WorldWideScience

Sample records for wolsey cheryl pham

  1. The conversion of the cardinal? Pride and penitence in some Tudor histories of Thomas Wolsey

    Directory of Open Access Journals (Sweden)

    Patrick Hornbeck

    2016-05-01

    Full Text Available The life of Cardinal Thomas Wolsey, lord chancellor of England from 1515 to 1529, has inspired no small number of literary, historical, and dramatic retellings. A comprehensive study of these texts remains to be written, but this article seeks to make a start by examining how Tudor writers portrayed the cardinal’s response to his deposition and subsequent disgrace. For some authors, Wolsey’s fall only made him more proud, and he began to act erratically and disloyally, confirming the wisdom of the king’s decision to relieve him of office. For others, deposition moved Wolsey to become philosophical and penitent, and some such writers depict a cardinal who at the end of his life underwent nothing short of a conversion. This article traces both of these historiographical trajectories from their origins in writings of the late 1540s and 1550s through a range of late Tudor chronicle accounts. Elements of both narratives about the cardinal appear, prominently if not always congruously, in one of the best-known theatrical works about the events of the reign of Henry VIII, the play King Henry VIII (All Is True by William Shakespeare and John Fletcher. Understanding the interrelationships between the Tudor texts presented here is essential to grasping later portrayals of Wolsey and his contemporaries. Keywords: Thomas Wolsey; Henry VIII; English Reformation; conversion; historiography

  2. Cheryl's Birthday

    OpenAIRE

    van Ditmarsch, Hans; Hartley, Michael Ian; Kooi, Barteld; Welton, Jonathan; Yeo, Joseph B. W.

    2017-01-01

    We present four logic puzzles and after that their solutions. Joseph Yeo designed 'Cheryl's Birthday'. Mike Hartley came up with a novel solution for 'One Hundred Prisoners and a Light Bulb'. Jonathan Welton designed 'A Blind Guess' and 'Abby's Birthday'. Hans van Ditmarsch and Barteld Kooi authored the puzzlebook 'One Hundred Prisoners and a Light Bulb' that contains other knowledge puzzles, and that can also be found on the webpage http://personal.us.es/hvd/lightbulb.html dedicated to the b...

  3. Exon: CBRC-PHAM-01-0263 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0263 ATGGCTACCATCACCACCACCAGCACCACCACCATCACCACCACCACCACCACCACCTCTACCACCATCGCTACCACCACTACCATCACC...ACCACCACCACCATCGCTACCACCACCACCACCACCACTACCACCCCCACCACCACCACTACCACCACTACCACCACCACCACCATCACTACCACCACCACCACCA...TCACCACCTCTACCACCATCGCTACCATCACCACCACCACCACCACCACCCCCACCACCACCAATATCACCACTACCACCACTACCACCACCACCACCATCACCA...CCTCTACCACCATCGCTACCATCATGACCACCACCACCACCATCACCACCACCGTCACTACCACCACTACCACCACCACCACCA...TCACTACCACCACCACCACCATCACCTCTACCACCATTGCTACCATCACCACCACCACTAACATCACCACCACCACTACCATCACTACCACCACCTCTACCACCA

  4. PHAM THI NGOC LAN

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. PHAM THI NGOC LAN. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 6. Lead ions removal from aqueous solution using modified carbon nanotubes · NGUYEN DUC VU QUYEN TRAN NGOC TUYEN DINH QUANG KHIEU HO VAN MINH ...

  5. 77 FR 69929 - Western Carolina Railway Service Corporation, Steven C. Hawkins and Cheryl R. Hawkins-Continuance...

    Science.gov (United States)

    2012-11-21

    ... Railway Service Corporation, Steven C. Hawkins and Cheryl R. Hawkins--Continuance in Control Exemption--Aiken Railway Company, LLC Western Carolina Railway Service Corporation (WCRS) and Steven C. Hawkins and Cheryl R. Hawkins (the Hawkins) (collectively, Applicants) have filed a verified notice of exemption...

  6. NCBI nr-aa BLAST: CBRC-PHAM-01-1025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1025 ref|XP_001697359.1| magnesium chelatase subunit H [Chlamydomonas ...reinhardtii] gb|EDP00299.1| magnesium chelatase subunit H [Chlamydomonas reinhardtii] XP_001697359.1 7e-05 47% ...

  7. NCBI nr-aa BLAST: CBRC-PHAM-01-0643 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0643 ref|YP_026083.1| NADH dehydrogenase subunit 2 [Steinernema carpoc...apsae] gb|AAT00526.1| NADH dehydrogenase subunit 2 [Steinernema carpocapsae] YP_026083.1 5e-05 28% ...

  8. NCBI nr-aa BLAST: CBRC-PHAM-01-1493 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1493 ref|YP_002519420.1| NADH dehydrogenase subunit 2 [Bombus hypocrita... sapporoensis] gb|ABY75171.1| NADH dehydrogenase subunit 2 [Bombus hypocrita sapporoensis] YP_002519420.1 0.13 22% ...

  9. NCBI nr-aa BLAST: CBRC-PHAM-01-1593 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1593 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 86% ...

  10. NCBI nr-aa BLAST: CBRC-PHAM-01-0638 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0638 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi...rotein coupled receptor 154; AltName: Full=G-protein coupled receptor for asthma susceptibility; AltName: Fu

  11. NCBI nr-aa BLAST: CBRC-PHAM-01-1277 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1277 emb|CAI12641.1| caspase 7, apoptosis-related cysteine peptidase [...Homo sapiens] emb|CAI16007.1| caspase 7, apoptosis-related cysteine peptidase [Homo sapiens] CAI12641.1 2e-09 73% ...

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-1632 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1632 emb|CAI12641.1| caspase 7, apoptosis-related cysteine peptidase [...Homo sapiens] emb|CAI16007.1| caspase 7, apoptosis-related cysteine peptidase [Homo sapiens] CAI12641.1 3e-25 69% ...

  13. NCBI nr-aa BLAST: CBRC-PHAM-01-1321 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1321 ref|NP_001136139.1| feline leukemia virus subgroup A receptor [Su...s scrofa] gb|ACJ60911.1| feline leukemia virus subgroup A receptor [Sus scrofa] NP_001136139.1 0.0 92% ...

  14. NCBI nr-aa BLAST: CBRC-PHAM-01-1369 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1369 ref|NP_001158011.1| disrupted in schizophrenia 1 isoform c [Homo ...sapiens] gb|ACR40062.1| disrupted in schizophrenia 1 isoform 26 [Homo sapiens] NP_001158011.1 3e-09 70% ...

  15. NCBI nr-aa BLAST: CBRC-PHAM-01-0770 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0770 ref|YP_002938379.1| hypothetical protein EUBREC_2514 [Eubacterium rectale... ATCC 33656] gb|ACR76245.1| Hypothetical protein EUBREC_2514 [Eubacterium rectale ATCC 33656] YP_002938379.1 8e-26 40% ...

  16. NCBI nr-aa BLAST: CBRC-PHAM-01-1011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1011 ref|YP_002938379.1| hypothetical protein EUBREC_2514 [Eubacterium rectale... ATCC 33656] gb|ACR76245.1| Hypothetical protein EUBREC_2514 [Eubacterium rectale ATCC 33656] YP_002938379.1 6e-14 36% ...

  17. NCBI nr-aa BLAST: CBRC-PHAM-01-0930 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0930 ref|YP_264072.1| competence protein, ComEC [Psychrobacter arcticu...s 273-4] gb|AAZ18638.1| possible competence protein, ComEC [Psychrobacter arcticus 273-4] YP_264072.1 2.8 24% ...

  18. NCBI nr-aa BLAST: CBRC-PHAM-01-1757 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1757 ref|NP_001003095.1| bradykinin receptor B2 [Canis lupus familiari...s] gb|AAK21217.1|AF334948_1 B2 bradykinin receptor [Canis lupus familiaris] NP_001003095.1 0.0 80% ...

  19. NCBI nr-aa BLAST: CBRC-PHAM-01-0824 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0824 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-128 75% ...

  20. NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...

  1. NCBI nr-aa BLAST: CBRC-PHAM-01-0706 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0706 ref|YP_001504998.1| hypothetical protein Franean1_0633 [Frankia s...p. EAN1pec] gb|ABW10092.1| conserved hypothetical protein [Frankia sp. EAN1pec] YP_001504998.1 0.63 35% ...

  2. NCBI nr-aa BLAST: CBRC-PHAM-01-0369 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0369 ref|YP_003322102.1| hypothetical protein Tter_0358 [Thermobaculum terre...num ATCC BAA-798] gb|ACZ41280.1| hypothetical protein Tter_0358 [Thermobaculum terrenum ATCC BAA-798] YP_003322102.1 2e-49 38% ...

  3. NCBI nr-aa BLAST: CBRC-PHAM-01-1741 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1741 ref|YP_003322102.1| hypothetical protein Tter_0358 [Thermobaculum terre...num ATCC BAA-798] gb|ACZ41280.1| hypothetical protein Tter_0358 [Thermobaculum terrenum ATCC BAA-798] YP_003322102.1 1e-06 31% ...

  4. NCBI nr-aa BLAST: CBRC-PHAM-01-0476 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0476 ref|YP_003322102.1| hypothetical protein Tter_0358 [Thermobaculum terre...num ATCC BAA-798] gb|ACZ41280.1| hypothetical protein Tter_0358 [Thermobaculum terrenum ATCC BAA-798] YP_003322102.1 1e-25 38% ...

  5. NCBI nr-aa BLAST: CBRC-PHAM-01-0502 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0502 ref|YP_003322102.1| hypothetical protein Tter_0358 [Thermobaculum terre...num ATCC BAA-798] gb|ACZ41280.1| hypothetical protein Tter_0358 [Thermobaculum terrenum ATCC BAA-798] YP_003322102.1 1e-103 48% ...

  6. NCBI nr-aa BLAST: CBRC-PHAM-01-1069 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1069 ref|YP_003322102.1| hypothetical protein Tter_0358 [Thermobaculum terre...num ATCC BAA-798] gb|ACZ41280.1| hypothetical protein Tter_0358 [Thermobaculum terrenum ATCC BAA-798] YP_003322102.1 2e-57 48% ...

  7. NCBI nr-aa BLAST: CBRC-PHAM-01-1406 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1406 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 96% ...

  8. NCBI nr-aa BLAST: CBRC-PHAM-01-1625 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1625 ref|YP_001507126.1| hypothetical protein Franean1_2797 [Frankia s...p. EAN1pec] gb|ABW12220.1| hypothetical protein Franean1_2797 [Frankia sp. EAN1pec] YP_001507126.1 2e-04 34% ...

  9. NCBI nr-aa BLAST: CBRC-PHAM-01-0662 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0662 ref|NP_003473.3| myeloid/lymphoid or mixed-lineage leukemia 2 [Ho...mo sapiens] gb|EAW58035.1| myeloid/lymphoid or mixed-lineage leukemia 2, isoform CRA_b [Homo sapiens] NP_003473.3 0.0 94% ...

  10. NCBI nr-aa BLAST: CBRC-PHAM-01-0544 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0544 ref|ZP_01460426.1| hypothetical protein STIAU_8532 [Stigmatella a...urantiaca DW4/3-1] gb|EAU68813.1| hypothetical protein STIAU_8532 [Stigmatella aurantiaca DW4/3-1] ZP_01460426.1 0.36 26% ...

  11. NCBI nr-aa BLAST: CBRC-PHAM-01-0645 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0645 ref|YP_866086.1| putative outer membrane adhesin like proteiin [Magnet...ococcus sp. MC-1] gb|ABK44680.1| putative outer membrane adhesin like proteiin [Magnetococcus sp. MC-1] YP_866086.1 1e-23 39% ...

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-0810 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0810 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-160 80% ...

  13. NCBI nr-aa BLAST: CBRC-PHAM-01-0280 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0280 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-176 84% ...

  14. NCBI nr-aa BLAST: CBRC-PHAM-01-0106 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0106 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-142 80% ...

  15. NCBI nr-aa BLAST: CBRC-PHAM-01-0433 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0433 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-176 92% ...

  16. PhaM is the physiological activator of poly(3-hydroxybutyrate) (PHB) synthase (PhaC1) in Ralstonia eutropha.

    Science.gov (United States)

    Pfeiffer, Daniel; Jendrossek, Dieter

    2014-01-01

    Poly(3-hydroxybutyrate) (PHB) synthase (PhaC1) is the key enzyme of PHB synthesis in Ralstonia eutropha and other PHB-accumulating bacteria and catalyzes the polymerization of 3-hydroxybutyryl-CoA to PHB. Activity assays of R. eutropha PHB synthase are characterized by the presence of lag phases and by low specific activity. It is assumed that the lag phase is caused by the time necessary to convert the inactive PhaC1 monomer into the active dimeric form by an unknown priming process. The lag phase can be reduced by addition of nonionic detergents such as hecameg [6-O-(N-heptyl-carbamoyl)-methyl-α-D-glucopyranoside], which apparently accelerates the formation of PhaC1 dimers. We identified the PHB granule-associated protein (PGAP) PhaM as the natural primer (activator) of PHB synthase activity. PhaM was recently discovered as a novel type of PGAP with multiple functions in PHB metabolism. Addition of PhaM to PHB synthase assays resulted in immediate polymerization of 3HB coenzyme A with high specific activity and without a significant lag phase. The effect of PhaM on (i) PhaC1 activity, (ii) oligomerization of PhaC1, (iii) complex formation with PhaC1, and (iv) PHB granule formation in vitro and in vivo was shown by cross-linking experiments of purified proteins (PhaM, PhaC1) with glutardialdehyde, by size exclusion chromatography, and by fluorescence microscopic detection of de novo-synthesized PHB granules.

  17. PHB granules are attached to the nucleoid via PhaM in Ralstonia eutropha.

    Science.gov (United States)

    Wahl, Andreas; Schuth, Nora; Pfeiffer, Daniel; Nussberger, Stephan; Jendrossek, Dieter

    2012-11-16

    Poly(3-hydroxybutyrate) (PHB) granules are important storage compounds of carbon and energy in many prokaryotes which allow survival of the cells in the absence of suitable carbon sources. Formation and subcellular localization of PHB granules was previously assumed to occur randomly in the cytoplasm of PHB accumulating bacteria. However, contradictionary results on subcellular localization of PHB granules in Ralstonia eutropha were published, recently. Here, we provide evidence by transmission electron microscopy that PHB granules are localized in close contact to the nucleoid region in R. eutropha during growth on nutrient broth. Binding of PHB granules to the nucleoid is mediated by PhaM, a PHB granule associated protein with phasin-like properties that is also able to bind to DNA and to phasin PhaP5. Over-expression of PhaM resulted in formation of many small PHB granules that were always attached to the nucleoid region. In contrast, PHB granules of ∆phaM strains became very large and distribution of granules to daughter cells was impaired. Association of PHB granules to the nucleoid region was prevented by over-expression of PhaP5 and clusters of several PHB granules were mainly localized near the cell poles. Subcellular localization of PHB granules is controlled in R. eutropha and depends on the presence and concentrations of at least two PHB granule associated proteins, PhaM and PhaP5.

  18. Mida andis teile Tallinna ülikooli suvekoolis osalemine? / Ipios Nikos, Cheryl Johnson, Jevgenijs Kaktinš...[jt.

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastasid arst Ipios Nikos, luteri-anglikaani vaimulik, arheoloog Cheryl Johnson, ökonomist Jevgenijs Kaktinš, filosoofia magistrant Gabriele Avincola ja filosoofia üliõpilane Kaia Otstak

  19. NCBI nr-aa BLAST: CBRC-PHAM-01-0469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0469 ref|ZP_04755732.1| fucose permease-like protein [Francisella philomiragia subsp. philo...miragia ATCC 25015] ref|ZP_05249399.1| major facilitator superfamily transporter [Francisella philo...miragia subsp. philomiragia ATCC 25015] gb|ACA66108.1| major facilitator superfamily protein [Francisella philo...miragia subsp. philomiragia] gb|EET21124.1| major facilitator supe...rfamily transporter [Francisella philomiragia subsp. philomiragia ATCC 25015] ZP_04755732.1 0.099 25% ...

  20. NCBI nr-aa BLAST: CBRC-PHAM-01-1260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1260 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  1. Diligence in front-end processes is critical: an interview with Cheryl A. Harmon.

    Science.gov (United States)

    Harmon, Cheryl A

    2002-12-01

    Cheryl Harmon's position reflects her organization's emphasis on an expanded role for the CFO. Harmon was hired recently to serve as CFO of Provena Covenant Medical Center, (PCMC) in Urbana, Illinois. Her mission as CFO is to help develop strategies to ensure that Provena Covenant maintains its financial stability. Harmon appreciates Povena Covenant's creative approaches to challenges faced by many healthcare organizations, such as workforce shortages.

  2. NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1594 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  3. NCBI nr-aa BLAST: CBRC-PHAM-01-0909 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0909 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] sp|P...48146|NPBW2_HUMAN RecName: Full=Neuropeptides B/W receptor type 2; AltName: Full=G-protein coupled receptor ...8 emb|CAC17004.1| neuropeptides B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [H...omo sapiens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 0.0 94% ...

  4. NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1594 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  5. NCBI nr-aa BLAST: CBRC-PHAM-01-0677 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0677 ref|NP_055456.2| mediator of DNA-damage checkpoint 1 [Homo sapien...tor with BRCT domains 1 emb|CAI17440.1| mediator of DNA damage checkpoint 1 [Homo sapiens] emb|CAI18195.1| mediator... of DNA damage checkpoint 1 [Homo sapiens] gb|EAX03321.1| mediator of DNA ...damage checkpoint 1 [Homo sapiens] emb|CAQ06814.1| mediator of DNA damage checkpoint 1 [Homo sapiens] emb|CAQ06770.1| mediator... of DNA damage checkpoint 1 [Homo sapiens] emb|CAQ07572.1| mediator of DNA damage checkpoi

  6. NCBI nr-aa BLAST: CBRC-PHAM-01-0810 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0810 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 0.0 96% ...

  7. Identification of a multifunctional protein, PhaM, that determines number, surface to volume ratio, subcellular localization and distribution to daughter cells of poly(3-hydroxybutyrate), PHB, granules in Ralstonia eutropha H16.

    Science.gov (United States)

    Pfeiffer, Daniel; Wahl, Andreas; Jendrossek, Dieter

    2011-11-01

    A two-hybrid approach was applied to screen for proteins with the ability to interact with PHB synthase (PhaC1) of Ralstonia eutropha. The H16_A0141 gene (phaM) was identified in the majority of positive clones. PhaM (26.6 kDa) strongly interacted with PhaC1 and with phasin PhaP5 but not with PhaP1 or other PHB granule-associated proteins. A ΔphaM mutant accumulated only one or two large PHB granules instead of three to six medium-sized PHB granules of the wild type, and distribution of granules to daughter cells was disordered. All three phenotypes (number, size and distribution of PHB granules) were reversed by reintroduction of phaM. Purified PhaM revealed DNA-binding properties in gel mobility shift experiments. Expression of a fusion of the yellow fluorescent protein (eYfp) with PhaM resulted in formation of many small fluorescent granules that were bound to the nucleoid region. Remarkably, an eYfp-PhaP5 fusion localized at the cell poles in a PHB-negative background and overexpression of eYfp-PhaP5 in the wild type conferred binding of PHB granules to the cell poles. In conclusion, subcellular localization of PHB granules in R. eutropha depends on a concerted expression of at least three PHB granule-associated proteins, namely PhaM, PhaP5 and PHB synthase PhaC1. © 2011 Blackwell Publishing Ltd.

  8. The Pelagics Habitat Analysis Module (PHAM): Decision Support Tools for Pelagic Fisheries

    Science.gov (United States)

    Armstrong, E. M.; Harrison, D. P.; Kiefer, D.; O'Brien, F.; Hinton, M.; Kohin, S.; Snyder, S.

    2009-12-01

    PHAM is a project funded by NASA to integrate satellite imagery and circulation models into the management of commercial and threatened pelagic species. Specifically, the project merges data from fishery surveys, and fisheries catch and effort data with satellite imagery and circulation models to define the habitat of each species. This new information on habitat will then be used to inform population distribution and models of population dynamics that are used for management. During the first year of the project, we created two prototype modules. One module, which was developed for the Inter-American Tropical Tuna Commission, is designed to help improve information available to manage the tuna fisheries of the eastern Pacific Ocean. The other module, which was developed for the Coastal Pelagics Division of the Southwest Fishery Science Center, assists management of by-catch of mako, blue, and thresher sharks along the Californian coast. Both modules were built with the EASy marine geographic information system, which provides a 4 dimensional (latitude, longitude, depth, and time) home for integration of the data. The projects currently provide tools for automated downloading and geo-referencing of satellite imagery of sea surface temperature, height, and chlorophyll concentrations; output from JPL’s ECCO2 global circulation model and its ROM California current model; and gridded data from fisheries and fishery surveys. It also provides statistical tools for defining species habitat from these and other types of environmental data. These tools include unbalanced ANOVA, EOF analysis of satellite imagery, and multivariate search routines for fitting fishery data to transforms of the environmental data. Output from the projects consists of dynamic maps of the distribution of the species that are driven by the time series of satellite imagery and output from the circulation models. It also includes relationships between environmental variables and recruitment. During

  9. 77 FR 50460 - Rogue-Umpqua Resource Advisory Committee

    Science.gov (United States)

    2012-08-21

    ... building to view comments. FOR FURTHER INFORMATION CONTACT: Cheryl Caplan, Public Affairs Officer, Umpqua... to Umpqua National Forest ATTN: Cheryl Caplan, 2900 NW Stewart Parkway, Roseburg, OR 97471, or by...-case basis. Dated: August 14, 2012. Cheryl Caplan, Acting Umpqua Forest Supervisor. [FR Doc. 2012-20468...

  10. 76 FR 27645 - Formations of, Acquisitions by, and Mergers of Bank Holding Companies

    Science.gov (United States)

    2011-05-12

    ..., Inc., Wolsey, South Dakota; to acquire 100 percent of the voting shares of and merge with Kingsbury Bank Holding Company, and thereby indirectly acquire voting shares of Peoples State Bank, both in De Smet, South Dakota. Board of Governors of the Federal Reserve System, May 9, 2011. Robert deV. Frierson...

  11. Quantitative analysis of 123I-metaiodobenzylguanidine myocardial scintigraphy by myocardial uptake using a phantom

    International Nuclear Information System (INIS)

    Momose, Mitsuru; Kobayashi, Hideki; Kashikura, Kenichi; Kanaya, Shinichi; Maki, Masako; Hosoda, Saichi; Kusakabe, Kiyoko

    1994-01-01

    To evaluate the quantitative analysis of 123 I-metaiodobenzylguanidine (MIBG) myocardial scintigraphy, total injected dose measured by first pass (FP) method (T FP ) was compared with that measured by phantom method using an acrylic phantom in 45 patients with cardiac disease. Heart per mediastinum ratio (H/M) was compared to myocardial uptake calculated with T FP . The total injected dose measured using the phantom in which the syringe was set in depth of 3.5 cm (T pham ) was correlated with T FP (r=0.73, p=0.0001). When T pham was corrected by body weight (c-T pham ), c-T pham showed better correlation with T FP . MU calculated by T FP (MU-FP) was well correlated with MU by c-T pham (MU-pham) (r=0.94, p=0.001). These results indicate that phantom method is sufficient to substitute for FP method. Though H/M was correlated with MU-FP (p<0.001), the interpatient variation was relatively large. Then the analysis by H/M is insufficient to substitute for the myocardial uptake. It is thought to be enough to use the phantom method on daily routine work, since this method is accurate and easy to quantitate the myocardial uptake of MIBG taking a short time. (author)

  12. The conversion of the cardinal? Pride and penitence in some Tudor ...

    African Journals Online (AJOL)

    The life of Cardinal Thomas Wolsey, lord chancellor of England from 1515 to 1529, has inspired no small number of literary, historical, and dramatic retellings. A comprehensive study of these texts remains to be written, but this article seeks to make a start by examining how Tudor writers portrayed the cardinal's response to ...

  13. 76 FR 38604 - Rogue-Umpqua Resource Advisory Committee

    Science.gov (United States)

    2011-07-01

    ... INFORMATION CONTACT: Cheryl Caplan, Public Affairs Officer, Umpqua National Forest, 541-957-3270 or [email protected] comments must be sent to Umpqua National Forest ATTN: Cheryl Caplan, 2900 NW. Stewart Parkway, Roseburg, OR...

  14. 75 FR 78209 - Notice of Request for Revision of a Currently Approved Information Collection

    Science.gov (United States)

    2010-12-15

    ... wealth and job opportunities in Rural Areas and among individuals living in such areas through the... from Cheryl Thompson, Regulations and Paperwork Management Branch, Support Services Division at (202... information technology. Comments may be sent to Cheryl Thompson, Regulations and Paperwork Management Branch...

  15. Whiteness as Cursed Property: An Interdisciplinary Intervention with Joyce Carol Oates’s Bellefleur and Cheryl Harris’s “Whiteness as Property”

    Directory of Open Access Journals (Sweden)

    Karen Gaffney

    2015-02-01

    Full Text Available This article begins with the assertion that now more than ever, in the aftermath of Ferguson and in a time when many believe our society to be post-racial, we need to bring together scholars and activists who care about racial justice, regardless of discipline, and build interdisciplinary tools for fighting racism. Furthermore, we need to understand and reveal how whiteness has been socially constructed because the power of whiteness lies in its invisibility, and that fuels the perpetuation of systemic racism. In making whiteness visible, we can see how it has been wielded as a weapon, which in turn will allow us to see how destructive it is for everyone, whites included. As part of this work, we need to break down the disciplinary boundary between literary studies and critical race theory (a field within legal studies that examines systemic racism in the context of the law. One example of such an interdisciplinary intervention is to bring together Cheryl Harris, a critical race theorist, and Joyce Carol Oates, a novelist. Harris published one of the foundational pieces of critical race theory in 1993 with her law review article “Whiteness as Property,” a legal analysis of whiteness, and Oates produced a masterpiece of American literature in 1980 with her novel Bellefleur, a complex story of a powerful white family that spans seven generations. This pairing lays the groundwork for the type of interdisciplinary dialogue we need because, within literary studies, when the novelist is white and the characters are white, there is still very little emphasis on the study of whiteness even though race is a significant focus of attention when the novelist and characters are people of color. Whiteness is still invisible, and that is part of the problem I am describing, both within literary studies and in our society at large. We need an interdisciplinary intervention to pull back the curtain on whiteness, see how it operates, recognize its danger, and

  16. Rose's Life Lessons: Signed and Spoken

    Science.gov (United States)

    McAuliffe, Chris

    2008-01-01

    In this article, the author shares the experiences of his wife, Cheryl, and his 5-year-old daughter, Rose, when they visited their local high school's child development class. Cheryl and Rose met with over a 100 teenagers teenagers in eight different classes to talk about their family, raising a child with Down syndrome, and their experiences with…

  17. Improved Sorting-Based Procedure for Integer Programming

    DEFF Research Database (Denmark)

    Dantchev, Stefan

    2002-01-01

    Recently, Cornuéjols and Dawande have considered a special class of 0-1 programs that turns out to be hard for existing IP solvers. One of them is a sorting-based algorithm, based on an idea of Wolsey. In this paper, we show how to improve both the running time and the space requirements...... of this algorithm. The drastic reduction of space needed allows us to solve much larger instances than was possible before using this technique....

  18. Applying Strengths Model principles to build a rural community-based mental health support service and achieve recovery outcomes.

    Science.gov (United States)

    Dunstan, Debra; Anderson, Donnah

    2018-02-01

    The Personal Helpers and Mentors (PHaMs) service is a non-clinical, community-based Australian Government initiative aimed at increasing opportunities for recovery for people whose lives are severely affected by mental illness. Using a strengths-based recovery model, PHaMs caseworkers support and mentor people 'at risk of falling through the gaps' between state funded clinical treatment services and federally funded social services (such as supported housing, education and employment). While there is evidence that PHaMs realises its aim in metropolitan areas, little is known about how services are developed and function in low resource rural settings and what outcomes are achieved. These questions were addressed in a case study of a PHaMs service in a rural town in the state of New South Wales, Australia. Data were collected from two sources: local service documents prepared for staff orientation and operational purposes, and records and reports of service participants\\' performance and achievements. Participants\\' gains in wellbeing, recovery goals, and the target outcome areas of increased access to services, increased personal capacity and self-reliance, and increased community participation, were gathered from self-reports. The Role Functioning Scale was used as a measure of caseworker ratings of participants\\' adaptive functioning. The qualitative data were examined for semantic content and underlying themes. The quantitative analyses involved repeated measures and between-groups comparisons of uncontrolled pre-test–post-test and retrospective pre-test data. From commencement of the service in October 2009 to June 2014, an estimated 31% of the people living with severe mental illness in the local government area had accessed the PHaMs service (N=126; mean age 31.9 years; 42% male, 27% Aboriginal). The document analysis revealed that despite a lack of detail on how a PHaMs service should be developed or delivered, by focusing on the goal of client recovery

  19. Protecting the Homeland: The Importance of Counter-Illicit Trafficking to Prevent an Attack with Weapons of Mass Destruction

    Science.gov (United States)

    2013-03-01

    Congressional Research Service, U.S. International Borders: Brief Facts, Janice Cheryl Beaver , RS21729 (Washington, DC: Government Printing Office, November 9...and the opportunity to utilize the breadth of smuggling options for transportation. The commercial prevalence of radiological material and the...Janice Cheryl Beaver . RS21729. Washington, DC: Government Printing Office November 9, 2006. http://www.fas.org/sgp/crs/misc/RS21729.pdf (accessed

  20. Effect of Oyster Shell Calcium Powder on the Quality of Restructured Pork Ham.

    Science.gov (United States)

    Choi, Jung-Seok; Lee, Hyun-Jin; Jin, Sang-Keun; Lee, Hyun-Joo; Choi, Yang-Il

    2014-01-01

    This study was conducted to evaluate the effects of oyster shell calcium powder (OSCP) as a substitute for phosphates in curing agent, on the quality of restructured pork ham. Restructured pork ham was processed under six treatment conditions: T1 (no additives), T2 (0.3% sodium tripolyphosphate), T3 (1.5% NaCl+0.5% whey protein), T4 (1.5% NaCl+0.5% whey protein+0.15% OSCP), T5 (1.5% NaCl+0.5% whey protein+0.3% OSCP), and T6 (1.5% NaCl+0.5% whey protein+0.5% OSCP). Addition of OSCP significantly increased the ash content and pH of restructured pork ham (pham. Addition of OSCP had no effect on Hunter a and b surface color values of restructured pork ham, but did decrease the Hunter L surface color value (pham, compared with the addition of phosphates (pham.

  1. Pride and penitence in some Tudor histories of Thomas Wolsey

    African Journals Online (AJOL)

    2016-05-26

    May 26, 2016 ... Limitations of space have made it necessary to exclude many texts, including the poems of John Skelton; Polydore Vergil's Anglica historia; polemics by Robert. Barnes, Simon Fish, and William Tyndale; Samuel Rowley's play When You See Me,. You Know Me; the collection of poems Mirror for Magistrates ...

  2. Antithrombotic strategies in patients undergoing percutaneous coronary intervention for acute coronary syndrome

    Directory of Open Access Journals (Sweden)

    Son V Pham

    2010-09-01

    Full Text Available Son V Pham1, Phuong-Chi T Pham2, Phuong-Mai T Pham3, Jeffrey M Miller4, Phuong-Thu T Pham5, Phuong-Anh T Pham61Bay Pines VA Medical Center, Department of Cardiology, Bay Pines, FL, USA; 2Department of Medicine, Nephrology Division, UCLA-Olive View Medical Center, 3Department of Medicine, Greater Los Angeles VA Medical Center, 4Department of Medicine, Hematology-Oncology Division, UCLA-Olive View Medical Center, 5Department of Medicine, Nephrology Division, Kidney and Pancreas Transplant Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 6Mercy General Hospital, Heart and Vascular Institute, Department of Cardiology, Sacramento, CA, USAAbstract: In patients undergoing percutaneous coronary intervention (PCI for acute coronary syndrome (ACS, both periprocedural acute myocardial infarction and bleeding complications have been shown to be associated with early and late mortality. Current standard antithrombotic therapy after coronary stent implantation consists of lifelong aspirin and clopidogrel for a variable period depending in part on the stent type. Despite its well-established efficacy in reducing cardiac-related death, myocardial infarction, and stroke, dual antiplatelet therapy with aspirin and clopidogrel is not without shortcomings. While clopidogrel may be of little beneficial effect if administered immediately prior to PCI and may even increase major bleeding risk if coronary artery bypass grafting is anticipated, early discontinuation of the drug may result in insufficient antiplatelet coverage with thrombotic complications. Optimal and rapid inhibition of platelet activity to suppress ischemic and thrombotic events while minimizing bleeding complications is an important therapeutic goal in the management of patients undergoing percutaneous coronary intervention. In this article we present an overview of the literature on clinical trials evaluating the different aspects of antithrombotic therapy in patients

  3. Effect of Particular Breed on the Chemical Composition, Texture, Color, and Sensorial Characteristics of Dry-cured Ham.

    Science.gov (United States)

    Seong, Pil Nam; Park, Kuyng Mi; Kang, Sun Moon; Kang, Geun Ho; Cho, Soo Hyun; Park, Beom Young; Van Ba, Hoa

    2014-08-01

    The present study demonstrates the impact of specific breed on the characteristics of dry-cured ham. Eighty thighs from Korean native pig (KNP), crossbreed (Landrace×Yorkshire)♀×Duroc♂ (LYD), Berkshire (Ber), and Duroc (Du) pig breeds (n = 10 for each breed) were used for processing of dry-cured ham. The thighs were salted with 6% NaCl (w/w) and 100 ppm NaNO2, and total processing time was 413 days. The effects of breed on the physicochemical composition, texture, color and sensory characteristics were assessed on the biceps femoris muscle of the hams. The results revealed that the highest weight loss was found in the dry-cured ham of LYD breed and the lowest weight loss was found in Ber dry-cured ham. The KNP dry-cured ham contain higher intramuscular fat level than other breed hams (pham made from KNP breed had the lowest water activity value and highest salt content, while the LYD dry-cure ham had higher total volatile basic nitrogen content than the Ber and Du hams (pham while polyunsaturated fatty acids levels were higher in Du ham when compared to other breed hams (pham possessed higher Commission International de l'Eclairage (CIE) a* value, while the Du dry-cured ham had higher L*, CIE b* and hue angle values (phams with higher scores for color, aroma and taste found in KNP dry-cured ham as compared to other breed hams (pcolor and sensorial properties of dry-cured hams. These data could be useful for meat processors to select the suitable breeds for economical manufacturing of high quality dry-cured hams.

  4. Adverse effects of T-2 toxin on chicken lymphocytes blastogenesis and its protection with Vitamin E.

    Science.gov (United States)

    Jaradat, Ziad W; Viià, Borja; Marquardt, Ronal R

    2006-08-15

    T-2 toxin, a trichothecene mycotoxin that is produced by fusarium species, is prevalent mainly in cereal crops and poultry feed. One of the major effects of this toxin is immunomodulation. The effect of T-2 toxin on chicken lymphocyte proliferation in the presence of mitogens and the subsequent protection with Vitamin E in both fat and water soluble forms was studied using an MTT colorimetric assay. T-2 toxin was administered in concentrations ranging from 0 to 10ng/mL of lymphocytes in the presence of either concanavalin A (ConA) or phytohemagglutinine (PHA-M) at optimum concentration of 333ng/mL and a dilution of 1:160 for ConA and PHA-M, respectively. Lymphocyte proliferation in response to ConA and PHA-M mitogens was depressed at T-2 doses of 1ng/mL or higher (pprotection effect against the toxin when it was added at either 25 or 100microg. However, when the water soluble form (Trolox) was added at a concentration of (200microg) (equivalent to 100microM of alpha-tocopherol), it provided considerable protection (pprotection.

  5. Effect of Dietary Processed Sulfur Supplementation on Texture Quality, Color and Mineral Status of Dry-cured Ham.

    Science.gov (United States)

    Kim, Ji-Han; Ju, Min-Gu; Yeon, Su-Jung; Hong, Go-Eun; Park, WooJoon; Lee, Chi-Ho

    2015-01-01

    This study was performed to investigate the chemical composition, mineral status, oxidative stability, and texture attributes of dry-cured ham from pigs fed processed sulfur (S, 1 g/kg feed), and from those fed a basal diet (CON), during the period from weaning to slaughter (174 d). Total collagen content and soluble collagen of the S group was significantly higher than that of the control group (pham (pham from the control group, that from the S group exhibited lower springiness and gumminess; these results suggest that feeding processed sulfur to pigs can improve the quality of the texture and enhance the oxidative stability of dry-cured ham.

  6. Welcome aboard (but don't change a thing).

    Science.gov (United States)

    McNulty, Eric

    2002-10-01

    Cheryl Hailstrom, the CEO of Lakeland Wonders, a manufacturer of high-quality wooden toys, is the first person outside the Swensen family to hold the top job. But she's not a stranger to this 94-year-old company: She'd been the COO of one of its largest customers and had worked with Lakeland to develop many best-selling products. Wally Swensen IV, the previous CEO, chose Cheryl because she knew how to generate profits and because he believed her energy and enthusiasm could take the company to the next level. Yet here she is, nearing her six-month anniversary, wondering why her expansive vision for the company isn't taking hold. She's tried to lead by example: traveling a pounding schedule to visit customers, setting aggressive project deadlines, and proposing a bonus schedule. She has a plan to reach the board's growth goals--going beyond Lakeland's core upscale market and launching into the midmarket with an exclusive toy contract with a new customer. The problem is that while Cheryl's senior managers are giving her the nod on the surface, they're all really dragging their feet. Some fear that offshore outsourcing will hurt their brand, not to mention make for tricky union negotiations. Others are balking at trying a new design firm. Is Cheryl pushing too much change too quickly? Should she bring in outsiders to speedily adopt the changes she envisions and overhaul Lakeland's corporate culture? Or should she keep trying to work with the current team? Commentators Kathleen Calcidise of Apple Retail Stores; executive coach Debra Benton; Dan Cohen, coauthor of The Heart of Change; and consultant Nina Aversano offer advice in this fictional case study.

  7. forecasting in one-dimensional and generalized integrated

    African Journals Online (AJOL)

    GLOBAL JOURNAL OF MATHEMATICAL SCIENCES VOL. ... models and their application can be found in Subba Rao (1981), Pham and Tran (1981), Gabr and Subba ... J. F. Ojo, Department of Statistics, University of Ibadan, Ibadan, Nigeria.

  8. A New Edition of an Old Favorite

    Directory of Open Access Journals (Sweden)

    S. Krishna Sundari

    2012-02-01

    Full Text Available Review of: Molecular Biotechnology—Principles and Applications of Recombinant DNA , 4th ed.; Bernard R. Glick, Jack J. Pasternak, Cheryl L. Patten; (2010 . ASM Press, Washington, DC. 1000 pages.

  9. An Exceptional Case of Spontaneous Fistulization of an Intrahepatic ...

    African Journals Online (AJOL)

    ADMIN

    Whenever they occur, usually, areassociated with diseases of extrahepatic biliary tree12-14. Spontaneousfistulization .... John G; Thai, Pham H. chapter 32. ... presented as an exophytic mass in the liver. PedSurgInternat 1998; 13:177-179. 10.

  10. A Coupled System of Integrodifferential Equations Arising in Liquidity Risk Model

    International Nuclear Information System (INIS)

    Pham, Huyen; Tankov, Peter

    2009-01-01

    We study the mathematical aspects of the portfolio/consumption choice problem in a market model with liquidity risk introduced in (Pham and Tankov, Math. Finance, 2006, to appear). In this model, the investor can trade and observe stock prices only at exogenous Poisson arrival times. He may also consume continuously from his cash holdings, and his goal is to maximize his expected utility from consumption. This is a mixed discrete/continuous time stochastic control problem, nonstandard in the literature. We show how the dynamic programming principle leads to a coupled system of Integro-Differential Equations (IDE), and we prove an analytic characterization of this control problem by adapting the concept of viscosity solutions. This coupled system of IDE may be numerically solved by a decoupling algorithm, and this is the topic of a companion paper (Pham and Tankov, Math. Finance, 2006, to appear)

  11. The moderating role of personal relevance on differential priming of anxiety and sadness on perceived travel risk: a replication.

    Science.gov (United States)

    Chiou, Wen-Bin; Chang, Ming-Hsu; Chen, Chien-Lung

    2009-04-01

    Raghunathan and Pham conducted a pioneer study in 1999 on the motivational influences of anxiety and sadness on decision making and indicated that anxiety would motivate individuals to be risk averse, whereas sadness would motivate individuals to be risk taking. A replication study was employed in the domain of perceived travel risk. Compared to participants in a neutral mood, anxious participants showed higher perceived travel risk than sad participants. Moreover, the differential effect of anxiety and sadness on perceived travel risk was only pronounced under the high personal relevance condition, in which participants made personal decisions and expected that they would be affected by the outcomes. In general, the results extend the notion proposed by Raghunathan and Pham suggesting that travelers' implicit goals primed by anxiety or sadness used for mood-repair purposes appear to be moderated by personal relevance.

  12. 77 FR 48983 - Change in Bank Control Notices; Acquisitions of Shares of a Bank or Bank Holding Company

    Science.gov (United States)

    2012-08-15

    ... Living Trust, Yvenna E. Pour Revocable Living Trust, Cheryl S. Beaver, all of Troy, Ohio; Valeria A..., Troy, Ohio; and The James A. Gorrell Family Control Group which consist of James A. Gorrell, Tiffin...

  13. HIV/AIDS misconceptions may be associated with condom use ...

    African Journals Online (AJOL)

    HIV/AIDS misconceptions may be associated with condom use among black South Africans: an exploratory analysis. Laura M Bogart, Donald Skinner, Lance S Weinhardt, Laura Glasman, Cheryl Sitzler, Yoesrie Toefy, Seth C Kalichman ...

  14. When Art, Science, and Culture Commingle.

    Directory of Open Access Journals (Sweden)

    Cheryl A. Kerfeld

    2009-05-01

    Full Text Available Cheryl Kerfeld reviews Tactical Biopolitics, a collection of essays that reveals the constructive exchanges and “tribal skirmishes” that inevitably arise when departmentalized minds explore the boundaries of science, art, and politics.

  15. 75 FR 1446 - Rate of Payment for Medical Records Received Through Health Information Technology (IT) Necessary...

    Science.gov (United States)

    2010-01-11

    ... Received Through Health Information Technology (IT) Necessary To Make Disability Determinations AGENCY... Federal Register. FOR FURTHER INFORMATION CONTACT: Cheryl Elksnis, Office of Disability Programs, Social Security Administration, 6401 Security Boulevard, Baltimore, MD 21235-6401, 410-966-0497, for information...

  16. Gene : CBRC-PHAM-01-1469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available PSPVYPFPRISLSSYVPSPIYTFPCVSQPLYIPSPVYPVSRISLPLYIPSPVYSFPCISLPLDILSPVYPIPCLSLLLCITSPVYPFPCISCPPYIPFPIYPFPCISH...PPYIPSPVYPIPCISRPPCIPSLVYPFPCISLPLDILSPIYPIPCLSLPLCITSSVYPFPRISHPPYIPSPVYHSPCISHP...LYIPSSVYPFPCLSLPQSILSPVYPIPHISLPPYIPPPVYPVPCISHPLCIPSPVYPFPCLSLPLYIISRVYPVPRISHPLYILSPVYPFPCLSLPLYTPSPVYPIPC

  17. Gene : CBRC-PHAM-01-1650 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available tinin [Chlamydomonas reinhardtii] 1e-68 36% MFFFPTLSPPPSSPLTLIPSPSQSLLPSPSVPTPSSLHPHLHPSPLTPSSSRLSPPHLICPHPIFIPSILTPSSSHLSPAHPHP...MCPHSHHPHPHPSPLTPSSPHPSPAHPHPMCPHSPHPHPHPSPLTPPSPHPSPAHPHPMCPHSPHPHPMCPHSPHPHPHLSPLTPSSP...PSIPTPSSPPSVLTHPILTPIHPHSPHPHPHPSPLTPSSPHPSPLTPSSPPSVPTHPILTPSVPTHPILTPSVPTPSSPHV...SPLTPSSSPSVPTHPTLTPIHPHSILTPICPHSPHPHPHPSPLTPSSSPSVSTHPILTPIHPHSIFTPICPHSPHPHPHPSPLTPSSPPSVPTHPILTPSIPTHPILTPIRPHSPHPHPIRPHSPHPHP...IRPHPILTPCVPTHPILIPICLHSPHPHPHPSPLHLHPHLSSLTPSSPPSIPTHPILPSSSPPHPCHSSWEAGCTCVEPEPPHPCPSLPSPLAEREGTAWDWLPPVAMTVARIRAVSSPCRKHVMNYGCPIFSERPDL ...

  18. Gene : CBRC-PHAM-01-0874 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 84 49% MLLPSDNRTLPVNTCCRGWVLGSCLFAQASQRKRRVLHRNIAQQATVQSQPVGRRQPCPSEPCPSEPCPSEHSPSEPCPSEHSPSEPSPSEHSPSEHSPSEPCPSEPCPSEHSPSEPSPSEP...SPSEHSPSEHSPSQHSPSEPCPSEHSPSEPCPSEHSPSEHSPSEPCPSEPCPSEPSPSEPSPSEPCPSEHSPSEHSPSEP...CPSEHSPSEHSPSEPCPSEPSPSEHSPLEPCPSEPSPSEPCPSEPCPSEHSPSEPSPSEPSPSEHSPSEHSPSQHSPSEPCPSEPSPSEPSPSEP...SPSEHSPSEHSPSEHSPSEHSPSEPSPSEHSPSEHSWGGLLRDLPSFPPTQQPAAGTFLGVLVGGVRASCAHRGNGTEADSSERTGLVPFGGLWLDHLIVLRHSLSV ...

  19. Gene : CBRC-PHAM-01-1144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4 [Homo sapiens] 1e-39 43% MYANRRLEMKMTTYCPNSRPCTDANASSPSPLSLPPSSLSPTSLSSPSLPLSPSSPPPSSPSSSSLSPSSPSLPLSPSSSPPPSPSS...SSSSLSPHHHHYHHHIITIITTFTIVTIIIIIIITIITVTTTITIITITAIITIITTTSITITIIIVTTITITAIITIIIVTNITITAIITIIITTFITIIIITVVITSSPSLSSPSS...PLSPPSPLSLSSSSSSSLSPPPSLSSPSLPLSPSSLSPTSLSSPSLPLSPSSSPPPSLSSLSPTSLSLPLSPSSPPPPSPSS...SSLSLSPHHHHYHHHYHHLHIITVIIIITITVVTVTIAIIIVTNITITAIITIITTSITIIIIIVIITSSPSLSPPLSSPLSPPSPSSPSSSLSLSLSPSPSS...LSPPSLSPSLPPLSPSSSSLSLSLSPHHYHYHHHHYHHLHHHHCHHHHYYCHYHHHHYHCHHLHHYHHCHQHHYHCHYHHHHHLHHHHDHHYHCLY

  20. Gene : CBRC-PHAM-01-0465 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available AHTGTQTCTCTDMRICTHRGTLTGTCTCTQRHTHRHTHMHTQRHTQRHTHRYMHMHTEAHTQAHTHAHTEAHTEAHTQVHAHTRTHTCTHTSTCTGMCRCTHTGTHTG...TCTHTCTHRHTQVHAHTQAHRGTHRYTPKHTHMHTQRHMHMHTHKYMHRHTHMHMHRHTQAHTCAHTEAHRHTHAHTEAHTST...CTGTHAGTHTGTYTSTHTCTRTCTHRSTHTGTQAHAQAHTEAHAQAHTEAHTQAHTSTCTCTHTGTHTSTNRYTHMHTHRHTQRHIHRYTHRHMHMCMHRHRHTEAHTGAHTGTHTFIHRGTHAGTCTQRHTSIRSHTCFTLLKLVFGAIPIYKDEKGV ...

  1. Gene : CBRC-PHAM-01-0832 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available m berghei] 8e-35 53% MTFSVPTGNTQIHSQAYAHPHTSTHRGPHTFTHRGPHTSTHRSTHIHTQRSTHIHTQVHTHLHTEVHTHPHTEVHTHPHTQVHTHPHTGPHTSTHRGPHTST...HRPTHIHTQVHTHPHTEIHTHPHTGPYTSTHTGPHTSTHRSTHIHTHGFIHIHTHVHTHPHTEVHTHVHTHPHTGPHTSTHTGPHTSTHRSTHIXXXXXXXXXXXXXXXXX ...

  2. Gene : CBRC-PHAM-01-1483 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available hloroflexus aggregans DSM 9485] 4e-59 35% MHSGAPATHTHSCTSSCSSRCTHFHSHTPPPTHPSTTTHHPHTPPPPQTPPPTHTSTHTSLHPHTPPPPQTPPPTHTST...HTSLHPHTPPPPHTSTTTHTSTHTHLPPTHTSTTTHLPPTHTSTTTHPSTHTPPTHPSXXXXXXXXXX...XXXXXXXTTTHLHYHTHLHPHTPPPPHNLHPHTPPPPHTPPPTHTSTHTHLHPPTPPPPHTSTHTHLHHHTPPLPHTPPPTHTSTTTHLHPHTPPPPHTPPPTHHPHTPPPPQTPPPPHTSTTTHTST...HTPPPPHTSTTTHTSTHTPPPPHTSTTTHTSNHTSNHTHTSTTTHTSTTTHLHPHTSTHTHLHHHTPPPPHTSTHTHLHPHTPPPPHTSTTTHLHPHTPPPPHTPPPTHTSNHTHLHPCTHLHWHTLRHLHAPPTCIHPPPAFAPHPLYASSSTRKCES ...

  3. Gene : CBRC-PHAM-01-0869 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ICTED: hypothetical protein, partial [Homo sapiens] 9e-73 57% MHPSIHASIHPFIHSSMHPSIHSSIHLSTIPSMHPSMNPCVHPSMH...PSIHASIHPFVHPSMHPFIHACIHPFIHPSVYHSIHAPIHESMHPSIHASIQPFIHPSVYHSIHAPIHESTHPSIHPFIHPFIHSSMRPSIHSSIHLSTIPSMHPSMN...PCTHPSVHPSIHSSIHLFVHPSMHPSIHSSIHPFIHPSVYHSIHAPIHESMHPSIHAPIHESMHPSIHASIHPCIHPSVYHSIHAPI...HESMHPSIHASIQPFIHPSVYHSIHAPIHESMHPSIHAPIHESMHPSIHASIHPSIYPSLLGLSRQDPTETPLSRVDKEKLTSPRGFPKRYGRSANTSVMQSMLSELTQSTLSERPCSQRHTVSPEWGVRGRVP ...

  4. Cross-Cultural Issues in Parent Involvement.

    Science.gov (United States)

    Tran, Bach-Tuyet Pham; And Others

    Four papers address cultural issues related to the involvement of limited-English-proficient parents in public schools in the United States. "Cultural Issues in Indochinese Parent Involvement" (Bach-Tuyet (Pham) Tran) outlines the linguistic, social, and practical barriers to Indochinese immigrant parent involvement and makes suggestions for…

  5. SSC San Diego Command History Calendar Year 2007

    Science.gov (United States)

    2008-03-01

    Camargo , Sylvia Salazar, Karen Manley-Guerrero, Dina Demuth, Clay Oeholke, Gannon Graue, Dee Johnson, Erwin Mier, Hoa Nguyen. Navy Multiband Terminal...Davenport, Brian Devine, Greg Doriguzzi, Richard Felkins, John Fleming, Cheryl Francisco , Sid Graser, Eric Hillis, Craig LaMaster, Susan Manor, Joel

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 451 - 500 of 644 ... C Chimphambano, I O Komolafe, A S Muula .... Desirée Witte, Mari Kirsten, Cheryl Louw, Bagrey Ngwira, John C. Victor, Paul H. Gillard, ... Jennifer J. Hull, Nigel Cunliffe, Khuzwayo C. Jere, Sung-Sil Moon, Yuhuan Wang, ...

  7. 78 FR 68079 - Information Collection Activities: Oil and Gas Well-Completion Operations; Submitted for Office...

    Science.gov (United States)

    2013-11-13

    ... view all related materials. We will post all comments. Email [email protected] : cheryl... personnel, property, and natural resources; (d) well- completion operations are conducted on well casings... hours. The following chart details the individual components and estimated hour burdens. In calculating...

  8. Landslide Prediction Capability by Comparison of Frequency Ratio ...

    Indian Academy of Sciences (India)

    8

    3.2.2.1.4 Curvature: The surface curvature at a point is the curvature of a line formed .... (Pham et al, 2017) or by saturating the lower part of the material in a .... In order to fuzzy analysis, at first, the weights of frequency ratio was standardized.

  9. Volatile constituents of the essential oils of two Polygonum species from Vietnam

    NARCIS (Netherlands)

    Dung, N.X.; Van, le H.; Moi, La Dinh; Cu, Lu'u Dam; Leclercq, P.A.

    1994-01-01

    Polygonum species grown in many places in Vietnam, esp. on the rice-field. It is used in the traditional medicine. After Pham Hoang Ho until now in Vietnam, 40 Polygonum species have been found. From the polygonum genus (Family Polygonaceae) the essential oils of 2 species are reported: Polygonum

  10. 78 FR 48773 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2013-08-09

    ... NICHOLAS TAN KIMBERLY-ANN........ ANNE TAN SIAN WEE TAN SUNNY TANENBAUM CHERYL MARLA TAPANILA CAROL LEE... NICHOLAS ADAMS GEORGE HOLADAY AGARWAL ASEEM AKITT SHERLYNN RAE AL ABDULLA MISHAL HASSAN ALBERTI PIETRO AL... BUHRER EMANUEL DAVID BURCKHARDT FELICIA JOYCE BURCKHARDT MARTIN NICHOLAS BURGER NADINE EUNHAE BURNS...

  11. 75 FR 20085 - Subpart B-Advanced Biofuel Payment Program

    Science.gov (United States)

    2010-04-16

    ... years (FY) and to obtain information to help determine payment rates. Before being accepted into the... information collection may be obtained from Cheryl Thompson, Regulations and Paperwork Management Branch... made to producers of advanced biofuel and biogas, which is fuel derived from renewable biomass, other...

  12. 78 FR 41853 - Safety Advisory Guidance: Heating Rail Tank Cars To Prepare Hazardous Material for Unloading or...

    Science.gov (United States)

    2013-07-12

    ... rail tank car due to chemical self-reaction and expansion of the toluene diisocyanate matter wastes. On...: Cheryl West Freeman, Division of Engineering and Research, Pipeline and Hazardous Materials Safety... catastrophically ruptured at a transfer station at the BASF Corporation chemical facility in Freeport, Texas. The...

  13. 78 FR 46499 - Change in Terminology: “Mental Retardation” to “Intellectual Disability”

    Science.gov (United States)

    2013-08-01

    ... Change in Terminology: ``Mental Retardation'' to ``Intellectual Disability'' AGENCY: Social Security... INFORMATION CONTACT: Cheryl Williams, Office of Medical Listings Improvement, Social Security Administration... terminology.\\3\\ \\2\\ Public Law 111-256. \\3\\ See 77 FR 29002 and 77 FR 6022-01. Public Comments In the NPRM, we...

  14. African Journal of AIDS Research - Vol 10, No 2 (2011)

    African Journals Online (AJOL)

    HIV/AIDS misconceptions may be associated with condom use among black South Africans: an exploratory analysis · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Laura M Bogart, Donald Skinner, Lance S Weinhardt, Laura Glasman, Cheryl Sitzler, Yoesrie Toefy, Seth C ...

  15. South African Medical Journal - Vol 83, No 10 (1993)

    African Journals Online (AJOL)

    Do high fetal catecholamine levels affect heart rate variability and tneconiutn passage during labour? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. G.J. Hofmeyr, J. Esser, V. Cheryl Ukodem, Marie Lawson, T. Kramer, A. M. Gulmezoglu, 739-742 ...

  16. 76 FR 36000 - Rulemaking Petition: Independent Expenditure Reporting

    Science.gov (United States)

    2011-06-21

    ... sent to the Federal Election Commission, Attn.: Robert M. Knop, Assistant General Counsel, 999 E [[Page... CONTACT: Mr. Robert M. Knop, Assistant General Counsel, or Ms. Cheryl A. F. Hemsley, Attorney, 999 E... FEDERAL ELECTION COMMISSION 11 CFR Part 109 [Notice 2011-09] Rulemaking Petition: Independent...

  17. Modelling stable atmospheric boundary layers over snow

    NARCIS (Netherlands)

    Sterk, H.A.M.

    2015-01-01

    Thesis entitled:

    Modelling Stable Atmospheric Boundary Layers over Snow

    <p>H.A.M. Sterk

    Wageningen, 29th of April, 2015

    Summary

    The emphasis of this thesis is on the understanding and forecasting of the Stable Boundary Layer (SBL) over snow-covered surfaces. SBLs

  18. Optimal investment models with stochastic volatility: the time ...

    African Journals Online (AJOL)

    Therefore, a transform is primordial to express the value function in terms of a semilinear PDE with quadratic growth on the derivative term. Some proofs for the existence of smooth solution to this equation have been provided for this equation by Pham [11]. In that paper they illustrated some common stochastic volatility ...

  19. 75 FR 29548 - Privacy Act of 1974; Notice of New System of Records

    Science.gov (United States)

    2010-05-26

    .... Cheryl M. Paige, Director, Office of Information Management. SYSTEM NAME: GSA/PBS- 8 (Electronic Document... establish and maintain an electronic system to serve as a repository for GSA's PBS documents to reduce paper... documents where and when they are needed. The system contains information related to unsolicited resumes...

  20. Steps to the Future. Dental Hygiene Education and Practice Workshop II Proceedings (Louisville, Kentucky, April 25-27, 1985).

    Science.gov (United States)

    American Dental Hygienists' Association, Chicago, IL.

    The proceedings of the second in a series of workshops on dental hygiene education and practice are presented. The opening remarks are by Cheryl Westphal. Papers categorized as "Considerations for the Professionalization of Dental Hygiene" are as follows: "Socio-Economic Viewpoint" (Gary Gaumer); "Political Science Viewpoint" (Lelia Helms);…

  1. 76 FR 58277 - Performance Review Board Members

    Science.gov (United States)

    2011-09-20

    .... Cantrell, Patrick H. Conway, Kathleen M. Crosby, John Czajkowski, Cheryl R. Dammons, Michelle S. Davis..., William B. Schultz, Neil Shapiro, Jeremy B. Sharp, George H. Sheldon, Steven D. Silverman, Rebecca T... E. Tyler Jr., Stephen J. Veneruso, Karen V. Walker Bryce, Luis A. Wilmot, Holly J. Wong, Robert K...

  2. 78 FR 23903 - Proposed Information Collection; Comment Request; Quarterly Summary of State and Local Government...

    Science.gov (United States)

    2013-04-23

    ... Cheryl Lee, Chief, State Finance and Tax Statistics Branch, Governments Division, U.S. Census Bureau... economic research and comparative studies of governmental finances. Tax collection data are used to measure...) ways to enhance the quality, utility, and clarity of the information to be collected; and (d) ways to...

  3. 77 FR 3773 - Ocean Transportation Intermediary License; Applicants

    Science.gov (United States)

    2012-01-25

    .... Hartwig Gdynia dba C. Hartwig Transport (NVO), 7, Derdowskiego Street, 81-369 Gdynia, Poland. Officers...: New OFF License. Cheryl G. Wilson dba JC Logistics (NVO & OFF), 28612 Redondo Beach Drive South, Des...: Add NVO Service. CR & J Logistics, Inc. dba Brightwater Shipping Services (NVO & OFF), 8401 Lake Worth...

  4. Adverse effects of T-2 toxin on chicken lymphocytes blastogenesis and its protection with Vitamin E

    International Nuclear Information System (INIS)

    Jaradat, Ziad W.; ViIa, Borja; Marquardt, Ronal R.

    2006-01-01

    T-2 toxin, a trichothecene mycotoxin that is produced by fusarium species, is prevalent mainly in cereal crops and poultry feed. One of the major effects of this toxin is immunomodulation. The effect of T-2 toxin on chicken lymphocyte proliferation in the presence of mitogens and the subsequent protection with Vitamin E in both fat and water soluble forms was studied using an MTT colorimetric assay. T-2 toxin was administered in concentrations ranging from 0 to 10 ng/mL of lymphocytes in the presence of either concanavalin A (ConA) or phytohemagglutinine (PHA-M) at optimum concentration of 333 ng/mL and a dilution of 1:160 for ConA and PHA-M, respectively. Lymphocyte proliferation in response to ConA and PHA-M mitogens was depressed at T-2 doses of 1 ng/mL or higher (p < 0.05). The proliferation was completely abolished at 10 ng/mL when the toxin was added at 0 time, while it was decreased by 80% when the toxin was added to the lymphocytes after 24 h. The addition of Vitamin E in the fat soluble form (α-tocopheryl acetate) did not exert any protection effect against the toxin when it was added at either 25 or 100 μg. However, when the water soluble form (Trolox) was added at a concentration of (200 μg) (equivalent to 100 μM of α-tocopherol), it provided considerable protection (p < 0.05) against T-2 toxin inhibition of lymphocyte proliferation. The difference in the effect between the two forms of Vitamin E might be related to their relative solubility in the culture media which in turn may affect their availability for protection

  5. 77 FR 68886 - Aiken Railway Company, LLC-Lease and Operation Exemption-Lines of Norfolk Southern Railway...

    Science.gov (United States)

    2012-11-16

    ... Carolina Railway Service Corporation (WCRS), and Steven C. Hawkins and Cheryl R. Hawkins (collectively, the Hawkins) seek Board approval to continue in control of AIKR upon AIKR's becoming a Class III rail carrier... 5, 2012. WCRS and the Hawkins are reminded that they are not authorized to control AIKR until the...

  6. Critical Studies in Teaching and Learning - Vol 2, No 2 (2014)

    African Journals Online (AJOL)

    Using Wikis to Teach History Education to 21st Century Learners: A Hermeneutic Perspective · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Dorothy Sebbowa, Dick Ng'ambi, Cheryl Brown, 24-48. http://dx.doi.org/10.14426/cristal.v3i1 ...

  7. 76 FR 7187 - Priorities for Addressing Risks to the Reliability of the Bulk-Power System; Reliability...

    Science.gov (United States)

    2011-02-09

    ..., U.S. House of Representatives. 10:35 a.m. Introductions; Commissioner Cheryl LaFleur, Chair. 10:40 a... protecting against sophisticated and fast-moving threats? What role do you expect Smart Grid to play in the... grid reliability under Smart Grid applications? If not, how should NERC address these issues? c. Will...

  8. Forward by Guest Editors | Potgieter | African Journal on Conflict ...

    African Journals Online (AJOL)

    African Journal on Conflict Resolution. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 15, No 3 (2015) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Forward by Guest Editors. Cheryl Potgieter, Paulus ...

  9. Incremental Effect of the Addition of Prescriber Restrictions on a State Medicaid's Pharmacy-Only Patient Review and Restriction Program.

    Science.gov (United States)

    Keast, Shellie L; Pham, Timothy; Teel, Ashley; Nesser, Nancy J

    2017-08-01

    result in long-term changes to behavior outside the payer system. Future research into the effects of PRRPs on patient behavior beyond the payer system is needed. No outside funding supported this research. All authors disclose either employment by the Oklahoma Health Care Authority or contractual work for this employer. In addition, Keast discloses unrelated funding through unrestricted research grants from Gilead Sciences and Purdue Pharma. Study concept and design were contributed by Keast and Pham, along with Teel and Nesser. Keast and Pham collected the data, along with Teel, and data interpretation was provided by Keast and Pham, with assistance from Teel and Nesser. The manuscript was written primarily by Keast, along with Pham and Teel, and revised by all the authors.

  10. 78 FR 76032 - Date of Political Party Nominations of Candidates for Special Primary Elections in New York

    Science.gov (United States)

    2013-12-16

    ...: Robert M. Knop, Assistant General Counsel, or Cheryl A.F. Hemsley, Attorney, 999 E Street NW., Washington... party committee votes to nominate the party's candidate for the special general election, not the date... primary elections in New York from contributions for special general elections. \\1\\ See 2 U.S.C. 441a(a)(1...

  11. The Polysaccharide Capsule of Campylobacter jejuni 81-176 Modulates the Host Immune Response

    Science.gov (United States)

    2012-12-17

    immune response 3 4 Alexander C. Maue1, Krystle L. Mohawk1, David K. Giles*2, Frédéric Poly1, Cheryl 5 P. Ewing1, Yuening Jiao3, Ginyoung Lee3, Zuchao...McGowan, D. Musher , A. Martin and J. 652 Richards. 1998. Phosphorylcholine on the lipooligosaccharide of 653 Haemophilus influnezae contributes to

  12. Identifying and Validating Selection Tools for Predicting Officer Performance and Retention

    Science.gov (United States)

    2017-05-01

    Teresa L. Russell, Editor Cheryl J. Paullin, Editor Human Resources Research Organization Peter J. Legree, Editor Robert N. Kilcullen, Editor...for the Department of the Army by Human Resources Research Organization Technical review by Rebekkah Beeco, U.S. Army Research Institute...i.e., Career Intentions) and four job performance dimensions: (a) Technical Task Proficiency (TTP); (b) Management , Administration, and

  13. The Ecology of Hope: Natural Guides to Building a Children and Nature Movement

    Science.gov (United States)

    Charles, Cheryl

    2009-01-01

    Cheryl Charles, Ph.D gave the 2009 Paul F-Brandwein Lecture. The lecture addresses the impact of children's disconnect from the natural world in their everyday lives. Co-founder of the Children & Nature Network (C&NN) with Richard Louv, author of "Last Child in the Woods: Saving Our Children from Nature-Deficit Disorder" (2005/2008), the author…

  14. Monitoring Water Quality at Lake Merritt, Oakland, CA Following Improvements to the Tidal Channel to the San Francisco Bay

    Science.gov (United States)

    Bracho, H.; Martinez, J.; Johnson, M.; Turrey, A.; Avila, M.; Medina, S.; Rubio, E.; Ahumada, E.; Nguyen, S.; Guzman, Y.

    2014-12-01

    Elliot Ahumada, Esosa Oghogho, Samantha Nguyen, Humberto Bracho, Diego Quintero, Ashanti Johnson and Kevin Cuff Lake Merritt is a tidal lagoon in the center of Oakland, California, just east of Downtown. Water quality at Lake Merritt has been a major concern for community members and researchers for many years (Pham 200X). Results of past research lead to recommendations to lengthen a channel that connects Lake Merritt with the San Francisco Bay to improve water flow and quality. In 2012 the City of Oakland responded to these recommendations by initiating the creation of a 230-meter long channel. In conducting our research we use a water quality index that takes into account measurements of pH, temperature, water hardness (dissolved solids), ammonia, salinity, dissolved oxygen, and nitrate. Newly collected data is then compared with that collected by Pham using comparable parameters to assess the impact of recent changes at the Lake on its overall water quality. In addition, we measured the abundance of aquatic species at four different sites within the Lake. Preliminary results suggest that an increase in the abundance of fish and improved overall water quality have resulted from channel extension at Lake Merritt.

  15. Screening strategies and predictive diagnostic tools for the development of new-onset diabetes mellitus after transplantation: an overview

    Directory of Open Access Journals (Sweden)

    Pham PT

    2012-10-01

    Full Text Available Phuong-Thu T Pham,1 Kari L Edling,2 Harini A Chakkera,3 Phuong-Chi T Pham,4 Phuong-Mai T Pham51Department of Medicine, Nephrology Division, Kidney Transplant Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 2Department of Medicine, Division of Endocrinology, Diabetes and Hypertension, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 3Department of Medicine, Nephrology Division Kidney Transplant Program, Mayo Clinic Hospital, Phoenix, AZ, USA; 4Department of Medicine, Nephrology Division, UCLA-Olive View Medical Center, Sylmar, CA, USA; 5Department of Medicine, Greater Los Angeles, Veterans Administration Health Care System, CA, USAAbstract: New-onset diabetes mellitus after transplantation (NODAT is a serious and common complication following solid organ transplantation. NODAT has been reported in 2% to 53% of all solid organ transplants. Kidney transplant recipients who develop NODAT have variably been reported to be at increased risk of fatal and nonfatal cardiovascular events and other adverse outcomes including infection, reduced patient survival, graft rejection, and accelerated graft loss compared with those who do not develop diabetes. Limited clinical studies in liver, heart, and lung transplants similarly suggested that NODAT has an adverse impact on patient and graft outcomes. Early detection and management of NODAT must, therefore, be integrated into the treatment of transplant recipients. Studies investigating the best screening or predictive tool for identifying patients at risk for developing NODAT early after transplantation, however, are lacking. We review the clinical predictive values of fasting plasma glucose, oral glucose tolerance test, and A1C in assessing the risk for NODAT development and as a screening tool. Simple diabetes prediction models that incorporate clinical and/or metabolic risk factors (such as age, body mass index, hypertriglyceridemia, or metabolic syndrome are also

  16. Toward a Theory of Strategic Communication: A Relationship Management Approach

    Science.gov (United States)

    2012-03-22

    Washington, DC: U.S. Department of Defense, Aug. 15, 2009), 5. 31 Ibid. 32 Ibid., 6. 33 Ibid. 34 Severin Peters, Strategic Communication for Crisis ...Relations, ed. Robert L. Heath (Thousand Oaks, CA: Sage Publications, 2001), 128. 76 W. Timothy Coombs , “Interpersonal Communication and Public Relations...Toward a Theory of Strategic Communication : A Relationship Management Approach by Lieutenant Colonel Cheryl D. Phillips

  17. Developing Conceptual Models for Assessing Climate Change Impacts to Contaminant Availability in Terrestrial Ecosystems

    Science.gov (United States)

    2015-03-01

    Greenberg 2005), effects of dredged material (PIANC 2006), and ecosystem restoration (Fischenich 2008) among others. The process of developing a conceptual...Impacts to Contaminant Availability in Terrestrial Ecosystems by Burton C. Suedel, Nathan R. Beane, Eric R. Britzke, Cheryl R. Montgomery, and...are generally project or problem specific. Building a CM includes determining the components of the ecosystem , identifying relationships linking these

  18. Measuring Cooperative Biological Engagement Program (CBEP) Performance: Capacities, Capabilities, and Sustainability Enablers for Biorisk Management and Biosurveillance

    Science.gov (United States)

    2014-01-01

    Monica, Calif.: RAND Corporation, MG-662-OSD, 2008. As of May 21, 2014: http://www.rand.org/pubs/monographs/MG662.html de Sa, Joia , Sandra Mounier...Hanvoravongchai, Piya, Wiku Adisasmito, Pham Ngoc Chau, Alexandra Conseil, Joia de Sa, Ralf Krumkamp, Sandra Mounier-Jack, Bounlay Phommasack...This work should be of interest to CBEP and CTR leadership as they seek to improve program design , budget allocation, and execution and to

  19. A Multithreaded Missions And Means Framework (MMF) Concept Report

    Science.gov (United States)

    2012-03-01

    Vasconcelos , W.; Gibson, C.; Bar-Noy, A.; Borowiecki, K.; La Porta, T.; Pizzocaro, D.; Rowaihy, H.; Pearson, G.; Pham, T. An Ontology Centric...M.; de Mel, G.; Vasconcelos , W.; Sleeman, D.; Colley, S.; La Porta, T. An Ontology-Based Approach to Sensor-Mission Assignment. Proceedings of the...1st Annual Conference of the International Technology Alliance (ACITA 2007), 2007. Preece, A.; Gomez, M.; de Mel, G.; Vasconcelos , W.; Sleeman, D

  20. Development of a Computational Assay for the Estrogen Receptor

    Science.gov (United States)

    2006-07-01

    Research in Undergraduate Computational Chemistry across New York and New England" at the Executive Summit, Delivering Technology Leadership for Life...Sciences: Research Advances for Drug Discovery and Bioterrorism. A Life Sciences Executive Summit co-sponsored by SGI, the Delaware Biotechnology...Bharath, J.; Jain, S.; Pham, H. B.; Boonyasiriwat, C.; Nguyen, N.; Andersen, E.; Kim, Y.; Choc , S.; Choi, J.; Cheatham, T. E.; Facelli, J. C. J. Chemical

  1. Attribution of Spear Phishing Attacks: A Literature Survey

    Science.gov (United States)

    2013-08-01

    However, the efficacy of methods using syntactic features as features rely on the availability and accuracy of a natural language processing ( NLP ) tool...92] implemented TAT — an author profiling tool with application to Arabic emails demographic traits (age, gender and education), and psychometric...pp. 1–9. 93. Estival, D., Gaustad, T., Pham, S. B., Radford, W. and Hutchinson, B. 2007. TAT: an author profiling tool with application to Arabic

  2. Managing Adverse and Reportable Information Regarding General and Flag Officers

    Science.gov (United States)

    2012-01-01

    require a complete reading. xvii Acknowledgments The authors appreciate the sponsor support provided by William Carr , Lernes Hebert, Cheryl Black, and...E7. 22 Managing Adverse and Reportable Information nel also review the promotion board statistics regarding race, gender , acquisition personnel... discrimination brought by service members are called “equal opportunity (EO)” complaints, or some- times “military equal opportunity (MEO)” complaints.1 In

  3. USSR and Eastern Europe Scientific Abstracts, Electronics and Electrical Engineering, Number 33.

    Science.gov (United States)

    1977-09-27

    transliterated are enclosed in parentheses. Words or names preceded by a ques - tion mark and enclosed in parentheses were not clear in the original but have...ADAPTIVE SYSTEM Budapest MERES ES AUTOMATIKA in Hungarian No 3, 1977 pp 109-1H PHAM THUONG CAT, Research Institute for Computing Sciences of the...profiles have been identified by successfully approximating them with a parabola above a cer- tain depth and an exponential below it. A close

  4. A new cross-effect in local relativistic thermodynamics of irreversible processes

    International Nuclear Information System (INIS)

    Gariel, J.

    1981-01-01

    It is shown that the supplementary term qsup(α)usub(α) which appears in the caloric conducting fluid Eckart's theory (where qsup(α) is the derivative by the curvilinear absciss of the calorific conduction density and usub(α) the local unitary speed) states a thermodynamics construction problem. We can solve this one by admitting the existence of a new relativistic 'thermokinetic' cross-effect, which leads to the relativistic Fourier's hypothesis of Pham Mau Quan [fr

  5. Semi Quantitative MALDI TOF for Antimicrobial Susceptibility Testing in Staphylococcus aureus

    Science.gov (United States)

    2017-08-31

    Semi- quantitative MALDI-TOF for antimicrobial susceptibility testing in Staphylococcus 1 aureus 2 3 4 Tucker Maxson,a Cheryl L. Taylor-Howell,a...Timothy D. Minoguea# 5 6 Diagnostic Systems Division, United States Army Medical Research Institute of Infectious 7 Disease, Fort Detrick, MD...USAa 8 9 Running Title: Quantitative MALDI for AST in S. aureus 10 #Address correspondence to Timothy D. Minogue, timothy.d.minogue.civ@mail.mil

  6. Determining Sources of Fecal Contamination in Two Rivers of Northumberland County, Virginia

    OpenAIRE

    Szeles, Cheryl Lynne

    2003-01-01

    DETERMINING SOURCES OF FECAL CONTAMINATION IN TWO RIVERS OF NORTHUMBERLAND COUNTY, VIRGINIA By Cheryl Lynne Szeles Dr. Charles Hagedorn III, Chairman Crop and Soil Environmental Sciences (ABSTRACT) The goal of monitoring the water quality of shellfish beds is to provide protection against transmission of water-borne infectious diseases. The Coan River and the Little Wicomico River contain shellfish beds that are closed to harvest due to contamination with fecal ...

  7. Delayed hyperacute rejection in a patient who developed clostridium difficile infection after ABO-incompatible kidney transplantation

    Directory of Open Access Journals (Sweden)

    Gerald S Lipshutz

    2010-11-01

    Full Text Available Gerald S Lipshutz1, Elaine F Reed2, Phuong-Chi Pham3, Jeffrey M Miller4, Jennifer S Singer5, Gabriel M Danovitch6, Alan H Wilkinson6, Dean W Wallace7, Suzanne McGuire6, Phuong-Truc Pham8, Phuong-Thu Pham61Department of Surgery, Kidney and Pancreas Transplant Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 2Department of Pathology and Laboratory Medicine-Immunogenetics, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 3Department of Medicine, Nephrology Division, UCLA-Olive View Medical Center, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 4Department of Medicine, Hematology Oncology Division, UCLA-Olive View Medical Center, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 5Department of Surgery and Urology, Kidney and Pancreas Transplant Program, 6Department of Medicine, Nephrology Division, Kidney and Pancreas Transplant Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 7Department of Pathology and Laboratory Medicine, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 8Department of Science, Penn State University, Worthington-Scranton, Dunmore, PA, USAAbstract: Over the past decade ABO incompatible transplantation has emerged as an important potential source for increasing living kidney transplantation in selected transplant centers. Early reports suggest that patients who have elevated serum anti-blood group antibody titers (anti-A/B before transplantation and a rebound antibody production after antibody removal may be at high immunological risk. With currently available immune modulation protocols and immunosuppressive therapy, excellent short- and long-term patient and graft survival rates have been achieved even in those with high anti-A/B antibody titers before plasmapheresis or immunoadsorption. Nonetheless, acute infection with an organism possessing surface markers analogous to blood group antigens such as carbohydrate structures on

  8. The evolving role of alemtuzumab (Campath-1H in renal transplantation

    Directory of Open Access Journals (Sweden)

    Phuong-Thu T Pham

    2008-12-01

    Full Text Available Phuong-Thu T Pham1, Gerald S Lipshutz2, Phuong-Truc T Pham3, Joseph Kawahji1, Jennifer S Singer4, Phuong-Chi T Pham51Division of Nephrology, Department of Medicine, Kidney and Pancreas Transplant Program, University of California at Los Angeles, David Geffen School of Medicine, Los Angeles, California; 2Kidney and Pancreas Transplant Program, Department of Surgery and Urology, University of California at Los Angeles, David Geffen School of Medicine, Los Angeles, California; 3Department of Science, Penn State University, Worthington-Scranton, Dunmore, Pennsylvania; 4Renal Transplantation and Pediatric Urology, Department of Urology, University of California at Los Angeles, David Geffen School of Medicine, Los Angeles, California; 5Division of Nephrology, Department of Medicine, University of California at Los Angeles, David Geffen School of Medicine, Los Angeles, and Olive-View-UCLA Medical Center, Sylmar, California, USAAbstract: The introduction of new immunosuppressive agents into clinical transplantation in the 1990s has resulted in excellent short-term graft survival. Nonetheless, extended long-term graft outcomes have not been achieved due in part to the nephrotoxic effects of calcineurin inhibitors (CNIs and the adverse effects of steroid on cardiovascular disease risk factors. Induction therapy with lymphocyte depleting antibodies has originally been introduced into renal transplantation to provide intense immunosuppression in the early post-transplant period to prevent allograft rejection. Over the past half decade, induction therapy with both non-lymphocyte depleting (basiliximab and daclizumab and lymphocyte-depleting antibodies (antithymocyte antibodies, OKT3, alemtuzumab has increasingly been utilized in steroid or CNI sparing protocols in the early postoperative period. Alemtuzumab is a humanized monoclonal antibody targeted against CD52 on the surface of circulatory mononuclear cells. The ability of alemtuzumab (Campath-1H to

  9. A Functional Transcriptomic Approach to Understanding the Sand Fly Vector Relationships to the Host and Leshmania Parasites

    Science.gov (United States)

    2008-04-07

    Carolina V. Barillas -Mury, M.D., Ph.D., Dissertation Committee Member Stephen J. Davies, BVSc., Ph.D., Dissertation Committee Member Ernest L. Maynard...mediated midgut attachment. Parasitology 2000, 121 ( Pt 1):25-33. 34. Kamhawi S, Ramalho-Ortigao M, Pham VM, Kumar S, Lawyer PG, Turco SJ, Barillas ...Lawyer PG, Turco SJ, Barillas -Mury C, Sacks DL, Valenzuela JG: A role for insect galectins in parasite survival. Cell 2004, 119(3):329-341. 2. Pal U

  10. In silico ordinary differential equation/partial differential equation hemodialysis model estimates methadone removal during dialysis

    OpenAIRE

    Linares, Oscar A; Schiesser, William E; Fudin, Jeffrey; Pham, Thien C; Bettinger, Jeffrey J; Mathew, Roy O; Daly, Annemarie L

    2015-01-01

    Oscar A Linares,1 William E Schiesser,2 Jeffrey Fudin,3–6 Thien C Pham,6 Jeffrey J Bettinger,6 Roy O Mathew,6 Annemarie L Daly7 1Translational Genomic Medicine Lab, Plymouth Pharmacokinetic Modeling Study Group, Plymouth, MI, 2Department of Chemical and Biomolecular Engineering, Lehigh University, Bethlehem, PA, 3University of Connecticut School of Pharmacy, Storrs, CT, 4Western New England College of Pharmacy, Springfield, MA, 5Albany College of Pharmacy and Health Sciences, Albany...

  11. Increased Cardiometabolic Risk and Worsening Hypoxemia at High Altitude

    OpenAIRE

    Miele, Catherine H.; Schwartz, Alan R.; Gilman, Robert H.; Pham, Luu; Wise, Robert A.; Davila-Roman, Victor G.; Jun, Jonathan C.; Polotsky, Vsevolod Y.; Miranda, J. Jaime; Leon-Velarde, Fabiola; Checkley, William

    2016-01-01

    Miele, Catherine H., Alan R. Schwartz, Robert H. Gilman, Luu Pham, Robert A. Wise, Victor G. Davila-Roman, Jonathan C. Jun, Vsevolod Y. Polotsky, J. Jaime Miranda, Fabiola Leon-Velarde, and William Checkley. Increased cardiometabolic risk and worsening hypoxemia at high altitude. High Alt Med Biol. 17:93���100, 2016.���Metabolic syndrome, insulin resistance, diabetes, and dyslipidemia are associated with an increased risk of cardiovascular disease. While excessive erythrocytosis is associated...

  12. Managing cultural differences in MNE: a case study on IKEA in China and their staffs

    OpenAIRE

    Pham, Binh; Hongyu, Xue

    2012-01-01

    Course: EFO703 Bachelor Thesis in Business administration 15 ECTS University: Mälardalen University School of Sustainable Development of Society and Technology, Västerås Authors: Pham Ngoc Binh & Xue Hongyu Examiner: Ole Liljefors Tutor: Per Nordqvist Research question: How has IKEA managed cultural differences regarding their staffs in China? Purpose of the research: The purpose of the research is to describe and analyze the managerial practices of IKEA in China under the influence of Ch...

  13. Novel in situ self-assembly nanoparticles for formulating a poorly water-soluble drug in oral solid granules, improving stability, palatability, and bioavailability

    OpenAIRE

    Dong, Xiaowei; Guo,Shujie; Pham,Kevin; Li,Diana; Penzak,Scott

    2016-01-01

    Shujie Guo,1 Kevin Pham,2 Diana Li,2 Scott R Penzak,3 Xiaowei Dong2 1State Key Laboratory of Medical Genomics, Shanghai Key Laboratory of Hypertension, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, People’s Republic of China; 2Department of Pharmaceutical Sciences, 3Department of Pharmacotherapy, University of North Texas Health Science Center, Fort Worth, TX, USA Purpose: The purpose of this study was to develop a novel lipid-based nanotechnology to...

  14. Youth Education - Health / Nutrition

    OpenAIRE

    2004-01-01

    Deborah L. Angell: The Bug Stops Here! Cheryl L. Barber: Successful Snacks - Food, Fitness and Food Safety Learning Activities. Darcy Batura: At-Risk Youth and Household Hazardous Waste Education. Katherine L. Cason: Nutrition Mission – A Multimedia Educational Tool for Youth . Patsy A. Ezell: An Interactive Food and Nutrition Education Program for Youth. Rhea Lanting: Got Calcium? Sandy McCurdy: Reaching Teens through a Food Safety Education Partnership. Patricia Mulkeen: Choosing 4-H Fitnes...

  15. Perspectives on Embedded Media

    Science.gov (United States)

    2004-01-01

    allowed him to report whatever he wanted, as long as it was accurate and did not compromise operational security. Jim Landers and Cheryl Diaz -Meyers...and Diaz -Meyers photographed the scene. The 51 article was published on 6 April 2003, describing the incident with the same detail as Cerre: They...anti-coalition agenda. It is fair to state that each side achieved its aims, though not without controversy or obstacles. Alicia Sheppard, in

  16. Consumer Decision Process in Restaurant Selection: An Application of the Stylized EKB Model

    Directory of Open Access Journals (Sweden)

    Eugenia Wickens

    2016-12-01

    Full Text Available Purpose – The aim of this paper is to propose a framework based on empirical work for understanding the consumer decision processes involved in the selection of a restaurant for leisure meals. Design/Methodology/Approach – An interpretive approach is taken in order to understand the intricacies of the process and the various stages in the process. Six focus group interviews with consumers of various ages and occupations in the South East of the United Kingdom were conducted. Findings and implications – The stylized EKB model of the consumer decision process (Tuan-Pham & Higgins, 2005 was used as a framework for developing different stages of the process. Two distinct parts of the process were identified. Occasion was found to be critical to the stage of problem recognition. In terms of evaluation of alternatives and, in particular, sensitivity to evaluative content, the research indicates that the regulatory focus theory of Tuan-Pham and Higgins (2005 applies to the decision of selecting a restaurant. Limitations – It is acknowledged that this exploratory study is based on a small sample in a single geographical area. Originality – The paper is the first application of the stylized EKB model, which takes into account the motivational dimensions of consumer decision making, missing in other models. It concludes that it may have broader applications to other research contexts.

  17. NCBI nr-aa BLAST: CBRC-PHAM-01-0774 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ced As A Secretion Protein In E.Coli pdb|3BSQ|B Chain B, Crystal Structure Of Human Kallikrein 7 Produced As... A Secretion Protein In E.Coli pdb|3BSQ|C Chain C, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli 3BSQ 2e-12 89% ...

  18. NCBI nr-aa BLAST: CBRC-PHAM-01-1678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available neurons protein 2 pdb|3HAJ|A Chain A, Crystal Structure Of Human Pacsin2 F-Bar Domain (P212121 Lattice) pdb...|3HAJ|B Chain B, Crystal Structure Of Human Pacsin2 F-Bar Domain (P212121 Lattice

  19. Essays on Strategy. 5

    Science.gov (United States)

    1988-01-01

    Van Dong, Truong Chinh , To Huu, and Le Duc Tho, but retained and pro- moted to the number two position Pham Hung, the Min- ister of Interior and one...explained that a basic concern of the United States was that the Pacific region Should not be trans - formed "into yet another area of superpower confronta... tran - ,sition to mutual 13Mll) t’apkailities would be frought with uncertainty, instabilitY, and po-,ible peril. ("On.juentlvt. alternative tour vields

  20. Muscle characteristics only partially explain color variations in fresh hams.

    Science.gov (United States)

    Stufft, K; Elgin, J; Patterson, B; Matarneh, S K; Preisser, R; Shi, H; England, E M; Scheffler, T L; Mills, E W; Gerrard, D E

    2017-06-01

    Fresh hams display significant lean color variation that persists through further processing and contributes to a less desirable cured product. In an attempt to understand the underlying cause of this color disparity, we evaluated the differences in muscle characteristics and energy metabolites across semimembranosus (SM) muscles differing in color variation. The L* (lightness) and a* (redness) values were highest and lowest (Pham color variation but suggest other factors may mitigate or exacerbate these variances. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Winning without Fighting: Military/Ngo Interaction Development

    Science.gov (United States)

    2015-12-01

    U.S. Response to the Haiti Earthquake,” 203. 98 Hillary Rodham Clinton , “One Year Commemoration of Haiti’s Earthquake,” Washington, DC: U.S...www.rand.org/content/dam/rand/pubs/research_reports/RR300/RR304/RA ND_RR304.pdf. Clinton , Hillary Rodham. “One Year Commemoration of Haiti’s Earthquake...of State Hilary Clinton appointed counselor and chief of staff Cheryl Mills to lead the overall effort due to her continued work on a Haitian

  2. A systematic review of interventions conducted in clinical or community settings to improve dual-task postural control in older adults

    OpenAIRE

    Agmon M; Belza B; Nguyen HQ; Logsdon RG; Kelly VE

    2014-01-01

    Maayan Agmon,1 Basia Belza,2 Huong Q Nguyen,2,3 Rebecca G Logsdon,2 Valerie E Kelly41The Cheryl Spencer Department of Nursing, Faculty of Social Welfare and Health Studies, University of Haifa, Israel; 2School of Nursing, University of Washington, Seattle, WA, USA; 3Department of Research and Evaluation, Kaiser Permanente, CA, USA; 4School of Medicine, University of Washington, Seattle, WA, USABackground: Injury due to falls is a major problem among older adults. Decrements in dual-task postu...

  3. Distributed plot-making

    DEFF Research Database (Denmark)

    Jensen, Lotte Groth; Bossen, Claus

    2016-01-01

    different socio-technical systems (paper-based and electronic patient records). Drawing on the theory of distributed cognition and narrative theory, primarily inspired by the work done within health care by Cheryl Mattingly, we propose that the creation of overview may be conceptualised as ‘distributed plot......-making’. Distributed cognition focuses on the role of artefacts, humans and their interaction in information processing, while narrative theory focuses on how humans create narratives through the plot construction. Hence, the concept of distributed plot-making highlights the distribution of information processing...

  4. Paris-Princeton Lectures on Mathematical Finance

    CERN Document Server

    Carmona, René A; Kohatsu-Higa, Arturo; Lasry, Jean-Michel; Lions, Pierre-Louis; Pham, Huyên; Taflin, Erik

    2007-01-01

    The Paris-Princeton Lectures in Financial Mathematics, of which this is the third volume, will, on an annual basis, publish cutting-edge research in self-contained, expository articles from outstanding - established or upcoming! - specialists. The aim is to produce a series of articles that can serve as an introductory reference for research in the field. It arises as a result of frequent exchanges between the finance and financial mathematics groups in Paris and Princeton. The present volume sets standards with articles by René Carmona, Ivar Ekeland/Erik Taflin, Arturo Kohatsu-Higa, Pierre-Louis Lions/Jean-Michel Lasry, and Hyuên Pham.

  5. Pelagic Habitat Analysis Module (PHAM) for GIS Based Fisheries Decision Support

    Science.gov (United States)

    Kiefer, D. A.; Armstrong, Edward M.; Harrison, D. P.; Hinton, M. G.; Kohin, S.; Snyder, S.; O'Brien, F. J.

    2011-01-01

    We have assembled a system that integrates satellite and model output with fisheries data We have developed tools that allow analysis of the interaction between species and key environmental variables Demonstrated the capacity to accurately map habitat of Thresher Sharks Alopias vulpinus & pelagicus. Their seasonal migration along the California Current is at least partly driven by the seasonal migration of sardine, key prey of the sharks.We have assembled a system that integrates satellite and model output with fisheries data We have developed tools that allow analysis of the interaction between species and key environmental variables Demonstrated the capacity to accurately map habitat of Thresher Sharks Alopias vulpinus nd pelagicus. Their seasonal migration along the California Current is at least partly driven by the seasonal migration of sardine, key prey of the sharks.

  6. Effect of magnetic resonance imaging characteristics on uterine fibroid treatment

    Directory of Open Access Journals (Sweden)

    Duc NM

    2018-04-01

    Full Text Available Nguyen Minh Duc, Huynh Quang HuyDepartment of Radiology, Pham Ngoc Thach University of Medicine, Ho Chi Minh City, VietnamAbstract: Uterine fibroids are the most common gynecological benign tumors adversely affecting the quality of life of women of a reproductive age. Magnetic resonance imaging (MRI is efficient at localizing the site of lesions and characterizing uterine fibroids before treatment. Understanding the different characteristics of uterine fibroids on MRI is essential, because it not only enables prompt diagnosis, but also guides the development of suitable therapeutic methods. This pictorial review demonstrates the effect of MRI features on uterine fibroid treatment. Keywords: uterine fibroids, characteristics, magnetic resonance imaging, treatments

  7. Earthworms of the 'acaecate' Pheretima group in Vietnam (Oligochaeta: Megascolecidae), with description of a new species from the Mekong delta.

    Science.gov (United States)

    Nguyen, Tung T; Tran, Binh T T; Nguyen, Anh D

    2014-09-22

    The 'acaecate' Pheretima group from Vietnam is revised, with description of a new species, Polypheretima mekongmontis sp. nov. A total of 18 species of three genera, Metapheretima Michaelsen, 1928, Planapheretima Michaelsen, 1934, and Polypheretima Michaelsen, 1934 has been recorded from Vietnam. Caecate species of Planapheretima are included here as well. Planapheretima arboricola (Rosa, 1890), Pl. lacertina (Chen, 1946), Pl. tenebrica (Chen, 1946), Polypheretima elongata (Perrier, 1872), and Po. taprobanae (Beddard, 1892) are originally recorded from other countries; all remaining species are native to Vietnam. The species Polypheretima tani (Thai, 1996) and Po. tiencanhensis (Pham, 1995) are transferred to the genus Metapheretima. A key to species and distribution maps are also presented.

  8. Uncovering student thinking about mathematics in the common core, grades 6-8 25 formative assessment probes

    CERN Document Server

    Tobey, Cheryl Rose

    2013-01-01

    Pinpoint and reverse math misconceptions with laser-like accuracyQuickly and reliably uncover common math misconceptions in Grades 6-8 with these convenient and easy-to-implement diagnostic tools! Bestselling authors Cheryl Tobey and Carolyn Arline provide 25 new assessment probes that pinpoint subconcepts within the new Common Core Standards for Mathematics to promote deep learning and expert math instruction--while learning is already underway.Completely CCSM aligned, these grade-specific probes eliminate the guesswork and help teachers: Systematically address conceptual and procedural mistakes Help students better understand areas of struggle Plan targeted instruction that covers Grades 6-8 CCSM mathematical processes and proficiencies.

  9. Reel success creating demo reels and animation portfolios

    CERN Document Server

    Cabrera, Cheryl

    2013-01-01

    Are you an animator looking to get your foot in the door to the top studios?It's tough if you don't have a demo reel and portfolio that reflects your unique style and incredible talents.  The reception of that reel will make or break you; so it's no wonder that creating a demo reel can be such a daunting task.  Reel Success by Cheryl Cabrera can help.  This book guides you into putting the right content into your portfolio, how to cater to the right audience, and how to harness the power of social media and network effectively.  Accompanied by case studies of actual students

  10. 78 FR 42064 - Before Commissioners: Jon Wellinghoff, Chairman; Philip D. Moeller, John R. Norris, Cheryl A...

    Science.gov (United States)

    2013-07-15

    ... Transmission Organizations (Joint ISOs/RTOs) filed a joint motion to intervene out-of-time and comments on NERC's Petition.\\13\\ In support of their request for leave to intervene out-of-time, Joint ISOs/RTOs... the January 30, 2013 close of the intervention and comment period. Joint ISOs/RTOs maintain that their...

  11. Quality attributes and color characteristics in three-piece boneless hams.

    Science.gov (United States)

    McKeith, Russell O; Pringle, T Dean

    2013-09-01

    One hundred and fifty hams were selected on visual assessment of quality into normal (C) and two-tone (TT) groups. CIE LAB color and pH measurements were collected at the plant 48h postmortem on the gluteus medius (GM), gluteus profundus (GP), and rectus femoris (RF), and again at 72h on the semimembranosus (SM), biceps femoris (BF), semitendinosus (ST), and RF. Data were analyzed using GLM procedures of SAS, and correlations between color scores, pH, and drip loss were calculated. Plant and fabrication pH were lower (Phams compared with C. Muscles from TT hams had lower (Pcolor and pH are accurate predictors of pork quality attributes in the muscles of a three-piece boneless ham. Copyright © 2013 Elsevier Ltd. All rights reserved.

  12. Bioethics and Climate Change: A Response to Macpherson and Valles.

    Science.gov (United States)

    Resnik, David B

    2016-10-01

    Two articles published in Bioethics recently have explored the ways that bioethics can contribute to the climate change debate. Cheryl Cox Macpherson argues that bioethicists can play an important role in the climate change debate by helping the public to better understand the values at stake and the trade-offs that must be made in individual and social choices, and Sean Valles claims that bioethicists can contribute to the debate by framing the issues in terms of the public health impacts of climate change. While Macpherson and Valles make valid points concerning a potential role for bioethics in the climate change debate, it is important to recognize that much more than ethical analysis and reflection will be needed to significantly impact public attitudes and government policies. © 2016 John Wiley & Sons Ltd.

  13. 76 FR 72197 - Before Commissioners: Jon Wellinghoff, Chairman; Philip D. Moeller, John R. Norris, and Cheryl A...

    Science.gov (United States)

    2011-11-22

    ..., control, or restore the Bulk-Power System. See North American Electric Reliability Corporation, 119 FERC... in the planning horizon, as a means of improving the long-term reliability of the Bulk-Power System..., by contrast, should be focused on improving the long-term reliability of the Bulk-Power System...

  14. 78 FR 6173 - Diana Del Grosso, Ray Smith, Joseph Hatch, Cheryl Hatch, Kathleen Kelley, Andrew Wilklund, and...

    Science.gov (United States)

    2013-01-29

    ... submissions by the parties may be submitted via the Board's e-filing format or in the traditional paper format. Any person using e-filing should attach a document and otherwise comply with the instructions at the E... proceeding under 49 U.S.C. 721 and 5 U.S.C. 554(e). Petitioners request that the Board declare that specific...

  15. Laws of cognition and the cognition of law.

    Science.gov (United States)

    Kahan, Dan M

    2015-02-01

    This paper presents a compact synthesis of the study of cognition in legal decisionmaking. Featured dynamics include the story-telling model (Pennington & Hastie, 1986), lay prototypes (Smith, 1991), motivated cognition (Sood, 2012), and coherence-based reasoning (Simon, Pham, Le, & Holyoak, 2001). Unlike biases and heuristics understood to bound or constrain rationality, these dynamics identify how information shapes a variety of cognitive inputs-from prior beliefs to perceptions of events to the probative weight assigned new information-that rational decisionmaking presupposes. The operation of these mechanisms can be shown to radically alter the significance that jurors give to evidence, and hence the conclusions they reach, within a Bayesian framework of information processing. How these dynamics interact with the professional judgment of lawyers and judges, the paper notes, remains in need of investigation. Copyright © 2014 Elsevier B.V. All rights reserved.

  16. AGR-1 Thermocouple Data Analysis

    International Nuclear Information System (INIS)

    Einerson, Jeff

    2012-01-01

    This report documents an effort to analyze measured and simulated data obtained in the Advanced Gas Reactor (AGR) fuel irradiation test program conducted in the INL's Advanced Test Reactor (ATR) to support the Next Generation Nuclear Plant (NGNP) R and D program. The work follows up on a previous study (Pham and Einerson, 2010), in which statistical analysis methods were applied for AGR-1 thermocouple data qualification. The present work exercises the idea that, while recognizing uncertainties inherent in physics and thermal simulations of the AGR-1 test, results of the numerical simulations can be used in combination with the statistical analysis methods to further improve qualification of measured data. Additionally, the combined analysis of measured and simulation data can generate insights about simulation model uncertainty that can be useful for model improvement. This report also describes an experimental control procedure to maintain fuel target temperature in the future AGR tests using regression relationships that include simulation results. The report is organized into four chapters. Chapter 1 introduces the AGR Fuel Development and Qualification program, AGR-1 test configuration and test procedure, overview of AGR-1 measured data, and overview of physics and thermal simulation, including modeling assumptions and uncertainties. A brief summary of statistical analysis methods developed in (Pham and Einerson 2010) for AGR-1 measured data qualification within NGNP Data Management and Analysis System (NDMAS) is also included for completeness. Chapters 2-3 describe and discuss cases, in which the combined use of experimental and simulation data is realized. A set of issues associated with measurement and modeling uncertainties resulted from the combined analysis are identified. This includes demonstration that such a combined analysis led to important insights for reducing uncertainty in presentation of AGR-1 measured data (Chapter 2) and interpretation of

  17. AGR-1 Thermocouple Data Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Jeff Einerson

    2012-05-01

    This report documents an effort to analyze measured and simulated data obtained in the Advanced Gas Reactor (AGR) fuel irradiation test program conducted in the INL's Advanced Test Reactor (ATR) to support the Next Generation Nuclear Plant (NGNP) R&D program. The work follows up on a previous study (Pham and Einerson, 2010), in which statistical analysis methods were applied for AGR-1 thermocouple data qualification. The present work exercises the idea that, while recognizing uncertainties inherent in physics and thermal simulations of the AGR-1 test, results of the numerical simulations can be used in combination with the statistical analysis methods to further improve qualification of measured data. Additionally, the combined analysis of measured and simulation data can generate insights about simulation model uncertainty that can be useful for model improvement. This report also describes an experimental control procedure to maintain fuel target temperature in the future AGR tests using regression relationships that include simulation results. The report is organized into four chapters. Chapter 1 introduces the AGR Fuel Development and Qualification program, AGR-1 test configuration and test procedure, overview of AGR-1 measured data, and overview of physics and thermal simulation, including modeling assumptions and uncertainties. A brief summary of statistical analysis methods developed in (Pham and Einerson 2010) for AGR-1 measured data qualification within NGNP Data Management and Analysis System (NDMAS) is also included for completeness. Chapters 2-3 describe and discuss cases, in which the combined use of experimental and simulation data is realized. A set of issues associated with measurement and modeling uncertainties resulted from the combined analysis are identified. This includes demonstration that such a combined analysis led to important insights for reducing uncertainty in presentation of AGR-1 measured data (Chapter 2) and interpretation of

  18. Kennedy Space Center (KSC) Launch Pad Avian Abatement Efforts Including Related KSC Road Kill Reduction Effort

    Science.gov (United States)

    Schlierf, Roland; Hight, Ron; Payne, Stephen J.; Shaffer, John P.; Missimer, Brad; Willis, Christopher

    2007-01-01

    While birds might seem harmless, there's a good reason for the concern. During the July 2005 launch of Discovery on mission STS-1 14, a vulture soaring around the launch pad impacted the shuttle's external tank just after liftoff. With a vulture's average weight ranging from 3 to 5 pounds. a strike at a critical point on the Shuttle -- like the nose or wing leading thermal protection panels -- could cause catastrophic damage to the vehicle. The foam chunk that fatefully struck Columbia's wing in 2003 weighed only 1.7 pounds. (Cheryl L. Mansfield "Bye Bye Birdies" 2006) To address this issue, NASA formed an "Avian Abatement Team". The team goal is to have safer Shuttle missions by reducing the vulture population at KSC near the pad area thereby reducing the probability of another vulture strike during a Shuttle launch.

  19. Plundering the poor: the role of the World Bank in the Third World.

    Science.gov (United States)

    Feder, E

    1983-01-01

    The World Bank, the most important so-called development assistance agency, annually dispenses billions of dollars to Third World governments, ostensibly to "develop" their economics through a variety of loan projects. But even a superficial analysis reveals that the Bank is the perfect mechanism to help (i.e., subsidize) the large transnational corporations from the industrial countries to expand their industrial, commercial, and financial activities in the Third World, at the expense of the latter and particularly at the expense of the rural and urban proletariat. This article discusses Cheryl Payer's recent book, The World Bank: A Critical Analysis, in which she analyzes the Bank's role in the Third World and sets forth the major reasons why poverty, hunger, and malnutrition, as well as unemployment, and all the adverse social phenomena associated with them, are on the increase.

  20. Factors affecting the occurrence of Porphyra vietnamensis Tanaka & Pham-Hoang Ho along the Goa coast

    Digital Repository Service at National Institute of Oceanography (India)

    Pereira, N.; Kakode, J.; Dhargalkar, V.K.

    on colour change of cultured lavers II. On the change of chlorophyll, carotenoid and other hydrochromes. Bull. T o hoku Region. Fish. Res. L ab ., 1955, 5 , 64 ? 78. 29. Flores Moya, A., Altamiriano, M., Cordero, M., Gonzalez, M. E. and Perez, M...

  1. Cytoplasmic Streaming - Skylab Student Experiment ED-63

    Science.gov (United States)

    1973-01-01

    This chart describes the Skylab student experiment (ED-63), Cytoplasmic Streaming, proposed by Cheryl A. Peitz of Arapahoe High School, Littleton, Colorado. Experiment ED-63 was to observe the effect of zero-gravity on cytoplasmic streaming in the aquatic plant named Elodea, commonly called water weed or water thyme. The phenomenon of cytoplasmic streaming is not well understood, but it is recognized as the circulation mechanism of the internal materials or cytoplasm of a cell. Cytoplasm is a gelatinous substance that has the ability to change its viscosity and flow, carrying various cell materials with it. The activity can be stimulated by sunlight or heat. In March 1972, NASA and the National Science Teachers Association selected 25 experiment proposals for flight on Skylab. Science advisors from the Marshall Space Flight Center aided and assisted the students in developing the proposals for flight on Skylab.

  2. Joint International Accelerator School

    CERN Multimedia

    CERN Accelerator School

    2014-01-01

    The CERN and US Particle Accelerator Schools recently organised a Joint International Accelerator School on Beam Loss and Accelerator Protection, held at the Hyatt Regency Hotel, Newport Beach, California, USA from 5-14 November 2014. This Joint School was the 13th in a series of such schools, which started in 1985 and also involves the accelerator communities in Japan and Russia.   Photo courtesy of Alfonse Pham, Michigan State University.   The school attracted 58 participants representing 22 different nationalities, with around half from Europe and the other half from Asia and the Americas. The programme comprised 26 lectures, each of 90 minutes, and 13 hours of case study. The students were given homework each day and had an opportunity to sit a final exam, which counted towards university credit. Feedback from the participants was extremely positive, praising the expertise and enthusiasm of the lecturers, as well as the high standard and quality of their lectures. Initial dis...

  3. The influence of discrete emotions on judgement and decision-making: a meta-analytic review.

    Science.gov (United States)

    Angie, Amanda D; Connelly, Shane; Waples, Ethan P; Kligyte, Vykinta

    2011-12-01

    During the past three decades, researchers interested in emotions and cognition have attempted to understand the relationship that affect and emotions have with cognitive outcomes such as judgement and decision-making. Recent research has revealed the importance of examining more discrete emotions, showing that same-valence emotions (e.g., anger and fear) differentially impact judgement and decision-making outcomes. Narrative reviews of the literature (Lerner & Tiedens, 2006 ; Pham, 2007 ) have identified some under-researched topics, but provide a limited synthesis of findings. The purpose of this study was to review the research examining the influence of discrete emotions on judgement and decision-making outcomes and provide an assessment of the observed effects using a meta-analytic approach. Results, overall, show that discrete emotions have moderate to large effects on judgement and decision-making outcomes. However, moderator analyses revealed differential effects for study-design characteristics and emotion-manipulation characteristics by emotion type. Implications are discussed.

  4. Incubation of curing brines for the production of ready-to-eat, uncured, no-nitrite-or-nitrate-added, ground, cooked and sliced ham.

    Science.gov (United States)

    Krause, B L; Sebranek, J G; Rust, R E; Mendonca, A

    2011-12-01

    Salt concentration, vegetable juice powder (VJP) concentration and temperature were investigated to determine necessary conditions for incubation of curing brines including VJP and a starter culture containing Staphylococcus carnosus prior to production of naturally cured, no-nitrate/nitrite-added meat products. Subsequently, incubated brines were utilized to produce no-nitrate/nitrite-added sliced ham in which quality characteristics and residual nitrite concentrations were measured to determine feasibility of brine incubation for nitrate conversion prior to injection. Two ham treatments (one with VJP and starter culture; one with pre-converted VJP) and a nitrite-added control were used. No differences (P>0.05) were found for color in the VJP treatments. Control sliced ham was redder after 42 days of storage, retaining significantly (Phams during the first week of storage. While the nitrite-added control retained greater red color and initially had more residual nitrite than the VJP treatments, the two VJP treatments did not differ from each other. Copyright © 2011 Elsevier Ltd. All rights reserved.

  5. Suppression of human breast tumors in NOD/SCID mice by CD44 shRNA gene therapy combined with doxorubicin treatment

    Directory of Open Access Journals (Sweden)

    Pham PV

    2012-05-01

    Full Text Available Phuc Van Pham1, Ngoc Bich Vu1, Thuy Thanh Duong1, Tam Thanh Nguyen1, Nhung Hai Truong1, Nhan Lu Chinh Phan1, Tue Gia Vuong1, Viet Quoc Pham1, Hoang Minh Nguyen1, Kha The Nguyen1, Nhung Thi Nguyen1, Khue Gia Nguyen1, Lam Tan Khat1, Dong Van Le2, Kiet Dinh Truong1, Ngoc Kim Phan11Laboratory of Stem Cell Research and Application, University of Science, Vietnam National University, HCM City, 2Military Medical University, Ha Noi, VietnamBackground: Breast cancer stem cells with a CD44+CD24- phenotype are the origin of breast tumors. Strong CD44 expression in this population indicates its important role in maintaining the stem cell phenotype. Previous studies show that CD44 down-regulation causes CD44+CD24- breast cancer stem cells to differentiate into non-stem cells that are sensitive to antitumor drugs and lose many characteristics of the original cells. In this study, we determined tumor suppression in non-obese severe combined immunodeficiency mice using CD44 shRNA therapy combined with doxorubicin treatment.Methods: Tumor-bearing non-obese severe combined immunodeficiency mice were established by injection of CD44+CD24- cells. To track CD44+CD24- cells, green fluorescence protein was stably transduced using a lentiviral vector prior to injection into mice. The amount of CD44 shRNA lentiviral vector used for transduction was based on CD44 down-regulation by in vitro CD44 shRNA transduction. Mice were treated with direct injection of CD44 shRNA lentiviral vector into tumors followed by doxorubicin administration after 48 hours. The effect was evaluated by changes in the size and weight of tumors compared with that of the control.Results: The combination of CD44 down-regulation and doxorubicin strongly suppressed tumor growth with significant differences in tumor sizes and weights compared with that of CD44 down-regulation or doxorubicin treatment alone. In the combination of CD44 down-regulation and doxorubicin group, the tumor weight was

  6. Becoming-Ariel: Viewing Julie Taymor’s The Tempest through an Ecocritical Lens

    Directory of Open Access Journals (Sweden)

    Clare Sibley-Esposito

    2012-10-01

    Full Text Available The burgeoning field of ecocriticism takes what Cheryll Glotfelty has referred to as an “earth-centered approach” to cultural productions, with ecocritics sharing a concern with the interconnectedness of human and non-human spheres. This article presents a brief overview of some ecocritical readings of The Tempest, before interpreting Julie Taymor’s cinematographic adaptation in the light of such considerations. Taymor attributes a rather unproblematic power of manipulation of the natural world to her Prospera, yet some of her directorial choices, operating within the specificity of the film medium, tend nonetheless to highlight certain ecocritically-relevant dimensions of Shakespeare’s text. By viewing the film through an ecocritical lens, whilst borrowing terminology from Gilles Deleuze and Félix Guattari, the figure of Ariel can be seen as operating on a “molecular plane” of ontological interconnectivity, in contrast to the “molar mode” of binary oppositions inherent in Prospera’s desire to dominate natural forces.

  7. Extraction studies. Final report, May 6, 1996--September 30, 1997

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-10-09

    During the first week of this effort, an Alpkem RFA-300 4-channel automated chemical analyzer was transferred to the basement of building 42 at TA-46 for the purpose of performing extraction studies. Initially, this instrumentation was applied to soil samples known to contain DNA. Using the SFA (Segmented Flow Analysis) technique, several fluidic systems were evaluated to perform on-line filtration of several varieties of soil obtained from Cheryl Kuske and Kaysie Banton (TA-43, Bldg. 1). Progress reports were issued monthly beginning May 15, 1996. Early in 1997 there was a shift from the conventional 2-phase system (aqueous + air) to a 3-phase system (oil + aqueous + air) to drastically reduce sample size and reagent consumption. Computer animation was recorded on videotape for presentations. The time remaining on the subcontract was devoted to setting up existing equipment to incorporate the 3rd phase (a special fluorocarbon oil obtained from DuPont).

  8. An African theory of bioethics: reply to MacPherson and Macklin.

    Science.gov (United States)

    Metz, Thaddeus

    2010-12-01

    In a prior issue of Developing World Bioethics, Cheryl Macpherson and Ruth Macklin critically engaged with an article of mine, where I articulated a moral theory grounded on indigenous values salient in the sub-Saharan region, and then applied it to four major issues in bioethics, comparing and contrasting its implications with those of the dominant Western moral theories, utilitarianism and Kantianism. In response to my essay, Macpherson and Macklin have posed questions about: whether philosophical justifications are something with which bioethicists ought to be concerned; why something counts as 'African'; how medicine is a moral enterprise; whether an individual right to informed consent is consistent with sub-Saharan values; and when thought experiments help to establish firm conclusions about moral status. These are important issues for the field, and I use this reply to take discussion of them a step or two farther, defending my initial article from Macpherson's and Macklin's critical questions and objections. © 2010 Blackwell Publishing Ltd.

  9. A quantitative method for zoning of protected areas and its spatial ecological implications.

    Science.gov (United States)

    Del Carmen Sabatini, María; Verdiell, Adriana; Rodríguez Iglesias, Ricardo M; Vidal, Marta

    2007-04-01

    Zoning is a key prescriptive tool for administration and management of protected areas. However, the lack of zoning is common for most protected areas in developing countries and, as a consequence, many protected areas are not effective in achieving the goals for which they were created. In this work, we introduce a quantitative method to expeditiously zone protected areas and we evaluate its ecological implications on hypothetical zoning cases. A real-world application is reported for the Talampaya National Park, a UNESCO World Heritage Site located in Argentina. Our method is a modification of the zoning forest model developed by Bos [Bos, J., 1993. Zoning in forest management: a quadratic assignment problem solved by simulated annealing. Journal of Environmental Management 37, 127-145.]. Main innovations involve a quadratic function of distance between land units, non-reciprocal weights for adjacent land uses (mathematically represented by a non-symmetric matrix), and the possibility of imposing a connectivity constraint. Due to its intrinsic spatial dimension, the zoning problem belongs to the NP-hard class, i.e. a solution can only be obtained in non-polynomial time [Nemhausser, G., Wolsey, L., 1988. Integer and Combinatorial Optimization. John Wiley, New York.]. For that purpose, we applied a simulated annealing heuristic implemented as a FORTRAN language routine. Our innovations were effective in achieving zoning designs more compatible with biological diversity protection. The quadratic distance term facilitated the delineation of core zones for elements of significance; the connectivity constraint minimized fragmentation; non-reciprocal land use weightings contributed to better representing management decisions, and influenced mainly the edge and shape of zones. This quantitative method can assist the zoning process within protected areas by offering many zonation scheme alternatives with minimum cost, time and effort. This ability provides a new tool to

  10. Augmenting an operational forecasting system for the North and Baltic Seas by in situ T and S data assimilation

    Science.gov (United States)

    Losa, Svetlana; Danilov, Sergey; Schröter, Jens; Nerger, Lars; Maßmann, Silvia; Janssen, Frank

    2014-05-01

    In order to improve the hydrography forecast of the North and Baltic Seas, the operational circulation model of the German Federal Maritime and Hydrographic Agency (BSH) has been augmented by a data assimilation (DA) system. The DA system has been developed based on the Singular Evolution Interpolated Kalman (SEIK) filter algorithm (Pham, 1998) coded within the Parallel Data Assimilation Framework (Nerger et al., 2004, Nerger and Hiller, 2012). Previously the only data assimilated were sea surface temperature (SST) measurements obtained with the Advanced Very High Resolution Radiometer (AVHRR) aboard NOAA's polar orbiting satellites. While the quality of the forecast has been significantly improved by assimilating the satellite data (Losa et al., 2012, Losa et al., 2014), assimilation of in situ observational temperature (T) and salinity (S) profiles has allowed for further improvement. Assimilating MARNET time series and CTD and Scanfish measurements, however, required a careful calibration of the DA system with respect to local analysis. The study addresses the problem of the local SEIK analysis accounting for the data within a certain radius. The localisation radius is considered spatially variable and dependent on the system local dynamics. As such, we define the radius of the data influence based on the energy ratio of the baroclinic and barotropic flows. D. T. Pham, J. Verron, L. Gourdeau, 1998. Singular evolutive Kalman filters for data assimilation in oceanography, C. R. Acad. Sci. Paris, Earth and Planetary Sciences, 326, 255-260. L. Nerger, W. Hiller, J. Schröter, 2004. PDAF - The Parallel Data Assimilation Framework: Experiences with Kalman Filtering, In: Zwieflhofer, W., Mozdzynski, G. (Eds.), Use of high performance computing in meteorology: proceedings of the Eleventh ECMWF Workshop on the Use of High Performance Computing in Meteorology. Singapore: World Scientific, Reading, UK, 63-83. L. Nerger, W. Hiller, 2012. Software for Ensemble-based Data

  11. Parent–Child Interaction Therapy: current perspectives

    Directory of Open Access Journals (Sweden)

    Lieneman CC

    2017-07-01

    Full Text Available Corey C Lieneman, Laurel A Brabson, April Highlander, Nancy M Wallace, Cheryl B McNeil Department of Psychology, West Virginia University, Morgantown, WV, USA Abstract: Parent–Child Interaction Therapy (PCIT is an empirically supported intervention originally developed to treat disruptive behavior problems in children between the ages of 2 and 7 years. Since its creation over 40 years ago, PCIT has been studied internationally with various populations and has been found to be an effective intervention for numerous behavioral and emotional issues. This article summarizes progress in the PCIT literature over the past decade (2006–2017 and outlines future directions for this important work. Recent PCIT research related to treatment effectiveness, treatment components, adaptations for specific populations (age groups, cultural groups, military families, individuals diagnosed with specific disorders, trauma survivors, and the hearing-impaired, format changes (group and home-based, teacher–child interaction training (TCIT, intensive PCIT (I-PCIT, treatment as prevention (for externalizing problems, child maltreatment, and developmental delays, and implementation are discussed. Keywords: PCIT, adaptations, implementation, effectiveness

  12. Critical ethnography: An under-used research methodology in neuroscience nursing.

    Science.gov (United States)

    Ross, Cheryl; Rogers, Cath; Duff, Diane

    2016-01-01

    Critical ethnography is a qualitative research method that endeavours to explore and understand dominant discourses that are seen as being the 'right' way to think, see, talk about or enact a particular 'action' or situation in society and recommend ways to re-dress social power inequities. In health care, vulnerable populations, including many individuals who have experienced neurological illnesses or injuries that leave them susceptible to the influence of others, would be suitable groups for study using critical ethnography methodology. Critical ethnography has also been used to study workplace culture. While ethnography has been effectively used to underpin other phenomena of interest to neuroscience nurses, only one example of the use of critical ethnography exists in the published literature related to neuroscience nursing. In our "Research Corner" in this issue of the Canadian Journal of Neuroscience Nursing (CJNN) our guest editors, Dr. Cheryl Ross and Dr. Cath Rogers will briefly highlight the origins of qualitative research, ethnography, and critical ethnography and describe how they are used and, as the third author, I will discuss the relevance of critical ethnography findings for neuroscience nurses.

  13. Cloning and functional analysis of succinate dehydrogenase gene PsSDHA in Phytophthora sojae.

    Science.gov (United States)

    Pan, Yuemin; Ye, Tao; Gao, Zhimou

    2017-07-01

    Succinate dehydrogenase (SDH) is one of the key enzymes of the tricarboxylic acid cycle (TCA cycle) and a proven target of fungicides for true fungi. To explore the roles of the SDHA gene in Phytophthora sojae, we first cloned PsSDHA to construct the PsSDHA silenced expression vector pHAM34-PsSDHA, and then utilized PEG to mediate the P. sojae protoplast transformation experiment. Through transformation screening, we obtained the silenced mutants A1 and A3, which have significant suppressive effect. Further study showed that the hyphae of the silenced mutant strains were shorter and more bifurcated; the growth of the silenced mutants was clearly inhibited in 10% V8 agar medium containing sodium chloride (NaCl), hydrogen peroxide (H 2 O 2 ) or Congo Red, respectively. The pathogenicity of the silenced mutants was significantly reduced compared with the wild-type strain and the mock. The results could help us better to understand the position and function of SDH in P. sojae and provide a proven target of fungicides for the oomycete. Copyright © 2017. Published by Elsevier Ltd.

  14. Technology, conflict early warning systems, public health, and human rights.

    Science.gov (United States)

    Pham, Phuong N; Vinck, Patrick

    2012-12-15

    Public health and conflict early warning are evolving rapidly in response to technology changes for the gathering, management, analysis and communication of data. It is expected that these changes will provide an unprecedented ability to monitor, detect, and respond to crises. One of the potentially most profound and lasting expected change affects the roles of the various actors in providing and sharing information and in responding to early warning. Communities and civil society actors have the opportunity to be empowered as a source of information, analysis, and response, while the role of traditional actors shifts toward supporting those communities and building resilience. However, by creating new roles, relationships, and responsibilities, technology changes raise major concerns and ethical challenges for practitioners, pressing the need for practical guidelines and actionable recommendations in line with existing ethical principles. Copyright © 2012 Pham and Vinck. This is an open access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/), which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original author and source are credited.

  15. KSC-04PD-0024

    Science.gov (United States)

    2004-01-01

    KENNEDY SPACE CENTER, FLA. -- In the KSC television studio, KSC management and other employees applaud President George W. Bush, who addressed the public and an assembly of government officials at NASA Headquarters as he outlined a new focus and vision for the space agency. Seated in the front row, left to right, are Bill Pickavance vice president and associate program manager of Florida Operations, United Space Alliance (USA) ; Howard DeCastro, vice president and Space Shuttle program manager, USA; Shannon Roberts, with External Affairs; Woodrow Whitlow, KSC deputy director; Bruce Buckingham, assistant to Dr. Whitlow; Lisa Malone, director of External Affairs; Ken Aguilar, chief, Equal Opportunity office; and Cheryl Cox, External Affairs. The President stated his goals for NASAs new mission: Completing the International Space Station, retiring the Space Shuttle orbiters, developing a new crew exploration vehicle, and returning to the moon and beyond within the next two decades. Pres. Bush was welcomed by NASA Administrator Sean OKeefe and Expedition 8 Commander Michael Foale, who greeted him from the International Space Station. Members of the Washington, D.C., audience included astronauts Eileen Collins, Ed Lu and Michael Lopez-Alegria, and former astronaut Gene Cernan.

  16. Political Ecology in Gabriel Garcia Marquez's One Hundred Years of Solitude

    Directory of Open Access Journals (Sweden)

    Eman Mohammed ElSherief

    2016-04-01

    Full Text Available The roots of ecology prolong profoundly within earlier phases of history, when the naturalistic fabric was first evinced.  Bringing out his On the Origin of Species in 1859, Darwin not merely engendered a biological culmination but also heralded the revolutionary critical canon of naturalism that was virtually a stone thrown in the vast stagnant lake of traditional literature. Via the naturalistic lens, the whole bulk of man’s behavioral attributes are being expounded in terms of milieu and heredity. The mid-1990s witnessed the publication of The Environmental Imagination by Lawrence Buell in 1995, and The Ecocriticism Reader edited by Cheryll Gloffelty and Harold Fromm in 1996, which palpably underpinned ecocriticism as revolving around the inextricable liaison between literature and the physical environment. The political ecology term was coined to further scrutinize relations among people that pertain to nature. The present paper is an endeavor to pursue the ecological tenor of Gabriel Garcia Marquez’s landmark novel, One Hundred Years of Solitude, and how it was admirably exploited to address precarious postcolonial issues. Keywords: Political ecology, Marquez, naturalism, ecocriticism, post-colonialism.

  17. Estrogens of multiple classes and their role in mental health disease mechanisms

    Directory of Open Access Journals (Sweden)

    Cheryl S Watson

    2010-06-01

    Full Text Available Cheryl S Watson1, Rebecca A Alyea1, Kathryn A Cunningham2, Yow-Jiun Jeng11Department of Biochemistry and Molecular Biology, 2Department of Pharmacology and Toxicology, Univ of Texas Medical Branch, Galveston, TX, USAAbstract: Gender and sex hormones can influence a variety of mental health states, including mood, cognitive development and function, and vulnerability to neurodegenerative diseases and brain damage. Functions of neuronal cells may be altered by estrogens depending upon the availability of different physiological estrogenic ligands; these ligands and their effects vary with life stages, the genetic or postgenetic regulation of receptor levels in specific tissues, or the intercession of competing nonphysiological ligands (either intentional or unintentional, beneficial to health or not. Here we review evidence for how different estrogens (physiological and environmental/dietary, acting via different estrogen receptor subtypes residing in alternative subcellular locations, influence brain functions and behavior. We also discuss the families of receptors and transporters for monoamine neurotransmitters and how they may interact with the estrogenic signaling pathways.Keywords: estrogen receptor α, estrogen receptor β, GPR30, GPER, xenoestrogens, phytoestrogens, transporters, brain function, neurotransmitter receptors

  18. "Totenkranz" Who would have thought Hanoi could be such a good setting for a film noir?

    Directory of Open Access Journals (Sweden)

    Britta Schmitz

    2017-02-01

    Full Text Available End of January in Hanoi: the Tet-festival – Vietnam’s New Year’s celebration – has brought a pause to the usual hustle and bustle in the city. People have left the capital and returned to their home villages. Even the police headquarters is deserted. This is the only reason why political commissar Hung calls criminal detective Pham Van Ly, who had been suspended from duty 10 months before. An old woman was found dead on a construction site. Only a few hours later a Chinese real estate investor dies from what looks like food poisoning. What first seem to be unrelated incidents turn out to be a series of murders with the killer leaving a track of mysterious funeral wreaths. Ly jumps at the chance for this case as he sees it as the only way to get his suspension lifted. His investigations lead quickly into the corruption and nepotism related to Vietnam’s real estate market. And while the grumpy detective with a taste for Thang Long cigarettes and beer is solving the case, the reader travels into the dark side of Vietnamese society with its corrupt officials, poor farmers and ruthless property sharks from China.

  19. Predictores de depresión posparto en puerperas atendidas en la ese municipal. Villavicencio. 2014

    Directory of Open Access Journals (Sweden)

    Luz Myriam Tobón-Borrero

    2015-04-01

    Full Text Available El presente estudio tuvo como objetivo determinar los predictores de la depresión posparto. Se realizaron visitas domiciliares a las maternas que asistieron a la cita de puerperio en las IPS´s de la ESE Municipal de Villavicencio durante los meses de febrero y marzo de 2014. Diseño descriptivo de corte transversal, con enfoque cuantitativo. La muestra no probabilística de 34 mujeres puérperas atendidas en la IPS La Esperanza, Porfía, Morichal y Popular de la E.S.E Municipal de Villavicencio; Instrumento fue la Escala de Detección Sistemática de Depresión Posparto (PDSS de Cheryl Tatano y colaboradores. Resultados. En la evaluación de la probabilidad de presencia de síntomas agrupados en dimensiones y su asociación con DPSS los hallazgos en la muestra estudio (n=32, determinaron significancia en tres de las siete: labilidad emocional, culpa/vergüenza y ansiedad/inseguridad. Se partió desde una perspectiva bilateral, esto es, desde la hipótesis alternativa que consistió en asumir que existen diferencias en la prevalencia de la DPSS según la presencia de las diferentes dimensiones, grupos de síntomas, que presentaban las usuarias

  20. KSC-04PD-0020

    Science.gov (United States)

    2004-01-01

    KENNEDY SPACE CENTER, FLA. -- From the KSC television studio, KSC management and other employees applaud President George W. Bush, who addressed the public and an assembly of government officials at NASA Headquarters as he outlined a new focus and vision for the space agency. Shown from left are Mike Leinbach, Shuttle launch director; David Culp, with NASA; Steve Francois, director, Launch Services Program; Richard Cota, deputy chief financial officer, KSC; Bill Pickavance vice president and associate program manager of Florida Operations, United Space Alliance (USA) ; Howard DeCastro, vice president and Space Shuttle program manager, USA; Shannon Roberts, with External Affairs; Woodrow Whitlow, KSC deputy director; Bruce Buckingham, assistant to Dr. Whitlow; Lisa Malone, director of External Affairs; Ken Aguilar, chief, Equal Opportunity office; and Cheryl Cox, External Affairs. The President stated his goals for NASAs new mission: Completing the International Space Station, retiring the Space Shuttle orbiters, developing a new crew exploration vehicle, and returning to the moon and beyond within the next two decades. Pres. Bush was welcomed by NASA Administrator Sean OKeefe and Expedition 8 Commander Michael Foale, who greeted him from the International Space Station. Members of the Washington, D.C., audience included astronauts Eileen Collins, Ed Lu and Michael Lopez-Alegria, and former astronaut Gene Cernan

  1. Position statement and guidelines on support personnel in audiology. American Speech-Language Hearing Association.

    Science.gov (United States)

    1998-01-01

    This policy document of the American Speech-Language-Hearing Association (ASHA) reflects the Association's position that the Certificate of Clinical Competence-Audiology (CCC-A) is a nationally recognized quality indicator and education standard for the profession. The following statement includes the CCC-A as the appropriate credential for audiologists supervising support personnel. The consensus panel document's exclusion of the CCC-A conflicts with ASHA's policy. Member organizations that composed the consensus panel on support personnel in audiology included: Academy of Dispensing Audiologists (ADA), American Academy of Audiology (AAA), ASHA, Educational Audiology Association (EAA), Military Audiology Association (MAA), and the National Hearing Conservation Association (NHCA). Representatives to the panel included Donald Bender (AAA) and Evelyn Cherow (ASHA), co-chairs; James McDonald and Meredy Hase (ADA); Albert deChiccis and Cheryl deConde Johnson (AAA); Chris Halpin and Deborah Price (ASHA); Peggy Benson (EAA); James Jerome (MAA); and Lloyd Bowling and Richard Danielson (NHCA). ASHA's Legislative Council and Executive Board elected not to adopt the consensus panel document because it excluded the CCC-A. In all others aspects, the documents remain similar. This position statement and guidelines supersede the audiology sections of the Guidelines for the Employment and Utilization of Supportive Personnel (LC 32-80).

  2. Flow-diverting Stent in the Treatment of Cervical Carotid Dissection and Pseudoaneurysm: Review of Literature and Case Report.

    Science.gov (United States)

    Baptista-Sincos, Anna Paula Weinhardt; Simplício, Aline Bigatão; Sincos, Igor Rafael; Leaderman, Alex; Neto, Fernando Saliture; Moraes, Adjaldes; Aun, Ricardo

    2018-01-01

    The endovascular technique has been recommended over the past few years to extracranial carotid dissection and pseudoaneurysm with promising results, especially after medical therapy failure. Flow-diverting stents are an alternative for complex cases. These stents have proven to be effective treatment devices for intracranial aneurysms. The reference list of Pham's systematic review, published in 2011, and Seward's literature review, published in 2015, was considered, as well as all new articles with eligible features. Search was conducted on specific databases: MEDLINE and Literatura Latino-Americana e do Caribe em Ciências da Saúde. For carotid dissection and pseudoaneurysm, our review yielded 3 published articles including 12 patients. The technical success rate of flow-diverting stent was 100% with no procedural complication described. Mean clinical follow-up was 27.2 months (range 5-48), and in 5 months' angiographic follow-up, all lesions had healed. No new neurological events were reported during the clinical follow-up. Flow diverter stent use on intracranial and peripheral vascular surgery demonstrates satisfactory initial results, but it is still under investigation. There are very few cases treated till now and the initial results with flow-diverting stents to cervical carotid dissection are promising. In well-selected cases, where simple embolization or conventional stent is not appropriate, this technic may be considered. Copyright © 2017 Elsevier Inc. All rights reserved.

  3. Animal models of GM2 gangliosidosis: utility and limitations

    Directory of Open Access Journals (Sweden)

    Lawson CA

    2016-07-01

    Full Text Available Cheryl A Lawson,1,2 Douglas R Martin2,3 1Department of Pathobiology, 2Scott-Ritchey Research Center, 3Department of Anatomy, Physiology and Pharmacology, Auburn University College of Veterinary Medicine, Auburn, AL, USA Abstract: GM2 gangliosidosis, a subset of lysosomal storage disorders, is caused by a deficiency of the glycohydrolase, β-N-acetylhexosaminidase, and includes the closely related Tay–Sachs and Sandhoff diseases. The enzyme deficiency prevents the normal, stepwise degradation of ganglioside, which accumulates unchecked within the cellular lysosome, particularly in neurons. As a result, individuals with GM2 gangliosidosis experience progressive neurological diseases including motor deficits, progressive weakness and hypotonia, decreased responsiveness, vision deterioration, and seizures. Mice and cats are well-established animal models for Sandhoff disease, whereas Jacob sheep are the only known laboratory animal model of Tay–Sachs disease to exhibit clinical symptoms. Since the human diseases are relatively rare, animal models are indispensable tools for further study of pathogenesis and for development of potential treatments. Though no effective treatments for gangliosidoses currently exist, animal models have been used to test promising experimental therapies. Herein, the utility and limitations of gangliosidosis animal models and how they have contributed to the development of potential new treatments are described. Keywords: GM2 gangliosidosis, Tay–Sachs disease, Sandhoff disease, lysosomal storage disorder, sphingolipidosis, brain disease

  4. ’n Narratief vir kerk-wees vandag

    Directory of Open Access Journals (Sweden)

    J. Christo van der Merwe

    2014-11-01

    Full Text Available A narrative of church life today. We live in a time when survival seems to be the biggest concern of most mainline congregations and denominations. How can the church possibly survive? This is a question that is asked in almost every corner of the institution. Since the 1960s, numerous books and articles have been published, trying to get a handle on why the mainline churches are in decline. Whatever the cause may be, decline is causing great fear and anxiety in the mainline churches. In an effort to answer the underlying question: ‘What shall we do to turn the situation around?’, some churches are simply trying to ‘market’ themselves and their message. Others try to ’do’ church differently. Some try to rediscover the purpose of the church, et cetera. Cheryl Peterson argues that churches are, in fact, facing an ecclesial crisis, that is much more than a crisis of declining numbers and membership. There is a deeper and more basic issue that must be explored, one that has to do with the church’s theological identity, and that is: what it means to be church? This article is about the question: Who is the church? And it answers the question on the basis of Peterson’s thesis by means of a narrative of the church that commences with the Spirit.

  5. A novel method for simultaneous and continuous determination of thermal properties during phase transition applied to Calanus finmarchicus.

    Science.gov (United States)

    Bantle, Michael; Eikevik, Trygve Magne; Brennvall, Jon Eirik

    2010-08-01

    The thermal properties of a product are the most important parameters for practical engineering purposes and models in food science. Calanus finmarchicus is currently being examined as a marine resource for uncommon aquatic lipids and proteins. Thermal conductivity, specific heat, enthalpy and density were measured over the temperature range from -40 to +20 degrees C. The initial freezing point was determined to be -2.3 degrees C. The thermal properties were recorded continuously on 4 samples using a new method, and the results were compared with predictive models. The accuracy of the new method is demonstrated by different calibration runs. Significant differences in the thermal conductivity of the frozen material were found between the parallel-series model and the data, whereas the model of Pham and Willix (1989) or the Maxwell-Euken adaption showed better agreement. The measured data for specific heat, enthalpy, and density agreed well with the model. Practical Application: The thermal data obtained can be used directly in food engineering and technology applications, for example, in a thin layer model for freezing food for which precise thermal data for each layer are now available, enabling the more accurate prediction of freezing times and temperature profiles. Dimensionless numbers (such as the Biot number) can also be based on measured data with minor deviations compared to more general modeled thermal properties. Future activities will include the generation of a comprehensive database for different products.

  6. Differential cardiovascular profiles of sodium-glucose cotransporter 2 inhibitors: critical evaluation of empagliflozin

    Directory of Open Access Journals (Sweden)

    Sanon VP

    2017-05-01

    Full Text Available Vani P Sanon,1 Shalin Patel,1 Saurabh Sanon,2 Ruben Rodriguez,1 Son V Pham,1 Robert Chilton1 1Division of Cardiology, University of Texas Health Science Center at San Antonio, Audie L Murphy VA Hospital, San Antonio, TX, 2Interventional Cardiology-Structural Heart Disease, Cardiology Consultants at Baptist Heart and Vascular Institute, Pensacola, FL, USA Abstract: One of the most feared repercussions of type 2 diabetes mellitus is the risk of adverse cardiovascular outcomes. The current antidiabetic agents on the market have had difficulty in showing cardiovascular outcome improvement. The EMPA-REG OUTCOME trial studied the sodium-glucose cotransporter 2 inhibitor empagliflozin in type 2 diabetic patients at high risk of cardiovascular events. The trial results revealed a decrease in the composite primary end points of death from cardiovascular causes, nonfatal myocardial infarction, and nonfatal stroke in those taking empagliflozin vs placebo. Those taking the medication also had a significant decrease in death from any cause, death from cardiovascular cause, and hospitalization for heart failure. The EMPA-REG trial is paradigm shifting because it demonstrates a clear mortality benefit to cardiovascular outcomes with a low side-effect profile, in contrast to prior outcome studies of hypoglycemic agents. Further studies are required to better clarify the long-term safety and efficacy of this promising class of diabetic drugs. Keywords: SGLT2 inhibitors, diabetes, cardiovascular mortality, heart failure, hypertension

  7. Phytohemagglutinin (PHA) stimulation of peripheral-blood lymphocytes and stem cell take

    Energy Technology Data Exchange (ETDEWEB)

    Astaldi, G [Blood Research Foundation Center, Tortona, Italy; Karanovic, D; Vettori, P P; Karanovic, J; Piletic, O

    1974-01-01

    The effect of PHA-stimulation of peripheral-blood lymphocytes on the spleen-colony formation in irradiated rats was examined. 25-day old Wistar rats underwent total-body irradiation (600 R), and they were used as recipients. On the other hand, 2 and /sup 1///sub 2/ month old untreated Wistar rats were used as donors of peripheral-blood lymphocytes, which were obtained by sedimentation with Dextraven from defibrinated blood. Four rat lots were used. The 1st one did not receive irradiation, and was kept as ''blank control.'' The 2nd one was just irradiated and kept as ''radiated control.'' The 3rd and the 4th rat lots of the series were irradiated, but the former lot was injected i.v. with 5 x 10/sup 7/ peripheral-blood untreated lymphocytes, whereas the fourth lot was injected i.v. with the same amount of lymphocytes, which were previously incubated in vitro for 24 hrs with PHA-M (Difco). The results showed that the PHA-incubation of transplanted peripheral-blood lymphocytes significantly increases the number and size of the macroscopic spleen colonies, in relationship to the colonies which occurs after transplantation of untreated lymphocytes. Histo-cytological observation clearly showed that the colonies formed after injection of mitogen-pretreated peripheral-blood lymphocytes were predominantly of erythroid type and, then, of non-differentiated cells. Only a few of them were of a mixed type, consisting of both undifferentiated cells and erythroid cells.

  8. Evaluation of the coupled COSMO-CLM+NEMO-Nordic model with focus on North and Baltic seas

    Science.gov (United States)

    Lenhardt, J.; Pham, T. V.; Früh, B.; Brauch, J.

    2017-12-01

    The region east of the Baltic Sea has been identified as a hot-spot of climate change by Giorgi, 2006, on the base of temperature and precipitation variability. For this purpose, the atmosphere model COSMO-CLM has been coupled to the ocean model NEMO, including the sea ice model LIM3, via the OASIS3-MCT coupler (Pham et al., 2014). The coupler interpolates heat, fresh water, momentum fluxes, sea level pressure and the fraction of sea ice at the interface in space and time. Our aim is to find an optimal configuration of the already existing coupled regional atmospheric-ocean model COSMO-CLM+NEMO-Nordic. So far results for the North- and Baltic seas show that the coupled run has large biases compared with the E-OBS reference data. Therefore, additional simulation evaluations are planned by the use of independent satellite observation data (e.g. Copernicus, EURO4M). We have performed a series of runs with the coupled COSMO-CLM+NEMO-Nordic model to find out about differences of model outputs due to different coupling time steps. First analyses of COSMO-CLM 2m temperatures let presume that different coupling time steps have an impact on the results of the coupled model run. Additional tests over a longer period of time are conducted to understand whether the signal-to-noise ratio could influence the bias. The results will be presented in our poster.

  9. La superación política ideológica un reto de la enseñanza médica Increasing political and ideological knowledge, a challenge

    Directory of Open Access Journals (Sweden)

    Sonia Socarrás Sánchez

    2003-12-01

    Full Text Available Esta investigación es un estudio descriptivo de los resultados obtenidos en el instituto politécnico de la salud Pham Ngoc Thach Camagüey a partir de un diagnóstico realizado a los docentes donde se detectaron dificultades. Este trabajo comenzó desde el año 1999 y se extiende hasta el 2003, formando parte de un proyecto de investigación del centro. Las dificultades detectadas en el año 1999 impedían la adecuada preparación de los docentes para el tratamiento de los valores ya que desconocían los fundamentos teóricos relacionados con los valores y existía insuficiente preparación para elaborar estrategias didácticas en el proceso de fortalecimiento de valores. En el año 2002 se detectaron dificultades ya que se desconocían los elementos del trabajo político ideológico e identificaban éste con la reflexión y el debate y lo limitaban al uso de materiales audiovisuales. Por estas razones nos motivamos a realizar este trabajo. El objetivo del mismo es proponer alternativas de trabajo para la superación político- ideológica de los docentes. Entre los resultados más importantes están: la elaboración de una metodología para el tratamiento de los valores, la formulación de habilidades profesionales para el trabajo con los valores, la elaboración de folletos que han servido como material de consulta para los docentes en su preparación política ideológica los cuales se han generalizado en la provincia. Con la investigación se pudo confirmar que con la impartición del postgrado de valores y de los diplomados se logró elevar y consolidar el conocimiento sobre la problemática axiológica y el trabajo político ideológico y las actividades de superación política fueron catalogadas de muy buenas por parte de los docentesThis investigation is a descriptive study of the results obtained in “Pham Ngoc Thach” health polytechnic institute in Camagüey, starting from the difficulties detected in a diagnosis carried out to

  10. Phytohemagglutinin (PHA) stimulation of peripheral-blood lymphocytes and stem cell take

    Energy Technology Data Exchange (ETDEWEB)

    Astaldi, G. (Blood Research Foundation Center, Tortona, Italy); Karanovic, D.; Vettori, P.P.; Karanovic, J.; Piletic, O.

    1974-01-01

    The effect of PHA-stimulation of peripheral-blood lymphocytes on the spleen-colony formation in irradiated rats was examined. 25-day old Wistar rats underwent total-body irradiation (600 R), and they were used as recipients. On the other hand, 2 and /sup 1///sub 2/ month old untreated Wistar rats were used as donors of peripheral-blood lymphocytes, which were obtained by sedimentation with Dextraven from defibrinated blood. Four rat lots were used. The 1st one did not receive irradiation, and was kept as ''blank control.'' The 2nd one was just irradiated and kept as ''radiated control.'' The 3rd and the 4th rat lots of the series were irradiated, but the former lot was injected i.v. with 5 x 10/sup 7/ peripheral-blood untreated lymphocytes, whereas the fourth lot was injected i.v. with the same amount of lymphocytes, which were previously incubated in vitro for 24 hrs with PHA-M (Difco). The results showed that the PHA-incubation of transplanted peripheral-blood lymphocytes significantly increases the number and size of the macroscopic spleen colonies, in relationship to the colonies which occurs after transplantation of untreated lymphocytes. Histo-cytological observation clearly showed that the colonies formed after injection of mitogen-pretreated peripheral-blood lymphocytes were predominantly of erythroid type and, then, of non-differentiated cells. Only a few of them were of a mixed type, consisting of both undifferentiated cells and erythroid cells.

  11. Downregulation of CD44 reduces doxorubicin resistance of CD44+CD24- breast cancer cells

    Directory of Open Access Journals (Sweden)

    Phuc PV

    2011-06-01

    Full Text Available Pham Van Phuc, Phan Lu Chinh Nhan, Truong Hai Nhung, Nguyen Thanh Tam, Nguyen Minh Hoang, Vuong Gia Tue, Duong Thanh Thuy, Phan Kim NgocLaboratory of Stem Cell Research and Application, University of Science, Vietnam National University, Ho Chi Minh, VietnamBackground: Cells within breast cancer stem cell populations have been confirmed to have a CD44+CD24- phenotype. Strong expression of CD44 plays a critical role in numerous types of human cancers. CD44 is involved in cell differentiation, adhesion, and metastasis of cancer cells.Methods: In this study, we reduced CD44 expression in CD44+CD24- breast cancer stem cells and investigated their sensitivity to an antitumor drug. The CD44+CD24- breast cancer stem cells were isolated from breast tumors; CD44 expression was downregulated with siRNAs followed by treatment with different concentrations of the antitumor drug.Results: The proliferation of CD44 downregulated CD44+CD24- breast cancer stem cells was decreased after drug treatment. We noticed treated cells were more sensitive to doxorubicin, even at low doses, compared with the control groups.Conclusions: It would appear that expression of CD44 is integral among the CD44+CD24- cell population. Reducing the expression level of CD44, combined with doxorubicin treatment, yields promising results for eradicating breast cancer stem cells in vitro. This study opens a new direction in treating breast cancer through gene therapy in conjunction with chemotherapy.Keywords: antitumor drugs, breast cancer stem cells, CD44, CD44+CD24- cells, doxorubicin

  12. With thanks to our 2016 peer reviewers

    Science.gov (United States)

    2017-01-01

    2016 peer reviewers We are grateful to the following people for their significant contribution to Health Promotion and Chronic Disease Prevention in Canada as peer reviewers in 2016. Their expertise ensures the quality of our journal and promotes the sharing of new knowledge among peers in Canada and internationally. Jillian Avis Sunday Azagba Sharon Bartholomew Michèle Boileau-Falardeau Jimmy Bourque Darren Brenner Robert Brison Yves Carrière Neena Chappell Guanmin Chen Yue Chen Edward Chesney Anna Chudyk Martin Cooke Erica Di Ruggiero Janet Durbin Charlene Elliott Peter Ellis Alexa Ferdinands Bradley Ferguson Lauren Fiechtner Maylene Fong Marilyn Fortin Nancy Gell Margo Greenwood Rita Henderson Erin Hobin Andrew Howell Natalie Iciaszczyk Jeff Johnson Janet Elizabeth Jull Tetyana Kendzerska Nicholas King Elaine Kingwell Victoria Kirsh Erin Kropac Liana Leach Claire Leblanc Yann Le Bodo Daniel Lebouthillier Isra Levy Elizabeth Lin Catherine Mah Loraine Marrett Caitlin McArthur Teri McComber Amy McPherson Verena Menec Leia Minaker Howard Morrison Yeeli Mui Kiyuri Naicker Tor Oiamo Scott Patten Marie-Claude Paquette Cheryl Peters Jennifer Petkovic William Pickett Michelle Ploughman Daniel Poremski Harry Prapavessis Steven Prus Jürgen Rehm Laurene Rehman Sandra Reynolds Annie Rhodes Celia Rodd Kaley Roosen Ellen Rosenberg Linda Rothman Jerry Schultz Kelly Skinner Robin Skinner Robin Somerville Becky Spencer Richard Stanwick Michael Stevenson David Streiner Laura Struik Anna Syrowatka Christopher Tait Chen Tang Kara Thompson Michelle Vine Claudio Violato JianLi Wang Stéphanie Ward Cynthia Weijs Russell Wilkins Keri Lynn Williams Renate Ysseldyk Tingting Zhang Christopher Zou

  13. Multidisciplinary management for esophageal and gastric cancer

    Directory of Open Access Journals (Sweden)

    Boniface MM

    2016-04-01

    Full Text Available Megan M Boniface,1 Sachin B Wani,2 Tracey E Schefter,3 Phillip J Koo,4 Cheryl Meguid,1 Stephen Leong,5 Jeffrey B Kaplan,6 Lisa J Wingrove,7 Martin D McCarter1 1Section of Surgical Oncology, Division of GI, Tumor and Endocrine Surgery, Department of Surgery, 2Division of Gastroenterology and Hepatology, Department of Therapeutic and Interventional Endoscopy, 3Department of Radiation Oncology, 4Division of Radiology-Nuclear Medicine, Department of Radiology, 5Division of Medical Oncology, 6Department of Pathology, University of Colorado Denver, 7Department of Food and Nutrition Services, University of Colorado Hospital Cancer Center, Aurora, CO, USA Abstract: The management of esophageal and gastric cancer is complex and involves multiple specialists in an effort to optimize patient outcomes. Utilizing a multidisciplinary team approach starting from the initial staging evaluation ensures that all members are in agreement with the plan of care. Treatment selection for esophageal and gastric cancer often involves a combination of chemotherapy, radiation, surgery, and palliative interventions (endoscopic and surgical, and direct communication between specialists in these fields is needed to ensure appropriate clinical decision making. At the University of Colorado, the Esophageal and Gastric Multidisciplinary Clinic was created to bring together all experts involved in treating these diseases at a weekly conference in order to provide patients with coordinated, individualized, and patient-centered care. This review details the essential elements and benefits of building a multidisciplinary program focused on treating esophageal and gastric cancer patients. Keywords: tumor board, upper gastrointestinal malignancies, patient centered

  14. A case of mistaken identity: alcohol withdrawal, schizophrenia, or central pontine myelinolysis?

    Directory of Open Access Journals (Sweden)

    Schneider P

    2012-02-01

    Full Text Available Paul Schneider1, Vicki A Nejtek2,3, Cheryl Hurd2,31Green Oaks Behavioral Health Care Services, Dallas, 2University of North Texas Health Science Center, Fort Worth, 3John Peter Smith Health Network, Fort Worth, Texas, USAAbstract: Demyelination is a hallmark of central pontine myelinolysis (CPM. Neuropsychiatric manifestations of this condition include weakness, quadriplegia, pseudobulbar palsy, mood changes, psychosis, and cognitive disturbances. These psychiatric symptoms are also associated with schizophrenia and alcohol withdrawal. Thus, it is clinically relevant to differentiate between CPM, schizophrenia, and alcohol withdrawal as the treatment and prognostic outcomes for each diagnosis are distinct. We present a series of events that led to a misdiagnosis of a patient admitted to the medical emergency center presenting with confusion, psychomotor agitation, and delirium who was first diagnosed with schizophrenia and alcohol withdrawal by emergency medical physicians and later discovered by the psychiatric consult team to have CPM. With a thorough psychiatric evaluation, a review of the laboratory results first showing mild hyponatremia (127 mmol/L, subsequent hypernatremia (154 mmol/L, and magnetic resonance brain imaging, psychiatrists concluded that CPM was the primary diagnosis underlying the observed neuropsychopathology. This patient has mild impairments in mood, cognition, and motor skills that remain 12 months after her emergency-center admission. This case report reminds emergency clinicians that abnormal sodium metabolism can have long-term and devastating psychopathological and neurological consequences. Differentiating between CPM, schizophrenia, and alcohol withdrawal using neuroimaging techniques and preventing the risks for CPM using slow sodium correction are paramount.Keywords: MRI, alcohol, schizophrenia, central pontine myelinolysis, hyponatremia

  15. Tools for assessing mitochondrial dynamics in mouse tissues and neurodegenerative models

    Science.gov (United States)

    Pham, Anh H.

    Mitochondria are dynamic organelles that undergo membrane fusion and fission and transport. The dynamic properties of mitochondria are important for regulating mitochondrial function. Defects in mitochondrial dynamics are linked neurodegenerative diseases and affect the development of many tissues. To investigate the role of mitochondrial dynamics in diseases, versatile tools are needed to explore the physiology of these dynamic organelles in multiple tissues. Current tools for monitoring mitochondrial dynamics have been limited to studies in cell culture, which may be inadequate model systems for exploring the network of tissues. Here, we have generated mouse models for monitoring mitochondrial dynamics in a broad spectrum of tissues and cell types. The Photo-Activatable Mitochondrial (PhAM floxed) line enables Cre-inducible expression of a mitochondrial targeted photoconvertible protein, Dendra2 (mito-Dendra2). In the PhAMexcised line, mito-Dendra2 is ubiquitously expressed to facilitate broad analysis of mitochondria at various developmental processes. We have utilized these models to study mitochondrial dynamics in the nigrostriatal circuit of Parkinson's disease (PD) and in the development of skeletal muscles. Increasing evidences implicate aberrant regulation of mitochondrial fusion and fission in models of PD. To assess the function of mitochondrial dynamics in the nigrostriatal circuit, we utilized transgenic techniques to abrogate mitochondrial fusion. We show that deletion of the Mfn2 leads to the degeneration of dopaminergic neurons and Parkinson's-like features in mice. To elucidate the dynamic properties of mitochondria during muscle development, we established a platform for examining mitochondrial compartmentalization in skeletal muscles. This model system may yield clues to the role of mitochondrial dynamics in mitochondrial myopathies.

  16. Engaging with Dementia: Moral Experiments in Art and Friendship.

    Science.gov (United States)

    Taylor, Janelle S

    2017-06-01

    The box-office as well as critical success of the 2014 major motion picture Still Alice, starring Julianne Moore in the title role and based on the bestselling novel of the same name by the Harvard-trained neuroscientist Lisa Genova (Still Alice. Simon & Schuster, New York, 2009), marked an important moment in public cultural representations of people with dementia. Still Alice tells the story of Alice Howland, an eminent scientist whose increasing memory lapses are eventually diagnosed as early-onset Alzheimer's, and chronicles the transformations in her family relationships as her husband and three children respond to her decline in different ways. Alice's husband, her son, and her older daughter all respond by turning toward science, while her younger daughter Lydia seeks to engage her mother as she is now, and turns toward art and relationships. Taking Still Alice and the figure of Lydia as an entry point, I discuss arts-focused efforts to improve the lives of people with dementia, and draw upon ongoing interview-based research on the topic of dementia and friendship, to offer an account of some of the ways that people I have spoken with are actively experimenting with art and with relationships in the face of dementia. I argue that these efforts can be understood as "moral experiements," in the sense articulated by Cheryl Mattingly (Moral Laboratories: Family Peril and the Struggle for a Good Life. University of California Press, Berkeley, 2014). Although Lydia is a fictional character, her response to Alice's dementia points toward the kinds of moral experimentation that are in fact possible, and quietly being practiced, by ordinary people every day.

  17. Turnover-dependent inactivation of the nitrogenase MoFe-protein at high pH.

    Science.gov (United States)

    Yang, Kun-Yun; Haynes, Chad A; Spatzal, Thomas; Rees, Douglas C; Howard, James B

    2014-01-21

    Proton uptake accompanies the reduction of all known substrates by nitrogenase. As a consequence, a higher pH should limit the availability of protons as a substrate essential for turnover, thereby increasing the proportion of more highly reduced forms of the enzyme for further study. The utility of the high-pH approach would appear to be problematic in view of the observation reported by Pham and Burgess [(1993) Biochemistry 32, 13725-13731] that the MoFe-protein undergoes irreversible protein denaturation above pH 8.65. In contrast, we found by both enzyme activity and crystallographic analyses that the MoFe-protein is stable when incubated at pH 9.5. We did observe, however, that at higher pHs and under turnover conditions, the MoFe-protein is slowly inactivated. While a normal, albeit low, level of substrate reduction occurs under these conditions, the MoFe-protein undergoes a complex transformation; initially, the enzyme is reversibly inhibited for substrate reduction at pH 9.5, yet in a second, slower process, the MoFe-protein becomes irreversibly inactivated as measured by substrate reduction activity at the optimal pH of 7.8. The final inactivated MoFe-protein has an increased hydrodynamic radius compared to that of the native MoFe-protein, yet it has a full complement of iron and molybdenum. Significantly, the modified MoFe-protein retains the ability to specifically interact with its nitrogenase partner, the Fe-protein, as judged by the support of ATP hydrolysis and by formation of a tight complex with the Fe-protein in the presence of ATP and aluminum fluoride. The turnover-dependent inactivation coupled to conformational change suggests a mechanism-based transformation that may provide a new probe of nitrogenase catalysis.

  18. Evaluation of a novel fluorescent nanobeacon for targeted imaging of Thomsen-Friedenreich associated colorectal cancer

    Directory of Open Access Journals (Sweden)

    Nakase H

    2017-03-01

    Full Text Available Hiroshi Nakase,1,2 Shinji Sakuma,3 Takumi Fukuchi,4 Takuya Yoshino,1,5 Kohta Mohri,3 Kohei Miyata,3,6 Hironori Kumagai,6 Ken-Ichiro Hiwatari,6 Kazufumi Tsubaki,6 Tetsuya Ikejima,6 Etsuo Tobita,6 Meiying Zhu,7 Kevin J Wilson,7 Kay Washington,8 John C Gore,7,9–13 Wellington Pham7,9–12,14 1Division of Endoscopy, Kyoto University Hospital, Kyoto, Japan; 2Department of Gastroenterology and Hepatology, Sapporo Medical University School of Medicine, Sapporo, Hokkaido, Japan; 3Faculty of Pharmaceutical Sciences, Setsunan University, Hirakata, Osaka, Japan; 4Gastroenterology and Hepatology, Osakafu Saiseikai Nakatsu Hospital, Osaka, Japan; 5Division of Inflammatory Bowel Disease, Digestive Disease Center, Kitano Hospital, Osaka, Japan; 6Advanced Materials R&D Laboratory, ADEKA Corp., Tokyo, Japan; 7Department of Radiology, Vanderbilt University Institute of Imaging Science, 8Division of Gastrointestinal and Hepatic Pathology, Vanderbilt School of Medicine, 9Department of Radiology and Radiological Sciences, 10Department of Biomedical Engineering, 11Vanderbilt Ingram Cancer Center, Vanderbilt School of Medicine, 12Vanderbilt Brain Institute, 13Molecular Physiology and Biophysics, 14Vanderbilt Institute of Chemical Biology, Vanderbilt University, Nashville, TN, USA Abstract: The Thomsen–Friedenreich (TF antigen represents a prognostic biomarker of colorectal carcinoma. Here, using a nanobeacon, the surface of which was fabricated with peanut agglutinin as TF-binding molecules, we demonstrate that the nanobeacon is able to detect TF antigen in frozen and freshly biopsied polyps using fluorescence microscopy. Our results provide important clues about how to detect aberrant colonic tissues in the most timely fashion. Given the versatile application method for this topical nanobeacon, the protocol used in this work is amenable to clinical colonoscopy. Moreover, the prospects of clinical translation of this technology are evident. Keywords: TF antigen

  19. Synthesis, characterization, and biological evaluation of poly(L-γ-glutamyl-glutamine-paclitaxel nanoconjugate

    Directory of Open Access Journals (Sweden)

    Sang Van

    2010-10-01

    Full Text Available Sang Van1, Sanjib K Das1, Xinghe Wang1, Zhongling Feng1, Yi Jin1, Zheng Hou1, Fu Chen1, Annie Pham1, Nan Jiang1, Stephen B Howell2, Lei Yu11Nitto Denko Technical Corporation, Oceanside, CA, USA; 2Moores Cancer Center, University of California, La Jolla, San Diego, CA, USAAbstract: The purpose of this study was to develop a novel, highly water-soluble poly(L-γ-glutamyl-glutamine-paclitaxel nanoconjugate (PGG-PTX that would improve the therapeutic index of paclitaxel (PTX. PGG-PTX is a modification of poly(L-glutamic acid-paclitaxel conjugate (PGA-PTX in which an additional glutamic acid has been added to each glutamic side chain in the polymer. PGG-PTX has higher water-solubility and faster dissolution than PGA-PTX. Unlike PGA-PTX, PGG-PTX self-assembles into nanoparticles, whose size remains in the range of 12–15 nm over the concentration range from 25 to 2,000 µg/mL in saline. Its critical micellar concentration in saline was found to be ~25 µg/mL. The potency of PGG-PTX when tested in vitro against the human lung cancer H460 cell line was comparable to other known polymer-PTX conjugates. However, PGG-PTX possesses lower toxicity compared with PGA-PTX in mice. The maximum tolerated dose of PGG-PTX was found to be 350 mg PTX/kg, which is 2.2-fold higher than the maximum tolerated dose of 160 mg PTX/kg reported for the PGA-PTX. This result indicates that PGG-PTX was substantially less toxic in vivo than PGA-PTX.Keywords: nanoconjugates, poly(L-glutamic acid, poly(L-γ-glutamyl-glutamine-paclitaxel, nanoparticles, anticancer

  20. Improved proliferation of antigen-specific cytolytic T lymphocytes using a multimodal nanovaccine

    Directory of Open Access Journals (Sweden)

    Li B

    2016-11-01

    Full Text Available Bo Li,1,2 Michael Siuta,1 Vanessa Bright,1,2 Dmitry Koktysh,3,4 Brittany K Matlock,5 Megan E Dumas,1 Meiying Zhu,1 Alex Holt,1 Donald Stec,3,6 Shenglou Deng,7 Paul B Savage,7 Sebastian Joyce,8,9 Wellington Pham1,2,6,10–12 1Institute of Imaging Science, Vanderbilt University School of Medicine, 2Department of Radiology and Radiological Sciences, 3Department of Chemistry, Vanderbilt University, 4Vanderbilt Institute of Nanoscale Science and Engineering, 5Vanderbilt Flow Cytometry Shared Resource, Vanderbilt University, 6Vanderbilt Institute of Chemical Biology, 7Department of Chemistry and Biochemistry, Brigham Young University, 8Department of Pathology, Microbiology and Immunology, Vanderbilt University, 9Veterans Administration Tennessee Valley Healthcare System, 10Department of Biomedical Engineering, 11Vanderbilt Ingram Cancer Center, 12Vanderbilt Brain Institute, Vanderbilt University, Nashville, TN, USA Abstract: The present study investigated the immunoenhancing property of our newly designed nanovaccine, that is, its ability to induce antigen-specific immunity. This study also evaluated the synergistic effect of a novel compound PBS-44, an α-galactosylceramide analog, in boosting the immune response induced by our nanovaccine. The nanovaccine was prepared by encapsulating ovalbumin (ova and an adjuvant within the poly(lactic-co-glycolic acid nanoparticles. Quantitative analysis of our study data showed that the encapsulated vaccine was physically and biologically stable; the core content of our nanovaccine was found to be released steadily and slowly, and nearly 90% of the core content was slowly released over the course of 25 days. The in vivo immunization studies exhibited that the nanovaccine induced stronger and longer immune responses compared to its soluble counterpart. Similarly, intranasal inhalation of the nanovaccine induced more robust antigen-specific CD8+ T cell response than intraperitoneal injection of nanovaccine

  1. Review of "P. Kumaraguru, J. Cranshaw, A. Acquisti, L. Cranor, J. Hong, M. Blair, T. Pham, School of phish: a real-world evaluation of anti-phishing training"

    NARCIS (Netherlands)

    Hartel, Pieter H.

    The well-designed "school of phish" experiment compares to what extent three groups, of about 170 participants each, fall for phishing scams. The control group received no training, one group was trained once, and the third group received two training sessions. The results indicate that training the

  2. The Importance of Trust in the Adoption and Use of Intelligent Assistive Technology by Older Adults to Support Aging in Place: Scoping Review Protocol.

    Science.gov (United States)

    McMurray, Josephine; Strudwick, Gillian; Forchuk, Cheryl; Morse, Adam; Lachance, Jessica; Baskaran, Arani; Allison, Lauren; Booth, Richard

    2017-11-02

    Intelligent assistive technologies that complement and extend human abilities have proliferated in recent years. Service robots, home automation equipment, and other digital assistant devices possessing artificial intelligence are forms of assistive technologies that have become popular in society. Older adults (>55 years of age) have been identified by industry, government, and researchers as a demographic who can benefit significantly from the use of intelligent assistive technology to support various activities of daily living. The purpose of this scoping review is to summarize the literature on the importance of the concept of "trust" in the adoption of intelligent assistive technologies to assist aging in place by older adults. Using a scoping review methodology, our search strategy will examine the following databases: ACM Digital Library, Allied and Complementary Medicine Database (AMED), Cumulative Index to Nursing and Allied Health Literature (CINAHL), Medline, PsycINFO, Scopus, and Web of Science. Two reviewers will independently screen the initial titles obtained from the search, and these results will be further inspected by other members of the research team for inclusion in the review. This review will provide insights into how the concept of trust is actualized in the adoption of intelligent assistive technology by older adults. Preliminary sensitization to the literature suggests that the concept of trust is fluid, unstable, and intimately tied to the type of intelligent assistive technology being examined. Furthermore, a wide range of theoretical lenses that include elements of trust have been used to examine this concept. This review will describe the concept of trust in the adoption of intelligent assistive technology by older adults, and will provide insights for practitioners, policy makers, and technology vendors for future practice. ©Josephine McMurray, Gillian Strudwick, Cheryl Forchuk, Adam Morse, Jessica Lachance, Arani Baskaran, Lauren

  3. A prospective echocardiographic evaluation of pulmonary hypertension in chronic hemodialysis patients in the United States: prevalence and clinical significance

    Directory of Open Access Journals (Sweden)

    Kumudha Ramasubbu

    2010-09-01

    Full Text Available Kumudha Ramasubbu1, Anita Deswal1, Cheryl Herdejurgen2, David Aguilar1, Adaani E Frost21Section of Cardiology, Michael E DeBakey VA Medical Center and Baylor College of Medicine, Houston, Texas, USA; 2Section of Pulmonary and Critical Care Medicine, Baylor College of Medicine, Houston, Texas, USABackground: Pulmonary hypertension (PH, a disease which carries substantial morbidity and mortality, has been reported to occur in 25%–45% of dialysis patients. No prospective evaluation of the prevalence or clinical significance of PH in chronic dialysis patients in the United States (US has been undertaken.Methods: Echocardiograms were performed prospectively in chronic hemodialysis patients prior to dialysis at a single dialysis center. PH was defined as a tricuspid regurgitant jet ≥2.5 m/s and “more severe PH” as ≥3.0 m/s. Clinical outcomes recovered were all-cause hospitalizations and death at 12 months.Results: In a cohort of 90 patients, 42 patients (47% met the definition of PH. Of those, 18 patients (20% met the definition of more severe PH. At 12 months, mortality was significantly higher in patients with PH (26% compared with patients without PH (6%. All-cause hospitalizations were similar in patients with PH and without PH. Echocardiographic findings suggesting impaired left ventricular function and elevated pulmonary capillary wedge pressure were significantly associated with PH.Conclusion: This prospective cross-sectional study of a single dialysis unit suggests that PH may be present in nearly half of US dialysis patients and when present is associated with increased mortality. Echocardiographic findings demonstrate an association between elevated filling pressures, elevated pulmonary artery pressures, and higher mortality, suggesting that the PH may be secondary to diastolic dysfunction and compounded by volume overload.Keywords: renal failure, pulmonary hypertension, diastolic dysfunction

  4. Layered nanoemulsions as mucoadhesive buccal systems for controlled delivery of oral cancer therapeutics

    Directory of Open Access Journals (Sweden)

    Gavin A

    2015-02-01

    Full Text Available Amy Gavin,1 Jimmy TH Pham,2 Dawei Wang,2 Bill Brownlow,3 Tamer A Elbayoumi3 1College of Dental Medicine, 2Arizona College of Osteopathic Medicine, 3Department of Pharmaceutical Sciences, College of Pharmacy-Glendale, Midwestern University, Glendale, AZ, USA Abstract: Oral cavity and oropharyngeal cancers are considered the eighth most common cancer worldwide, with relatively poor prognosis (62% of patients surviving 5 years, after diagnosis. The aim of this study was to develop a proof-of-concept mucoadhesive lozenge/buccal tablet, as a potential platform for direct sustained delivery of therapeutic antimitotic nanomedicines. Our system would serve as an adjuvant therapy for oral cancer patients undergoing full-scale diagnostic and operative treatment plans. We utilized lipid-based nanocarriers, namely nanoemulsions (NEs, containing mixed-polyethoxylated emulsifiers and a tocopheryl moiety–enriched oil phase. Prototype NEs, loaded with the proapoptotic lipophilic drug genistein (Gen, were further processed into buccal tablet formulations. The chitosan polyelectrolyte solution overcoat rendered NE droplets cationic, by acting as a mucoadhesive interfacial NE layer. With approximate size of 110 nm, the positively charged chitosan-layered NE (+25 mV vs negatively charged chitosan-free/primary aqueous NE (-28 mV exhibited a controlled-release profile and effective mucoadhesion for liquid oral spray prototypes. When punch-pressed, porous NE-based buccal tablets were physically evaluated for hardness, friability, and swelling in addition to ex vivo tissue mucoadhesion force and retention time measurements. Chitosan-containing NE tablets were found equivalent to primary NE and placebo tablets in compression tests, yet significantly superior in all ex vivo adhesion and in vitro release assays (P≤0.05. Following biocompatibility screening of prototype chitosan-layered NEs, substantial anticancer activity of selected cationic Gen-loaded NE

  5. Uncertainty Quantification of Calculated Temperatures for the U.S. Capsules in the AGR-2 Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Lybeck, Nancy [Idaho National Lab. (INL), Idaho Falls, ID (United States); Einerson, Jeffrey J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Pham, Binh T. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hawkes, Grant L. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-03-01

    A series of Advanced Gas Reactor (AGR) irradiation experiments are being conducted within the Advanced Reactor Technology (ART) Fuel Development and Qualification Program. The main objectives of the fuel experimental campaign are to provide the necessary data on fuel performance to support fuel process development, qualify a fuel design and fabrication process for normal operation and accident conditions, and support development and validation of fuel performance and fission product transport models and codes (PLN-3636). The AGR-2 test was inserted in the B-12 position in the Advanced Test Reactor (ATR) core at Idaho National Laboratory (INL) in June 2010 and successfully completed irradiation in October 2013, resulting in irradiation of the TRISO fuel for 559.2 effective full power days (EFPDs) during approximately 3.3 calendar years. The AGR-2 data, including the irradiation data and calculated results, were qualified and stored in the Nuclear Data Management and Analysis System (NDMAS) (Pham and Einerson 2014). To support the U.S. TRISO fuel performance assessment and to provide data for validation of fuel performance and fission product transport models and codes, the daily as-run thermal analysis has been performed separately on each of four AGR-2 U.S. capsules for the entire irradiation as discussed in (Hawkes 2014). The ABAQUS code’s finite element-based thermal model predicts the daily average volume-average fuel temperature and peak fuel temperature in each capsule. This thermal model involves complex physical mechanisms (e.g., graphite holder and fuel compact shrinkage) and properties (e.g., conductivity and density). Therefore, the thermal model predictions are affected by uncertainty in input parameters and by incomplete knowledge of the underlying physics leading to modeling assumptions. Therefore, alongside with the deterministic predictions from a set of input thermal conditions, information about prediction uncertainty is instrumental for the ART

  6. Evaluating an undergraduate interprofessional simulation-based educational module: communication, teamwork, and confidence performing cardiac resuscitation skills

    Directory of Open Access Journals (Sweden)

    Marian Luctkar-Flude

    2010-11-01

    Full Text Available Marian Luctkar-Flude1, Cynthia Baker1, Cheryl Pulling1, Robert McGraw2, Damon Dagnone2, Jennifer Medves1, Carly Turner-Kelly11School of Nursing, Queen’s University, Kingston, Ontario, Canada; 2School of Medicine, Queen’s University, Kingston, Ontario, CanadaPurpose: Interprofessional (IP collaboration during cardiac resuscitation is essential and contributes to patient wellbeing. The purpose of this study is to evaluate an innovative simulation-based IP educational module for undergraduate nursing and medical students on cardiac resuscitation skills.Methods: Nursing and medical trainees participated in a new cardiac resuscitation curriculum involving a 2-hour IP foundational cardiac resuscitation skills lab, followed by three 2-hour IP simulation sessions. Control group participants attended the existing two 2-hour IP simulation sessions. Study respondents (N = 71 completed a survey regarding their confidence performing cardiac resuscitation skills and their perceptions of IP collaboration.Results: Despite a consistent positive trend, only one out of 17 quantitative survey items were significantly improved for learners in the new curriculum. They were more likely to report feeling confident managing the airway during cardiac resuscitation (P = 0.001. Overall, quantitative results suggest that senior nursing and medical students were comfortable with IP communication and teamwork and confident with cardiac resuscitation skills. There were no significant differences between nursing students’ and medical students’ results. Through qualitative feedback, participants reported feeling comfortable learning with students from other professions and found value in the IP simulation sessions.Conclusion: Results from this study will inform ongoing restructuring of the IP cardiac resuscitation skills simulation module as defined by the action research process. Specific improvements that are suggested by these findings include strengthening the team

  7. Adoption, Acceptability, and Effectiveness of a Mobile Health App for Personalized Prostate Cancer Survivorship Care: Protocol for a Realist Case Study of the Ned App.

    Science.gov (United States)

    Pham, Quynh; Cafazzo, Joseph A; Feifer, Andrew

    2017-10-12

    what circumstances. Understanding the impact of digital health interventions such as Ned on how survivors care for themselves is critical to realizing patient-centered care. ©Quynh Pham, Joseph A Cafazzo, Andrew Feifer. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 12.10.2017.

  8. Type 2 diabetes in Vietnam: a cross-sectional, prevalence-based cost-of-illness study

    Directory of Open Access Journals (Sweden)

    Le NTD

    2017-08-01

    Full Text Available Nguyen Tu Dang Le, Luyen Dinh Pham, Trung Quang Vo Department of Pharmacy Administration, Faculty of Pharmacy, University of Medicine and Pharmacy at Ho Chi Minh City, Vietnam Background: According to the International Diabetes Federation, total global health care expenditures for diabetes tripled between 2003 and 2013 because of increases in the number of people with diabetes as well as in the average expenditures per patient. This study aims to provide accurate and timely information about the economic impacts of type 2 diabetes mellitus (T2DM in Vietnam. Method: The cost-of-illness estimates followed a prospective, prevalence-based approach from the societal perspective of T2DM with 392 selected diabetic patients who received treatment from a public hospital in Ho Chi Minh City, Vietnam, during the 2016 fiscal year. Results: In this study, the annual cost per patient estimate was US $246.10 (95% CI 228.3, 267.2 for 392 patients, which accounted for about 12% (95% CI 11, 13 of the gross domestic product per capita in 2017. That includes US $127.30, US $34.40 and US $84.40 for direct medical costs, direct nonmedical expenditures, and indirect costs, respectively. The cost of pharmaceuticals accounted for the bulk of total expenditures in our study (27.5% of total costs and 53.2% of direct medical costs. A bootstrap analysis showed that female patients had a higher cost of treatment than men at US $48.90 (95% CI 3.1, 95.0; those who received insulin and oral antidiabetics (OAD also had a statistically significant higher cost of treatment compared to those receiving OAD, US $445.90 (95% CI 181.2, 690.6. The Gradient Boosting Regression (Ensemble method and Lasso Regression (Generalized Linear Models were determined to be the best models to predict the cost of T2DM (R2=65.3, mean square error [MSE]=0.94; and R2=64.75, MSE=0.96, respectively. Conclusion: The findings of this study serve as a reference for policy decision making in diabetes

  9. Role of motive forces for the spin torque transfer for nano-structures

    Science.gov (United States)

    Barnes, Stewart

    2009-03-01

    Despite an announced imminent commercial realization of spin transfer random access memory (SPRAM) the current theory evolved from that of Slonczewski [1,2] does not conserve energy. Barnes and Maekawa [3] have shown, in order correct this defect, forces which originate from the spin rather than the charge of an electron must be accounted for, this leading to the concept of spin-motive-forces (smf) which must appear in Faraday's law and which significantly modifies the theory for spin-valves and domain wall devices [4]. A multi-channel theory in which these smf's redirect the spin currents will be described. In nano-structures it is now well known that the Kondo effect is reflected by conductance peaks. In essence, the spin degrees of freedom are used to enhance conduction. In a system with nano-magnets and a Coulomb blockade [5] the similar spin channels can be the only means of effective conduction. This results in a smf which lasts for minutes and an enormous magneto-resistance [5]. This implies the possibility of ``single electron memory'' in which the magnetic state is switched by a single electron. [4pt] [1] J. C. Slonczewski, Current-Driven Excitation of Magnetic Multilayers J. Magn. Magn. Mater. 159, L1 (1996). [0pt] [2] Y. Tserkovnyak, A. Brataas, G. E. W. Bauer, and B. I. Halperin, Nonlocal magnetization dynamics in ferromagnetic heterostructures, Rev. Mod. Phys. 77, 1375 (2005). [0pt] [3] S. E. Barnes and S. Maekawa, Generalization of Faraday's Law to Include Nonconservative Spin Forces Phys. Rev. Lett. 98, 246601 (2007); S. E. Barnes and S. Maekawa, Currents induced by domain wall motion in thin ferromagnetic wires. arXiv:cond-mat/ 0410021v1 (2004). [0pt] [4] S. E., Barnes, Spin motive forces, measurement, and spin-valves. J. Magn. Magn. Mat. 310, 2035-2037 (2007); S. E. Barnes, J. Ieda. J and S. Maekawa, Magnetic memory and current amplification devices using moving domain walls. Appl. Phys. Lett. 89, 122507 (2006). [0pt] [5] Pham-Nam Hai, Byung-Ho Yu

  10. Investigating analgesic and psychological factors associated with risk of postpartum depression development: a case–control study

    Directory of Open Access Journals (Sweden)

    Suhitharan T

    2016-06-01

    Full Text Available Thangavelautham Suhitharan,1 Thi Phuong Tu Pham,2 Helen Chen,2,3 Pryseley Nkouibert Assam,4 Rehena Sultana,2 Nian-Lin Reena Han,5 Ene-Choo Tan,6,7 Ban Leong Sng1,2 1Department of Women’s Anaesthesia, KK Women’s and Children’s Hospital, 2Duke-NUS Medical School, 3Women’s Service, Department of Psychological Medicine, KK Women’s and Children’s Hospital, 4Singapore Clinical Research Institute, 5Division of Clinical Support Services, 6Research Laboratory, KK Women’s and Children’s Hospital, 7SingHealth Paediatrics Academic Clinical Programme, Duke-NUS Medical School, Singapore Aim: The aim of this study was to investigate the role of peripartum analgesic and psychological factors that may be related to postpartum depression (PPD.Methods: This case–control study was conducted in pregnant females who delivered at KK Women’s and Children’s Hospital from November 2010 to October 2013 and had postpartum psychological assessment. Demographic, medical, and postpartum psychological status assessments, intrapartum data including method of induction of labor, mode of labor analgesia, duration of first and second stages of labor, mode of delivery, and pain intensity on hospital admission and after delivery were collected. PPD was assessed using the Edinburgh Postnatal Depression Scale and clinical assessment by the psychiatrist.Results: There were 62 cases of PPD and 417 controls after childbirth within 4–8 weeks. The odds of PPD was significantly lower (33 of 329 [10.0%] in females who received epidural analgesia for labor compared with those who chose nonepidural analgesia (29 of 150 [19.3%] ([odds ratio] 0.47 (0.27–0.8, P=0.0078. The multivariate analysis showed that absence of labor epidural analgesia, increasing age, family history of depression, history of depression, and previous history of PPD were independent risk factors for development of PPD.Conclusion: The absence of labor epidural analgesia remained as an independent

  11. Increased Cardiometabolic Risk and Worsening Hypoxemia at High Altitude.

    Science.gov (United States)

    Miele, Catherine H; Schwartz, Alan R; Gilman, Robert H; Pham, Luu; Wise, Robert A; Davila-Roman, Victor G; Jun, Jonathan C; Polotsky, Vsevolod Y; Miranda, J Jaime; Leon-Velarde, Fabiola; Checkley, William

    2016-06-01

    Miele, Catherine H., Alan R. Schwartz, Robert H. Gilman, Luu Pham, Robert A. Wise, Victor G. Davila-Roman, Jonathan C. Jun, Vsevolod Y. Polotsky, J. Jaime Miranda, Fabiola Leon-Velarde, and William Checkley. Increased cardiometabolic risk and worsening hypoxemia at high altitude. High Alt Med Biol. 17:93-100, 2016.-Metabolic syndrome, insulin resistance, diabetes, and dyslipidemia are associated with an increased risk of cardiovascular disease. While excessive erythrocytosis is associated with cardiovascular complications, it is unclear how worsening hypoxemia of any degree affects cardiometabolic risk factors in high-altitude populations. We studied the relationship between daytime resting oxyhemoglobin saturation and cardiometabolic risk factors in adult participants living in Puno, Peru (3825 m above sea level). We used multivariable logistic regression models to study the relationship between having a lower oxyhemoglobin saturation and markers of cardiometabolic risk. Nine hundred and fifty-four participants (mean age 55 years, 52% male) had information available on pulse oximetry and markers of cardiometabolic risk. Average oxyhemoglobin saturation was 90% (interquartile range 88%-92%) and 43 (4.5%) had excessive erythrocytosis. Older age, decreased height-adjusted lung function, and higher body mass index (BMI) were associated with having an oxyhemoglobin saturation ≤85%. When adjusting for age, sex, socioeconomic status, having excessive erythrocytosis, and site, we found that each 5% decrease in oxyhemoglobin saturation was associated with a higher adjusted odds of metabolic syndrome (OR = 1.35, 95% CI: 1.07-1.72, p 2 mass units (OR = 1.29, 95% CI: 1.00-1.67, p < 0.05), hemoglobin A1c ≥6.5% (OR = 1.66, 95% CI: 1.09-2.51, p < 0.04), and high sensitivity C-reactive protein (hs-CRP) ≥3 mg/L (OR = 1.46, 95% CI: 1.09-1.96, p < 0.01). In high-altitude populations in Puno, Peru, a higher BMI and lower pulmonary function were

  12. Tracking multidecadal trends in sea level using coral microatolls

    Science.gov (United States)

    Majewski, Jedrzej; Pham, Dat; Meltzner, Aron; Switzer, Adam; Horton, Benjamin; Heng, Shu Yun; Warrick, David

    2015-04-01

    Tracking multidecadal trends in sea level using coral microatolls Jędrzej M. Majewski 1, Dat T. Pham1, Aron J. Meltzner 1, Adam D. Switzer 1, Benjamin P. Horton2, Shu Yun Heng1, David Warrick3, 1 Earth Observatory of Singapore, Nanyang Technological University, Singapore 2 Department of Marine and Coastal Sciences, Rutgers University, New Brunswick, NJ, USA 3 Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA, USA Coral microatolls can be used to study relative sea-level change at multidecadal timescales associated with vertical land movements, climate induced sea-level rise and other oceanographic phenomena such as the El Niño/Southern Oscillation (ENSO) or Indian Ocean Dipole (IOD) with the assumption that the highest level of survival (HLS) of coral microatolls track sea level over the course of their lifetimes. In this study we compare microatoll records covering from as early as 1883 through 2013, from two sites in Indonesia, with long records (>20 years) from proximal tide gauges, satellite altimetry, and other sea-level reconstructions. We compared the HLS time series derived from open-ocean and moated (or ponded) microatolls on tectonically stable Belitung Island and a potentially tectonically active setting in Mapur Island, with sea-level reconstructions for 1950-2011. The sea-level reconstructions are based on ground and satellite measurements, combining a tide model with the Estimating the Circulation and Climate of the Ocean (ECCO) model. Our results confirm that open-ocean microatolls do track low water levels at multi decadal time scales and can be used as a proxy for relative sea level (RSL) over time. However, microatolls that are even partially moated are unsuitable and do not track RSL; rather, their growth patterns likely reflect changes in the elevation of the sill of the local pond, as reported by earlier authors. Our ongoing efforts will include an attempt to recognize similarities in moated

  13. Control of mixed seismic isolation systems

    International Nuclear Information System (INIS)

    Teodorescu, Catalin-Stefan

    2013-01-01

    Vibration attenuation control designs are proposed for reduced plant models consisting of n-degree-of-freedom base seismically-isolated structures (i.e., a specific type of earthquake-resistant design), modeled by uncertain nonlinear systems and subjected to one-dimensional horizontal ground acceleration (i.e. the earthquake signal), treated as unknown disturbance but assumed to be bounded. In control systems literature, this is a perturbation attenuation problem. The main result of this PhD is the development of a modified version of Leitmann and co-authors' classical result on the stabilization of uncertain nonlinear systems. The proposed theorem consists of a bounded nonlinear feedback control law that is capable of ensuring uniform boundedness and uniform ultimate boundedness in closed-loop. In particular, it can be applied to solving semi-active control design problems, which are currently dealt with in earthquake engineering. The control objective is to improve the behavior (i.e. response) of mixed base-isolated structures to external disturbance, namely earthquakes. What differentiates our problem from the majority to be found in the literature is that: (i) attention is being paid to the protection of equipment placed inside the structure an not only to the structure itself; (ii) instead of using regular performance indicators expressed in terms of relative base displacement versus floors accelerations, we use solely the pseudo-acceleration floor response spectra, as it was proposed in previous recent works by Politopoulos and Pham. Actually, this work is an attempt to explicitly use floor response spectra as performance criterion. Concerning the application procedure, some of the topics that were detailed are: (i) modeling of earthquake signals; (ii) tuning of control law parameters based on vibration theory; (iii) validation and testing of the closed-loop behavior using numerical simulations: for simplicity reasons, we take n=2. This procedure can be

  14. A systematic review of interventions conducted in clinical or community settings to improve dual-task postural control in older adults

    Directory of Open Access Journals (Sweden)

    Agmon M

    2014-03-01

    Full Text Available Maayan Agmon,1 Basia Belza,2 Huong Q Nguyen,2,3 Rebecca G Logsdon,2 Valerie E Kelly41The Cheryl Spencer Department of Nursing, Faculty of Social Welfare and Health Studies, University of Haifa, Israel; 2School of Nursing, University of Washington, Seattle, WA, USA; 3Department of Research and Evaluation, Kaiser Permanente, CA, USA; 4School of Medicine, University of Washington, Seattle, WA, USABackground: Injury due to falls is a major problem among older adults. Decrements in dual-task postural control performance (simultaneously performing two tasks, at least one of which requires postural control have been associated with an increased risk of falling. Evidence-based interventions that can be used in clinical or community settings to improve dual-task postural control may help to reduce this risk.Purpose: The aims of this systematic review are: 1 to identify clinical or community-based interventions that improved dual-task postural control among older adults; and 2 to identify the key elements of those interventions.Data sources: Studies were obtained from a search conducted through October 2013 of the following electronic databases: PubMed, CINAHL, PsycINFO, and Web of Science.Study selection: Randomized and nonrandomized controlled studies examining the effects of interventions aimed at improving dual-task postural control among community-dwelling older adults were selected.Data extraction: All studies were evaluated based on methodological quality. Intervention characteristics including study purpose, study design, and sample size were identified, and effects of dual-task interventions on various postural control and cognitive outcomes were noted.Data synthesis: Twenty-two studies fulfilled the selection criteria and were summarized in this review to identify characteristics of successful interventions.Limitations: The ability to synthesize data was limited by the heterogeneity in participant characteristics, study designs, and outcome

  15. Psychometric evaluation of the Sheehan Disability Scale in adult patients with attention-deficit/hyperactivity disorder

    Directory of Open Access Journals (Sweden)

    Coles T

    2014-05-01

    Full Text Available Theresa Coles,1 Cheryl Coon,1 Carla DeMuro,1 Lori McLeod,1 Ari Gnanasakthy21Patient-Reported Outcomes, RTI Health Solutions, Research Triangle Park, NC, 2Novartis Pharmaceuticals, East Hanover, NJ, USAAbstract: Inattention and impulsivity symptoms are common among adults with attention-deficit/hyperactivity disorder (ADHD, which can lead to difficulty concentrating, restlessness, difficulty completing tasks, disorganization, impatience, and impulsiveness. Many adults with ADHD find it difficult to focus and prioritize. Resulting outcomes, such as missed deadlines and forgotten engagements, may ultimately impact the ability to function at work, school, home, or in a social environment. The European Medicines Agency guidelines for evaluating medicinal products for ADHD recommend inclusion of both functional outcomes, such as school, social, or work functioning, and outcomes related to symptoms of ADHD in clinical studies of novel medication primary efficacy endpoints. Due to its performance in other disease areas and the relevance of its items as evidenced by content validity analyses, the Sheehan Disability Scale (SDS was chosen to assess functional impairment in ADHD. The aim of this study was to investigate the psychometric properties of the SDS, used as a brief measure of functional impairment in a number of psychiatric disorders, in adult patients with ADHD. To the authors' knowledge, this is the first study to evaluate the reliability of the SDS (based on Cronbach's coefficient alpha and test-retest reliability, its validity (construct and known-groups validity, and its ability to detect change in this patient population. This study also established a preliminary responder definition for the SDS in this study population to determine when change can be considered clinically beneficial in a clinical trial setting. The psychometric results support the use of the SDS subscales (items 1–3 and total score (sum of items 1–3 in an ADHD

  16. Novel in situ self-assembly nanoparticles for formulating a poorly water-soluble drug in oral solid granules, improving stability, palatability, and bioavailability

    Directory of Open Access Journals (Sweden)

    Guo S

    2016-04-01

    Full Text Available Shujie Guo,1 Kevin Pham,2 Diana Li,2 Scott R Penzak,3 Xiaowei Dong2 1State Key Laboratory of Medical Genomics, Shanghai Key Laboratory of Hypertension, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, People’s Republic of China; 2Department of Pharmaceutical Sciences, 3Department of Pharmacotherapy, University of North Texas Health Science Center, Fort Worth, TX, USA Purpose: The purpose of this study was to develop a novel lipid-based nanotechnology to formulate poorly water-soluble drugs in oral solid granules to improve stability, palatability, and bioavailability. Materials and methods: In one method, we prepared ritonavir (RTV nanoparticles (NPs by a microemulsion-precursor method and then converted the RTV NPs to solid granules by wet granulation to produce RTV NP-containing granules. In the other innovative method, we did not use water in the formulation preparation, and discovered novel in situ self-assembly nanoparticles (ISNPs. We prepared RTV ISNP granules that did not initially contain NPs, but spontaneously produced RTV ISNPs when the granules were introduced to water with gentle agitation. We fully characterized these RTV nanoformulations. We also used rats to test the bioavailability of RTV ISNP granules. Finally, an Astree electronic tongue was used to assess the taste of the RTV ISNP granules. Results: RTV NP-containing granules only had about 1% drug loading of RTV in the solid granules. In contrast, RTV ISNP granules achieved over 16% drug loading and were stable at room temperature over 24 weeks. RTV ISNPs had particle size between 160 nm and 300 nm with narrow size distribution. RTV ISNPs were stable in simulated gastric fluid for 2 hours and in simulated intestinal fluid for another 6 hours. The data from the electronic tongue showed that the RTV ISNP granules were similar in taste to blank ISNP granules, but were much different from RTV solution. RTV ISNP granules increased RTV bioavailability

  17. "Presumed fair: Ironic effects of organizational diversity structures": Correction to Kaiser et al. (2013).

    Science.gov (United States)

    2016-06-01

    Reports an error in "Presumed fair: Ironic effects of organizational diversity structures" by Cheryl R. Kaiser, Brenda Major, Ines Jurcevic, Tessa L. Dover, Laura M. Brady and Jenessa R. Shapiro (Journal of Personality and Social Psychology, 2013[Mar], Vol 104[3], 504-519). In the article, a raw data merging error in one racial discrimination claim condition from Experiment 6 inadvertently resulted in data analyses on an inaccurate data set. When the error was discovered by the authors and corrected, all analyses reported in Experiment 6 for claim validity, seriousness of the claim, and support for the claimant were inaccurate and none were statistically significant. The conclusions should be altered to indicate that participants with management experience who reflected on their own workplace diversity policies did not show the predicted effects. The literature review, remaining five studies, and remaining conclusions in the article are unaffected by this error. Experiment 6 should also report that 26.4% (not 26.4.7%) of participants had a graduate degree and eight participants (not 8%) did not provide educational data. Experiment 5 should have referred to the claim validity measure as a six-item measure ( .92) rather than a five-item measure; analyses on claim validity are accurate in text. Table 2's note should have said standard errors, not standard deviations. (The following abstract of the original article appeared in record 2012-31077-001.) This research tests the hypothesis that the presence (vs. absence) of organizational diversity structures causes high-status group members (Whites, men) to perceive organizations with diversity structures as procedurally fairer environments for underrepresented groups (racial minorities, women), even when it is clear that underrepresented groups have been unfairly disadvantaged within these organizations. Furthermore, this illusory sense of fairness derived from the mere presence of diversity structures causes high

  18. Alteration of retinal layers in healthy subjects over 60 years of age until nonagenarians

    Directory of Open Access Journals (Sweden)

    Altay L

    2017-08-01

    Full Text Available Lebriz Altay,1 Cheryl Jahn,1 Mücella Arikan Yorgun,1 Albert Caramoy,1 Tina Schick,1 Carel B Hoyng,2 Anneke I den Hollander,2 Sascha Fauser1 1Department of Ophthalmology, University Hospital of Cologne, Cologne, Germany; 2Department of Ophthalmology, Radboud University Nijmegen Medical Centre, Nijmegen, the Netherlands Purpose: To assess alterations of retinal layers in healthy subjects over 60 years old. Methods: Retinal layers of 160 healthy subjects (aged 60–100 years without any retinal pathology were imaged using spectral domain optical coherence tomography. Mean thickness of retinal nerve fiber layer, ganglion cell/inner plexiform layer (GCLIPL, inner nuclear layer, outer plexiform layer/outer nuclear layer, photoreceptor complex (PR and retinal thickness (RT were measured in a 3.45 mm grid. Correlations between age and layers were estimated and linear regression equations were calculated. Different age-groups (60–69, 70–79, 80–89 years and nonagenarians, each group with 40 participants were compared. Results: Significant age-thickness correlations were observed for GCLIPL (P<0.001, r=-0.394, PR (P<0.001, r=-0.370 and RT (P<0.001, r=-0.290. A comparison between age groups 60–69 years and nonagenarians showed no significant thickness alteration of retinal nerve fiber layer (21.80±2.18 µm vs 22.82±2.97 µm, P=0.163, inner nuclear layer (37.23±3.02 µm vs 36.01±3.24 µm, P=0.07 and outer plexiform layer/outer nuclear layer (104.95±6.56 µm vs 104.23±7.59 µm, P=0.567, while GCLIPL (83.35±7.35 µm vs 74.38±9.09 µm, PR (83.03±3.31 µm vs 79.34±2.09 µm and RT (330.64±12.63 µm vs 316.83±18.35 µm showed a significant decrease (P<0.001 for all. Conclusion: Our study provides normative data of alterations of retinal layers for persons aged 60 years to nonagenarians and indicates a continuous decrease of RT, PR, and GCLIPL. This data may be useful for clinical trials investigating macular diseases in older patients

  19. Cost-effectiveness analysis of umeclidinium/vilanterol for the management of patients with moderate to very severe COPD using an economic model

    Directory of Open Access Journals (Sweden)

    Wilson MR

    2017-03-01

    Full Text Available Michele R Wilson,1 Jeetvan G Patel,2,3 Amber Coleman,2 Cheryl L McDade,1 Richard H Stanford,2 Stephanie R Earnshaw1 1RTI Health Solutions, Research Triangle Park, NC, USA; 2GSK, Research Triangle Park, NC, USA; 3Amgen Inc., Thousand Oaks, CA, USA Background: Bronchodilators such as long-acting muscarinic antagonists (LAMAs and long-acting β2-agonists (LABAs are central to the pharmacological management of COPD. Dual bronchodilation with umeclidinium/vilanterol (UMEC/VI; 62.5/25 µg is a novel LAMA/LABA combination approved for maintenance treatment for patients with COPD.Objective: The objective of this study was to assess the cost-effectiveness of maintenance treatment with UMEC/VI compared with tiotropium (TIO 18 µg, open dual LAMA + LABA treatment, or no long-acting bronchodilator treatment in patients with moderate to very severe COPD.Methods: A Markov model was developed to estimate the costs and outcomes associated with UMEC/VI treatment in patients with moderate to very severe COPD (GSK study number: HO-13-13411. Clinical efficacy, costs, utilities, and mortality obtained from the published literature were used as the model inputs. Costs are presented in US dollars based on 2015 prices. The model outputs are total costs, drug costs, other medical costs, number of COPD exacerbations, and quality-adjusted life-years (QALYs. Costs and outcomes were discounted at a 3% annual rate. Incremental cost-effectiveness ratios were calculated. One-way and probabilistic sensitivity analyses were conducted to assess the effects of changing parameters on the uncertainty of the results.Results: UMEC/VI treatment for moderate to very severe COPD was associated with lower lifetime medical costs ($82,344 compared with TIO ($88,822, open dual LAMA + LABA treatment ($114,442, and no long-acting bronchodilator ($86,751. Fewer exacerbations were predicted to occur with UMEC/VI treatment compared with no long-acting bronchodilator treatment. UMEC/VI provided

  20. Action-Oriented Population Nutrition Research: High Demand but Limited Supply.

    Science.gov (United States)

    Pham, Judy; Pelletier, David

    2015-05-27

    recent calls to expand population nutrition research agendas to more effectively inform and guide the initiation, development, implementation, and governance of policies, programs, and interventions to address the varied forms of nutrition-related problems. With heightened attention to the magnitude and importance of nutrition problems worldwide, there are substantial reasons and opportunities to incentivize and support such expansion. © Pham et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly cited. To view a copy of the license, visit http://creativecommons.org/licenses/by/3.0/

  1. In silico ordinary differential equation/partial differential equation hemodialysis model estimates methadone removal during dialysis

    Directory of Open Access Journals (Sweden)

    Linares OA

    2015-07-01

    Full Text Available Oscar A Linares,1 William E Schiesser,2 Jeffrey Fudin,3–6 Thien C Pham,6 Jeffrey J Bettinger,6 Roy O Mathew,6 Annemarie L Daly7 1Translational Genomic Medicine Lab, Plymouth Pharmacokinetic Modeling Study Group, Plymouth, MI, 2Department of Chemical and Biomolecular Engineering, Lehigh University, Bethlehem, PA, 3University of Connecticut School of Pharmacy, Storrs, CT, 4Western New England College of Pharmacy, Springfield, MA, 5Albany College of Pharmacy and Health Sciences, Albany, NY, 6Stratton VA Medical Center, Albany, NY, 7Grace Hospice of Ann Arbor, Ann Arbor, MI, USA Background: There is a need to have a model to study methadone’s losses during hemodialysis to provide informed methadone dose recommendations for the practitioner. Aim: To build a one-dimensional (1-D, hollow-fiber geometry, ordinary differential equation (ODE and partial differential equation (PDE countercurrent hemodialyzer model (ODE/PDE model. Methodology: We conducted a cross-sectional study in silico that evaluated eleven hemodialysis patients. Patients received a ceiling dose of methadone hydrochloride 30 mg/day. Outcome measures included: the total amount of methadone removed during dialysis; methadone’s overall intradialytic mass transfer rate coefficient, km; and, methadone’s removal rate, jME. Each metric was measured at dialysate flow rates of 250 mL/min and 800 mL/min. Results: The ODE/PDE model revealed a significant increase in the change of methadone’s mass transfer with increased dialysate flow rate, %Δ km=18.56, P=0.02, N=11. The total amount of methadone mass transferred across the dialyzer membrane with high dialysate flow rate significantly increased (0.042±0.016 versus 0.052±0.019 mg/kg, P=0.02, N=11. This was accompanied by a small significant increase in methadone’s mass transfer rate (0.113±0.002 versus 0.014±0.002 mg/kg/h, P=0.02, N=11. The ODE/PDE model accurately predicted methadone’s removal during dialysis. The absolute value

  2. Study of the correlations between fractional exhaled nitric oxide in exhaled breath and atopic status, blood eosinophils, FCER2 mutation, and asthma control in Vietnamese children

    Directory of Open Access Journals (Sweden)

    Nguyen-Thi-Bich H

    2016-09-01

    Full Text Available Hanh Nguyen-Thi-Bich,1 Huong Duong-Thi-Ly,2 Vu Thi Thom,2 Nhung Pham-Thi-Hong,2 Long Doan Dinh,2 Huong Le-Thi-Minh,1 Timothy John Craig,3 Sy Duong-Quy3,4 1Department of Immunology, Allergology, and Rheumatology, National Hospital of Pediatrics, Hanoi, Vietnam; 2School of Medicine and Pharmacy, Vietnam National University Hanoi, Vietnam; 3Department of Medicine, Penn State University, Hershey, PA, USA; 4Department of Respiratory Diseases, Lam Dong Medical College, Dalat, Vietnam Introduction: Fractional exhaled nitric oxide (FENO is a biomarker of airway inflammation in asthma. The measurement of FENO is utilized to assist in the diagnosis and treatment of children with asthma, especially for those treated with inhaled corticosteroids. Objectives: The aims of this study were to evaluate the correlations between FENO and atopic status, blood eosinophil levels, FCER2 mutation, and asthma control in Vietnamese children. Subjects and methods: This was a prospective and descriptive study approved by the local Ethical Board. All children with uncontrolled asthma, seen in the National Hospital of Pediatrics (Hanoi, Vietnam, were included. Exhaled breath FENO, blood eosinophils, skin prick test, total IgE, asthma control test (ACT, and FCER2 gene polymorphism were performed at inclusion. They were followed up at 3 months to evaluate clinical status, FENO levels, and ACT. Results: Forty-two children with uncontrolled asthma with a mean age of 10±3 years (6–16 years were included. The male/female ratio was 2.5/1. The mean FENO levels were 26±25 ppb. FENO was significantly higher in patients with a positive skin prick test for respiratory allergens (P<0.05. FENO was significantly correlated with blood eosinophil levels (r=0.5217; P=0.0004. Five of the 32 subjects (15.6% had a mutation of FCER2 gene (rs28364072 SNP. In this group, the levels of FENO were highest (37±10 ppb; P<0.05. The levels of FENO were significantly decreased after 3 months of

  3. Obituary: Michael James Ledlow, 1964-2004

    Science.gov (United States)

    Puxley, Philip John; Grashuis, Randon M.

    2004-12-01

    wide variety of interests including a wonderfully diverse taste in music and an exceptional talent for home brewing beer. Mike was one of those rare individuals, enthusiastic and driven by his work at the Observatory as well as by his personal research, and with the skills to deliver in both aspects. His devotion to the Observatory and to research was surpassed only by that for his family. He is survived by his wife Cheryl, their two children Alexandria ("Andrea") and Abigail ("Abi"), three stepdaughters Mandy, Memoree and Misty and his sister Lisa Gay Gilmore.

  4. A televideo exercise and nutrition program for children with acute lymphoblastic leukemia in maintenance therapy: design and methods

    Directory of Open Access Journals (Sweden)

    Gibson CA

    2015-07-01

    Full Text Available Cheryl A Gibson,1 Keith J August,2 Jerry L Greene,3 Stephen D Herrmann,4 Jaehoon Lee,5 Susan P Harvey,6 Kate Lambourne,3 Debra K Sullivan7 1Department of Internal Medicine, Division of General and Geriatric Medicine, University of Kansas Medical Center, KS, USA; 2Children's Mercy Hospital, MO, USA; 3Department of Health, Sport, and Exercise Sciences, University of Kansas, KS, USA; 4Children's Health Research Center, Sanford Research, SD, USA; 5Institute for Measurement, Methodology, Analysis and Policy, Texas Tech University, TX, USA; 6Center for Research on Learning, University of Kansas, KS, USA; 7Department of Dietetics and Nutrition, University of Kansas Medical Center, KS, USA Abstract: Changes in nutrient intake and decreased exercise resulting from cancer therapies as well as their side effects may be contributing factors in the increased body weight and differences in physical fitness observed in survivors of childhood acute lymphoblastic leukemia (ALL. This article will describe the study protocol for an intervention program designed to improve the physical activity and nutrition behaviors of ALL survivors. Twenty-four children aged between 4 years and 12 years with ALL will be randomized to a 6-month technology-based exercise and nutrition program (TLC4ALLKids or to enhanced usual care (eUC. The participants randomized to the TLC4ALLKids will participate in weekly, 1-hour coaching sessions on nutrition and physical activity and 1-hour physical activity classes delivered by group video conferencing. Participants will be provided with iPad tablets loaded with video conferencing software and the Healthy Lifestyle Tracking calendar to track daily nutrition and physical activity goals and weight. Both groups will be provided with Fitbit™ Zip to monitor physical activity. To assess feasibility, participant recruitment (achievement of proposed sample size, attendance (per weekly online sessions/assessment sessions, and adherence (number of

  5. Physicians’ use of computerized clinical decision supports to improve medication management in the elderly – the Seniors Medication Alert and Review Technology intervention

    Directory of Open Access Journals (Sweden)

    Alagiakrishnan K

    2016-01-01

    Full Text Available Kannayiram Alagiakrishnan,1 Patricia Wilson,2 Cheryl A Sadowski,3 Darryl Rolfson,1 Mark Ballermann,4,5 Allen Ausford,6,7 Karla Vermeer,7 Kunal Mohindra,8 Jacques Romney,9 Robert S Hayward10 1Department of Medicine, Division of Geriatric Medicine, 2Department of Medicine, 3Faculty of Pharmacy and Pharmaceutical Sciences, University of Alberta, 4Chief Medical Information Office, Alberta Health Services, 5Division of Critical Care, Department of Medicine, University of Alberta, 6Department of Family Medicine, University of Alberta, 7Lynwood Family Physician, 8eClinician EMR, Alberta Health Services-Information Systems, 9Department of Medicine, Division of Endocrinology, 10Division of General Internal Medicine, University of Alberta, Edmonton, AB, Canada Background: Elderly people (aged 65 years or more are at increased risk of polypharmacy (five or more medications, inappropriate medication use, and associated increased health care costs. The use of clinical decision support (CDS within an electronic medical record (EMR could improve medication safety.Methods: Participatory action research methods were applied to preproduction design and development and postproduction optimization of an EMR-embedded CDS implementation of the Beers’ Criteria for medication management and the Cockcroft–Gault formula for estimating glomerular filtration rates (GFR. The “Seniors Medication Alert and Review Technologies” (SMART intervention was used in primary care and geriatrics specialty clinics. Passive (chart messages and active (order-entry alerts prompts exposed potentially inappropriate medications, decreased GFR, and the possible need for medication adjustments. Physician reactions were assessed using surveys, EMR simulations, focus groups, and semi-structured interviews. EMR audit data were used to identify eligible patient encounters, the frequency of CDS events, how alerts were managed, and when evidence links were followed.Results: Analysis of

  6. Proceedings of Patient Reported Outcome Measure’s (PROMs Conference Sheffield 2016: advances in patient reported outcomes research

    Directory of Open Access Journals (Sweden)

    Tim Croudace

    2016-10-01

    longitudinal parameter shifts in epidemiological data: measurement invariance and response shifts in cohort and survey data describing the UK’s Quality of Life Jan R. Boehnke O12 Patient-reported outcomes within health technology decision making: current status and implications for future policy Andrew Trigg, Ruth Howells O13 Can social care needs and well-being be explained by the EQ-5D? Analysis of Health Survey for England dataset Jeshika Singh, Subhash Pokhrel, Louise Longworth O14 Where patients and policy meet: exploring individual-level use of the Long-Term Conditions Questionnaire (LTCQ Caroline Potter, Cheryl Hunter, Laura Kelly, Elizabeth Gibbons, Julian Forder, Angela Coulter, Ray Fitzpatrick, Michele Peters

  7. A One Health overview, facilitating advances in comparative medicine and translational research.

    Science.gov (United States)

    Stroud, Cheryl; Dmitriev, Igor; Kashentseva, Elena; Bryan, Jeffrey N; Curiel, David T; Rindt, Hans; Reinero, Carol; Henry, Carolyn J; Bergman, Philip J; Mason, Nicola J; Gnanandarajah, Josephine S; Engiles, Julie B; Gray, Falon; Laughlin, Danielle; Gaurnier-Hausser, Anita; Wallecha, Anu; Huebner, Margie; Paterson, Yvonne; O'Connor, Daniel; Treml, Laura S; Stannard, James P; Cook, James L; Jacobs, Marc; Wyckoff, Gerald J; Likins, Lee; Sabbagh, Ubadah; Skaff, Andrew; Guloy, Amado S; Hays, Harlen D; LeBlanc, Amy K; Coates, Joan R; Katz, Martin L; Lyons, Leslie A; Johnson, Gayle C; Johnson, Gary S; O'Brien, Dennis P; Duan, Dongsheng; Calvet, James P; Gandolfi, Barbara; Baron, David A; Weiss, Mark L; Webster, Debra A; Karanu, Francis N; Robb, Edward J; Harman, Robert J

    2016-08-01

    A1 One health advances and successes in comparative medicine and translational researchCheryl StroudA2 Dendritic cell-targeted gorilla adenoviral vector for cancer vaccination for canine melanomaIgor Dmitriev, Elena Kashentseva, Jeffrey N. Bryan, David T. CurielA3 Viroimmunotherapy for malignant melanoma in the companion dog modelJeffrey N. Bryan, David Curiel, Igor Dmitriev, Elena Kashentseva, Hans Rindt, Carol Reinero, Carolyn J. HenryA4 Of mice and men (and dogs!): development of a commercially licensed xenogeneic DNA vaccine for companion animals with malignant melanomaPhilip J. BergmanA5 Successful immunotherapy with a recombinant HER2-expressing Listeria monocytogenes in dogs with spontaneous osteosarcoma paves the way for advances in pediatric osteosarcomaNicola J. Mason, Josephine S. Gnanandarajah, Julie B. Engiles, Falon Gray, Danielle Laughlin, Anita Gaurnier-Hausser, Anu Wallecha, Margie Huebner, Yvonne PatersonA6 Human clinical development of ADXS-HER2Daniel O'ConnorA7 Leveraging use of data for both human and veterinary benefitLaura S. TremlA8 Biologic replacement of the knee: innovations and early clinical resultsJames P. StannardA9 Mizzou BioJoint Center: a translational success storyJames L. CookA10 University and industry translational partnership: from the lab to commercializationMarc JacobsA11 Beyond docking: an evolutionarily guided OneHealth approach to drug discoveryGerald J. Wyckoff, Lee Likins, Ubadah Sabbagh, Andrew SkaffA12 Challenges and opportunities for data applications in animal health: from precision medicine to precision husbandryAmado S. GuloyA13 A cloud-based programmable platform for healthHarlen D. HaysA14 Comparative oncology: One Health in actionAmy K. LeBlancA15 Companion animal diseases bridge the translational gap for human neurodegenerative diseaseJoan R. Coates, Martin L. Katz, Leslie A. Lyons, Gayle C. Johnson, Gary S. Johnson, Dennis P. O'BrienA16 Duchenne muscular dystrophy gene therapyDongsheng DuanA17 Polycystic

  8. An assessment toolkit to increase the resilience of NWE catchments to periods of drought

    Science.gov (United States)

    La Jeunesse, Isabelle; Larrue, Corinne

    2013-04-01

    European governance assessment toolkit to define regional drought adaptation; 2) to improve the effectiveness of drought adaptation measures for NWE areas, and 3) to enhance the preparedness of regional stakeholders in NWE in drought adaptation. In this presentation, authors aim at presenting the assessment toolkit based on a combination of five regime dimensions and four regime qualities which have been operationalized into a questionnaire. The questionnaire helps to make a regime assessment of both the static situation and the dynamics. Acknowledgments This research is funded by the INTERREG IVB programme for the North Western Europe and DROP is leaded by the Regge en Dinkel Water Board in the Netherlands. The toolkit is developped in collaboration with the University of Twente and in particular with Stefan Kuks, Hans Bressers, Cheryl de Boer, Joanne Vinke and Gül Özerol. We specially acknowledge Regional partners of DROP.

  9. EDITORIAL: Focus on Advances in Surface and Interface Science 2008 FOCUS ON ADVANCES IN SURFACE AND INTERFACE SCIENCE 2008

    Science.gov (United States)

    Scheffler, Matthias; Schneider, Wolf-Dieter

    2008-12-01

    Basic research in surface and interface science is highly interdisciplinary, covering the fields of physics, chemistry, biophysics, geo-, atmospheric and environmental sciences, material science, chemical engineering, and more. The various phenomena are interesting by themselves, and they are most important in nearly all modern technologies, as for example electronic, magnetic, and optical devices, sensors, catalysts, lubricants, hard and thermal-barrier coatings, protection against corrosion and crack formation under harsh environments. In fact, detailed understanding of the elementary processes at surfaces is necessary to support and to advance the high technology that very much founds the prosperity and lifestyle of our society. Current state-of-the-art experimental studies of elementary processes at surfaces, of surface properties and functions employ a variety of sophisticated tools. Some are capable of revealing the location and motion of individual atoms. Others measure excitations (electronic, magnetic and vibronic), employing, for example, special light sources such as synchrotrons, high magnetic fields, or free electron lasers. The surprising variety of intriguing physical phenomena at surfaces, interfaces, and nanostructures also pose a persistent challenge for the development of theoretical descriptions, methods, and even basic physical concepts. This second focus issue on the topic of 'Advances in Surface and Interface Science' in New Journal of Physics, following on from last year's successful collection, provides an exciting synoptic view on the latest pertinent developments in the field. Focus on Advances in Surface and Interface Science 2008 Contents Organic layers at metal/electrolyte interfaces: molecular structure and reactivity of viologen monolayers Stephan Breuer, Duc T Pham, Sascha Huemann, Knud Gentz, Caroline Zoerlein, Ralf Hunger, Klaus Wandelt and Peter Broekmann Spin polarized d surface resonance state of fcc Co/Cu(001) K Miyamoto, K

  10. A 4-year non-randomized comparative phase-IV study of early rheumatoid arthritis: integrative anthroposophic medicine for patients with preference against DMARDs versus conventional therapy including DMARDs for patients without preference

    Directory of Open Access Journals (Sweden)

    Hamre HJ

    2018-03-01

    Full Text Available Harald J Hamre,1 Van N Pham,2 Christian Kern,3 Rolf Rau,4 Jörn Klasen,3 Ute Schendel,5 Lars Gerlach,6 Attyla Drabik,2 Ludger Simon6,† 1Institute for Applied Epistemology and Medical Methodology at the Witten/Herdecke University, Freiburg, Germany; 2Institute of Statistics in Medicine, Universitätsklinikum Düsseldorf, Düsseldorf, Germany; 3Department of Integrative Medicine, Asklepios Westklinikum, Hamburg, Germany; 4Department of Rheumatology, Evangelisches Fachkrankenhaus Ratingen, Ratingen, Germany; 5Department of Rheumatology, m&i-Fachklinik Bad Pyrmont, Bad Pyrmont, Germany; 6Department of Internal Medicine and Gastroenterology, Filderklinik, Filderstadt, Germany †Dr Ludger Simon passed away on June 10, 2016 Background: While disease-modifying antirheumatic drugs (DMARDs are a mainstay of therapy for rheumatoid arthritis (RA, some patients with early RA refuse DMARDs. In anthroposophic medicine (AM, a treatment strategy for early RA without DMARDs has been developed. Preliminary data suggest that RA symptoms and inflammatory markers can be reduced under AM, without DMARDs. Patients and methods: Two hundred and fifty-one self-selected patients aged 16–70 years, starting treatment for RA of <3 years duration, without prior DMARD therapy, participated in a prospective, non-randomized, comparative Phase IV study. C-patients were treated in clinics offering conventional therapy including DMARDs, while A-patients had chosen treatment in anthroposophic clinics, without DMARDs. Both groups received corticosteroids and nonsteroidal anti-inflammatory drugs (NSAIDs. Primary outcomes were intensity of RA symptoms measured by self-rating on visual analog scales, C-reactive protein, radiological progression, study withdrawals, serious adverse events (SAE, and adverse drug reactions in months 0–48. Results: The groups were similar in most baseline characteristics, while A-patients had longer disease duration (mean 15.1 vs 10.8 months, p<0

  11. PDA Use by Clinicians has a Positive Impact on Clinical Decision Making. A review of: Dee, Cheryl R., Marilyn Teolis, and Andrew D. Todd. “Physicians’ use of the personal digital assistant (PDA in clinical decision making.” Journal of the Medical Library Association 93.4 (October 2005: 480-6.

    Directory of Open Access Journals (Sweden)

    Suzanne P. Lewis

    2006-06-01

    Full Text Available Objective – To examine how frequently attending physicians and physicians in training (medical students, interns and residents used PDAs for patient care and to explore physicians’ perceptions of the impact of PDA use on several aspects of clinical care. Design – User study via a questionnaire. Setting – Teaching hospitals in Tennessee, Florida, Alabama, Kentucky, and Pennsylvania in the United States. Subjects – A convenience sample of fifty nine attending physicians and forty-nine physicians in training (108 total, spread unevenly across the five states. Methods – Subjects were recruited by librarians at teaching hospitals to answer a questionnaire which was distributed and collected at medical meetings, as well as by email, mail, and fax. The subjects were required to have and use a PDA, but prior training on PDA use was not a requirement, nor was it offered to the subjects before the study. Most of the questions required the respondent to choose from five Likert scale answers regarding frequency of PDA use: almost always, often, a few times, rarely, or never. In the reporting of results, the options ‘almost always’ and ‘often’ were combined and reported as ‘frequent’, and the options ‘a few times’ and ‘rarely’, were combined and reported as ‘occasional’. Subjects could also record comments for each question, but only for affirmative responses. Subjects were asked about their frequency of PDA use before, during, or after a patient encounter. They were also asked if PDA use had influenced one or more of five aspects of clinical care – decision making, diagnosis, treatment, test ordering, and in-patient hospital length of stay. Data analysis included chi square tests to assess differences between attending physicians and physicians in training regarding frequency of PDA use and the influence of PDA use on the five aspects of clinical care. The subject population was also divided into frequent and occasional users of PDAs, and chi square testing was used to assess differences between these two groups regarding the influence of PDA use on clinical care. A significance value of PMain results – Ninety‐four (87% of the 108 respondents used PDAs for patient encounters. Of this group, 59 were frequent users and 35 were occasional users. There were no significant differences between attending physicians and physicians in training with regard to frequency of PDA use in patient encounters. Sixty-seven percent of the 108 respondents reported that using a PDA had influenced their clinical decision making; over 50% reported that PDA use had influenced changes in patient treatment; 16% reported that PDA use had helped avoid unnecessary tests; 10% reported that PDA use had helped change a patient’s diagnosis; and 6% reported that PDA use had helped shorten a patient’s length of stay. Within these results, there were no statistically significant differences between the attending physicians and the physicians in training. More than 85% of the frequent PDA users (n=59, and 60% of the occasional PDA users (n=35, reported that PDA use had influenced their clinical decision making. The difference between these two groups was statistically significant (PConclusion – PDA use has a positive impact on clinical decision making and patient care. Frequency of PDA use appears to be a factor in determining the perceived impact of PDAs on clinical decision making. However, even those physicians who used PDAs only occasionally reported a positive impact of PDA use on clinical decision making. The status of physicians (attending or in training does not appear to be a determining factor in the frequency of PDA use for patient encounters. Health sciences librarians are well positioned to provide resources and training for PDA use by clinicians.

  12. Enhancing mHealth Technology in the Patient-Centered Medical Home Environment to Activate Patients With Type 2 Diabetes: A Multisite Feasibility Study Protocol.

    Science.gov (United States)

    Gimbel, Ronald; Shi, Lu; Williams, Joel E; Dye, Cheryl J; Chen, Liwei; Crawford, Paul; Shry, Eric A; Griffin, Sarah F; Jones, Karyn O; Sherrill, Windsor W; Truong, Khoa; Little, Jeanette R; Edwards, Karen W; Hing, Marie; Moss, Jennie B

    2017-03-06

    Diabetes Self-care Activities Measure scores, clinical measures, comorbid conditions, health services resource consumption, and technology system usage statistics. We have completed phase 1 data collection. Formal analysis of phase 1 data has not been completed. We have obtained institutional review board approval and began phase 1 research in late fall 2016. The study hypotheses suggest that patients can, and will, improve their activation in chronic care management. Improved activation should translate into improved diabetes self-care. Expected benefits of this research to the scientific community and health care services include improved understanding of how to leverage mHealth technology to activate patients living with type 2 diabetes in self-management behaviors. The research will shed light on implementation strategies in integrating mHealth into the clinical workflow of the PCMH setting. ClinicalTrials.gov NCT02949037. https://clinicaltrials.gov/ct2/show/NCT02949037. (Archived by WebCite at http://www.webcitation.org/6oRyDzqei). ©Ronald Gimbel, Lu Shi, Joel E Williams, Cheryl J Dye, Liwei Chen, Paul Crawford, Eric A Shry, Sarah F Griffin, Karyn O Jones, Windsor W Sherrill, Khoa Truong, Jeanette R Little, Karen W Edwards, Marie Hing, Jennie B Moss. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 06.03.2017.

  13. Which Members of the Microbial Communities Are Active? Microarrays

    Science.gov (United States)

    Morris, Brandon E. L.

    only at the early stages of understanding the microbial processes that occur in petroliferous formations and the surrounding subterranean environment. Important first steps in characterising the microbiology of oilfield systems involve identifying the microbial community structure and determining how population diversity changes are affected by the overall geochemical and biological parameters of the system. This is relatively easy to do today by using general 16S rRNA primers for PCR and building clone libraries. For example, previous studies using molecular methods characterised many dominant prokaryotes in petroleum reservoirs (Orphan et al., 2000) and in two Alaskan North Slope oil facilities (Duncan et al., 2009; Pham et al., 2009). However, the problem is that more traditional molecular biology approaches, such as 16S clone libraries, fail to detect large portions of the community perhaps missing up to half of the biodiversity (see Hong et al., 2009) and require significant laboratory time to construct large libraries necessary to increase the probability of detecting the majority of even bacterial biodiversity. In the energy sector, the overarching desire would be to quickly assess the extent of in situ hydrocarbon biodegradation or to disrupt detrimental processes such as biofouling, and in these cases it may not be necessary to identify specific microbial species. Rather, it would be more critical to evaluate metabolic processes or monitor gene products that are implicated in the specific activity of interest. Research goals such as these are well suited for a tailored application of microarray technology.

  14. Experimental study of the anisotropic properties of argillite under moisture and mechanical loads

    International Nuclear Information System (INIS)

    Yang, D.S.; Chanchole, S.; Wang, L.L.; Bornert, M.; Gatmiri, B.

    2012-01-01

    Document available in extended abstract form only. Due to various factors, such as sedimentation, layered morphology of clay mineral, in-situ stress, etc., the behavior of argillite rocks is often anisotropic. In order to study the anisotropy of the Callovo-Oxfordian (COx) argillite considered as a possible host rock for high-level radioactive nuclear waste repository in France, a series of tests including uniaxial compression and dehydration and hydration at different constant applied stress levels, are carried out using a specific setup combining mechanical and moisture loading devices. During these hydro-mechanical tests, this specific setup can also continuously capture images of the sample surfaces to be subsequently analyzed using Digital Image Correlation techniques (DIC) in order to determine full-field strains. In this study, three sampling directions are used with the angle θ between the bedding plane and the cylindrical sample axis equal to 45 deg., 60 deg. and 90 deg.. To investigate the mechanical anisotropy, uniaxial compressive tests with mechanical loading and unloading cycles are performed on several different samples at the same moisture level. The results show that the mechanical parameters (apparent modulus, failure stress) depend on loading orientation relative to the stratification plane. For a given water content, the failure stress reaches maximum values for θ =90 deg. and minimum values for θ =45 deg.. To study the hydric anisotropy, dehydration and hydration tests under stress-free conditions are performed on two cylindrical samples (θ=90 deg. and θ=60 deg.). Three cycles of hydration and dehydration are carried out by varying the relative humidity between 40% and 95%. The sample weight, the deformation measured by strain gages and the relative humidity are continuously recorded during the test by means of another specific setup described in [Pham et al., 2007]. Fig.1a illustrates the evolution of the strains of the sample EST28030-No

  15. Experimenting with Educational Games using the Xbox, PC, and iPad

    Science.gov (United States)

    Rohrlick, D.; Kilb, D. L.; Peach, C. L.; Simms, E.; Yang, A.; Layman, C.; Deutscher, R.

    2012-12-01

    Daniel Rohrlick, Alan Yang, Eric Simms, Debi Kilb, Cheryl Peach, Charina Layman, Rebecca Deutscher 1. Scripps Institution of Oceanography, La Jolla, CA, USA 2. Harvard University Center for the Environment, Cambridge, MA, USA 3. Birch Aquarium at Scripps, La Jolla, CA, USA 4. The Lawrence Hall of Science, University of California Berkeley, Berkeley, CA, USA As videogames continue to grow in popularity, especially with today's youth, it is becoming clear that gaming can be a potent learning tool. But what is the best way to engage a player in learning from a videogame? Based on our five years of developing and testing our own educational games, we experimented with various forms of gaming techniques and player interaction. Our first game, "Deep-sea Extreme Environment Pilot (DEEP)", is an Xbox 360 game where players learn about deep-sea environments while controlling a Remotely Operated Vehicle (ROV). DEEP is a "traditional" videogame where players interact with a controller and a TV screen. The second game we developed for the PC is called the "Quake Catcher Network (QCN)" game. With the gameplay focused on earth sciences, players must quickly deploy seismic sensors to record aftershocks from a large earthquake. Instead of using a game controller to play the QCN game, we instead incorporate the Microsoft Kinect motion sensor for the game input. Finally, the "Glider Game" is our third and most recent game designed for use on the mobile device platform such as iPods and iPads. In this game players control ocean gliders and must complete missions while battling ocean currents, power consumption, and other unanticipated problems. Here, the gameplay is aimed toward the casual gamer using touch-screen based controls in the hope that players can easily pick up and play this game with little gaming experience. After testing our games numerous times in museums, informal science learning centers, and classrooms we have been able to track qualitatively which educational

  16. 2012 best practices for repositories collection, storage, retrieval, and distribution of biological materials for research international society for biological and environmental repositories.

    Science.gov (United States)

    2012-04-01

    Third Edition [Formula: see text] [Box: see text] Printed with permission from the International Society for Biological and Environmental Repositories (ISBER) © 2011 ISBER All Rights Reserved Editor-in-Chief Lori D. Campbell, PhD Associate Editors Fay Betsou, PhD Debra Leiolani Garcia, MPA Judith G. Giri, PhD Karen E. Pitt, PhD Rebecca S. Pugh, MS Katherine C. Sexton, MBA Amy P.N. Skubitz, PhD Stella B. Somiari, PhD Individual Contributors to the Third Edition Jonas Astrin, Susan Baker, Thomas J. Barr, Erica Benson, Mark Cada, Lori Campbell, Antonio Hugo Jose Froes Marques Campos, David Carpentieri, Omoshile Clement, Domenico Coppola, Yvonne De Souza, Paul Fearn, Kelly Feil, Debra Garcia, Judith Giri, William E. Grizzle, Kathleen Groover, Keith Harding, Edward Kaercher, Joseph Kessler, Sarah Loud, Hannah Maynor, Kevin McCluskey, Kevin Meagher, Cheryl Michels, Lisa Miranda, Judy Muller-Cohn, Rolf Muller, James O'Sullivan, Karen Pitt, Rebecca Pugh, Rivka Ravid, Katherine Sexton, Ricardo Luis A. Silva, Frank Simione, Amy Skubitz, Stella Somiari, Frans van der Horst, Gavin Welch, Andy Zaayenga 2012 Best Practices for Repositories: Collection, Storage, Retrieval and Distribution of Biological Materials for Research INTERNATIONAL SOCIETY FOR BIOLOGICAL AND ENVIRONMENTAL REPOSITORIES (ISBER) INTRODUCTION T he availability of high quality biological and environmental specimens for research purposes requires the development of standardized methods for collection, long-term storage, retrieval and distribution of specimens that will enable their future use. Sharing successful strategies for accomplishing this goal is one of the driving forces for the International Society for Biological and Environmental Repositories (ISBER). For more information about ISBER see www.isber.org . ISBER's Best Practices for Repositories (Best Practices) reflect the collective experience of its members and has received broad input from other repository professionals. Throughout this document

  17. Obituary: Ludwig Friedrich Oster, 1931-2003

    Science.gov (United States)

    Sofia, Sabatino; Altschuler, Martin D.

    2003-12-01

    Ludwig Friedrich Oster died at the Anchorage Nursing and Rehabilitation Center in Salisbury, MD on 28 February 2003, of complications from advanced Alzheimer's disease. He is survived by his wife Cheryl M. (Oroian) and his two children by a previous marriage, Ulrika and Mattias Oster. He had a distinguished career both as a researcher in solar physics and as a science administrator in the National Science Foundation. Ludwig was born on 8 March 1931 in Konstanz, Germany and emigrated to the U.S. in 1958, acquiring American citizenship in 1963. His mother and father were Emma Josefine (Schwarz) and Ludwig Friedrich Oster. He got a BS degree in physics at the University of Freiburg under the guidance of Prof. K. O. Kiepenheuer in 1951, and a MS (1954) and PhD from the University of Kiel in 1956 under the guidance of Prof. A. Unsold. From 1956 to 1958 he was a Fellow of the German Science Council at Kiel and, upon his arrival to the US in 1958, he became a Postdoctoral Research Associate in the Physics Department of Yale University. He became an Assistant Professor of Physics and Astrophysics at Yale in 1960 and five years later he was promoted to Associate Professor. In 1967 he became an Associate Professor of Physics and Astrophysics at the University of Colorado and a Fellow of the Joint Institute for Laboratory Astrophysics; he was promoted to Full Professor in 1970. In 1981 he was a Visiting Professor at Johns Hopkins University, and shortly thereafter became a National Research Council Senior Associate at NASA/Goddard Space Flight Center in Greenbelt, MD, where he worked on solar variability. He joined the National Science Foundation in 1983, where he became the Program Manager for the National Radio Astronomy Observatory in the Division of Astronomical Sciences of the Foundation; he remained there until his retirement in 1996. His early work, started in Germany and continued at Yale, concerned radiation mechanisms related to solar phenomena. His works on

  18. Selected abstracts from the Breastfeeding and Feminism International Conference 2016

    Directory of Open Access Journals (Sweden)

    Lisa H. Amir

    2016-10-01

    Full Text Available Table of contents A1. Infant feeding and poverty: a public health perspective in a global context Lisa H. Amir A2. Mothers’ experiences with galactagogues for lactation: an exploratory cross sectional study Alessandra Bazzano, Shelley Thibeau, Katherine P. Theall A3. The motherhood journey and breastfeeding: from self-efficacy to resilience and social stigma Anna Blair, Karin Cadwell A4. Breastfeeding as an evolutionary adaptive behavior Emily A. Bronson A5. Conflict-of-interest in public health policy: as real as that logo on your website Elizabeth C. Brooks A6. Co-opting sisterhood and motherhood: behind the scenes of Similac’s aggressive social media campaigns Jodine Chase A7. The exclusion of women from the definition of exclusive breastfeeding Ellen Chetwynd, Rebecca Costello, Kathryn Wouk A8. Healthy maternity policies in the workplace: a state health department’s experience with the “Bring Your Infant to Work” program Lindsey Dermid-Gray A9. Implications for a paradigm shift: factors related to breastfeeding among African American women Stephanie Devane-Johnson, Cheryl Woods Giscombe, Miriam Labbok A10. Social experiences of breastfeeding: building bridges between research and policy: an ESRC-funded seminar series in the UK Sally Dowling A11. Manager’s perspectives of lactation breaks Melanie Fraser A12. The challenging second night: a dialogue from two perspectives Jane Grassley, Deborah McCarter-Spaulding, Becky Spencer A13. The role of lactation consultants in two council breastfeeding services in Melbourne, Australia – some preliminary impressions Jennifer Hocking, Pranee Liamputtong A14. Integrating social marketing and community engagement concepts in community breastfeeding programs Sheree H. Keitt, Harumi Reis-Reilly A15. What happens before and after the maternity stay? Creating a community-wide Ten Steps approach Miriam Labbok A16. #RVABREASTFEEDS: cultivating a breastfeeding-friendly community Leslie Lytle A17

  19. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2002-01-01

    Full Text Available -Stephen J. Appold, Heidi Dahles ,Tourism and small entrepreneurs; Development, national policy, and entrepreneurial culture: Indonesian cases. Elmsford, New York: Cognizant Communication Corporation, 1999, vi + 165 pp., Karin Bras (eds -Jean-Pascal Bassino, Peter Boothroyd ,Socioeconomic renovation in Vietnam; The origin, evolution and impact of Doi Moi. Singapore: Institute of Southeast Asian Studies, 2001, xv + 175 pp., Pham Xuan Nam (eds -Peter Boomgaard, Patrick Vinton Kirch, The wet and the dry; Irrigation and agricultural intensification in Polynesia. Chicago: The University of Chicago Press, 1994, xxii + 385 pp. -A.Th. Boone, Chr.G.F. de Jong, De Gereformeerde Zending in Midden-Java 1931-1975; Een bronnenpublicatie. Zoetermeer: Boekencentrum, 1997, xxiv + 890 pp. [Uitgaven van de Werkgroep voor de Geschiedenis van de Nederlandse Zending en Overzeese Kerken, Grote Reeks 6.] -Okke Braadbaart, Colin Barlow, Institutions and economic change in Southeast Asia; The context of development from the 1960s to the 1990s. Cheltenham: Edward Elgar, xi + 204 pp. -Freek Colombijn, Abidin Kusno, Behind the postcolonial; Architecture, urban space, and political cultures in Indonesia. London: Routledge, 2000, xiv + 250 pp. -Raymond Corbey, Michael O'Hanlon ,Hunting the gatherers; Ethnographic collectors, agents and agency in Melanesia, 1870s -1930s. Oxford: Bergahn Books, 2000, xviii + 286 pp. [Methodology and History in Anthropology 6.], Robert L. Welsch (eds -Olga Deshpande, Hans Penth, A brief histroy of Lan Na; Civilizations of North Thailand. Chiang Mai: Silkworm Books, 2000, v + 74 pp. -Aone van Engelenhoven, I Ketut Artawa, Ergativity and Balinese syntax. Jakarta: Badan Penyelenggaran Seri NUSA, Universitas Katolik Indonesia Atma Jaya, 1998, v + 169 pp (in 3 volumes. [NUSA Linguistic Studies of Indonesian and Other Languages in Indonesia 42, 43, 44.] -Rens Heringa, Jill Forshee, Between the folds; Stories of cloth, lives, and travels from Sumba

  20. Water retention properties of Callovo-Oxfordian clay-stone

    International Nuclear Information System (INIS)

    Wan, Min; Delage, Pierre; Tang, Anh Minh; GATMIRI, Behrouz

    2012-01-01

    Document available in extended abstract form only. Many investigations were carried out on the Callovo-Oxfordian (COx) clay-stone that has been selected by the French radioactive waste management agency (ANDRA) as a potential host rock for high level radioactive waste disposal at great depth. Various authors demonstrated the significant water sensitivity of clay-stones. Some cracks generated by desaturation have been observed in the Tournemire URL (France) excavated in clay-stone. By carrying out some ESEM (environmental scanning electron microscope) observations on COx clay-stone samples submitted to cyclic changes in relative humidity, Montes et al. (2004) evidenced the water sensitivity of the clay fraction, with significant successive openings and closures of cracks and pores. Hysteresis effects have been observed in the water retention curve, in the ultrasonic velocity evolution and in the strain changes induced by hydration cycles on COx samples submitted to controlled relative humidities by Pham et al., (2007). Better knowledge of the mechanism of desaturation of the clay-stone is necessary to further understand the changes in hydro-mechanical properties of the excavation damaged zone (EDZ) that becomes significantly de-saturated all around the galleries because of ventilation. In this framework, a detailed study of the water retention properties of the COx clay-stone was carried out i) to complete existing observations with respect to volume changes under suction cycles and ii) to determine the main drying and wetting curves so as to better investigate hysteresis effects in the water retention curve.. Particular attention was paid to the characterization of the initial state in the laboratory (where samples are provided unsaturated due to the combined effect of coring, storage and transportation) and to the volume changes and changes in degree of saturation along the main wetting and drying paths. The determination of the water retention properties was

  1. Solid State Ionics Advanced Materials for Emerging Technologies

    Science.gov (United States)

    Chowdari, B. V. R.; Careem, M. A.; Dissanayake, M. A. K. L.; Rajapakse, R. M. G.; Seneviratne, V. A.

    2006-06-01

    Keynote lecture. Challenges and opportunities of solid state ionic devices / W. Weppner -- pt. I. Ionically conducting inorganic solids. Invited papers. Multinuclear NMR studies of mass transport of phosphoric acid in water / J. R. P. Jayakody ... [et al.]. Crystalline glassy and polymeric electrolytes: similarities and differences in ionic transport mechanisms / J.-L. Souquet. 30 years of NMR/NQR experiments in solid electrolytes / D. Brinkmann. Analysis of conductivity and NMR measurements in Li[symbol]La[symbol]TiO[symbol] fast Li[symbol] ionic conductor: evidence for correlated Li[symbol] motion / O. Bohnké ... [et al.]. Transport pathways for ions in disordered solids from bond valence mismatch landscapes / S. Adams. Proton conductivity in condensed phases of water: implications on linear and ball lightning / K. Tennakone -- Contributed papers. Proton transport in nanocrystalline bioceramic materials: an investigative study of synthetic bone with that of natural bone / H. Jena, B. Rambabu. Synthesis and properties of the nanostructured fast ionic conductor Li[symbol]La[symbol]TiO[symbol] / Q. N. Pham ... [et al.]. Hydrogen production: ceramic materials for high temperature water electrolysis / A. Hammou. Influence of the sintering temperature on pH sensor ability of Li[symbol]La[symbol]TiO[symbol]. Relationship between potentiometric and impedance spectroscopy measurements / Q. N. Pham ... [et al.]. Microstructure chracterization and ionic conductivity of nano-sized CeO[symbol]-Sm[symbol]O[symbol] system (x=0.05 - 0.2) prepared by combustion route / K. Singh, S. A. Acharya, S. S. Bhoga. Red soil in Northern Sri Lanka is a natural magnetic ceramic / K. Ahilan ... [et al.]. Neutron scattering of LiNiO[symbol] / K. Basar ... [et al.]. Preparation and properties of LiFePO[symbol] nanorods / L. Q. Mai ... [et al.]. Structural and electrochemical properties of monoclinic and othorhombic MoO[symbol] phases / O. M. Hussain ... [et al.]. Preparation of Zircon (Zr

  2. Obituary: Frank Culver Jones, 1932-2007

    Science.gov (United States)

    Ormes, Johnathan F.; Streitmatter, Robert E.

    2007-12-01

    everyone from technicians to scientists and managers. This generosity resulted in his becoming the first senior research scientist to be honored with the Laboratory's Peer Award. Survivors include his wife of 52 years, Ardythe Grube Jones of Silver Spring, Maryland, two children, Cheryl Mattis of Columbia and Timothy Jones of Silver Spring, two brothers, and four grandchildren.

  3. Editorial

    Directory of Open Access Journals (Sweden)

    AHM Zahirul Alam

    2018-06-01

    is made by the publisher and editorial board to see that no inaccurate or misleading data, opinion or statement appears in this Journal, they wish to make it clear that the data and opinions appearing in the articles and advertisement herein are the responsibility of the contributor or advertiser concerned. Accordingly, the publisher and the editorial committee accept no liability whatsoever for the consequence of any such inaccurate or misleading data, opinion or statement.      IIUM Engineering Journal ISSN: 1511-788X   E-ISSN: 2289-7860   Volume 19, Issue 1, June 2018 https://doi.org/10.31436/iiumej.v19i1 Table of Content     CHEMICAL AND BIOTECHNOLOGY ENGINEERING ADSORPTION OF HEAVY METALS AND RESIDUAL OIL FROM PALM OIL MILL EFFLUENT USING A NOVEL ADSORBENT OF ALGINATE AND MANGROVE COMPOSITE BEADS COATED WITH CHITOSAN IN A PACKED BED COLUMN... 1 Rana Jaafar Jawad, Mohd Halim Shah Ismail, Shamsul Izhar Siajam INVESTIGATION OF BIOFLOCCULANT AS DEWATERING AID IN SLUDGE TREATMENT........................................ 15 Mohammed Saedi Jami, Maizirwan Mel, Aysha Ralliya Mohd Ariff, Qabas Marwan Abdulazeez HYDROGEN PRODUCTION FROM ETHANOL DRY REFORMING OVER LANTHANIA-PROMOTED CO/AL2O3 CATALYST............................. 24 Fahim Fayaz, Nguyen Thi Anh Nga, Thong Le Minh Pham, Huong Thi Danh, Bawadi Abdullah, Herma Dina Setiabudi, Dai-Viet Nguyen Vo OPTIMIZATION OF RED PIGMENT PRODUCTION BY MONASCUS PURPUREUS FTC 5356 USING RESPONSE SURFACE METHODOLOGY......................................................... 34 Nor Farhana Hamid And Farhan Mohd Said PRODUCTION AND STABILITY OF MYCO-FLOCCULANTS FROM LENTINUS SQUARROSULUS RWF5 AND SIMPLICILLIUM OBCLAVATUM RWF6 FOR REDUCTION OF WATER TURBIDITY.............................................................................. 48 Nessa Jebun, Md. Zahangir Alam, Abdullah Al-Mamun, Raha Ahmad Raus ROLE OF SUBSTRATE BINDING ON THE PROTEIN DYNAMICS OF AN ENDOGLUCANASE FROM FUSARIUM OXYSPORUM AT DIFFERENT TEMPERATURES

  4. Preface: SciDAC 2009

    Science.gov (United States)

    Simon, Horst

    2009-07-01

    and posters goes to the teams of researchers, the success of this year's conference is due to the strong efforts and support from members of the 2009 SciDAC Program Committee and Organizing Committee, and I would like to extend my heartfelt thanks to them for helping to make the 2009 meeting the largest and most successful to date. Program Committee members were: David Bader, LLNL; Pete Beckman, ANL; John Bell, LBNL; John Boisseau, University of Texas; Paul Bonoli, MIT; Hank Childs, LBNL; Bill Collins, LBNL; Jim Davenport, BNL; David Dean, ORNL; Thom Dunning, NCSA; Peg Folta, LLNL; Glenn Hammond, PNNL; Maciej Haranczyk, LBNL; Robert Harrison, ORNL; Paul Hovland, ANL; Paul Kent, ORNL; Aram Kevorkian, SPAWAR; David Keyes, Columbia University; Kwok Ko, SLAC; Felice Lightstone, LLNL; Bob Lucas, ISI/USC; Paul Mackenzie, Fermilab; Tony Mezzacappa, ORNL; John Negele, MIT; Jeff Nichols, ORNL; Mike Norman, UCSD; Joe Oefelein, SNL; Jeanie Osburn, NRL; Peter Ostroumov, ANL; Valerio Pascucci, University of Utah; Ruth Pordes, Fermilab; Rob Ross, ANL; Nagiza Samatova, ORNL; Martin Savage, University of Washington; Tim Scheibe, PNNL; Ed Seidel, NSF; Arie Shoshani, LBNL; Rick Stevens, ANL; Bob Sugar, UCSB; Bill Tang, PPPL; Bob Wilhelmson, NCSA; Kathy Yelick, NERSC/LBNL; Dave Zachmann, Vista Computational Technology LLC. Organizing Committee members were: Communications: Jon Bashor, LBNL. Contracts/Logistics: Mary Spada and Cheryl Zidel, ANL. Posters: David Bailey, LBNL. Proceedings: John Hules, LBNL. Proceedings Database Developer: Beth Cerny Patino, ANL. Program Committee Liaison/Conference Web Site: Yeen Mankin, LBNL. Tutorials: David Skinner, NERSC/LBNL. Visualization Night: Hank Childs, LBNL; Valerio Pascucci, Chems Touati, Nathan Galli, and Erik Jorgensen, University of Utah. Again, my thanks to all. Horst Simon San Diego, California June 18, 2009

  5. News & Announcements

    Science.gov (United States)

    2001-08-01

    News from Journal House National Chemistry Week (NCW) Celebrating Chemistry and Art is the theme of NCW 2001, to be held November 4-10, 2001. As you make plans for participating in the celebrations in your area, keep in mind that JCE is developing special materials on this theme, which will appear in our October issue: Classroom Activities, a comprehensive Illustrated Resource Paper, Report from Online, specially written brief articles illustrated in color, articles related to the theme, and CLIPs (Chemical Laboratory Information Profiles). Awards Announced Passer Award Passer Award recipients from the April 1 closing date are: George Bennett, Millikin University, Decatur, IL Daniel Berger, Bluffton College, Bluffton, OH Karen Dunlap, Sierra College, Rocklin, CA Myung-Hoon Kim, Georgia Perimeter College, Dunwoody, GA Cheryl Longfellow, Philadelphia University, Philadelphia, PA Jerry Maas, Oakton Community College, Des Plaines, IL Tim Royappa, University of West Florida, Pensacola, FL Visiting Scientist Award, Western Connecticut Section Diane Bunce, The Catholic University of America, has been selected as the 2001 Visiting Scientist of the Western Connecticut Section of the ACS. The award, presented annually since 1967, brings an outstanding chemical educator to visit high schools in Fairfield County, CT. In May, Bunce visited three high schools, Christian Heritage School, Fairfield High School, and Greenwich High School, where she interacted with teachers and students and presented lectures and demonstrations to several chemistry classes. She was also keynote speaker at the ACS local section's Education Night. The awardee is selected by a committee of university and high school teachers, industrial chemists, and the previous Visiting Scientist; there is an honorarium of 1500 plus expenses. Welch Award Roger D. Kornberg, a professor of structural biology at the Stanford University School of Medicine, received the 2001 Welch Award for his discovery of the nucleosome

  6. Preface: SciDAC 2008

    Science.gov (United States)

    Stevens, Rick

    2008-07-01

    scenes an enormous amount of work is required to make a large conference go smoothly. First I thank Cheryl Zidel for her tireless efforts as organizing committee liaison and posters chair and, in general, handling all of my end of the program and keeping me calm. I also thank Gail Pieper for her work in editing the proceedings, Beth Cerny Patino for her work on the Organizing Committee website and electronic theater, and Ken Raffenetti for his work in keeping that website working. Jon Bashor and John Hules did an excellent job in handling conference communications. I thank Caitlin Youngquist for the striking graphic design; Dan Fay for tutorials arrangements; and Lynn Dory, Suzanne Stevenson, Sarah Pebelske and Sarah Zidel for on-site registration and conference support. We all owe Yeen Mankin an extra-special thanks for choosing the hotel, handling contracts, arranging menus, securing venues, and reassuring the chair that everything was under control. We are pleased to have obtained corporate sponsorship from Cray, IBM, Intel, HP, and SiCortex. I thank all the speakers and panel presenters. I also thank the former conference chairs Tony Metzzacappa, Bill Tang, and David Keyes, who were never far away for advice and encouragement. Finally, I offer my thanks to Michael Strayer, without whose leadership, vision, and persistence the SciDAC program would not have come into being and flourished. I am honored to be part of his program and his friend. Rick Stevens Seattle, Washington July 18, 2008

  7. 6th International Symposium on Molecular Allergology (ISMA

    Directory of Open Access Journals (Sweden)

    Christiane Hilger

    2016-10-01

    Centro Hospitalar Lisboa Norte, Lisbon, Portugal; Faculdade de Medicina de Lisboa, Lisbon, Portugal P10 Component-resolved IgE profiles in Georgian patients Tamar Abramidze, Nino Lomidze, Maia Gotua P11 Cross reactivity between food and pollen allergens in Lithuania according to spIgE evaluation Austeja Dapkeviciute, Ruta Einikyte, Jolita Norkuniene, Laima Skrickiene, Asta Miskiniene, Violeta Kvedariene P12 Distribution of inhalant allergy in the population of Lithuania Ruta Einikyte, Austeja Dapkeviciute, Jolita Norkuniene, Laima Skrickiene, Asta Miskiniene, Violeta Kvedariene Poster Session 2: Allergen molecules: identification, characterization, structure and function P13 Interference of antigen 5-based cross-reactivity in the diagnosis of hymenoptera venom allergy Maximilian Schiener, Bernadette Eberlein, Carmen Moreno-Aguilar, Gunilla Pietsch, Mareike Mc Intyre, Lea Schwarze, Dennis Rußkamp, Tilo Biedermann, Edzard Spillner, Ulf Darsow, Carsten Schmidt-Weber, Markus Ollert, Simon Blank P14 IgE cross-reactivity between European Hymenoptera and Asian hornet (Vespa velutina venom allergens Cyril Longé, Andrea Brazdova, Jean-Louis Brunet, Claire Schwartz, Bruno Girodet, François Lavaud, Joelle Birnbaum, Nhân Pham Thi, Magalie Duchateau, Julia Chamot-Rooke, Laurence Guilloux, Marie-Ange Selva, Rémy Couderc, Hélène Sénéchal, Jean-Pierre Sutra, Pascal Poncet P15 Carbohydrate composition of house dust mite extracts and major group 1 and group 2 allergens Steffen Augustin, Linda Pump, Martin Wald, Thomas Eichhorn, Frank Fischer, Christoph Willers P16 Specificity of monoclonal antibodies against cross-reactive carbohydrate determinants Michaela Miehe, Melanie Plum, Sara Wolf, Frederic Jabs, Tim Raiber, Frank Bantleon, Henning Seismann, Thilo Jakob, Edzard Spillner P17 Red meat allergic patients have a selective IgE response to the a-Gal glycan Danijela Apostolovic, Anh Thu Tran, Sara Sanchez-Vidaurre, Tanja Cirkovic Velickovic, Maria Starkhammar, Carl Hamsten

  8. News & Announcements

    Science.gov (United States)

    1999-09-01

    for travel awards for post-doctoral, graduate, and undergraduate women to make their first research presentation at a national meeting sponsored by Eli Lilly & Co. For more information and an application form, contact your department chair; http://www.tamug.tamu.edu/ascwcc; or Cheryl Brown, ACS, 1155 16th Street, NW, Washington, DC 20036; phone: 800/227-5558 ext. 6022; email c_brown@acs.org. The deadline for receipt of applications for meetings between January 1 and June 30, 2000, is October 15, 1999; for meetings between July 1 and December 31, 2000, the deadline is March 15, 2000. Call for Symposia, Papers, Workshops: 16th BCCE The 16th Biennial Conference on Chemical Education will be held July 30­August 3, 2000, at the University of Michigan in Ann Arbor. The conference Web site at http://www.umich.edu/ bcce is ready to accept proposals for symposia, papers, posters, and workshops. Or proposals may be submitted in writing to the Program Chair, Brian Coppola, phone: 734/764-7329; email: bcoppola@umich.edu. The deadline for submission of proposals for symposia and workshops is December 13, 1999; the deadline for submission of abstracts of papers and posters is February 4, 2000. For general information contact Seyhan Ege, phone: 734/764-7340; email: snege@umich.edu. 16th IUPAC Conference on Chemical Thermodynamics 16th IUPAC Conference on Chemical Thermodynamics (concurrent with 55th Calorimetry Conference and 10th Symposium on Thermodynamics of Nuclear Materials) August 6­11, 2000 Halifax, Nova Scotia, Canada This conference will cover research topics in all areas of thermodynamics. In addition, there will be a special poster session for papers on two aspects of thermodynamics education: lecture demonstrations and undergraduate laboratory experiments. Come and join us for lobster and learn what is new and exciting in thermodynamics. To be on the email list for this meeting, send a message to: ICCT@IS.DAL.CA. For further details, consult the conference Web site