Knowledge-Based Systems (KBS) used by the TDG to aid in the decision-making process are outlined in detail and example rules are presented. The results of tests to evaluate the performance of the TDG versus a version of AML and versus human pilots in the Langley Differential Maneuvering Simulator (DMS) are presented. To date, these results have shown significant performance gains in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify than the updated FORTRAN AML programs.

  4. Finding words in a language that allows words without vowels.

    Science.gov (United States)

    El Aissati, Abder; McQueen, James M; Cutler, Anne

    2012-07-01

    Across many languages from unrelated families, spoken-word recognition is subject to a constraint whereby potential word candidates must contain a vowel. This constraint minimizes competition from embedded words (e.g., in English, disfavoring win in twin because t cannot be a word). However, the constraint would be counter-productive in certain languages that allow stand-alone vowelless open-class words. One such language is Berber (where t is indeed a word). Berber listeners here detected words affixed to nonsense contexts with or without vowels. Length effects seen in other languages replicated in Berber, but in contrast to prior findings, word detection was not hindered by vowelless contexts. When words can be vowelless, otherwise universal constraints disfavoring vowelless words do not feature in spoken-word recognition. Copyright © 2012 Elsevier B.V. All rights reserved.

  5. 2013 National AIS at 1 Minute Intervals

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2013 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  6. Emotion words and categories: evidence from lexical decision.

    Science.gov (United States)

    Scott, Graham G; O'Donnell, Patrick J; Sereno, Sara C

    2014-05-01

    We examined the categorical nature of emotion word recognition. Positive, negative, and neutral words were presented in lexical decision tasks. Word frequency was additionally manipulated. In Experiment 1, "positive" and "negative" categories of words were implicitly indicated by the blocked design employed. A significant emotion-frequency interaction was obtained, replicating past research. While positive words consistently elicited faster responses than neutral words, only low frequency negative words demonstrated a similar advantage. In Experiments 2a and 2b, explicit categories ("positive," "negative," and "household" items) were specified to participants. Positive words again elicited faster responses than did neutral words. Responses to negative words, however, were no different than those to neutral words, regardless of their frequency. The overall pattern of effects indicates that positive words are always facilitated, frequency plays a greater role in the recognition of negative words, and a "negative" category represents a somewhat disparate set of emotions. These results support the notion that emotion word processing may be moderated by distinct systems.

  7. Orthographic effects in spoken word recognition: Evidence from Chinese.

    Science.gov (United States)

    Qu, Qingqing; Damian, Markus F

    2017-06-01

    Extensive evidence from alphabetic languages demonstrates a role of orthography in the processing of spoken words. Because alphabetic systems explicitly code speech sounds, such effects are perhaps not surprising. However, it is less clear whether orthographic codes are involuntarily accessed from spoken words in languages with non-alphabetic systems, in which the sound-spelling correspondence is largely arbitrary. We investigated the role of orthography via a semantic relatedness judgment task: native Mandarin speakers judged whether or not spoken word pairs were related in meaning. Word pairs were either semantically related, orthographically related, or unrelated. Results showed that relatedness judgments were made faster for word pairs that were semantically related than for unrelated word pairs. Critically, orthographic overlap on semantically unrelated word pairs induced a significant increase in response latencies. These findings indicate that orthographic information is involuntarily accessed in spoken-word recognition, even in a non-alphabetic language such as Chinese.

  8. Book Review: Elisabeth O. Selkirk, The syntax of words | Udeze ...

    African Journals Online (AJOL)

    The Syntax of Words provides a new insight into the study of the structure of words and the system for generating that structure. This treatment is a firm departure from the hitherto traditional notion in the study of morphology which considers words as part of a language's syntax or grammar and not having its own syntax.

  9. Functional Neuroanatomy of Contextual Acquisition of Concrete and Abstract Words

    Science.gov (United States)

    Mestres-Misse, Anna; Munte, Thomas F.; Rodriguez-Fornells, Antoni

    2009-01-01

    The meaning of a novel word can be acquired by extracting it from linguistic context. Here we simulated word learning of new words associated to concrete and abstract concepts in a variant of the human simulation paradigm that provided linguistic context information in order to characterize the brain systems involved. Native speakers of Spanish…

  10. Applications of AI, machine vision and robotics

    CERN Document Server

    Boyer, Kim; Bunke, H

    1995-01-01

    This text features a broad array of research efforts in computer vision including low level processing, perceptual organization, object recognition and active vision. The volume's nine papers specifically report on topics such as sensor confidence, low level feature extraction schemes, non-parametric multi-scale curve smoothing, integration of geometric and non-geometric attributes for object recognition, design criteria for a four degree-of-freedom robot head, a real-time vision system based on control of visual attention and a behavior-based active eye vision system. The scope of the book pr

  11. Ixpantepec Nieves Mixtec Word Prosody

    Science.gov (United States)

    Carroll, Lucien Serapio

    This dissertation presents a phonological description and acoustic analysis of the word prosody of Ixpantepec Nieves Mixtec, which involves both a complex tone system and a default stress system. The analysis of Nieves Mixtec word prosody is complicated by a close association between morphological structure and prosodic structure, and by the interactions between word prosody and phonation type, which has both contrastive and non-contrastive roles in the phonology. I contextualize these systems within the phonology of Nieves Mixtec as a whole, within the literature on other Mixtec varieties, and within the literature on cross-linguistic prosodic typology. The literature on prosodic typology indicates that stress is necessarily defined abstractly, as structured prominence realized differently in each language. Descriptions of stress in other Mixtec varieties widely report default stress on the initial syllable of the canonical bimoraic root, though some descriptions suggest final stress or mobile stress. I first present phonological evidence---from distributional restrictions, phonological processes, and loanword adaptation---that Nieves Mixtec word prosody does involve a stress system, based on trochaic feet aligned to the root. I then present an acoustic study comparing stressed syllables to unstressed syllables, for ten potential acoustic correlates of stress. The results indicate that the acoustic correlates of stress in Nieves Mixtec include segmental duration, intensity and periodicity. Building on analyses of other Mixtec tone systems, I show that the distribution of tone and the tone processes in Nieves Mixtec support an analysis in which morae may bear H, M or L tone, where M tone is underlyingly unspecified, and each morpheme may sponsor a final +H or +L floating tone. Bimoraic roots thus host up to two linked tones and one floating tone, while monomoraic clitics host just one linked tone and one floating tone, and tonal morphemes are limited to a single

  12. Finding words in a language that allows words without vowels

    NARCIS (Netherlands)

    El Aissati, A.; McQueen, J.M.; Cutler, A.

    2012-01-01

    Across many languages from unrelated families, spoken-word recognition is subject to a constraint whereby potential word candidates must contain a vowel. This constraint minimizes competition from embedded words (e.g., in English, disfavoring win in twin because t cannot be a word). However, the

  13. Notes on the inherently safe core design meeting with the DOE-RRT, AI, GE, W-ARD, EPRI, and ETEC (at AI, Canoga Park, California, November 7-8, 1978)

    International Nuclear Information System (INIS)

    Jackola, A.S.; Paschall, R.K.

    1978-01-01

    The primary purpose of the meeting was to familiarize large LMFBR design managers with the capabilities of the Inherent Secondary Shutdown Systems (articulated rod and absorber balls) and to obtain inputs from them. The other purpose of the meeting was for the ISSS designers (AI, GE, and WARD) to present current work status, future plans, and schedules for their respective ISSS tasks

  14. Word translation entropy in translation

    DEFF Research Database (Denmark)

    Schaeffer, Moritz; Dragsted, Barbara; Hvelplund, Kristian Tangsgaard

    2016-01-01

    This study reports on an investigation into the relationship between the number of translation alternatives for a single word and eye movements on the source text. In addition, the effect of word order differences between source and target text on eye movements on the source text is studied....... In particular, the current study investigates the effect of these variables on early and late eye movement measures. Early eye movement measures are indicative of processes that are more automatic while late measures are more indicative of conscious processing. Most studies that found evidence of target...... language activation during source text reading in translation, i.e. co-activation of the two linguistic systems, employed late eye movement measures or reaction times. The current study therefore aims to investigate if and to what extent earlier eye movement measures in reading for translation show...

  15. AI in Computer-Based Training

    Science.gov (United States)

    Camstra, Bert

    2008-01-01

    In this paper, intelligent approaches to CBT are put into several perspectives in an attempt to elucidate the concepts and give them a more realistic (and not only glamorous) footing. The role of expert systems in training is explored and possible routes towards intelligent CBT are outlined. [This paper was first published in "Interactive Learning…

  16. Word Similarity From Dictionaries: Inferring Fuzzy Measures From Fuzzy Graphs

    Directory of Open Access Journals (Sweden)

    Torra

    2008-01-01

    Full Text Available The computation of similarities between words is a basic element of information retrieval systems, when retrieval is not solely based on word matching. In this work we consider a measure between words based on dictionaries. This is achieved assuming that a dictionary is formalized as a fuzzy graph. We show that the approach permits to compute measures not only for pairs of words but for sets of them.

  17. Visual word recognition across the adult lifespan.

    Science.gov (United States)

    Cohen-Shikora, Emily R; Balota, David A

    2016-08-01

    The current study examines visual word recognition in a large sample (N = 148) across the adult life span and across a large set of stimuli (N = 1,187) in three different lexical processing tasks (pronunciation, lexical decision, and animacy judgment). Although the focus of the present study is on the influence of word frequency, a diverse set of other variables are examined as the word recognition system ages and acquires more experience with language. Computational models and conceptual theories of visual word recognition and aging make differing predictions for age-related changes in the system. However, these have been difficult to assess because prior studies have produced inconsistent results, possibly because of sample differences, analytic procedures, and/or task-specific processes. The current study confronts these potential differences by using 3 different tasks, treating age and word variables as continuous, and exploring the influence of individual differences such as vocabulary, vision, and working memory. The primary finding is remarkable stability in the influence of a diverse set of variables on visual word recognition across the adult age spectrum. This pattern is discussed in reference to previous inconsistent findings in the literature and implications for current models of visual word recognition. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  18. AI Techniques in a Context-Aware Ubiquitous Environment

    Science.gov (United States)

    Coppola, Paolo; Mea, Vincenzo Della; di Gaspero, Luca; Lomuscio, Raffaella; Mischis, Danny; Mizzaro, Stefano; Nazzi, Elena; Scagnetto, Ivan; Vassena, Luca

    Nowadays, the mobile computing paradigm and the widespread diffusion of mobile devices are quickly changing and replacing many common assumptions about software architectures and interaction/communication models. The environment, in particular, or more generally, the so-called user context is claiming a central role in everyday’s use of cellular phones, PDAs, etc. This is due to the huge amount of data “suggested” by the surrounding environment that can be helpful in many common tasks. For instance, the current context can help a search engine to refine the set of results in a useful way, providing the user with a more suitable and exploitable information. Moreover, we can take full advantage of this new data source by “pushing” active contents towards mobile devices, empowering the latter with new features (e.g., applications) that can allow the user to fruitfully interact with the current context. Following this vision, mobile devices become dynamic self-adapting tools, according to the user needs and the possibilities offered by the environment. The present work proposes MoBe: an approach for providing a basic infrastructure for pervasive context-aware applications on mobile devices, in which AI techniques (namely a principled combination of rule-based systems, Bayesian networks and ontologies) are applied to context inference. The aim is to devise a general inferential framework to make easier the development of context-aware applications by integrating the information coming from physical and logical sensors (e.g., position, agenda) and reasoning about this information in order to infer new and more abstract contexts.

  19. La bêtise, un privilège français ?

    Directory of Open Access Journals (Sweden)

    Magdalena Cámpora

    2012-03-01

    Full Text Available Le mot « bêtise » en français est polysémique et graduel et il ne semble pas y avoir en espagnol d'équivalent qui recouvre la totalité de ses acceptions. Cette situation acquiert des proportions considérables lorsqu'il s'agit de traduire Flaubert : en français flaubertien le mot « bêtise » s'étend comme on sait sur toute une gamme de signifiés, et le sens et le degré de nuisance que Flaubert lui attribue changent incessamment selon le contexte. Or une étude suivie des occurrences de « bêtise » dans des éditions argentines montre que ce qui se perd en premier dans le processus de traduction est justement cet emploi répété du mot : “torpeza”, “estupidez”, “barbaridad”, “idiotez”, “necedad”, “tontería” sont quelques unes des équivalences retenues par les traducteurs. Quels sont les effets de ce manque sur la textualité flaubertienne lorsqu'elle est traduite en espagnol ? Et est-ce nécessairement un manque ?The word “bêtise” is in French polysemic and gradual and there does not seem to be an equivalent in Spanish that covers the totality of its occurrences. The problem gets patently worse when translating Flaubert: in Flaubertian French the word “bêtise” spreads, as we know, to a whole range of signifiers, and the meaning and degree of nuisance that Flaubert attributes to it change constantly according to the context. Now the study of the occurrences of “bêtise” in Argentinean editions show that what is lost at first in the translation process is precisely this repeated use of the word: “torpeza”, “estupidez”, “barbaridad”, “idiotez”, “necedad”, “tontería” are a few of the equivalences given by the translators. What are the effects of this deficiency on the Flaubertian text when it is translated into Spanish? And is it necessarily a deficiency?

  20. Urban traffic information system prototype: Use for Rome downtown area traffic control; 200 S.I.T.U. prototipo del sistema informativo per il traffico urbano: La sua applicazione allo studio della regolamentazione dell`accesso ai centri storici

    Energy Technology Data Exchange (ETDEWEB)

    Lombardi, L; Mattucci, A; Frondaroli, A

    1993-12-31

    This paper describes the characteristics, in terms of type of information and systems approaches utilized, of a prototype urban traffic simulator developed by ENEA (the Italian Agency for New Technology, Energy and the Environment). With reference to the development of the functional and architectural elements of this simulator, a preliminary review is made of problematics relevant to transportation system design, urban planning, and traffic control. The data base incorporated by the simulator is described and a comparison is made of different traffic modelling codes and man-machine interface methods. The paper concludes with an assessment of the results obtained with the first experimental application of the simulator in the control of the flow of traffic in Rome`s heavily congested downtown area.

  1. A Note on the Lithuanian 2nd Sg. Ending "-ai."

    Science.gov (United States)

    Schmalstieg, William R.

    1980-01-01

    Discusses an attempt by Chr. S. Stang to establish a proto-Lithuanian present paradigm for the verb "megti" (to like), questioning the existence of the second singular form "-ai." Argues that the few examples of this form, all from a single Bible translation source, afford shaky support for its existence. (Executive Office of the AABS, 231 Miller…

  2. Exploring AI Language Assistants with Primary EFL Students

    Science.gov (United States)

    Underwood, Joshua

    2017-01-01

    The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

  3. The 2010 Mario AI Championship: Level Generation Track

    DEFF Research Database (Denmark)

    Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.

    2011-01-01

    The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

  4. Measuring the Value of AI in Space Science and Exploration

    Science.gov (United States)

    Blair, B.; Parr, J.; Diamond, B.; Pittman, B.; Rasky, D.

    2017-10-01

    FDL is tackling knowledge gaps useful to the space program by forming small teams of industrial partners, cutting-edge AI researchers and space science domain experts, and tasking them to solve problems that are important to NASA as well as humanity's future.

  5. On the homotopy equivalence of simple AI-algebras

    International Nuclear Information System (INIS)

    Aristov, O Yu

    1999-01-01

    Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

  6. Artificial Intelligence: Is the Future Now for A.I.?

    Science.gov (United States)

    Ramaswami, Rama

    2009-01-01

    In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

  7. Predicting Vessel Trajectories from Ais Data Using R

    Science.gov (United States)

    2017-06-01

    Source: Hampton (2009). A vessel operator with AIS is able to get useful information about the other vessels in the area by selecting a vessel icon ...random forest model on our computer. All calculations are done on a MacBook-Pro with 2.7GHz quad-core Intel Core i7, and 16GB of memory . H2O allows us

  8. Artificial Intelligence (AI) Studies in Water Resources

    OpenAIRE

    Ay, Murat; Özyıldırım, Serhat

    2018-01-01

    Artificial intelligence has been extensively used in many areas such as computer science,robotics, engineering, medicine, translation, economics, business, and psychology. Variousstudies in the literature show that the artificial intelligence in modeling approaches give closeresults to the real data for solution of linear, non-linear, and other systems. In this study, wereviewed the current state-of-the-art and progress on the modelling of artificial intelligence forwater variables: rainfall-...

  9. Improving the Performance of AI Algorithms.

    Science.gov (United States)

    1987-09-01

    system when execution begins. Furthermore, the value of a symbolic language function, like , its mathematical counterpart, is determined solely by the...Applcatins Lvel ppliat~os Pigra Languge Evironent’ -::,g u p rtP, iJ, ific ’M-t, - EKE~tr" SSYSTE Figur 9. 1;’ystin ’JpporzL~aylto~n A Aplcai Envronent

  10. WordPress 24-Hour Trainer

    CERN Document Server

    Plumley, George

    2011-01-01

    The eagerly anticipated second edition, completely updated for WordPress 3.1 As an open source content management system, WordPress allows users to easily build feature-rich web sites with no programming experience. This unique book-and-video package is a friendly, self-paced beginners guide to the latest release of WordPress. Lessons are focused on practical, everyday tasks that users will need to create and maintain their sites: entering new content, creating new pages, managing menus, making content search-engine friendly. Plus you'll find lots of tips based on years of experience teaching

  11. Professional WordPress Plugin Development

    CERN Document Server

    Williams, Brad; Tadlock, Justin

    2011-01-01

    Taking WordPress to the next level with advanced plugin developmentWordPress is used to create self-hosted blogs and sites, and it's fast becoming the most popular content management system (CMS) on the Web. Now you can extend it for personal, corporate and enterprise use with advanced plugins and this professional development guide. Learn how to create plugins using the WordPress plugin API: utilize hooks, store custom settings, craft translation files, secure your plugins, set custom user roles, integrate widgets, work with JavaScript and AJAX, create custom post types. You'll find a practic

  12. Impact of an AI heifer calf rearing scheme on dairy stock development in the Western province of Sri Lanka.

    NARCIS (Netherlands)

    Nettisinghe, A.M.P.; Udo, H.M.J.; Steenstra, F.A.

    2004-01-01

    This study evaluated the impact of an AI heifer calf rearing scheme on dairy stock development, in a coconut grazing and a peri-urban smallholder dairy production system in the Western Province of Sri Lanka. The heifer rearing scheme included free advice on calf rearing, drugs, acaricides, minerals

  13. THE IMPROVEMENT AND APPLICATION OF EI-GUN (ELECTRICAL INSEMINATION GUN FOR ARTIFICIAL INSEMINATION (AI USING GOAT FRESH SEMEN

    Directory of Open Access Journals (Sweden)

    Mirsa Ita Dewi

    2017-03-01

    Full Text Available Electrical Insemination Gun (EI-GUN was a tool for Artificial Insemination (AI using fresh semen with an electric control system. The research objective was to produced EI-GUN for AI using fresh semen on small ruminants (goat. The research was conducted from March to June 2015. The process of EI-GUN creation implemented in Design and Prototype Laboratory and Aero Modeling Research Laboratory at Engineering Faculty, University of Brawijaya (UB. Testing tools EI-GUN on goat was conducted in the Sumber Sekar Laboratory, Animal Husbandry Faculty, UB.  The methods of research were literature study, tool specification determination, designing EI-GUN, running test, semen evaluation passed EI-GUN and application on Goat. EI-GUN has seven important parts, which supports each other in this operating system. Those parts consist of stylet, servo, system controlled, insemination pump, connecting rod, battery, and holder. EI-GUN work system sucked the semen into insemination pump as much as 5 ml, and release the semen 0.25 ml appropriate standard of AI. It was applicable for 20 times AI. The results showed that the cell motility of spermatozoa ≥ 70% were still in ranging of Indonesian National Standard (SNI.   Keywords: artificial insemination, EI-GUN, fresh semen.

  14. Electronic Word of Behavior

    DEFF Research Database (Denmark)

    Kunst, Katrine

    It is widely recognized that the transition from Word-of-mouth (WOM) to electronic word-of-mouth (eWOM) allows for a wider and faster spread of information. However, little attention has been given to how digital channels expand the types of information consumers share. In this paper, we argue...... that recent years have seen a social media-facilitated move from opinion-centric eWOM (e.g. reviews) to behavior-centric (e.g. information about friends’ music consumption on Spotify). A review of the concepts of WOM and eWOM and a netnographic study reveal that the current definitions and understandings...... of the concepts do not capture this new kind of consumer-to-consumer information transfer about products and services. Consequently, we suggest an extension of those concepts: Electronic Word of Behavior....

  15. The Activation of Embedded Words in Spoken Word Recognition

    Science.gov (United States)

    Zhang, Xujin; Samuel, Arthur G.

    2015-01-01

    The current study investigated how listeners understand English words that have shorter words embedded in them. A series of auditory-auditory priming experiments assessed the activation of six types of embedded words (2 embedded positions × 3 embedded proportions) under different listening conditions. Facilitation of lexical decision responses to targets (e.g., pig) associated with words embedded in primes (e.g., hamster) indexed activation of the embedded words (e.g., ham). When the listening conditions were optimal, isolated embedded words (e.g., ham) primed their targets in all six conditions (Experiment 1a). Within carrier words (e.g., hamster), the same set of embedded words produced priming only when they were at the beginning or comprised a large proportion of the carrier word (Experiment 1b). When the listening conditions were made suboptimal by expanding or compressing the primes, significant priming was found for isolated embedded words (Experiment 2a), but no priming was produced when the carrier words were compressed/expanded (Experiment 2b). Similarly, priming was eliminated when the carrier words were presented with one segment replaced by noise (Experiment 3). When cognitive load was imposed, priming for embedded words was again found when they were presented in isolation (Experiment 4a), but not when they were embedded in the carrier words (Experiment 4b). The results suggest that both embedded position and proportion play important roles in the activation of embedded words, but that such activation only occurs under unusually good listening conditions. PMID:25593407

  16. The Activation of Embedded Words in Spoken Word Recognition.

    Science.gov (United States)

    Zhang, Xujin; Samuel, Arthur G

    2015-01-01

    The current study investigated how listeners understand English words that have shorter words embedded in them. A series of auditory-auditory priming experiments assessed the activation of six types of embedded words (2 embedded positions × 3 embedded proportions) under different listening conditions. Facilitation of lexical decision responses to targets (e.g., pig) associated with words embedded in primes (e.g., hamster ) indexed activation of the embedded words (e.g., ham ). When the listening conditions were optimal, isolated embedded words (e.g., ham ) primed their targets in all six conditions (Experiment 1a). Within carrier words (e.g., hamster ), the same set of embedded words produced priming only when they were at the beginning or comprised a large proportion of the carrier word (Experiment 1b). When the listening conditions were made suboptimal by expanding or compressing the primes, significant priming was found for isolated embedded words (Experiment 2a), but no priming was produced when the carrier words were compressed/expanded (Experiment 2b). Similarly, priming was eliminated when the carrier words were presented with one segment replaced by noise (Experiment 3). When cognitive load was imposed, priming for embedded words was again found when they were presented in isolation (Experiment 4a), but not when they were embedded in the carrier words (Experiment 4b). The results suggest that both embedded position and proportion play important roles in the activation of embedded words, but that such activation only occurs under unusually good listening conditions.

  17. Essential words for the TOEFL

    CERN Document Server

    Matthiesen, Steven J

    2017-01-01

    This revised book is specifically designed for ESL students preparing to take the TOEFL. Includes new words and phrases, a section on purpose words, a list of vocabulary words with definitions, sample sentences, practice exercises for 500 need-to-know words, practice test with answer key, and more.

  18. Reduplication Facilitates Early Word Segmentation

    Science.gov (United States)

    Ota, Mitsuhiko; Skarabela, Barbora

    2018-01-01

    This study explores the possibility that early word segmentation is aided by infants' tendency to segment words with repeated syllables ("reduplication"). Twenty-four nine-month-olds were familiarized with passages containing one novel reduplicated word and one novel non-reduplicated word. Their central fixation times in response to…

  19. Finding Rising and Falling Words

    NARCIS (Netherlands)

    Tjong Kim Sang, E.

    2016-01-01

    We examine two different methods for finding rising words (among which neologisms) and falling words (among which archaisms) in decades of magazine texts (millions of words) and in years of tweets (billions of words): one based on correlation coefficients of relative frequencies and time, and one

  20. Word of mouth komunikacija

    Directory of Open Access Journals (Sweden)

    Žnideršić-Kovač Ružica

    2009-01-01

    Full Text Available Consumers' buying decision is very complex multistep process in which a lot of factors have significant impact. Traditional approach to the problem of communication between a company and its consumers, implies usage of marketing mix instruments, mostly promotion mix, in order to achieve positive purchase decision. Formal communication between company and consumers is dominant comparing to informal communication, and even in marketing literature there is not enough attention paid to this type of communication such as Word of Mouth. Numerous of research shows that consumers emphasize crucial impact of Word of Mouth on their buying decision. .

  1. AARP Word 2010 for dummies

    CERN Document Server

    Gookin, Dan

    2011-01-01

    It's a whole new Word - make the most of it! Here's exactly what you need to know to get going with Word 2010. From firing up Word, using the spell checker, and working with templates to formatting documents, adding images, and saving your stuff, you'll get the first and last word on Word 2010 with this fun and easy mini guide. So get ready to channel your inner writer and start creating Word files that wow! Open the book and find:Tips for navigating Word with the keyboard and mouseAdvice on using the RibbonHow to edit text and undo mistakesThings to know

  2. Office automation: a look beyond word processing

    OpenAIRE

    DuBois, Milan Ephriam, Jr.

    1983-01-01

    Approved for public release; distribution is unlimited Word processing was the first of various forms of office automation technologies to gain widespread acceptance and usability in the business world. For many, it remains the only form of office automation technology. Office automation, however, is not just word processing, although it does include the function of facilitating and manipulating text. In reality, office automation is not one innovation, or one office system, or one tech...

  3. Cultural Image of Animal Words

    Institute of Scientific and Technical Information of China (English)

    邓海燕

    2017-01-01

    This paper,after introducing the definition and forms of cultural image,focuses on the detailed comparison and analysis of cultural image of animal words both in English and in Chinese from four aspects,that is,same animal word,same cultural image;same animal word,different cultural images;different animal words,same cultural image;different animal words,different cultural images.

  4. Short communication: The role of autoinducer 2 (AI-2) on antibiotic resistance regulation in an Escherichia coli strain isolated from a dairy cow with mastitis.

    Science.gov (United States)

    Xue, Ting; Yu, Lumin; Shang, Fei; Li, Wenchang; Zhang, Ming; Ni, Jingtian; Chen, Xiaolin

    2016-06-01

    Extended spectrum β-lactamase (ESBL)-positive Escherichia coli is a major etiological organism responsible for bovine mastitis. The autoinducer 2 (AI-2) quorum sensing system is widely present in many species of gram-negative and gram-positive bacteria and has been proposed to be involved in interspecies communication. In E. coli model strains, the functional mechanisms of AI-2 have been well studied; however, in clinical antibiotic-resistant E. coli strains, whether AI-2 affects the expression of antibiotic resistance genes has not been reported. In this study, we report that exogenous AI-2 increased the antibiotic resistance of a clinical E. coli strain isolated from a dairy cow with mastitis by upregulating the expression of TEM-type enzyme in an LsrR (LuxS regulated repressor)-dependent manner. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  5. Artificial Psychology: The Psychology of AI

    Directory of Open Access Journals (Sweden)

    James A. Crowder

    2013-12-01

    Full Text Available Having artificially intelligent machines that think, learn, reason, experience, and can function autonomously, without supervision, is one of the most intriguing goals in all of Computer Science. As the types of problems we would like machines to solve get more complex, it is becoming a necessary goal as well. One of the many problems associated with this goal is that what learning and reasoning are have so many possible meanings that the solution can easily get lost in the sea of opinions and options. The goal of this paper is to establish some foundational principles, theory, and concepts that we feel are the backbone of real, autonomous Artificial Intelligence. With this fully autonomous, learning, reasoning, artificially intelligent system (an artificial brain, comes the need to possess constructs in its hardware and software that mimic processes and subsystems that exist within the human brain, including intuitive and emotional memory concepts. Presented here is a discussion of the psychological constructs of artificial intelligence and how they might play out in an artificial mind.

  6. Wording in international law

    NARCIS (Netherlands)

    d' Aspremont, J.

    2012-01-01

    Since the demise of philosophical foundationalism and that of the Aristotelian idea of an inner meaning of words, scholarship about international law is no longer perceived as a mining activity geared towards the extraction of pre-existing meaning. Rather, international legal scholarship is in a

  7. Wording in International Law

    NARCIS (Netherlands)

    d' Aspremont, J.

    2012-01-01

    Since the demise of philosophical foundationalism and that of the Aristotelian idea of an inner meaning of words, the scholarship about international law is no longer perceived as a mining activity geared towards the extraction of pre-existing meaning. Rather, international legal scholarship is in a

  8. A Life in Words

    DEFF Research Database (Denmark)

    Siegumfeldt, Inge Birgitte; Auster, Paul

    "Paul Auster's A Life in Words--a wide-ranging dialogue between Auster and the Danish professor I.B. Siegumfeldt--is a remarkably candid and often surprising celebration of one writer's art, craft, and life. It includes many revelations that have never been shared before, such as that he doesn...

  9. Have Words, Will Understand?

    Science.gov (United States)

    James, Jon

    2013-01-01

    Shifting the focus from words to concepts--does it work? The author shares his findings from such a project with three primary schools in the UK. Many children aged 7-10 find mastering the language of science difficult and do not make the progress that they could. Encountering complex terminology in the science language causes students to become…

  10. Doing words together

    DEFF Research Database (Denmark)

    Fusaroli, Riccardo; Østergaard, Svend; Raczaszek-Leonardi, Joanna

    In this paper we test the effects of social interactions in embodied problem solving by employing a Scrabble-like setting. 28 pairs of participants had to generate as many words as possible from 2 balanced sets of 7 letters, which they could manipulate, either individually or collectively...

  11. Getting the Word Out.

    Science.gov (United States)

    Brandou, Julian R.

    1982-01-01

    Suggests public relations strategies which science educators can adopt to spread the word about the importance of good science teaching. These include preparing a fact sheet summarizing a project/course/organization, tips on creating a newsworthy event (awards, displays at a mall, and others), and what to submit to the news media. (Author/JN)

  12. Word Problem Wizardry.

    Science.gov (United States)

    Cassidy, Jack

    1991-01-01

    Presents suggestions for teaching math word problems to elementary students. The strategies take into consideration differences between reading in math and reading in other areas. A problem-prediction game and four self-checking activities are included along with a magic password challenge. (SM)

  13. Artemisiae Argyi Folium and its geo-authentic crude drug qi ai

    Directory of Open Access Journals (Sweden)

    Diangang Liu

    2017-01-01

    Conclusion: The superior quality of qi ai compared with general AAF may be due to relatively higher contents of bioactive components. This study provides basic information for further study and utilization of AAF and qi ai.

  14. Representation Learning of Logic Words by an RNN: From Word Sequences to Robot Actions

    Directory of Open Access Journals (Sweden)

    Tatsuro Yamada

    2017-12-01

    Full Text Available An important characteristic of human language is compositionality. We can efficiently express a wide variety of real-world situations, events, and behaviors by compositionally constructing the meaning of a complex expression from a finite number of elements. Previous studies have analyzed how machine-learning models, particularly neural networks, can learn from experience to represent compositional relationships between language and robot actions with the aim of understanding the symbol grounding structure and achieving intelligent communicative agents. Such studies have mainly dealt with the words (nouns, adjectives, and verbs that directly refer to real-world matters. In addition to these words, the current study deals with logic words, such as “not,” “and,” and “or” simultaneously. These words are not directly referring to the real world, but are logical operators that contribute to the construction of meaning in sentences. In human–robot communication, these words may be used often. The current study builds a recurrent neural network model with long short-term memory units and trains it to learn to translate sentences including logic words into robot actions. We investigate what kind of compositional representations, which mediate sentences and robot actions, emerge as the network's internal states via the learning process. Analysis after learning shows that referential words are merged with visual information and the robot's own current state, and the logical words are represented by the model in accordance with their functions as logical operators. Words such as “true,” “false,” and “not” work as non-linear transformations to encode orthogonal phrases into the same area in a memory cell state space. The word “and,” which required a robot to lift up both its hands, worked as if it was a universal quantifier. The word “or,” which required action generation that looked apparently random, was represented as an

  15. Visual Word Recognition Across the Adult Lifespan

    Science.gov (United States)

    Cohen-Shikora, Emily R.; Balota, David A.

    2016-01-01

    The current study examines visual word recognition in a large sample (N = 148) across the adult lifespan and across a large set of stimuli (N = 1187) in three different lexical processing tasks (pronunciation, lexical decision, and animacy judgments). Although the focus of the present study is on the influence of word frequency, a diverse set of other variables are examined as the system ages and acquires more experience with language. Computational models and conceptual theories of visual word recognition and aging make differing predictions for age-related changes in the system. However, these have been difficult to assess because prior studies have produced inconsistent results, possibly due to sample differences, analytic procedures, and/or task-specific processes. The current study confronts these potential differences by using three different tasks, treating age and word variables as continuous, and exploring the influence of individual differences such as vocabulary, vision, and working memory. The primary finding is remarkable stability in the influence of a diverse set of variables on visual word recognition across the adult age spectrum. This pattern is discussed in reference to previous inconsistent findings in the literature and implications for current models of visual word recognition. PMID:27336629

  16. Word generalization by a dog (Canis familiaris: is shape important?

    Directory of Open Access Journals (Sweden)

    Emile van der Zee

    Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.

  17. Word Generalization by a Dog (Canis familiaris): Is Shape Important?

    Science.gov (United States)

    van der Zee, Emile; Zulch, Helen; Mills, Daniel

    2012-01-01

    We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax) for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs. PMID:23185321

  18. Oil spills and AI: How to manage resources through simulation

    International Nuclear Information System (INIS)

    Giribone, P.; Bruzzone, A.G.; Caddeo, S.

    1995-01-01

    Today, in the Mediterranean theater of the Upper Tyrrhenian, the ecological risk involving oil installations is still quite high. This is due to the fact that valuable environmental and tourist areas exist together with large industrial and port structures; in particular, recent events have demonstrated the danger involving oil spills along the Ligurian coastline. This study proposes an approach to plan the operations that should be performed when accidents occur, based on the use of AI techniques

  19. Conversational AI: The Science Behind the Alexa Prize

    OpenAIRE

    Ram, Ashwin; Prasad, Rohit; Khatri, Chandra; Venkatesh, Anu; Gabriel, Raefer; Liu, Qing; Nunn, Jeff; Hedayatnia, Behnam; Cheng, Ming; Nagar, Ashish; King, Eric; Bland, Kate; Wartick, Amanda; Pan, Yi; Song, Han

    2018-01-01

    Conversational agents are exploding in popularity. However, much work remains in the area of social conversation as well as free-form conversation over a broad range of domains and topics. To advance the state of the art in conversational AI, Amazon launched the Alexa Prize, a 2.5-million-dollar university competition where sixteen selected university teams were challenged to build conversational agents, known as socialbots, to converse coherently and engagingly with humans on popular topics ...

  20. General Video Game AI: Learning from Screen Capture

    OpenAIRE

    Kunanusont, Kamolwan; Lucas, Simon M.; Perez-Liebana, Diego

    2017-01-01

    General Video Game Artificial Intelligence is a general game playing framework for Artificial General Intelligence research in the video-games domain. In this paper, we propose for the first time a screen capture learning agent for General Video Game AI framework. A Deep Q-Network algorithm was applied and improved to develop an agent capable of learning to play different games in the framework. After testing this algorithm using various games of different categories and difficulty levels, th...

  1. Application of plausible reasoning to AI-based control systems

    Science.gov (United States)

    Berenji, Hamid; Lum, Henry, Jr.

    1987-01-01

    Some current approaches to plausible reasoning in artificial intelligence are reviewed and discussed. Some of the most significant recent advances in plausible and approximate reasoning are examined. A synergism among the techniques of uncertainty management is advocated, and brief discussions on the certainty factor approach, probabilistic approach, Dempster-Shafer theory of evidence, possibility theory, linguistic variables, and fuzzy control are presented. Some extensions to these methods are described, and the applications of the methods are considered.

  2. Atypical performance patterns on Delis-Kaplan Executive Functioning System Color-Word Interference Test: Cognitive switching and learning ability in older adults.

    Science.gov (United States)

    Berg, Jody-Lynn; Swan, Natasha M; Banks, Sarah J; Miller, Justin B

    2016-09-01

    Cognitive set shifting requires flexible application of lower level processes. The Delis-Kaplan Executive Functioning System (DKEFS) Color-Word Interference Test (CWIT) is commonly used to clinically assess cognitive set shifting. An atypical pattern of performance has been observed on the CWIT; a subset of individuals perform faster, with equal or fewer errors, on the more difficult inhibition/switching than the inhibition trial. This study seeks to explore the cognitive underpinnings of this atypical pattern. It is hypothesized that atypical patterns on CWIT will be associated with better performance on underlying cognitive measures of attention, working memory, and learning when compared to typical CWIT patterns. Records from 239 clinical referrals (age: M = 68.09 years, SD = 10.62; education: M = 14.87 years, SD = 2.73) seen for a neuropsychological evaluation as part of diagnostic work up in an outpatient dementia and movement disorders clinic were sampled. The standard battery of tests included measures of attention, learning, fluency, executive functioning, and working memory. Analyses of variance (ANOVAs) were conducted to compare the cognitive performance of those with typical versus atypical CWIT patterns. An atypical pattern of performance was confirmed in 23% of our sample. Analyses revealed a significant group difference in acquisition of information on both nonverbal (Brief Visuospatial Memory Test-Revised, BVMT-R total recall), F(1, 213) = 16.61, p < .001, and verbal (Hopkins Verbal Learning Test-Revised, HVLT-R total recall) learning tasks, F(1, 181) = 6.43, p < .01, and semantic fluency (Animal Naming), F(1, 232) = 7.57, p = .006, with the atypical group performing better on each task. Effect sizes were larger for nonverbal (Cohen's d = 0.66) than verbal learning (Cohen's d = 0.47) and semantic fluency (Cohen's d = 0.43). Individuals demonstrating an atypical pattern of performance on the CWIT inhibition/switching trial also demonstrated relative

  3. Annealing Induced Softening in Deformed AI-4043 Alloy

    International Nuclear Information System (INIS)

    Saad, G.; Fawzy, A.; Soliman, H.N.; Mohammed, Gh.; Fayek, S.A.

    2011-01-01

    The present paper is devoted to study the effect of annealing temperature for different annealing periods of time on the structure and consequently on the tensile properties of Al-4043 alloy. The obtained results showed that the microstructure of AI-4043 alloy is characterized by the presence of spherically shaped Si-particles, which were found to be uniformly distributed within the AI-matrix. Stress-strain characterizations of AI-4043 samples annealed at different temperatures (T a = 573, 673 and 773 K) for different periods of time (t a = 0.5, 1,2.5,5 and 10 h), showed that the tensile parameters; yield stress ε y 0.2 and fracture stress ε f were decreased with increasing Ta and/or ta while the total strain ε T was increased. This was interpreted in terms of growth of Si-particles with increasing T a and/or t a . Attention has been also paid to the role of the minor elements Fe, Cu and Ti on the structure and tensile response behavior of the alloy under investigation

  4. The deep learning AI playbook strategy for disruptive artificial intelligence

    CERN Document Server

    Perez, Carlos E

    2017-01-01

    Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

  5. Accretion in Radiative Equipartition (AiRE) Disks

    Energy Technology Data Exchange (ETDEWEB)

    Yazdi, Yasaman K.; Afshordi, Niayesh, E-mail: yyazdi@pitp.ca, E-mail: nafshordi@pitp.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada)

    2017-07-01

    Standard accretion disk theory predicts that the total pressure in disks at typical (sub-)Eddington accretion rates becomes radiation pressure dominated. However, radiation pressure dominated disks are thermally unstable. Since these disks are observed in approximate steady state over the instability timescale, our accretion models in the radiation-pressure-dominated regime (i.e., inner disk) need to be modified. Here, we present a modification to the Shakura and Sunyaev model, where the radiation pressure is in equipartition with the gas pressure in the inner region. We call these flows accretion in radiative equipartition (AiRE) disks. We introduce the basic features of AiRE disks and show how they modify disk properties such as the Toomre parameter and the central temperature. We then show that the accretion rate of AiRE disks is limited from above and below, by Toomre and nodal sonic point instabilities, respectively. The former leads to a strict upper limit on the mass of supermassive black holes as a function of cosmic time (and spin), while the latter could explain the transition between hard and soft states of X-ray binaries.

  6. Right word making sense of the words that confuse

    CERN Document Server

    Morrison, Elizabeth

    2012-01-01

    'Affect' or 'effect'? 'Right', 'write' or 'rite'? English can certainly be a confusing language, whether you're a native speaker or learning it as a second language. 'The Right Word' is the essential reference to help people master its subtleties and avoid making mistakes. Divided into three sections, it first examines homophones - those tricky words that sound the same but are spelled differently - then looks at words that often confuse before providing a list of commonly misspelled words.

  7. Detection of the Lux S-mediated quorum-sensing system signal autoinducer-2 of Enterococcus durans SQ-3-2 and optimize the methods%坚强肠球菌SQ-3-2基于Lux S群体感应系统信号分子AI-2的检测及方法优化

    Institute of Scientific and Technical Information of China (English)

    张腾; 贺银凤

    2013-01-01

    To explore that if the Enterococcus durans SQ-3-2 produces the quorum-sensing signal autoinducer-2 by utilizing a biological assay and optimize the test condition at the same time.The experiment employed a biolumi-nescent bacterial reporter strain called Vibrio harveyi BB170, which produces light in response to AI-2.We collected the cell-free culture fluids and added them to the V.harveyi BB170 reporter strain.The resulting light production was measured using a luminometer or scintillation counter.AI-2 activity was deduced according to the induction of luminescence of V.harveyi BB170.The fluorescence of the V.harveyi increased after adding the cell-free culture fluids of E.durans SQ-3-2 and based on the fluorescence intensity of different sample experiment condition was optimized.We found that the E.durans SQ-3-2 produces the quorum-sensing signal AI-2.With the increase of cell density, concentration of signaling molecule AI-2 increased and the maximum value was reached in logarithmic period.Optimal testing condition was sample pH =7 and sample ratio of 1: 100.Experiment lays the foundation to further study of function of AI-2 from E.durans SQ-3-2.At the same time, the optimized experimental conditions for detection of quorum-sensing signal AI-2 of various kinds of lactic acid bacteria is the experimental foundation.%通过生物学方法检测坚强肠球菌SQ-3-2是否产生群体感应信号分子AI-2,并对检测条件进行优化.将坚强肠球菌SQ-3-2培养上清液加入到由哈维氏弧菌BB170构成的特异性报告系统中,使用多功能酶标仪化学发光模式检测荧光强度,通过与AB培养基空白对照进行荧光强度的比较得出坚强肠球菌SQ-3-2是否产生具有活性的AI-2信号分子,同时依据荧光强度的大小对加样比和酸碱度两个条件进行优化.研究结果表明,坚强肠球菌SQ-3-2培养上清液中含有AI-2信号分子,随着菌体密度的增加信号分子AI-2的浓度也随之增大,在对数期

  8. 76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2011-07-22

    ... SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of... Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') is being established in accordance...

  9. 78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2013-03-20

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting. SUMMARY: The National Coordination Committee on the American Indian/ Alaska Native (AI/AN) Sexual Assault... violence within AI/AN communities. DATES AND LOCATIONS: The meeting will be held via webinar on Wednesday...

  10. Nine Words - Nine Columns

    DEFF Research Database (Denmark)

    Trempe Jr., Robert B.; Buthke, Jan

    2016-01-01

    This book records the efforts of a one-week joint workshop between Master students from Studio 2B of Arkitektskolen Aarhus and Master students from the Harbin Institute of Technology in Harbin, China. The workshop employed nine action words to instigate team-based investigation into the effects o...... as formwork for the shaping of wood veneer. The resulting columns ‘wear’ every aspect of this design pipeline process and display the power of process towards an architectural resolution....

  11. Italian Word Association Norms.

    Science.gov (United States)

    1966-07-01

    and Russell, VI.A. Systematic changes in word association norms: 1910-1952. Journal of Abnormal and Social Psychology, 19C0, 60, 293-303. lilb Kurez, I...Acsorbento, Cartone, Celluloee, Compiti, Disegno, !)o- cuwe-m~to, Gnibinetto, Gihills, Goinma, Lete, Licer~ .a, l!ateri.Ble, Notp, Penna, Problema ...Ostiflato, flifatto, Ruvido, Seno, Somaro, Studio, Tavolo FACILITA’( 42,31) 36 Difficolth 7 Difficile, Semplicit~. 5 Problema 2 Grande, Impossibile

  12. An Internet of Things Approach for Extracting Featured Data Using AIS Database: An Application Based on the Viewpoint of Connected Ships

    Directory of Open Access Journals (Sweden)

    Wei He

    2017-09-01

    Full Text Available Automatic Identification System (AIS, as a major data source of navigational data, is widely used in the application of connected ships for the purpose of implementing maritime situation awareness and evaluating maritime transportation. Efficiently extracting featured data from AIS database is always a challenge and time-consuming work for maritime administrators and researchers. In this paper, a novel approach was proposed to extract massive featured data from the AIS database. An Evidential Reasoning rule based methodology was proposed to simulate the procedure of extracting routes from AIS database artificially. First, the frequency distributions of ship dynamic attributes, such as the mean and variance of Speed over Ground, Course over Ground, are obtained, respectively, according to the verified AIS data samples. Subsequently, the correlations between the attributes and belief degrees of the categories are established based on likelihood modeling. In this case, the attributes were characterized into several pieces of evidence, and the evidence can be combined with the Evidential Reasoning rule. In addition, the weight coefficients were trained in a nonlinear optimization model to extract the AIS data more accurately. A real life case study was conducted at an intersection waterway, Yangtze River, Wuhan, China. The results show that the proposed methodology is able to extract data very precisely.

  13. Infants Track Word Forms in Early Word-Object Associations

    Science.gov (United States)

    Zamuner, Tania S.; Fais, Laurel; Werker, Janet F.

    2014-01-01

    A central component of language development is word learning. One characterization of this process is that language learners discover objects and then look for word forms to associate with these objects (Mcnamara, 1984; Smith, 2000). Another possibility is that word forms themselves are also important, such that once learned, hearing a familiar…

  14. Effects of providing word sounds during printed word learning

    NARCIS (Netherlands)

    Reitsma, P.; Dongen, van A.J.N.; Custers, E.

    1984-01-01

    The purpose of this study was to explore the effects of the availability of the spoken sound of words along with the printed forms during reading practice. Firstgrade children from two normal elementary schools practised reading several unfamiliar words in print. For half of the printed words the

  15. The Human Touch: Practical and Ethical Implications of Putting AI and Robotics to Work for Patients.

    Science.gov (United States)

    Banks, Jim

    2018-01-01

    We live in a time when science fiction can quickly become science fact. Within a generation, the Internet has matured from a technological marvel to a utility, and mobile telephones have redefined how we communicate. Health care, as an industry, is quick to embrace technology, so it is no surprise that the application of programmable robotic systems that can carry out actions automatically and artificial intelligence (AI), e.g., machines that learn, solve problems, and respond to their environment, is being keenly explored.

  16. AI in medical education--another grand challenge for medical informatics.

    Science.gov (United States)

    Lillehaug, S I; Lajoie, S P

    1998-03-01

    The potential benefits of artificial intelligence in medicine (AIM) were never realized as anticipated. This paper addresses ways in which such potential can be achieved. Recent discussions of this topic have proposed a stronger integration between AIM applications and health information systems, and emphasize computer guidelines to support the new health care paradigms of evidence-based medicine and cost-effectiveness. These proposals, however, promote the initial definition of AIM applications as being AI systems that can perform or aid in diagnoses. We challenge this traditional philosophy of AIM and propose a new approach aiming at empowering health care workers to become independent self-sufficient problem solvers and decision makers. Our philosophy is based on findings from a review of empirical research that examines the relationship between the health care personnel's level of knowledge and skills, their job satisfaction, and the quality of the health care they provide. This review supports addressing the quality of health care by empowering health care workers to reach their full potential. As an aid in this empowerment process we argue for reviving a long forgotten AIM research area, namely, AI based applications for medical education and training. There is a growing body of research in artificial intelligence in education that demonstrates that the use of artificial intelligence can enhance learning in numerous domains. By examining the strengths of these educational applications and the results from previous AIM research we derive a framework for empowering medical personnel and consequently raising the quality of health care through the use of advanced AI based technology.

  17. Activation of words with phonological overlap

    Directory of Open Access Journals (Sweden)

    Claudia K. Friedrich

    2013-08-01

    Full Text Available Multiple lexical representations overlapping with the input (cohort neighbors are temporarily activated in the listener’s mental lexicon when speech unfolds in time. Activation for cohort neighbors appears to rapidly decline as soon as there is mismatch with the input. However, it is a matter of debate whether or not they are completely excluded from further processing. We recorded behavioral data and event-related brain potentials (ERPs in auditory-visual word onset priming during a lexical decision task. As primes we used the first two syllables of spoken German words. In a carrier word condition, the primes were extracted from spoken versions of the target words (ano-ANORAK 'anorak'. In a cohort neighbor condition, the primes were taken from words that overlap with the target word up to the second nucleus (ana- taken from ANANAS 'pineapple'. Relative to a control condition, where primes and targets were unrelated, lexical decision responses for cohort neighbors were delayed. This reveals that cohort neighbors are disfavored by the decision processes at the behavioral front end. In contrast, left-anterior ERPs reflected long-lasting facilitated processing of cohort neighbors. We interpret these results as evidence for extended parallel processing of cohort neighbors. That is, in parallel to the preparation and elicitation of delayed lexical decision responses to cohort neighbors, aspects of the processing system appear to keep track of those less efficient candidates.

  18. WordPress multisite administration

    CERN Document Server

    Longren, Tyler

    2013-01-01

    This is a simple, concise guide with a step-by-step approach, packed with screenshots and examples to set up and manage a network blog using WordPress.WordPress Multisite Administration is ideal for anyone wanting to familiarize themselves with WordPress Multisite. You'll need to know the basics about WordPress, and having at least a broad understanding of HTML, CSS, and PHP will help, but isn't required.

  19. Word Recognition in Auditory Cortex

    Science.gov (United States)

    DeWitt, Iain D. J.

    2013-01-01

    Although spoken word recognition is more fundamental to human communication than text recognition, knowledge of word-processing in auditory cortex is comparatively impoverished. This dissertation synthesizes current models of auditory cortex, models of cortical pattern recognition, models of single-word reading, results in phonetics and results in…

  20. 1100 words you must know

    CERN Document Server

    Bromberg, Murray

    2018-01-01

    A Barron's best-seller for more than four decades! This brand-new edition has been expanded and updated with word lists and definitions, analogy exercises, words-in-context exercises, idiom indexes, a pronunciation guide, and more. It's the ideal way to strengthen word power!.

  1. Build an Interactive Word Wall

    Science.gov (United States)

    Jackson, Julie

    2018-01-01

    Word walls visually display important vocabulary covered during class. Although teachers have often been encouraged to post word walls in their classrooms, little information is available to guide them. This article describes steps science teachers can follow to transform traditional word walls into interactive teaching tools. It also describes a…

  2. Usage of the word 'ether'

    International Nuclear Information System (INIS)

    Duffy, M.C.

    1980-01-01

    Confusion has been caused by scientists using the one word 'ether' to classify models differing from each other in important respects. Major roles assigned to the word are examined, and the nature of modern ether theories surveyed. The part played by the several meanings attached to the word, in the ether concept, is outlined. (author)

  3. Diapo, applying advanced AI methods to diagnosis of PWR reactor coolant pump

    International Nuclear Information System (INIS)

    Porcheron, M.; Ricard, B.

    1993-01-01

    Electricite de France has decided to increase the capabilities of its monitoring and diagnostic architecture with the development of an AI system for reactor coolant pump diagnostic support. This development is carried out with the cooperation of the equipment constructor Jeumont Schneider Industries. This diagnostic system will eventually be included in an integrated surveillance architecture. We present the architecture of the system and the basics of the knowledge model used. Main data for diagnosis are provided by sensor data issued by the pump monitoring system. Diagnostic reasoning is based on the cooperation of two main activities : a heuristic search among typical symptomatic situations that leads to the formulation of hypotheses and a ''deep'' causal analysis that consists in backtracking from identified situations up to initial faults or causes. This approach is well fitted to field expert reasoning, and provides powerful diagnostic capabilities that help to overcome conventional limitations of expert systems entirely based on heuristic knowledge. (authors). 9 figs., 11 refs

  4. Evidence for simultaneous syntactic processing of multiple words during reading.

    Directory of Open Access Journals (Sweden)

    Joshua Snell

    Full Text Available A hotly debated issue in reading research concerns the extent to which readers process parafoveal words, and how parafoveal information might influence foveal word recognition. We investigated syntactic word processing both in sentence reading and in reading isolated foveal words when these were flanked by parafoveal words. In Experiment 1 we found a syntactic parafoveal preview benefit in sentence reading, meaning that fixation durations on target words were decreased when there was a syntactically congruent preview word at the target location (n during the fixation on the pre-target (n-1. In Experiment 2 we used a flanker paradigm in which participants had to classify foveal target words as either noun or verb, when those targets were flanked by syntactically congruent or incongruent words (stimulus on-time 170 ms. Lower response times and error rates in the congruent condition suggested that higher-order (syntactic information can be integrated across foveal and parafoveal words. Although higher-order parafoveal-on-foveal effects have been elusive in sentence reading, results from our flanker paradigm show that the reading system can extract higher-order information from multiple words in a single glance. We propose a model of reading to account for the present findings.

  5. Ins-Robust Primitive Words

    OpenAIRE

    Srivastava, Amit Kumar; Kapoor, Kalpesh

    2017-01-01

    Let Q be the set of primitive words over a finite alphabet with at least two symbols. We characterize a class of primitive words, Q_I, referred to as ins-robust primitive words, which remain primitive on insertion of any letter from the alphabet and present some properties that characterizes words in the set Q_I. It is shown that the language Q_I is dense. We prove that the language of primitive words that are not ins-robust is not context-free. We also present a linear time algorithm to reco...

  6. Gesture en route to words

    DEFF Research Database (Denmark)

    Jensen de López, Kristine M.

    2010-01-01

    This study explores the communicative production of gestrural and vocal modalities by 8 normally developing children in two different cultures (Danish and Zapotec: Mexican indigenous) 16 to 20 months). We analyzed spontaneous production of gestrures and words in children's transition to the two-word...... the children showed an early preference for the gestural or vocal modality. Through Analyzes of two-element combinations of words and/or gestures, we observd a relative increase in cross-modal (gesture-word and two-word) combinations. The results are discussed in terms understanding gestures as a transition...

  7. Artificial Intelligence and Expert Systems.

    Science.gov (United States)

    Wilson, Harold O.; Burford, Anna Marie

    1990-01-01

    Delineates artificial intelligence/expert systems (AI/ES) concepts; provides an exposition of some business application areas; relates progress; and creates an awareness of the benefits, limitations, and reservations of AI/ES. (Author)

  8. Emotion Words: Adding Face Value.

    Science.gov (United States)

    Fugate, Jennifer M B; Gendron, Maria; Nakashima, Satoshi F; Barrett, Lisa Feldman

    2017-06-12

    Despite a growing number of studies suggesting that emotion words affect perceptual judgments of emotional stimuli, little is known about how emotion words affect perceptual memory for emotional faces. In Experiments 1 and 2 we tested how emotion words (compared with control words) affected participants' abilities to select a target emotional face from among distractor faces. Participants were generally more likely to false alarm to distractor emotional faces when primed with an emotion word congruent with the face (compared with a control word). Moreover, participants showed both decreased sensitivity (d') to discriminate between target and distractor faces, as well as altered response biases (c; more likely to answer "yes") when primed with an emotion word (compared with a control word). In Experiment 3 we showed that emotion words had more of an effect on perceptual memory judgments when the structural information in the target face was limited, as well as when participants were only able to categorize the face with a partially congruent emotion word. The overall results are consistent with the idea that emotion words affect the encoding of emotional faces in perceptual memory. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  9. English words structure, history, usage

    CERN Document Server

    Katamba, Francis

    2015-01-01

    How do we find the right word for the job? Where does that word come from? Why do we spell it like that? And how do we know what it means? Words are all around us - we use them every day to communicate our joys, fears, hopes, opinions, wishes and demands - but we don't often think about them too deeply. In this highly accessible introduction to English words, the reader will discover what the study of words can tell them about the extraordinary richness and complexity of our daily vocabulary and about the nature of language in general. Assuming no prior knowledge of linguistics, the book covers a wide range of topics, including the structure of words, the meaning of words, how their spelling relates to pronunciation, how new words are manufactured or imported from other languages, and how the meaning of words changes with the passage of time. It also investigates how the mind deals with words by highlighting the amazing intellectual feat performed routinely when the right word is retrieved from the mental dic...

  10. WordPress for dummies

    CERN Document Server

    Sabin-Wilson, Lisa

    2014-01-01

    The bestselling WordPress guide, fully updated to cover the 2013 enhancements WordPress has millions of users, and this popular guide has sold more than 105,000 copies in its previous editions. With the newest releases of WordPress, author and WordPress expert Lisa Sabin-Wilson has completely updated the book to help you use and understand all the latest features. You'll learn about both the hosted WordPress.com version and the more flexible WordPress.org, which requires third-party hosting. Whether you're switching to WordPress from another blogging platform or just beginning to blog, you'll

  11. Deep Learning Neural Networks in Cybersecurity - Managing Malware with AI

    OpenAIRE

    Rayle, Keith

    2017-01-01

    There’s a lot of talk about the benefits of deep learning (neural networks) and how it’s the new electricity that will power us into the future. Medical diagnosis, computer vision and speech recognition are all examples of use-cases where neural networks are being applied in our everyday business environment. This begs the question…what are the uses of neural-network applications for cyber security? How does the AI process work when applying neural networks to detect malicious software bombar...

  12. How AI turned the chess world upside down

    KAUST Repository

    Polgar, Susan

    2018-01-22

    Man vs. Machine! In 1977 an IBM supercomputer \\'Deep Blue\\' beat the reigning World Chess Champion Gary Kasparov in a 6 game chess match played under tournament conditions. This was the first time a machine beat a human at chess. It symbolized the emergence of Artificial Intelligence (AI) and the potential for great good (and great harm) from machines that have aspects of human intelligence. During this lecture Susan Polgar, a pioneer for Women in Chess, will share her remarkable story as well as how technology has changed the world of chess.

  13. Spatial attention in written word perception

    Directory of Open Access Journals (Sweden)

    Veronica eMontani

    2014-02-01

    Full Text Available The role of attention in visual word recognition and reading aloud is a long debated issue. Studies of both developmental and acquired reading disorders provide growing evidence that spatial attention is critically involved in word reading, in particular for the phonological decoding of unfamiliar letter strings. However, studies on healthy participants have produced contrasting results. The aim of this study was to investigate how the allocation of spatial attention may influence the perception of letter strings in skilled readers. High frequency words, low frequency words and pseudowords were briefly and parafoveally presented either in the left or the right visual field. Attentional allocation was modulated by the presentation of a spatial cue before the target string. Accuracy in reporting the target string was modulated by the spatial cue but this effect varied with the type of string. For unfamiliar strings, processing was facilitated when attention was focused on the string location and hindered when it was diverted from the target. This finding is consistent the assumptions of the CDP+ model of reading aloud, as well as with familiarity sensitivity models that argue for a flexible use of attention according with the specific requirements of the string. Moreover, we found that processing of high-frequency words was facilitated by an extra-large focus of attention. The latter result is consistent with the hypothesis that a broad distribution of attention is the default mode during reading of familiar words because it might optimally engage the broad receptive fields of the highest detectors in the hierarchical system for visual word recognition.

  14. Limitations of the Dual-Process-Theory regarding the Writing of Words and Non-Words to Dictation

    Science.gov (United States)

    Tucha, Oliver; Trumpp, Christian; Lange, Klaus W.

    2004-01-01

    It is generally assumed that the lexical and phonological systems are involved in writing to dictation. In an experiment concerned with the writing of words and non-words to dictation, the handwriting of female students was registered using a digitising tablet. The data contradict the assumption that the phonological system represents an alexical…

  15. Statistical Laws Governing Fluctuations in Word Use from Word Birth to Word Death

    Science.gov (United States)

    Petersen, Alexander M.; Tenenbaum, Joel; Havlin, Shlomo; Stanley, H. Eugene

    2012-03-01

    We analyze the dynamic properties of 107 words recorded in English, Spanish and Hebrew over the period 1800-2008 in order to gain insight into the coevolution of language and culture. We report language independent patterns useful as benchmarks for theoretical models of language evolution. A significantly decreasing (increasing) trend in the birth (death) rate of words indicates a recent shift in the selection laws governing word use. For new words, we observe a peak in the growth-rate fluctuations around 40 years after introduction, consistent with the typical entry time into standard dictionaries and the human generational timescale. Pronounced changes in the dynamics of language during periods of war shows that word correlations, occurring across time and between words, are largely influenced by coevolutionary social, technological, and political factors. We quantify cultural memory by analyzing the long-term correlations in the use of individual words using detrended fluctuation analysis.

  16. First steps in translating human cognitive processes of cane pruning grapevines into AI rules for automated robotic pruning

    Directory of Open Access Journals (Sweden)

    Saxton Valerie

    2014-01-01

    Full Text Available Cane pruning of grapevines is a skilled task for which, internationally, there is a dire shortage of human pruners. As part of a larger project developing an automated robotic pruner, we have used artificial intelligence (AI algorithms to create an expert system for selecting new canes and cutting off unwanted canes. A domain and ontology has been created for AI, which reflects the expertise of expert human pruners. The first step in the creation of an expert system was to generate virtual vines, which were then ‘pruned’ by human pruners and also by the expert system in its infancy. Here we examined the decisions of 12 human pruners, for consistency of decision, on 60 virtual vines. 96.7% of the 12 pruners agreed on at least one cane choice after which there was diminishing agreement on which further canes to select for laying. Our results indicate that techniques developed in computational intelligence can be used to co-ordinate and synthesise the expertise of human pruners into a best practice format. This paper describes first steps in this knowledge elicitation process, and discusses the fit between cane pruning expertise and the expertise that can be elicited using AI based expert system techniques.

  17. PNNL: A Supervised Maximum Entropy Approach to Word Sense Disambiguation

    Energy Technology Data Exchange (ETDEWEB)

    Tratz, Stephen C.; Sanfilippo, Antonio P.; Gregory, Michelle L.; Chappell, Alan R.; Posse, Christian; Whitney, Paul D.

    2007-06-23

    In this paper, we described the PNNL Word Sense Disambiguation system as applied to the English All-Word task in Se-mEval 2007. We use a supervised learning approach, employing a large number of features and using Information Gain for dimension reduction. Our Maximum Entropy approach combined with a rich set of features produced results that are significantly better than baseline and are the highest F-score for the fined-grained English All-Words subtask.

  18. Remembering New Words: Integrating Early Memory Development into Word Learning

    OpenAIRE

    Wojcik, Erica H.

    2013-01-01

    In order to successfully acquire a new word, young children must learn the correct associations between labels and their referents. For decades, word-learning researchers have explored how young children are able to form these associations. However, in addition to learning label-referent mappings, children must also remember them. Despite the importance of memory processes in forming a stable lexicon, there has been little integration of early memory research into the study of early word lear...

  19. Grounding word learning in space.

    Directory of Open Access Journals (Sweden)

    Larissa K Samuelson

    Full Text Available Humans and objects, and thus social interactions about objects, exist within space. Words direct listeners' attention to specific regions of space. Thus, a strong correspondence exists between where one looks, one's bodily orientation, and what one sees. This leads to further correspondence with what one remembers. Here, we present data suggesting that children use associations between space and objects and space and words to link words and objects--space binds labels to their referents. We tested this claim in four experiments, showing that the spatial consistency of where objects are presented affects children's word learning. Next, we demonstrate that a process model that grounds word learning in the known neural dynamics of spatial attention, spatial memory, and associative learning can capture the suite of results reported here. This model also predicts that space is special, a prediction supported in a fifth experiment that shows children do not use color as a cue to bind words and objects. In a final experiment, we ask whether spatial consistency affects word learning in naturalistic word learning contexts. Children of parents who spontaneously keep objects in a consistent spatial location during naming interactions learn words more effectively. Together, the model and data show that space is a powerful tool that can effectively ground word learning in social contexts.

  20. The word-length effect and disyllabic words.

    Science.gov (United States)

    Lovatt, P; Avons, S E; Masterson, J

    2000-02-01

    Three experiments compared immediate serial recall of disyllabic words that differed on spoken duration. Two sets of long- and short-duration words were selected, in each case maximizing duration differences but matching for frequency, familiarity, phonological similarity, and number of phonemes, and controlling for semantic associations. Serial recall measures were obtained using auditory and visual presentation and spoken and picture-pointing recall. In Experiments 1a and 1b, using the first set of items, long words were better recalled than short words. In Experiments 2a and 2b, using the second set of items, no difference was found between long and short disyllabic words. Experiment 3 confirmed the large advantage for short-duration words in the word set originally selected by Baddeley, Thomson, and Buchanan (1975). These findings suggest that there is no reliable advantage for short-duration disyllables in span tasks, and that previous accounts of a word-length effect in disyllables are based on accidental differences between list items. The failure to find an effect of word duration casts doubt on theories that propose that the capacity of memory span is determined by the duration of list items or the decay rate of phonological information in short-term memory.

  1. Sensor assignment to mission in AI-TECD

    Science.gov (United States)

    Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan

    2016-05-01

    Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

  2. SMARTER THAN YOUR AVERAGE SENSOR: AIS SENSOR THAT INTELLIGENTLY RE-TRANSMITS MEANINGFUL INFORMATION DERIVED FROM RAWAIS DATA IN NETWORK LIMITED AREAS

    Directory of Open Access Journals (Sweden)

    R. G. V. Meyer

    2017-11-01

    Full Text Available AIS is a transponder based, anti-collision system used by the majority of ocean traffic. Ships regularly transmit their identity, position and speed. The information used to populate the AIS fields come from ship based sensors, such as GPS, and user populated fields, such as the vessels name and MMSI number. These fields are susceptible to spoofing and can be changed to hide the identity or location of a vessel. This is often done to disguise the vessel as a different class to avoid inspections or to enter a protected area without raising alarms. The AIS system has found great utility in monitoring global shipping trends and traffic but this was never intended when the protocol was designed. Docked vessels still transmit messages regularly that contain no new information. These, and other redundant messages, are still transmitted and stored. In situations where a sensor is remote and has limited access to the Internet this can become costly. The Smart-AIS sensor records all incoming messages locally and makes a decision on whether the message is of special interest or not. Messages of interest are re-transmitted to an external AIS database.

  3. “Awake” intraoperative functional MRI (ai-fMRI) for mapping the eloquent cortex: Is it possible in awake craniotomy?☆

    Science.gov (United States)

    Lu, Jun-Feng; Zhang, Han; Wu, Jin-Song; Yao, Cheng-Jun; Zhuang, Dong-Xiao; Qiu, Tian-Ming; Jia, Wen-Bin; Mao, Ying; Zhou, Liang-Fu

    2012-01-01

    As a promising noninvasive imaging technique, functional MRI (fMRI) has been extensively adopted as a functional localization procedure for surgical planning. However, the information provided by preoperative fMRI (pre-fMRI) is hampered by the brain deformation that is secondary to surgical procedures. Therefore, intraoperative fMRI (i-fMRI) becomes a potential alternative that can compensate for brain shifts by updating the functional localization information during craniotomy. However, previous i-fMRI studies required that patients be under general anesthesia, preventing the wider application of such a technique as the patients cannot perform tasks unless they are awake. In this study, we propose a new technique that combines awake surgery and i-fMRI, named “awake” i-fMRI (ai-fMRI). We introduced ai-fMRI to the real-time localization of sensorimotor areas during awake craniotomy in seven patients. The results showed that ai-fMRI could successfully detect activations in the bilateral primary sensorimotor areas and supplementary motor areas for all patients, indicating the feasibility of this technique in eloquent area localization. The reliability of ai-fMRI was further validated using intraoperative stimulation mapping (ISM) in two of the seven patients. Comparisons between the pre-fMRI-derived localization result and the ai-fMRI derived result showed that the former was subject to a heavy brain shift and led to incorrect localization, while the latter solved that problem. Additionally, the approaches for the acquisition and processing of the ai-fMRI data were fully illustrated and described. Some practical issues on employing ai-fMRI in awake craniotomy were systemically discussed, and guidelines were provided. PMID:24179766

  4. Electronic Word of Behavior

    DEFF Research Database (Denmark)

    Kunst, Katrine; Vatrapu, Ravi; Hussain, Abid

    2017-01-01

    In this research in progress-paper, we introduce the notion of ‘Electronic Word of Behavior’ (eWOB) to describe the phenomenon of consumers’ product-related behaviors increasingly made observable by online social environments. We employ Observational Learning theory to conceptualize the notion of e......WOB and generate hypotheses about how consumers influence each other by means of behavior in online social environments. We present a conceptual framework for categorizing eWOB, and propose a novel research design for a randomized controlled field experiment. Specifically, the ongoing experiment aims to analyze...... how the presence of individual-specific behavior-based social information in a movie streaming service affects potential users’ attitude towards and intentions to use the service....

  5. Chinese Number Words, Culture, and Mathematics Learning

    Science.gov (United States)

    Ng, Sharon Sui Ngan; Rao, Nirmala

    2010-01-01

    This review evaluates the role of language--specifically, the Chinese-based system of number words and the simplicity of Chinese mathematical terms--in explaining the relatively superior performance of Chinese and other East Asian students in cross-national studies of mathematics achievement. Relevant research is critically reviewed focusing on…

  6. Visual word representation in the brain

    NARCIS (Netherlands)

    Ramakrishnan, K.; Groen, I.; Scholte, S.; Smeulders, A.; Ghebreab, S.

    2013-01-01

    The human visual system is thought to use features of intermediate complexity for scene representation. How the brain computationally represents intermediate features is unclear, however. To study this, we tested the Bag of Words (BoW) model in computer vision against human brain activity. This

  7. Iconic Factors and Language Word Order

    Science.gov (United States)

    Moeser, Shannon Dawn

    1975-01-01

    College students were presented with an artificial language in which spoken nonsense words were correlated with visual references. Inferences regarding vocabulary acquisition were drawn, and it was suggested that the processing of the language was mediated through a semantic memory system. (CK)

  8. PER Estimation of AIS in Inland Rivers based on Three Dimensional Ray Tracking

    Directory of Open Access Journals (Sweden)

    F. Ma

    2014-03-01

    Full Text Available The Automatic Identification System (AIS is an important maritime safety device, which is populous in inland rivers. Compared with that in open sea, the Package Error Rate (PER of AIS in inland river has increased sharply due to its complex environment. With the help of hardware in loop simulation, it is possible to make statistical calculation on the PER under a given field strength and describe the data by quadratic rational fraction. Meanwhile, in the three dimensional software environments, the signal field strength is able to be calculated by the ray tracking method, which exhausts all the possible propagation paths, including direct way, reflection, diffractions, and the other medium attenuation matters. Beyond that, in the model, the propagation geography information in inland rivers is required to be simplified in some way, or the computation of the ray tracking is too hard to get. The paper set the Changjiang Wuhan channel as the field testing region, and all the deviations are less than 5% in sunny weather, which proves the method accurate and effective.

  9. Optimal synthesis of four-bar steering mechanism using AIS and genetic algorithms

    Energy Technology Data Exchange (ETDEWEB)

    Ettefagh, Mir Mohammad; Javash, Morteza Saeidi [University of Tabriz, Tabriz (Iran, Islamic Republic of)

    2014-06-15

    Synthesis of four-bar Ackermann steering mechanism was considered as an optimization problem for generating the best function between input and output links. The steering mechanism was designed through two heuristic optimization methods, namely, artificial immune system (AIS) algorithm and genetic algorithm (GA). The optimization was implemented using the two methods, length was selected as optimization parameter in the first method, whereas precision point distribution was considered in the second method. Two of the links in the first method had the same length to achieve a symmetric mechanism; one of these lengths was considered as optimization parameter. Five precision points were considered in the precision point distribution method, one of which was in the straight line condition, whereas the others were symmetric. The obtained results showed that the AIS algorithm can generate the closest function to the desired function in the first method. By contrast, GA can generate the closest function to the desired function with the least error in the second method.

  10. Usability of EFBs for Viewing NOTAMs and AIS/MET Data Link Messages

    Science.gov (United States)

    Evans, Emory T.; Young, Steven D.; Daniels, Tammi S.; Myer, Robert R.

    2014-01-01

    Electronic Flight Bags (EFB) are increasingly integral to flight deck information management. A piloted simulation study was conducted at NASA Langley Research Center, one aspect of which was to evaluate the usability and acceptability of EFBs for viewing and managing Notices to Airmen (NOTAMs) and data linked aeronautical information services (AIS) and meteorological information (MET). The study simulated approaches and landings at Memphis International Airport (KMEM) using various flight scenarios and weather conditions. Ten two-pilot commercial airline crews participated, utilizing the Cockpit Motion Facility's Research Flight Deck (CMF/RFD) simulator. Each crew completed approximately two dozen flights over a two day period. Two EFBs were installed, one for each pilot. Study data were collected in the form of questionnaire/interview responses, audio/video recordings, oculometer recordings, and aircraft/system state data. Preliminary usability results are reported primarily based on pilot interviews and responses to questions focused on ease of learning, ease of use, usefulness, satisfaction, and acceptability. Analysis of the data from the other objective measures (e.g., oculometer) is ongoing and will be reported in a future publication. This paper covers how the EFB functionality was set up for the study; the NOTAM, AIS/MET data link, and weather messages that were presented; questionnaire results; selected pilot observations; and conclusions.

  11. Artificial intelligence, expert systems, computer vision, and natural language processing

    Science.gov (United States)

    Gevarter, W. B.

    1984-01-01

    An overview of artificial intelligence (AI), its core ingredients, and its applications is presented. The knowledge representation, logic, problem solving approaches, languages, and computers pertaining to AI are examined, and the state of the art in AI is reviewed. The use of AI in expert systems, computer vision, natural language processing, speech recognition and understanding, speech synthesis, problem solving, and planning is examined. Basic AI topics, including automation, search-oriented problem solving, knowledge representation, and computational logic, are discussed.

  12. WordPress For Dummies

    CERN Document Server

    Sabin-Wilson, Lisa

    2011-01-01

    The bestselling guide to WordPress, fully updated to help you get your blog going! Millions of bloggers rely on WordPress, the popular, free blogging platform. This guide covers all the features and improvements in the most up-to-date version of WordPress. Whether you are switching to WordPress from another blogging platform or just starting your first blog, you'll find the advice in this friendly guide gets you up to speed on both the free-hosted WordPress.com version and WordPress.org, which requires the purchase of web hosting services, and figure out which version is best for you. You'll b

  13. Words and possible words in early language acquisition.

    Science.gov (United States)

    Marchetto, Erika; Bonatti, Luca L

    2013-11-01

    In order to acquire language, infants must extract its building blocks-words-and master the rules governing their legal combinations from speech. These two problems are not independent, however: words also have internal structure. Thus, infants must extract two kinds of information from the same speech input. They must find the actual words of their language. Furthermore, they must identify its possible words, that is, the sequences of sounds that, being morphologically well formed, could be words. Here, we show that infants' sensitivity to possible words appears to be more primitive and fundamental than their ability to find actual words. We expose 12- and 18-month-old infants to an artificial language containing a conflict between statistically coherent and structurally coherent items. We show that 18-month-olds can extract possible words when the familiarization stream contains marks of segmentation, but cannot do so when the stream is continuous. Yet, they can find actual words from a continuous stream by computing statistical relationships among syllables. By contrast, 12-month-olds can find possible words when familiarized with a segmented stream, but seem unable to extract statistically coherent items from a continuous stream that contains minimal conflicts between statistical and structural information. These results suggest that sensitivity to word structure is in place earlier than the ability to analyze distributional information. The ability to compute nontrivial statistical relationships becomes fully effective relatively late in development, when infants have already acquired a considerable amount of linguistic knowledge. Thus, mechanisms for structure extraction that do not rely on extensive sampling of the input are likely to have a much larger role in language acquisition than general-purpose statistical abilities. Copyright © 2013. Published by Elsevier Inc.

  14. Aeronautical Information System -

    Data.gov (United States)

    Department of Transportation — The Aeronautical Information System (AIS) is a leased weather automated system that provides a means of collecting and distributing aeronautical weather information...

  15. Words Do Come Easy (Sometimes)

    DEFF Research Database (Denmark)

    Starrfelt, Randi; Petersen, Anders; Vangkilde, Signe Allerup

    multiple stimuli are presented simultaneously: Are words treated as units or wholes in visual short term memory? Using methods based on a Theory of Visual Attention (TVA), we measured perceptual threshold, visual processing speed and visual short term memory capacity for words and letters, in two simple...... a different pattern: Letters are perceived more easily than words, and this is reflected both in perceptual processing speed and short term memory capacity. So even if single words do come easy, they seem to enjoy no advantage in visual short term memory....

  16. WordPress Top Plugins

    CERN Document Server

    Corbin, Brandon

    2010-01-01

    Time flies when you're having fun. This is the right way to describe this WordPress Top Plugins book by Brandon Corbin. With real world examples and by showing you the perks of having these plugins installed on your websites, the author is all set to captivate your interest from start to end. Regardless of whether this is your first time working with WordPress, or you're a seasoned WordPress coding ninja, WordPress Top Plugins will walk you through finding and installing the best plugins for generating and sharing content, building communities and reader base, and generating real advertising r

  17. Rapid interactions between lexical semantic and word form analysis during word recognition in context: evidence from ERPs.

    Science.gov (United States)

    Kim, Albert; Lai, Vicky

    2012-05-01

    We used ERPs to investigate the time course of interactions between lexical semantic and sublexical visual word form processing during word recognition. Participants read sentence-embedded pseudowords that orthographically resembled a contextually supported real word (e.g., "She measured the flour so she could bake a ceke…") or did not (e.g., "She measured the flour so she could bake a tont…") along with nonword consonant strings (e.g., "She measured the flour so she could bake a srdt…"). Pseudowords that resembled a contextually supported real word ("ceke") elicited an enhanced positivity at 130 msec (P130), relative to real words (e.g., "She measured the flour so she could bake a cake…"). Pseudowords that did not resemble a plausible real word ("tont") enhanced the N170 component, as did nonword consonant strings ("srdt"). The effect pattern shows that the visual word recognition system is, perhaps, counterintuitively, more rapidly sensitive to minor than to flagrant deviations from contextually predicted inputs. The findings are consistent with rapid interactions between lexical and sublexical representations during word recognition, in which rapid lexical access of a contextually supported word (CAKE) provides top-down excitation of form features ("cake"), highlighting the anomaly of an unexpected word "ceke."

  18. Greek-English Word Processing on the Macintosh.

    Science.gov (United States)

    Rusten, Jeffrey

    1986-01-01

    Discusses the complete Greek-English word processing system of the Apple Macintosh computer. Describes the features of its operating system, shows how the Greek fonts look and work, and enumerates both the advantages and drawbacks of the Macintosh. (SED)

  19. AI (artificial intelligence) in histopathology--from image analysis to automated diagnosis.

    Science.gov (United States)

    Kayser, Klaus; Görtler, Jürgen; Bogovac, Milica; Bogovac, Aleksandar; Goldmann, Torsten; Vollmer, Ekkehard; Kayser, Gian

    2009-01-01

    education in anatomy and pathology. First attempts to introduce them into routine work have been reported. Application of AI has been established by automated immunohistochemical measurement systems (EAMUS, www.diagnomX.eu). The performance of automated diagnosis has been reported for a broad variety of organs at sensitivity and specificity levels >85%). The implementation of a complete connected AI supported system is in its childhood. Application of AI in digital tissue--based diagnosis will allow the pathologists to work as supervisors and no longer as primary "water carriers". Its accurate use will give them the time needed to concentrating on difficult cases for the benefit of their patients.

  20. Computing Facilities for AI: A Survey of Present and Near-Future Options

    OpenAIRE

    Fahlman, Scott

    1981-01-01

    At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

  1. Auditory word recognition: extrinsic and intrinsic effects of word frequency.

    Science.gov (United States)

    Connine, C M; Titone, D; Wang, J

    1993-01-01

    Two experiments investigated the influence of word frequency in a phoneme identification task. Speech voicing continua were constructed so that one endpoint was a high-frequency word and the other endpoint was a low-frequency word (e.g., best-pest). Experiment 1 demonstrated that ambiguous tokens were labeled such that a high-frequency word was formed (intrinsic frequency effect). Experiment 2 manipulated the frequency composition of the list (extrinsic frequency effect). A high-frequency list bias produced an exaggerated influence of frequency; a low-frequency list bias showed a reverse frequency effect. Reaction time effects were discussed in terms of activation and postaccess decision models of frequency coding. The results support a late use of frequency in auditory word recognition.

  2. Off The Beaten Lane: AI Challenges In MOBAs Beyond Player Control

    OpenAIRE

    Cook, Michael; Summerville, Adam; Colton, Simon

    2017-01-01

    MOBAs represent a huge segment of online gaming and are growing as both an eSport and a casual genre. The natural starting point for AI researchers interested in MOBAs is to develop an AI to play the game better than a human - but MOBAs have many more challenges besides adversarial AI. In this paper we introduce the reader to the wider context of MOBA culture, propose a range of challenges faced by the community today, and posit concrete AI projects that can be undertaken to begin solving them.

  3. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    OpenAIRE

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Bas...

  4. AI's Philosophical Underpinnings: A Thinking Person's Walk through the Twists and Turns of Artificial Intelligence's Meandering Path

    Science.gov (United States)

    Colombano, Silvano; Norvig, Peter (Technical Monitor)

    2000-01-01

    Few human endeavors can be viewed both as extremely successful and unsuccessful at the same time. This is typically the case when goals have not been well defined or have been shifting in time. This has certainly been true of Artificial Intelligence (AI). The nature of intelligence has been the object of much thought and speculation throughout the history of philosophy. It is in the nature of philosophy that real headway is sometimes made only when appropriate tools become available. Similarly the computer, coupled with the ability to program (at least in principle) any function, appeared to be the tool that could tackle the notion of intelligence. To suit the tool, the problem of the nature of intelligence was soon sidestepped in favor of this notion: If a probing conversation with a computer could not be distinguished from a conversation with a human, then AI had been achieved. This notion became known as the Turing test, after the mathematician Alan Turing who proposed it in 1950. Conceptually rich and interesting, these early efforts gave rise to a large portion of the field's framework. Key to AI, rather than the 'number crunching' typical of computers until then, was viewed as the ability to manipulate symbols and make logical inferences. To facilitate these tasks, AI languages such as LISP and Prolog were invented and used widely in the field. One idea that emerged and enabled some success with real world problems was the notion that 'most intelligence' really resided in knowledge. A phrase attributed to Feigenbaum, one of the pioneers, was 'knowledge is the power.' With this premise, the problem is shifted from 'how do we solve problems' to 'how do we represent knowledge.' A good knowledge representation scheme could allow one to draw conclusions from given premises. Such schemes took forms such as rules,frames and scripts. It allowed the building of what became known as expert systems or knowledge based systems (KBS).

  5. Le français de la communication professionnelle

    CERN Document Server

    Danilo, Michel; Lincoln, M

    A partir de 150 heures de français. - Pour acquérir une bonne maîtrise des pratiques professionnelles. - Pour améliorer ses connaissances de la langue tout en se familiarisant avec les pratiques langagières spécifiques du monde du travail. - Pour préparer les examens de la Chambre de Commerce et d'Industrie de Paris. Dix dossiers : - La communication dans les affaires - Le travail administratif - Le téléphone - La communication interne - Le courrier de l'entreprise - L'offre et la commande - Livraison, transport, assurance - La facturation et le règlement - La communication avec les partenaires - Les nouveaux outils de communication Une cassette audio ainsi que des corrigés accompagnent ce livre.

  6. Conjugaison progressive du français avec 400 exercices

    CERN Document Server

    Boularès, Michèle

    1999-01-01

    La Conjugaison progressive du français s'adresse aux grands adolescents et aux adultes de tous niveaux. C'est un ouvrage d'apprentissage des formes verbales. On trouve sur la page de gauche : - la règle de formation de chaque temps ; - les verbes types présentés en tableaux et accompagnés d'une liste de verbes conjugués sur le même modèle ; - des remarques phonétiques ou orthographiques ; - des explications sur les difficultés particulières. La page de droite propose des exercices et des activités de difficulté progressive. C'est également un ouvrage de référence grâce aux nombreux tableaux de conjugaison qu'il contient.

  7. Orthogonally Evolved AI to Improve Difficulty Adjustment in Video Games

    DEFF Research Database (Denmark)

    Hintze, Arend; Olson, Randal; Lehman, Joel Anthony

    2016-01-01

    Computer games are most engaging when their difficulty is well matched to the player's ability, thereby providing an experience in which the player is neither overwhelmed nor bored. In games where the player interacts with computer-controlled opponents, the difficulty of the game can be adjusted...... not only by changing the distribution of opponents or game resources, but also through modifying the skill of the opponents. Applying evolutionary algorithms to evolve the artificial intelligence that controls opponent agents is one established method for adjusting opponent difficulty. Less-evolved agents...... (i.e. agents subject to fewer generations of evolution) make for easier opponents, while highly-evolved agents are more challenging to overcome. In this publication we test a new approach for difficulty adjustment in games: orthogonally evolved AI, where the player receives support from collaborating...

  8. Presidents' words - Gianni Deroma

    CERN Multimedia

    Staff Association

    2015-01-01

    Gianni Deroma This week we publish the last contributions in the 'Words of presidents' series by giving the floor to Gianni Deroma (2007-2010) and Michel Goossens (2011-2015). "Tu patere legem quam ipse fecisti" This Latin adage has marked my years with the Staff Association (SA). For someone like me, coming from the technical world, the discovery of the importance of the role played by legal matters in the defence of the staff illustrates a new reality and incarnates my years spent with the SA. We, members of personnel, as citizens have as reference the democratic societies in which we live. CERN is not a democracy. The Member States, the Director-General have full powers, or almost. Contrary to citizens of states, we do not elect our leaders. So in that context is it useful to have a Staff Association? Or does it only serve as a necessary alibi for those who have the power? This is where a legal approach makes sense, in counterbalancing the power of our governing ...

  9. Quivers, words and fundamentals

    International Nuclear Information System (INIS)

    Mattioli, Paolo; Ramgoolam, Sanjaye

    2015-01-01

    A systematic study of holomorphic gauge invariant operators in general N=1 quiver gauge theories, with unitary gauge groups and bifundamental matter fields, was recently presented in http://dx.doi.org/10.1007/JHEP04(2013)094. For large ranks a simple counting formula in terms of an infinite product was given. We extend this study to quiver gauge theories with fundamental matter fields, deriving an infinite product form for the refined counting in these cases. The infinite products are found to be obtained from substitutions in a simple building block expressed in terms of the weighted adjacency matrix of the quiver. In the case without fundamentals, it is a determinant which itself is found to have a counting interpretation in terms of words formed from partially commuting letters associated with simple closed loops in the quiver. This is a new relation between counting problems in gauge theory and the Cartier-Foata monoid. For finite ranks of the unitary gauge groups, the refined counting is given in terms of expressions involving Littlewood-Richardson coefficients.

  10. Preliminary experience with SpineEOS, a new software for 3D planning in AIS surgery.

    Science.gov (United States)

    Ferrero, Emmanuelle; Mazda, Keyvan; Simon, Anne-Laure; Ilharreborde, Brice

    2018-04-24

    Preoperative planning of scoliosis surgery is essential in the effective treatment of spine pathology. Thus, precontoured rods have been recently developed to avoid iatrogenic sagittal misalignment and rod breakage. Some specific issues exist in adolescent idiopathic scoliosis (AIS), such as a less distal lower instrumented level, a great variability in the location of inflection point (transition from lumbar lordosis to thoracic kyphosis), and sagittal correction is limited by both bone-implant interface. Since 2007, stereoradiographic imaging system is used and allows for 3D reconstructions. Therefore, a software was developed to perform preoperative 3D surgical planning and to provide rod's shape and length. The goal of this preliminary study was to assess the feasibility, reliability, and the clinical relevance of this new software. Retrospective study on 47 AIS patients operated with the same surgical technique: posteromedial translation through posterior approach with lumbar screws and thoracic sublaminar bands. Pre- and postoperatively, 3D reconstructions were performed on stereoradiographic images (EOS system, Paris, France) and compared. Then, the software was used to plan the surgical correction and determine rod's shape and length. Simulated spine and rods were compared to postoperative real 3D reconstructions. 3D reconstructions and planning were performed by an independent observer. 3D simulations were performed on the 47 patients. No difference was found between the simulated model and the postoperative 3D reconstructions in terms of sagittal parameters. Postoperatively, 21% of LL were not within reference values. Postoperative SVA was 20 mm anterior in 2/3 of the cases. Postoperative rods were significantly longer than precontoured rods planned with the software (mean 10 mm). Inflection points were different on the rods used and the planned rods (2.3 levels on average). In this preliminary study, the software based on 3D stereoradiography low

  11. Spatial attention in written word perception.

    Science.gov (United States)

    Montani, Veronica; Facoetti, Andrea; Zorzi, Marco

    2014-01-01

    The role of attention in visual word recognition and reading aloud is a long debated issue. Studies of both developmental and acquired reading disorders provide growing evidence that spatial attention is critically involved in word reading, in particular for the phonological decoding of unfamiliar letter strings. However, studies on healthy participants have produced contrasting results. The aim of this study was to investigate how the allocation of spatial attention may influence the perception of letter strings in skilled readers. High frequency words (HFWs), low frequency words and pseudowords were briefly and parafoveally presented either in the left or the right visual field. Attentional allocation was modulated by the presentation of a spatial cue before the target string. Accuracy in reporting the target string was modulated by the spatial cue but this effect varied with the type of string. For unfamiliar strings, processing was facilitated when attention was focused on the string location and hindered when it was diverted from the target. This finding is consistent the assumptions of the CDP+ model of reading aloud, as well as with familiarity sensitivity models that argue for a flexible use of attention according with the specific requirements of the string. Moreover, we found that processing of HFWs was facilitated by an extra-large focus of attention. The latter result is consistent with the hypothesis that a broad distribution of attention is the default mode during reading of familiar words because it might optimally engage the broad receptive fields of the highest detectors in the hierarchical system for visual word recognition.

  12. Gamification for Word Sense Labeling

    NARCIS (Netherlands)

    Venhuizen, Noortje; Basile, Valerio; Evang, Kilian; Bos, Johan; Erk, Kartin; Koller, Alexander

    2013-01-01

    Obtaining gold standard data for word sense disambiguation is important but costly. We show how it can be done using a “Game with a Purpose” (GWAP) called Wordrobe. This game consists of a large set of multiple-choice questions on word senses generated from the Groningen Meaning Bank. The players

  13. Learning Words through Multimedia Application

    DEFF Research Database (Denmark)

    Zhang, Chun

    2007-01-01

      This study explores the relevance of multimedia application in relation to vocabulary acquisition in the classroom of Chinese as a foreign language. The herein depicted application refers to the computer-assisted implicit word-learning, wherein the Danish students built hypertexts to acquire...... meanings of unknown words aiming to research and to enlarging Chinese vocabulary.  ...

  14. A quick overview of artificial intelligence and expert systems

    International Nuclear Information System (INIS)

    Engelmore, R.S.

    1989-01-01

    Artificial intelligence (AI) is almost a household word these days. There have been several conferences held in this country over the last two years on artificial intelligence and its applications. The international AI conference at Snowbird, Utah, in 1987 centered on AI applications in the nuclear industry. This paper serves as an introductory overview of the subject of AI for this state-of-the-art review of AI applications in the nuclear industry. We introduce the subject in a way that will be relevant to many people in the nuclear industry who have heard of AI but are not familiar with it and are looking for answers to several simple questions. We attempt to answer those simple questions here and prepare the reader so that he or she can appreciate the following sections on AI applications in the nuclear field. (orig./GL)

  15. Computing with Words Principal Concepts and Ideas

    CERN Document Server

    Zadeh, Lotfi A

    2012-01-01

    In essence, Computing with Words (CWW) is a system of computation in which the objects of computation are predominantly words, phrases and propositions drawn from a natural language. CWW is based on fuzzy logic. In science there is a deep-seated tradition of according much more respect to numbers than to words. In a fundamental way, CWW is a challenge to this tradition. What is not widely recognized is that, today, words are used in place of numbers in a wide variety of applications ranging from digital cameras and household appliances to fraud detection systems, biomedical instrumentation and subway trains.  CWW offers a unique capability—the capability to precisiate natural language. Unprecisiated (raw) natural language cannot be computed with. A key concept which underlies precisiation of meaning is that of the meaning postulate: A proposition, p, is a restriction on the values which a variable, X—a variable which is implicit in p—is allowed to take. CWW has an important ramification for mathema...

  16. Head First WordPress

    CERN Document Server

    Siarto, Jeff

    2010-01-01

    Whether you're promoting your business or writing about your travel adventures, Head First WordPress will teach you not only how to make your blog look unique and attention-grabbing, but also how to dig into the more complex features of WordPress 3.0 to make your website work well, too. You'll learn how to move beyond the standard WordPress look and feel by customizing your blog with your own URL, templates, plugin functionality, and more. As you learn, you'll be working with real WordPress files: The book's website provides pre-fab WordPress themes to download and work with as you follow al

  17. The x-word and its usage : Taboo words and swearwords in general, and x-words in newspapers

    OpenAIRE

    Lindahl, Katarina

    2008-01-01

    All languages have words that are considered taboo – words that are not supposed to be said or used. Taboo words, or swearwords, can be used in many different ways and they can have different meanings depending on what context they appear in. Another aspect of taboo words is the euphemisms that are used in order to avoid obscene speech. This paper will focus on x-words, words like the f-word or the c-word, which replace the words fuck or cunt, but as the study will show they also have other m...

  18. Apolipoprotein A-I metabolism in cynomolgus monkey. Identification and characterization of beta-migrating pools

    International Nuclear Information System (INIS)

    Melchior, G.W.; Castle, C.K.

    1989-01-01

    Fresh plasma from control (C) and hypercholesterolemic (HC) cynomolgus monkeys was analyzed by agarose electrophoresis-immunoblotting with antibody to cynomolgus monkey apolipoprotein (apo) A-I. Two bands were evident on the autoradiogram: an alpha-migrating band (high density lipoprotein) and a beta-migrating band that comigrated exactly with cynomolgus monkey low density lipoprotein (LDL). The presence of beta-migrating apo A-I in the plasma of these monkeys was confirmed by Geon-Pevikon preparative electrophoresis, crossed immunoelectrophoresis, and isotope dilution studies in which radiolabeled apo A-I was found to equilibrate also with alpha- and beta-migrating pools of apo A-I in the plasma. Subfractionation of C and HC plasma by agarose column chromatography (Bio-Gel A-0.5M and A-15M) followed by agarose electrophoresis-immunoblotting indicated that the beta-migrating apo A-I in C was relatively homogeneous and eluted with proteins of Mr approximately 50 kD [apo A-I(50 kD)], whereas two beta-migrating fractions were identified in HC, one that eluted with the 50-kD proteins, and the other that eluted in the LDL Mr range [apo A-I(LDL)]. The apo A-I(LDL) was precipitated by antibody to cynomolgus monkey apo B. The apo A-I(50 kD) accounted for 5 +/- 1% (mean +/- SD) of the plasma apo A-I in C plasma, and 15 +/- 7% in HC plasma. No apo A-I(LDL) was detected in C plasma, but that fraction accounted for 9 +/- 7% of the apo A-I in HC plasma. These data establish the presence of multiple pools of apo A-I in the cynomolgus monkey, which must be taken into consideration in any comprehensive model of apo A-I metabolism in this species

  19. From word superiority to word inferiority: Visual processing of letters and words in pure alexia

    DEFF Research Database (Denmark)

    Habekost, Thomas; Petersen, Anders; Behrmann, Marlene

    2014-01-01

    Visual processing and naming of individual letters and short words were investigated in four patients with pure alexia. To test processing at different levels, the same stimuli were studied across a naming task and a visual perception task. The normal word superiority effect was eliminated in bot...

  20. An application of A.I. techniques for the support of emergency operation

    International Nuclear Information System (INIS)

    Jeong, Kwang-Sub; Yang, Joon-On; Park, C.K.

    1991-01-01

    For the support of emergency operation, COSMOS is being developed at KAERI using A.I. techniques. COSMOC consists of two parts; one is to identify CSF's status and to determine the overall response strategy and the other to generate a set of success paths which restore the challenged CSF's and to rank them. The status of CSF is identified by the rule-based reasoning. The overall response strategy is inferred according to the identified CSF's status. The success paths are generated by the given structure descriptions of systems and the general generation algorithm. Backtracking, an inherent feature of the Prolog language, is used for the search of next success path. Generated success paths are ranked according to either its respective reliability or the number of manual operator's actions required to complete each success path. For efficient man-machine interface, a color graphic display is utilized. COSMOS is being built on a workstation. (author)

  1. Dynamics of Semantic and Word-Formation Subsystems of the Russian Language: Historical Dynamics of the Word Family

    Directory of Open Access Journals (Sweden)

    Olga Ivanovna Dmitrieva

    2015-09-01

    Full Text Available The article provides comprehensive justification of the principles and methods of the synchronic and diachronic research of word-formation subsystems of the Russian language. The authors also study the ways of analyzing historical dynamics of word family as the main macro-unit of word-formation system. In the field of analysis there is a family of words with the stem 'ход-' (the meaning of 'motion', word-formation of which is investigated in different periods of the Russian literary language. Significance of motion-verbs in the process of forming a language picture of the world determined the character and the structure of this word family as one of the biggest in the history of the Russian language. In the article a structural and semantic dynamics of the word family 'ход-' is depicted. The results of the study show that in the ancient period the prefixes of verbal derivatives were formed, which became the apex-branched derivational paradigms existing in modern Russian. The old Russian period of language development is characterized by the appearance of words with connotative meaning (with suffixes -ishk-, -ichn-, as well as the words with possessive semantics (with suffixes –ev-, -sk-. In this period the verbs with the postfix -cz also supplement the analyzed word family. The period of formation of the National Russian language was marked by the loss of a large number of abstract nouns and the appearance of neologisms from some old Russian abstract nouns. The studied family in the modern Russian language is characterized by the following processes: the appearance of terms, the active semantic derivation, the weakening of word-formation variability, the semantic differentiation of duplicate units, the development of subsystem of words with connotative meanings, and the preservation of derivatives in all functional styles.

  2. Voice congruency facilitates word recognition.

    Directory of Open Access Journals (Sweden)

    Sandra Campeanu

    Full Text Available Behavioral studies of spoken word memory have shown that context congruency facilitates both word and source recognition, though the level at which context exerts its influence remains equivocal. We measured event-related potentials (ERPs while participants performed both types of recognition task with words spoken in four voices. Two voice parameters (i.e., gender and accent varied between speakers, with the possibility that none, one or two of these parameters was congruent between study and test. Results indicated that reinstating the study voice at test facilitated both word and source recognition, compared to similar or no context congruency at test. Behavioral effects were paralleled by two ERP modulations. First, in the word recognition test, the left parietal old/new effect showed a positive deflection reflective of context congruency between study and test words. Namely, the same speaker condition provided the most positive deflection of all correctly identified old words. In the source recognition test, a right frontal positivity was found for the same speaker condition compared to the different speaker conditions, regardless of response success. Taken together, the results of this study suggest that the benefit of context congruency is reflected behaviorally and in ERP modulations traditionally associated with recognition memory.

  3. Voice congruency facilitates word recognition.

    Science.gov (United States)

    Campeanu, Sandra; Craik, Fergus I M; Alain, Claude

    2013-01-01

    Behavioral studies of spoken word memory have shown that context congruency facilitates both word and source recognition, though the level at which context exerts its influence remains equivocal. We measured event-related potentials (ERPs) while participants performed both types of recognition task with words spoken in four voices. Two voice parameters (i.e., gender and accent) varied between speakers, with the possibility that none, one or two of these parameters was congruent between study and test. Results indicated that reinstating the study voice at test facilitated both word and source recognition, compared to similar or no context congruency at test. Behavioral effects were paralleled by two ERP modulations. First, in the word recognition test, the left parietal old/new effect showed a positive deflection reflective of context congruency between study and test words. Namely, the same speaker condition provided the most positive deflection of all correctly identified old words. In the source recognition test, a right frontal positivity was found for the same speaker condition compared to the different speaker conditions, regardless of response success. Taken together, the results of this study suggest that the benefit of context congruency is reflected behaviorally and in ERP modulations traditionally associated with recognition memory.

  4. Brain activation during word identification and word recognition

    DEFF Research Database (Denmark)

    Jernigan, Terry L.; Ostergaard, Arne L.; Law, Ian

    1998-01-01

    Previous memory research has suggested that the effects of prior study observed in priming tasks are functionally, and neurobiologically, distinct phenomena from the kind of memory expressed in conventional (explicit) memory tests. Evidence for this position comes from observed dissociations...... between memory scores obtained with the two kinds of tasks. However, there is continuing controversy about the meaning of these dissociations. In recent studies, Ostergaard (1998a, Memory Cognit. 26:40-60; 1998b, J. Int. Neuropsychol. Soc., in press) showed that simply degrading visual word stimuli can...... dramatically alter the degree to which word priming shows a dissociation from word recognition; i.e., effects of a number of factors on priming paralleled their effects on recognition memory tests when the words were degraded at test. In the present study, cerebral blood flow changes were measured while...

  5. Smashing WordPress Themes Making WordPress Beautiful

    CERN Document Server

    Hedengren, Thord Daniel

    2011-01-01

    The ultimate guide to WordPress Themes - one of the hottest topics on the web today WordPress is so much more than a blogging platform, and Smashing WordPress Themes teaches readers how to make it look any way they like - from a corporate site, to a photography gallery and moreWordPress is one of the hottest tools on the web today and is used by sites including The New York Times, Rolling Stone, flickr, CNN, NASA and of course Smashing MagazineBeautiful full colour throughout - web designers expect nothing lessSmashing Magazine will fully support this book by by promoting it through their webs

  6. Comparison of AI techniques for prediction of liver fibrosis in hepatitis patients.

    Science.gov (United States)

    Keltch, Brian; Lin, Yuan; Bayrak, Coskun

    2014-08-01

    Globally one in twelve people have the Hepatitis B or Hepatitis C virus. Diagnosis and treatment of this disease is guided by liver biopsies where a small amount of tissue is removed by a surgeon and examined by a pathologist to determine the fibrosis stage from F(0) (no damage) to F(4) (cirrhosis). Biopsies are costly and carry some risk for the patient. Non-invasive techniques for determining fibrosis stage have been developed and evaluated since 2003. Non-invasive methods have utilized serum markers, imaging test, and genetic studies. The accuracy of these non-invasive techniques has not achieved sufficient acceptance and so the invasive biopsy is still considered the gold standard.Clinical decision support systems (CDSS) use decision support system theory and technology to assist clinicians in the evaluation and treatment process. Using historical clinical data and the relationship processed by Artificial Intelligence (AI) techniques to aid physicians in their decision making process is the goal of CDSS. The CDSS provides a large number of medical support functions to help clinicians make the most reasonable diagnosis and choose the best treatment measures.This paper applies four artificial intelligence predictive techniques to publicly available data on 424 Hepatitis B and Hepatitis C patients. Demographic and standard serum markers are utilized to predict fibrosis stage and compare these predictions to known biopsy results. A final decision tree evaluation is applied to make a final prediction. We have also developed a publically available web application that can be used as a prototype for presenting AI predictive results in a CDSS environment based on these models. This technique along with others could mitigate the need for some liver biopsies in the more than 500 million Hepatitis B and C patients worldwide with additional validation and verification.

  7. BioWord: A sequence manipulation suite for Microsoft Word

    Directory of Open Access Journals (Sweden)

    Anzaldi Laura J

    2012-06-01

    Full Text Available Abstract Background The ability to manipulate, edit and process DNA and protein sequences has rapidly become a necessary skill for practicing biologists across a wide swath of disciplines. In spite of this, most everyday sequence manipulation tools are distributed across several programs and web servers, sometimes requiring installation and typically involving frequent switching between applications. To address this problem, here we have developed BioWord, a macro-enabled self-installing template for Microsoft Word documents that integrates an extensive suite of DNA and protein sequence manipulation tools. Results BioWord is distributed as a single macro-enabled template that self-installs with a single click. After installation, BioWord will open as a tab in the Office ribbon. Biologists can then easily manipulate DNA and protein sequences using a familiar interface and minimize the need to switch between applications. Beyond simple sequence manipulation, BioWord integrates functionality ranging from dyad search and consensus logos to motif discovery and pair-wise alignment. Written in Visual Basic for Applications (VBA as an open source, object-oriented project, BioWord allows users with varying programming experience to expand and customize the program to better meet their own needs. Conclusions BioWord integrates a powerful set of tools for biological sequence manipulation within a handy, user-friendly tab in a widely used word processing software package. The use of a simple scripting language and an object-oriented scheme facilitates customization by users and provides a very accessible educational platform for introducing students to basic bioinformatics algorithms.

  8. BioWord: A sequence manipulation suite for Microsoft Word

    Science.gov (United States)

    2012-01-01

    Background The ability to manipulate, edit and process DNA and protein sequences has rapidly become a necessary skill for practicing biologists across a wide swath of disciplines. In spite of this, most everyday sequence manipulation tools are distributed across several programs and web servers, sometimes requiring installation and typically involving frequent switching between applications. To address this problem, here we have developed BioWord, a macro-enabled self-installing template for Microsoft Word documents that integrates an extensive suite of DNA and protein sequence manipulation tools. Results BioWord is distributed as a single macro-enabled template that self-installs with a single click. After installation, BioWord will open as a tab in the Office ribbon. Biologists can then easily manipulate DNA and protein sequences using a familiar interface and minimize the need to switch between applications. Beyond simple sequence manipulation, BioWord integrates functionality ranging from dyad search and consensus logos to motif discovery and pair-wise alignment. Written in Visual Basic for Applications (VBA) as an open source, object-oriented project, BioWord allows users with varying programming experience to expand and customize the program to better meet their own needs. Conclusions BioWord integrates a powerful set of tools for biological sequence manipulation within a handy, user-friendly tab in a widely used word processing software package. The use of a simple scripting language and an object-oriented scheme facilitates customization by users and provides a very accessible educational platform for introducing students to basic bioinformatics algorithms. PMID:22676326

  9. BioWord: a sequence manipulation suite for Microsoft Word.

    Science.gov (United States)

    Anzaldi, Laura J; Muñoz-Fernández, Daniel; Erill, Ivan

    2012-06-07

    The ability to manipulate, edit and process DNA and protein sequences has rapidly become a necessary skill for practicing biologists across a wide swath of disciplines. In spite of this, most everyday sequence manipulation tools are distributed across several programs and web servers, sometimes requiring installation and typically involving frequent switching between applications. To address this problem, here we have developed BioWord, a macro-enabled self-installing template for Microsoft Word documents that integrates an extensive suite of DNA and protein sequence manipulation tools. BioWord is distributed as a single macro-enabled template that self-installs with a single click. After installation, BioWord will open as a tab in the Office ribbon. Biologists can then easily manipulate DNA and protein sequences using a familiar interface and minimize the need to switch between applications. Beyond simple sequence manipulation, BioWord integrates functionality ranging from dyad search and consensus logos to motif discovery and pair-wise alignment. Written in Visual Basic for Applications (VBA) as an open source, object-oriented project, BioWord allows users with varying programming experience to expand and customize the program to better meet their own needs. BioWord integrates a powerful set of tools for biological sequence manipulation within a handy, user-friendly tab in a widely used word processing software package. The use of a simple scripting language and an object-oriented scheme facilitates customization by users and provides a very accessible educational platform for introducing students to basic bioinformatics algorithms.

  10. Squeeze Casting Method Of AI-Si Alloy For Piston Material

    International Nuclear Information System (INIS)

    Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

    2001-01-01

    The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

  11. Activity of autoinducer two (AI-2) in bacteria isolated from surface ripened cheeses

    DEFF Research Database (Denmark)

    Gori, Klaus; Jespersen, Lene

    2007-01-01

    ). Corynebacterium casei, Microbacterium barkeri, Microbacterium gubbeenense and S. equorum subsp. linens (all isolated from the smear of surface ripened cheeses) using the AI-2 bioluminescence assay. This indicates that AI-2 signaling could take place between bacteria found in the smear of surface ripened cheeses....

  12. In Orbit Validation of the AAUSAT3 SDR based AIS receiver

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2013-01-01

    During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

  13. Teach yourself visually Word 2013

    CERN Document Server

    Marmel, Elaine

    2013-01-01

    Get up to speed on the newest version of Word with visual instruction Microsoft Word is the standard for word processing programs, and the newest version offers additional functionality you'll want to use. Get up to speed quickly and easily with the step-by-step instructions and full-color screen shots in this popular guide! You'll see how to perform dozens of tasks, including how to set up and format documents and text; work with diagrams, charts, and pictures; use Mail Merge; post documents online; and much more. Easy-to-follow, two-page lessons make learning a snap.Full-

  14. Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

    Institute of Scientific and Technical Information of China (English)

    李雪; 何芳; 卢金霞; 管翠萍; 周学章

    2017-01-01

    [Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2信号分子的活性;用荧光定量PCR法检测luxS基因的转录水平;用苦参碱

  15. Enabling technologies and methods for the retro-fitting of AI software into NPPS

    International Nuclear Information System (INIS)

    Pymm, P.

    1994-01-01

    Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

  16. Forehearing words: Pre-activation of word endings at word onset.

    Science.gov (United States)

    Roll, Mikael; Söderström, Pelle; Frid, Johan; Mannfolk, Peter; Horne, Merle

    2017-09-29

    Occurring at rates up to 6-7 syllables per second, speech perception and understanding involves rapid identification of speech sounds and pre-activation of morphemes and words. Using event-related potentials (ERPs) and functional magnetic resonance imaging (fMRI), we investigated the time-course and neural sources of pre-activation of word endings as participants heard the beginning of unfolding words. ERPs showed a pre-activation negativity (PrAN) for word beginnings (first two segmental phonemes) with few possible completions. PrAN increased gradually as the number of possible completions of word onsets decreased and the lexical frequency of the completions increased. The early brain potential effect for few possible word completions was associated with a blood-oxygen-level-dependent (BOLD) contrast increase in Broca's area (pars opercularis of the left inferior frontal gyrus) and angular gyrus of the left parietal lobe. We suggest early involvement of the left prefrontal cortex in inhibiting irrelevant left parietal activation during lexical selection. The results further our understanding of the importance of Broca's area in rapid online pre-activation of words. Copyright © 2017 The Author(s). Published by Elsevier B.V. All rights reserved.

  17. Social interaction facilitates word learning in preverbal infants: Word-object mapping and word segmentation.

    Science.gov (United States)

    Hakuno, Yoko; Omori, Takahide; Yamamoto, Jun-Ichi; Minagawa, Yasuyo

    2017-08-01

    In natural settings, infants learn spoken language with the aid of a caregiver who explicitly provides social signals. Although previous studies have demonstrated that young infants are sensitive to these signals that facilitate language development, the impact of real-life interactions on early word segmentation and word-object mapping remains elusive. We tested whether infants aged 5-6 months and 9-10 months could segment a word from continuous speech and acquire a word-object relation in an ecologically valid setting. In Experiment 1, infants were exposed to a live tutor, while in Experiment 2, another group of infants were exposed to a televised tutor. Results indicate that both younger and older infants were capable of segmenting a word and learning a word-object association only when the stimuli were derived from a live tutor in a natural manner, suggesting that real-life interaction enhances the learning of spoken words in preverbal infants. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. LuxS-independent formation of AI-2 from ribulose-5-phosphate

    Directory of Open Access Journals (Sweden)

    Hardie Kim R

    2008-06-01

    Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

  19. 1001 most useful French words

    CERN Document Server

    McCoy, Heather

    2012-01-01

    Up-to-date entries cover technology terms, and sections on vocabulary and grammar offer helpful tips. Each word is accompanied by a brief definition, a sentence demonstrating proper usage, and a translation.

  20. Wording effects in moral judgments

    Directory of Open Access Journals (Sweden)

    Ross E. O'Hara

    2010-12-01

    Full Text Available As the study of moral judgments grows, it becomes imperative to compare results across studies in order to create unified theories within the field. These efforts are potentially undermined, however, by variations in wording used by different researchers. The current study sought to determine whether, when, and how variations in wording influence moral judgments. Online participants responded to 15 different moral vignettes (e.g., the trolley problem using 1 of 4 adjectives: ``wrong'', ``inappropriate'', ``forbidden'', or ``blameworthy''. For half of the sample, these adjectives were preceded by the adverb ``morally''. Results indicated that people were more apt to judge an act as wrong or inappropriate than forbidden or blameworthy, and that disgusting acts were rated as more acceptable when ``morally'' was included. Although some wording differences emerged, effects sizes were small and suggest that studies of moral judgment with different wordings can legitimately be compared.