WorldWideScience

Sample records for woce section p17c

  1. IOC-WMO Intergovernmental WOCE panel. First session

    International Nuclear Information System (INIS)

    1990-10-01

    Ocean currents are an important mechanism by which the present-day climate system moves heat and salt from one latitude band to another. Meteorologists have long been able to quantify the large scale atmospheric circulation by mapping surface pressure. It is only in the coming decade that advances in satellite altimetry, deep floats and surface drifters will permit the design of programmes to determine the ocean circulation in a global and a quantitative sense. The World Ocean Circulation Experiment (WOCE) is such a programme. The WOCE Implementation Plan, also published in 1986, established the elements of the WOCE Field Programme that are necessary to achieve those scientific goals. Core project working groups and scientific panels ensure that the most effective balance of tools such as hydrography, subsurface floats, satellites and moorings are deployed to meet the scientific objective. WOCE is closely related to the International Geosphere Biosphere Programme (IGBP) and the World Climate Research Programme (WCRP). Various aspects of global climate change science are encompassed by WOCE. The heat balance of the earth involves incoming energy, mainly radiation received through the tropics, and outgoing energy, radiated fairly uniformly around the globe. A large amount (more than half) of the total heat flux is moved laterally across the globe by the oceans. Sea surface temperature is now determined globally by satellite. The Joint Global Ocean Flux Study is addressing the global carbon cycle. Tracers such as tritium, freon, have helped to qualitatively describe ocean sections. Drifting buoys have helped to describe surface ocean circulation and ALACE floats (pop-up) are describing intermediate layer circulation. Precision satellite radar altimetry has helped demonstrate the variability of ocean currents on a global scale

  2. 17 CFR 170.10 - Proficiency examinations (sections 4p and 17(p) of the Act).

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Proficiency examinations (sections 4p and 17(p) of the Act). 170.10 Section 170.10 Commodity and Securities Exchanges COMMODITY... examinations (sections 4p and 17(p) of the Act). A futures association may prescribe different training...

  3. Low-frequency variability of meridional transport in the divergence zone of the North Atlantic subtropical and subpolar gyres. The WOCE section A2; Niederfrequente Variabilitaet meridionaler Transporte in der Divergenzzone des nordatlantischen Subtropen- und Subpolarwirbels. Der WOCE-Schnitt A2

    Energy Technology Data Exchange (ETDEWEB)

    Lorbacher, K.

    2000-07-01

    The subinertial, climate relevant variability of the large-scale ocean circulation in the northern North Atlantic and its integral key parameters such as the advective transports of mass (volume), heat and freshwater are determined from observations alone using the hydrographic data from seven realisations of the so-called '48 N'-section between the English Channel and the Grand Banks of Newfoundland. The data consist of five available sets of the WOCE/A2-section during the Nineties for the years 1993, 1994, 1996, 1997, 1998 and of two previous transatlantic cruises in April of 1957 and 1982. The realisations of the WOCE/A2-section were carried out in the same season (May to July), except for the cruise in October 1994. The '48 N'-section follows the divergence zone of the mainly wind-driven subtropical gyre and the more complex, with respect to the forcing, subpolar gyre. In the central Westeuropean and Newfoundland Basins the section runs a few degrees south of the line of zero wind stress curl (curl{sub z}{tau}). In the West, the WOCE/A2-section turns northwest to cross the boundary current regime perpendicularly. Therefore, this quasi-zonal hydrographic section covers all large-scale circulation elements on the regional scale that contribute essentially to the ocean circulation on the global scale - the Meridional Overturning Circulation (MOC). The transport estimates are given as the sum of the three transport components of a quasi-steady, large-scale ocean circulation: The ageostrophic Ekman-, and the two geostrophic components, the depth-independent, barotropic or Sverdrup- and the baroclinic component. To maintain the mass balance over the plane of the section the compensation of each component is assumed. In the case of the baroclinic component the balance is achieved through a suitable choice for a surface of 'no-motion'. The absolute meridional velocity as a function of the zonal distance along the section and depth is

  4. Electrochemistry of cytochrome P450 17α-hydroxylase/17,20-lyase (P450c17).

    Science.gov (United States)

    Martin, Lisandra L; Kubeil, Clemens; Simonov, Alexandr N; Kuznetsov, Vladimir L; Corbin, C Jo; Auchus, Richard J; Conley, Alan J; Bond, Alan M; Rodgers, Raymond J

    2017-02-05

    Within the superfamily of cytochrome P450 enzymes (P450s), there is a small class which is functionally employed for steroid biosynthesis. The enzymes in this class appear to have a small active site to accommodate the steroid substrates specifically and snuggly, prior to the redox transformation or hydroxylation to form a product. Cytochrome P450c17 is one of these and is also a multi-functional P450, with two activities, the first 17α-hydroxylation of pregnenolone is followed by a subsequent 17,20-lyase transformation to dehydroepiandrosterone (DHEA) as the dominant pathways to cortisol precursors or androgens in humans, respectively. How P450c17 regulates these two redox reactions is of special interest. There is a paucity of direct electrochemical studies on steroidogenic P450s, and in this mini-review we provide an overview of these studies with P450c17. Historical consideration as to the difficulties in obtaining reliable electrochemistry due to issues of handling proteins on an electrode, together with advances in the electrochemical techniques are addressed. Recent work using Fourier transformed alternating current voltammetry is highlighted as this technique can provide both catalytic information simultaneously with the underlying redox transfer with the P450 haem. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  5. Determination of Carbon Dioxide, Hydrograohic, and Chemical Parameters During the R/V Nathaniel B. Palmer Cruise in the Southern Indian Ocean (WOCE Section S04I, 3 May - 4 July, 1996)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2006-03-31

    This report discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and partial pressure of CO2 (pCO2) at hydrographic stations during the cruise of research vessel (R/V) Nathaniel B. Palmer in the Southern Indian Ocean on the S04I Section as a part of the Joint Global Ocean Flux Study (JGOFS)/World Ocean Circulation Experiment (WOCE). The carbon-related measurements were sponsored by the U.S. Department of Energy (DOE). The expedition started in Cape Town, South Africa, on May 3, 1996, and ended in Hobart, Australia, on July 4, 1996. Instructions for accessing the data are provided. The TCO2 was measured in discrete water samples using the Lamont-Doherty Earth Observatory (LDEO) coulomteric system with an overall precision of ±1.7 μmol/kg. TALK was determined by potentiometric titration with an overall precision of ±1.7 μmol/kg. During the S04I cruise pCO2 was also measured using the LDEO equilibrator-gas chromatograph system with a precision of 0.5% (including the station-to-station reproducibility) at a constant temperature of 4.0ºC. The R/V Nathaniel B. Palmer S04I data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center. The NDP consists of the oceanographic data files and this printed documentation, which describes the contents and format of all files as well as the procedures and methods used to obtain the data.

  6. The NOSAMS sample preparation laboratory in the next millenium: Progress after the WOCE program

    International Nuclear Information System (INIS)

    Gagnon, Alan R.; McNichol, Ann P.; Donoghue, Joanne C.; Stuart, Dana R.; Reden, Karl von

    2000-01-01

    Since 1991, the primary charge of the National Ocean Sciences AMS (NOSAMS) facility at the Woods Hole Oceanographic Institution has been to supply high throughput, high precision AMS 14 C analyses for seawater samples collected as part of the World Ocean Circulation Experiment (WOCE). Approximately 13,000 samples taken as part of WOCE should be fully analyzed by the end of Y2K. Additional sample sources and techniques must be identified and incorporated if NOSAMS is to continue in its present operation mode. A trend in AMS today is the ability to routinely process and analyze radiocarbon samples that contain tiny amounts ( 14 C analysis has been recognized as a major facility goal. The installation of a new 134-position MC-SNICS ion source, which utilizes a smaller graphite target cartridge than presently used, is one step towards realizing this goal. New preparation systems constructed in the sample preparation laboratory (SPL) include an automated bank of 10 small-volume graphite reactors, an automated system to process organic carbon samples, and a multi-dimensional preparative capillary gas chromatograph (PCGC)

  7. Northern and southern water masses in the equatorial Atlantic: Distribution of nutrients on the WOCE A6 and A7 lines

    Digital Repository Service at National Institute of Oceanography (India)

    Oudot, C.; Morin, P.; Baurand, F.; Wafar, M.V.M.; Le Corre, P.

    In the framework of the WOCE Hydrographic Program, two trans-Atlantic CTDO/tracer sections with closely-spaced stations, along 7 degrees 30'N and 4 degrees 30'S (WHP Lines A6 and A7), and two meridional sections, along 3 degrees 50'W and 35 degrees...

  8. The NOSAMS sample preparation laboratory in the next millenium: Progress after the WOCE program

    Energy Technology Data Exchange (ETDEWEB)

    Gagnon, Alan R. E-mail: agagnon@whoi.edu; McNichol, Ann P.; Donoghue, Joanne C.; Stuart, Dana R.; Reden, Karl von

    2000-10-01

    Since 1991, the primary charge of the National Ocean Sciences AMS (NOSAMS) facility at the Woods Hole Oceanographic Institution has been to supply high throughput, high precision AMS {sup 14}C analyses for seawater samples collected as part of the World Ocean Circulation Experiment (WOCE). Approximately 13,000 samples taken as part of WOCE should be fully analyzed by the end of Y2K. Additional sample sources and techniques must be identified and incorporated if NOSAMS is to continue in its present operation mode. A trend in AMS today is the ability to routinely process and analyze radiocarbon samples that contain tiny amounts (<100 {mu}g) of carbon. The capability to mass-produce small samples for {sup 14}C analysis has been recognized as a major facility goal. The installation of a new 134-position MC-SNICS ion source, which utilizes a smaller graphite target cartridge than presently used, is one step towards realizing this goal. New preparation systems constructed in the sample preparation laboratory (SPL) include an automated bank of 10 small-volume graphite reactors, an automated system to process organic carbon samples, and a multi-dimensional preparative capillary gas chromatograph (PCGC)

  9. Mechanistic Scrutiny Identifies a Kinetic Role for Cytochrome b5 Regulation of Human Cytochrome P450c17 (CYP17A1, P450 17A1.

    Directory of Open Access Journals (Sweden)

    Alexandr N Simonov

    Full Text Available Cytochrome P450c17 (P450 17A1, CYP17A1 is a critical enzyme in the synthesis of androgens and is now a target enzyme for the treatment of prostate cancer. Cytochrome P450c17 can exhibit either one or two physiological enzymatic activities differentially regulated by cytochrome b5. How this is achieved remains unknown. Here, comprehensive in silico, in vivo and in vitro analyses were undertaken. Fluorescence Resonance Energy Transfer analysis showed close interactions within living cells between cytochrome P450c17 and cytochrome b5. In silico modeling identified the sites of interaction and confirmed that E48 and E49 residues in cytochrome b5 are essential for activity. Quartz crystal microbalance studies identified specific protein-protein interactions in a lipid membrane. Voltammetric analysis revealed that the wild type cytochrome b5, but not a mutated, E48G/E49G cyt b5, altered the kinetics of electron transfer between the electrode and the P450c17. We conclude that cytochrome b5 can influence the electronic conductivity of cytochrome P450c17 via allosteric, protein-protein interactions.

  10. NODC Standard Product: World Ocean Circulation Experiment (WOCE) Global Data Resource (GDR), versions 1-3, on CD-ROM and DVD

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC produced twelve (12) CD-ROMs containing WOCE Version 1 project data in the summer of 1998. NODC produced fifteen (15) CD-ROMs containing WOCE Version 2 project...

  11. Cytochrome P450c17 (steroid 17α-hydroxylase/17,20 lyase): cloning of human adrenal and testis cDNAs indicates the same gene is expressed in both tissues

    International Nuclear Information System (INIS)

    Chung, B.; Picado-Leonard, J.; Haniu, M.; Bienkowski, M.; Hall, P.F.; Shively, J.E.; Miller, W.L.

    1987-01-01

    P450c17 is the single enzyme mediating both 17α-hydroxylase (steroid 17α-monooxygenase, EC 1.14.99.9) and 17,20 lyase activities in the synthesis of steroid hormones. It has been suggested that different P450c17 isozymes mediate these activities in the adrenal gland and testis. The authors sequenced 423 of the 509 amino acids (83%) of the porcine adrenal enzyme; based on this partial sequence, a 128-fold degenerate 17-mer was synthesized and used to screen a porcine adrenal cDNA library. This yielded a 380-base cloned cDNA, which in turn was used to isolate several human adrenal cDNAs. The longest of these, λ hac 17-2, is 1754 base pairs long and includes the full-length coding region, the complete 3'-untranslated region, and 41 bases of the 5'-untranslated region. This cDNA encodes a protein of 508 amino acids having a predicted molecular weight of 57,379.82. High-stringency screening of a human testicular cDNA library yielded a partial clone containing 1303 identical bases. RNA gel blots and nuclease S1-protection experiments confirm that the adrenal and testicular P450c17 mRNAs are indistinguishable. These data indicate that the testis possesses a P450c17 identical to that in the adrenal. The human amino acid sequence is 66.7% homologous to the corresponding regions of the porcine sequence, and the human cDNA and amino acid sequences are 80.1 and 70.3% homologous, respectively, to bovine adrenal P450c17 cDNA. Both comparisons indicate that a central region comprising amino acid residues 160-268 is hypervariable among these species of P450c17

  12. Measurement of the {sup 15}O(2p,{gamma}){sup 17}Ne cross section by Coulomb dissociation of {sup 17}Ne

    Energy Technology Data Exchange (ETDEWEB)

    Marganiec, Justyna [ExtreMe Matter Institute EMMI, GSI Darmstadt, Darmstadt (Germany); Aumann, Thomas; Heil, Michael; Plag, Ralf; Wamers, Felix [Kernreaktionen und Nuklear Astrophysik, GSI Darmstadt, Darmstadt (Germany)

    2010-07-01

    For the production of proton-rich nuclei during the rp process two-proton capture plays an important role. This process can bridge long-lived waiting points which otherwise hamper the mass flow between CNO material and the FeNi mass region. One of these waiting points is {sup 15}O. The three-body radiative capture can proceed sequentially or directly from the three-body continuum. The rate of the {sup 15}O(2p,{gamma}){sup 17}Ne reaction obtained using the two-successive-proton-capture model has been discussed in J. Goerres et al. (Phys. Rev. C 51, 392, 1995). The role of continuum states ({sup 15}O+2p) for the rate calculation has been demonstrated in L.V Grigorenko, M.V. Zhukov (Phys. Rev. C 72, 015803, 2005). It has been suggested that the reaction rate can be enhanced by a few orders of magnitude by taking into account the three-body continuum. In order to verify these calculations, we have deduced the {sup 15}O(2p,{gamma}){sup 17}Ne cross section by studying the time-reversed process, the Coulomb dissociation of {sup 17}Ne, at the LAND/R{sup 3}B setup at GSI, using a {sup 17}Ne secondary beam from the fragment separator FRS.

  13. Measurement of the $\\eta_c (1S)$ production cross-section in proton-proton collisions via the decay $\\eta_c (1S) \\rightarrow p \\bar{p}$

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Graverini, Elena; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilschut, Hans; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2015-01-01

    The production of the $\\eta_c (1S)$ state in proton-proton collisions is probed via its decay to the $p \\bar{p}$ final state with the LHCb detector, in the rapidity range $2.0 6.5$ GeV/c. The cross-section for prompt production of $\\eta_c (1S)$ mesons relative to the prompt $J/\\psi$ cross-section is measured, for the first time, to be $\\sigma_{\\eta_c (1S)}/\\sigma_{J/\\psi} = 1.74 \\pm 0.29 \\pm 0.28 \\pm 0.18 _{B}$ at a centre-of-mass energy $\\sqrt{s} = 7$ TeV using data corresponding to an integrated luminosity of 0.7 fb$^{-1}$, and $\\sigma_{\\eta_c (1S)}/\\sigma_{J/\\psi} = 1.60 \\pm 0.29 \\pm 0.25 \\pm 0.17 _{B}$ at $\\sqrt{s} = 8$ TeV using 2.0 fb$^{-1}$. The uncertainties quoted are, in order, statistical, systematic, and that on the ratio of branching fractions of the $\\eta_c (1S)$ and $J/\\psi$ decays to the $p \\bar{p}$ final state. In addition, the inclusive branching fraction of $b$-hadron decays into $\\eta_c (1S)$ mesons is measured, for the first time, to be $B ( b \\rightarrow \\eta_c X ) = (4.88 \\pm 0.64 \\pm ...

  14. Nuclear Landau-Zener phenomena and the fusion cross sections in the system 13C + 16O → 12C + 17O

    International Nuclear Information System (INIS)

    Imanishi, B.; Oertzen, W. von.

    1990-07-01

    Reaction mechanism of the system 13 C+ 16 O- 12 C+ 17 O is investigated with the use of the nucleon molecular-orbital model in the framework of the orthogonalized coupled-reaction-channel (OCRC) theory. The adiabatic potentials obtained are quite different from the diagonal potentials of the original OCRC basis. The Landau-Zener radial coupling explains the backward enhancement of measured differential cross sections of the transfer reaction 13 C( 16 O, 17 O) 12 C. In the OCRC calculation the fusion cross sections of the channel 13 C+ 16 O is enhanced at low bombarding energies, in agreement with the experimental data. (author)

  15. Oceanic uptake of CO2 re-estimated through δ13C in WOCE samples

    International Nuclear Information System (INIS)

    Lerperger, Michael; McNichol, A.P.; Peden, J.; Gagnon, A.R.; Elder, K.L.; Kutschera, W.; Rom, W.; Steier, P.

    2000-01-01

    In addition to 14 C, a large set of δ 13 C data was produced at NOSAMS as part of the World ocean circulation experiment (WOCE). In this paper, a subset of 973 δ 13 C results from 63 stations in the Pacific Ocean was compared to a total number of 219 corresponding results from 12 stations sampled during oceanographic programs in the early 1970s. The data were analyzed in light of recent work to estimate the uptake of CO 2 derived from fossil fuel and biomass burning in the oceans by quantifying the δ 13 C Suess effect in the oceans. In principle, the δ 13 C value of dissolved inorganic carbon (DIC) allows a quantitative estimate of how much of the anthropogenic CO 2 released into the atmosphere is taken up by the oceans, because the δ 13 C of CO 2 derived from organic matter (∼2.7 percent) is significantly different from that of the atmosphere (∼0.8 percent). Our new analysis indicates an apparent discrepancy between the old and the new data sets, possibly caused by a constant offset in δ 13 C values in a subset of the data. A similar offset was reported in an earlier work by Paul Quay et al. for one station that was not included in their final analysis. We present an estimate for this assumed offset based on data from water depths below which little or no change in δ 13 C over time would be expected. Such a correction leads to a significantly reduced estimate of the CO 2 uptake, possibly as low as one half of the amount of 2.1 GtC yr -1 (gigatons carbon per year) estimated previously. The present conclusion is based on a comparison with a relatively small data set from the 70s in the Pacific Ocean. The larger data set collected during the GEOSECS program was not used because of problems reported with the data. This work suggests there may also be problems in comparing non-GEOSECS data from the 1970s to the current data. The calculation of significantly lower uptake estimates based on an offset-related problem appears valid, but the exact figures are

  16. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Thomas G. Thompson Cruise in the Pacific Ocean; TOPICAL

    International Nuclear Information System (INIS)

    Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.

    1999-01-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity[measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2

  17. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Thomas G. Thompson Cruise in the Pacific Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.

    1999-08-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity [measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2.

  18. 17O(n,α)14C cross section from 25 meV to approximately 1 MeV

    International Nuclear Information System (INIS)

    Koehler, P.E.; Graff, S.M.

    1991-01-01

    We have measured the 17 O(n,α) 14 C cross section from thermal energy to approximately 1 MeV. A bump in the data near 3 keV could be fitted by a state whose properties are consistent with a known subthreshold J π =1 - level at E x =8.039 MeV. The cause of the 1/v cross section near thermal energy could not be determined although the known 2 + state at 8.213 MeV was found to be too narrow to contribute much to the thermal cross section. Our data are compared to measurements made via the inverse reaction. There are many differences between the two sets of data. The astrophysical reaction rate was calculated from the measured cross section. This reaction plays a role in the nucleosynthesis of heavy elements in nonstandard big-bang models. At big-bang temperatures, the experimental rate was found to be in fair agreement with the rate estimated from the previously known properties of states of 18 O in this region. Furthermore, using the available information from experiments, it was estimated that the 17 O(n,α) 14 C rate is approximately a factor of 10 3 --10 4 times larger than the 17 O(n,γ) 18 O rate at big-bang temperatures. As a result, there may be significant cycling between 14 C and 17 O resulting in a reduction of heavy-element nucleosynthesis

  19. The differential cross section of the 12C(p,p)12C reaction near the resonance at energy 1.726 MeV

    International Nuclear Information System (INIS)

    Duvanov, S.M.; Kobzev, A.P.

    1996-01-01

    New experimental results on the differential cross section of the 12 C(p,p) 12 C reaction near the separate resonance at 1726 keV were obtained for the 170 deg scattering angle. The cross section measured with a thin target has been used for computer simulation of the spectra measured for a defined initial proton energy for two thick targets. The precision measurements of the proton energies have been carried out using the resonance of 27 Al(p,γ) 28 Si reaction at 1726.0 keV. The energy scale of the excitation function of the 12 C(p,p) 12 C reaction near the resonance at 1726 keV has been defined more exactly. It will improve the precision of depth profiling of carbon in solids. 11 refs., 5 figs., 1 tab

  20. anti p-3He reaction cross section at 200 MeV/c

    International Nuclear Information System (INIS)

    Balestra, F.; Bossolasco, S.; Bussa, M.P.; Busso, L.; Ferrero, L.; Grasso, A.; Panzieri, D.; Piragino, G.; Tosello, F.; Barbieri, R.; Bendiscioli, G.; Rotondi, A.; Salvini, P.; Venaglioni, A.; Zenoni, A.; Batusov, Yu.A.; Falomkin, I.V.; Pontecorvo, G.B.; Sapozhnikov, M.G.; Tretyak, V.I.; Breivik, F.O.; Jacobsen, T.; Soerensen, S.O.

    1988-01-01

    Inelastic anti p- 3 He events at 192.8 MeV/c are detected with a self-shunted streamer chamber. The measured reaction cross section is 392±23.8 mb. This result is briefly discussed and compared with other reaction cross sections for low-energy anti p with light nuclei. (orig.)

  1. Differential cross section measurement of elastic scattering 12C(p,p)12C in the astrophysical range of energy

    International Nuclear Information System (INIS)

    Baktibayev, M.K.; Burminskii, V.P.; Burtebaev, N.; Dzazairov -Kakhramanov, V.; Hassan, S.F.; Satpaev, N.K.; Zazulin, D.M.

    2004-01-01

    Full text: The fulfillment of planned works on measurements of differential cross sections of elastic scattering of protons on nuclear 12 C at the energy region of 350†1050 keV suggests the preparation of thin self - supporting carbon target. The self - supporting target is necessary in order to perform investigations in the total angular range. In the future last data will be used in order to determine optical potentials and scattering phases for this nuclear in the energy range of astrophysical interest. There was prepared target layer of the 12 C with natural composition of carbon and of thickness of 17.4 μg/cm 2 . The spraying was conducted in the vacuum evaporation installation (VUP - 4) by an electron bombardment method. Carbon was sprayed on a glass plate with previously deposited of layer salt. After a heating during 12 hours at the temperature of 150 o C the film of carbon was floated from glass plate and self - supporting target has been picked up on the specially prepared target frame. In order to determine thickness of target there was used the resonance chamber, installed in the protons channel of the accelerator RAC - 2 - 1 (INP NNC RK), with the help of which there was measured energy loss of the protons beam during the passage through target, disposed in the central chamber. For this purpose there was used the reaction 27 Al(p,γ) 28 Si with narrow resonance with E R = 992 keV and with detection of gamma-quanta with E γ = 1779 keV. On shift of the resonance E R =992 keV in the reaction 27 Al(p,γ) 28 Si, which takes place owing to protons energy loss in the thickness of carbon film, and using table values of brake quantities S(E p )[MeV·cm 2 /g] [1], there was determined thickness of this fine film. Such the method allows to determine thicknesses of films in the interval of (10 † 100) mcg/cm 2 with the accuracy of not worse than 5%. In the present work there were carried out measurements of angular distributions of cross sections of the

  2. Carbon Isotope (d13C) in dissolved inorganic carbon and other physical and biogeochemical variables synthesized across the global ocean from February 17, 1991 to February 21, 2005 (NODC Accession 0110496)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Measurements of d13C in DIC were compiled mainly from WOCE and CLIVAR cruises. The dataset also contains other physical and biogeochemical variables.

  3. 17 CFR 240.16c-1 - Brokers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Brokers. 240.16c-1 Section 240... Act of 1934 Exemption of Certain Transactions from Section 16(c) § 240.16c-1 Brokers. Any transaction... a broker of an order for an account in which the broker has no direct or indirect interest. ...

  4. Effects of electro-acupuncture on ovarian P450arom, P450c17α and mRNA expression induced by letrozole in PCOS rats.

    Directory of Open Access Journals (Sweden)

    Jie Sun

    Full Text Available Hyperandrogenism is a core factor in the series of reproductive and endocrine metabolic disorders involved in polycystic ovary syndrome (PCOS. Abnormalities in enzymatic activity and the expression of ovarian granular cell layer P450arom and theca cell P450c17α can lead to an atypical environment of local ovarian hormones, including excessive androgen levels. Rat models prepared with letrozole exhibit similar endocrine and histological changes to those that occur in human PCOS. We used such a model to study the role of electro-acupuncture (EA in regulating ovarian P450arom and P450c17α enzymatic activity and mRNA expression in PCOS rats. Female Sprague Dawley (SD rats aged 42 days were randomly divided into 3 groups (control, PCOS, and PCOS EA consisting of 10 rats each. The PCOS and PCOS EA groups were administered a gavage of 1.0 mg/kg(-1 of letrozole solution once daily for 21 consecutive days. Beginning in the ninth week, the PCOS EA group was administered low-frequency EA treatment daily for 14 consecutive days. After the treatment, we obtained the following results. The estrous cycles were restored in 8 of the 10 rats in the PCOS EA group, and their ovarian morphologies and ultrastructures normalized. The peripheral blood measurements (with ELISA showed significantly decreased androgens (i.e., androstenedione and testosterone with significantly increased estrogens (i.e., estrone, estradiol and increased P450arom with decreased P450C17α. Immunohistochemistry and Western blotting methods showed enhanced expression of ovarian granular cell layer P450arom as well as decreased expression of theca cell layer P450C17α. Fluorescence quantitative PCR methods showed enhanced expression of ovarian granular cell layer P450arom mRNA as well as decreased expression of theca cell layer P450C17α mRNA. These results may help explain the effects of electro-acupuncture in changing the local ovarian hyperandrogenic environment and improving reproductive

  5. Effects of electro-acupuncture on ovarian P450arom, P450c17α and mRNA expression induced by letrozole in PCOS rats.

    Science.gov (United States)

    Sun, Jie; Jin, Chunlan; Wu, Huangan; Zhao, Jimeng; Cui, Yunhua; Liu, Huirong; Wu, Lingxiang; Shi, Yin; Zhu, Bing

    2013-01-01

    Hyperandrogenism is a core factor in the series of reproductive and endocrine metabolic disorders involved in polycystic ovary syndrome (PCOS). Abnormalities in enzymatic activity and the expression of ovarian granular cell layer P450arom and theca cell P450c17α can lead to an atypical environment of local ovarian hormones, including excessive androgen levels. Rat models prepared with letrozole exhibit similar endocrine and histological changes to those that occur in human PCOS. We used such a model to study the role of electro-acupuncture (EA) in regulating ovarian P450arom and P450c17α enzymatic activity and mRNA expression in PCOS rats. Female Sprague Dawley (SD) rats aged 42 days were randomly divided into 3 groups (control, PCOS, and PCOS EA) consisting of 10 rats each. The PCOS and PCOS EA groups were administered a gavage of 1.0 mg/kg(-1) of letrozole solution once daily for 21 consecutive days. Beginning in the ninth week, the PCOS EA group was administered low-frequency EA treatment daily for 14 consecutive days. After the treatment, we obtained the following results. The estrous cycles were restored in 8 of the 10 rats in the PCOS EA group, and their ovarian morphologies and ultrastructures normalized. The peripheral blood measurements (with ELISA) showed significantly decreased androgens (i.e., androstenedione and testosterone) with significantly increased estrogens (i.e., estrone, estradiol) and increased P450arom with decreased P450C17α. Immunohistochemistry and Western blotting methods showed enhanced expression of ovarian granular cell layer P450arom as well as decreased expression of theca cell layer P450C17α. Fluorescence quantitative PCR methods showed enhanced expression of ovarian granular cell layer P450arom mRNA as well as decreased expression of theca cell layer P450C17α mRNA. These results may help explain the effects of electro-acupuncture in changing the local ovarian hyperandrogenic environment and improving reproductive and

  6. Effects of Electro-Acupuncture on Ovarian P450arom, P450c17α and mRNA Expression Induced by Letrozole in PCOS Rats

    Science.gov (United States)

    Wu, Huangan; Zhao, Jimeng; Cui, Yunhua; Liu, Huirong; Wu, Lingxiang; Shi, Yin; Zhu, Bing

    2013-01-01

    Hyperandrogenism is a core factor in the series of reproductive and endocrine metabolic disorders involved in polycystic ovary syndrome (PCOS). Abnormalities in enzymatic activity and the expression of ovarian granular cell layer P450arom and theca cell P450c17α can lead to an atypical environment of local ovarian hormones, including excessive androgen levels. Rat models prepared with letrozole exhibit similar endocrine and histological changes to those that occur in human PCOS. We used such a model to study the role of electro-acupuncture (EA) in regulating ovarian P450arom and P450c17α enzymatic activity and mRNA expression in PCOS rats. Female Sprague Dawley (SD) rats aged 42 days were randomly divided into 3 groups (control, PCOS, and PCOS EA) consisting of 10 rats each. The PCOS and PCOS EA groups were administered a gavage of 1.0 mg/kg−1 of letrozole solution once daily for 21 consecutive days. Beginning in the ninth week, the PCOS EA group was administered low-frequency EA treatment daily for 14 consecutive days. After the treatment, we obtained the following results. The estrous cycles were restored in 8 of the 10 rats in the PCOS EA group, and their ovarian morphologies and ultrastructures normalized. The peripheral blood measurements (with ELISA) showed significantly decreased androgens (i.e., androstenedione and testosterone) with significantly increased estrogens (i.e., estrone, estradiol) and increased P450arom with decreased P450C17α. Immunohistochemistry and Western blotting methods showed enhanced expression of ovarian granular cell layer P450arom as well as decreased expression of theca cell layer P450C17α. Fluorescence quantitative PCR methods showed enhanced expression of ovarian granular cell layer P450arom mRNA as well as decreased expression of theca cell layer P450C17α mRNA. These results may help explain the effects of electro-acupuncture in changing the local ovarian hyperandrogenic environment and improving reproductive and

  7. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Meteor Cruise 28/1 in the South Atlantic Ocean (WOCE Section A8, March 29 - May 12, 1994)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, A.

    2002-05-09

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO{sub 2}) and the fugacity of CO{sub 2} (fCO{sub 2}) at hydrographic stations during the R/V Meteor oceanographic cruise 28/1 in the South Atlantic Ocean (Section A8). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Recife, Brazil, on March 29, 1994, and ended after 35 days at sea in Walvis Bay, Namibia, on May 12, 1994. Instructions for accessing the data are provided. TCO{sub 2} was measured using two single-operator multiparameter metabolic analyzers (SOMMA) coupled to a coulometer for extracting and detecting CO{sub 2} from seawater samples. The overall precision and accuracy of the analyses was {+-}1.17 {micro}mol/kg. For the second carbonate system parameter, the fCO{sub 2} was measured in discrete samples by equilibrating a known volume of liquid phase (seawater) with a known volume of a gas phase containing a known mixture of CO{sub 2} in gaseous nitrogen (N{sub 2}). After equilibration, the gas phase CO{sub 2} concentration was determined by flame ionization detection following the catalytic conversion of CO{sub 2} to methane (CH{sub 4}). The precision of these measurements was less than or equal to 1.0%. The R/V Meteor Cruise 28/1 data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center. The NDP consists of two oceanographic data files, two FORTRAN 90 data retrieval routine files, a readme file, and this printed documentation that describes the contents and format of all files as well as the procedures and methods used to obtain the data.

  8. 17 CFR 240.16c-4 - Derivative securities.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Derivative securities. 240.16c-4 Section 240.16c-4 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED... Exchange Act of 1934 Exemption of Certain Transactions from Section 16(c) § 240.16c-4 Derivative securities...

  9. 17 CFR 270.3c-3 - Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt securities offered by small business... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-3 Definition of certain...

  10. Investigation of carbon dioxide in the central South Pacific Ocean (WOCE Sections P-16C and P-17C) during the TUNES/2 expedition of the R/V Thomas Washington, July--August, 1991. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    Takahashi, T.; Goddard, J.G.; Rubin, S.; Chipman, D.W.; Sutherland, S.C.

    1993-12-01

    This report summarizes the results of carbon dioxide and associated hydrographic measurements made during the oceanographic expedition, TUNES/2, aboard the R/V Thomas Washington in the central South Pacific Ocean. During the 40 day expedition, the total carbon dioxide concentration in 1000 seawater samples were determined using a coulometer system and the pCO(sub 2) in 940 seawater samples were determined using an equilibrator/gas chromatograph system. The alkalinity values in 900 water samples were computed using these measurements. In addition, 156 coulometric measurements were made for the Certified Reference Solutions (Batch No. 6) and yielded a mean value of 2303.2 +or- 1.5umol/kg. The chemical characteristics for the major water masses have been determined.

  11. Baryon exchange in 12 GeV/c. pi. /sup -/p interactions. [Differential cross sections

    Energy Technology Data Exchange (ETDEWEB)

    Arenton, M W; Bacino, W J; Hauptman, J M; Rudnick, F D; Shepard, P F; Slater, W E; Stork, D H; Ticho, H K [California Univ., Los Angeles (USA)

    1978-08-14

    Final states produced by charged baryon exchange in ..pi../sup -/p interactions at 12 GeV/c laboratory momentum have been studied. Forward neutrons with momenta determined by a calorimeter to be greater than 8.5 +- 1.4 GeV/c triggered the SLAC 40-inch hydrogen bubble chamber which operated at a 10 Hz expansion rate. Data on the reactions ..pi../sup -/p..-->..n..pi../sup -/..pi../sup +/, ..pi../sup -/p..-->..n..pi../sup -/..pi../sup +/..pi../sup 0/, and ..pi../sup -/p..-->..n..pi../sup -/..pi../sup -/..pi../sup +/..pi../sup +/are reported. In ..pi../sup -/p..-->..n..pi../sup -/..pi../sup +/ production of rho and f mesons is observed. Differential cross sections are derived and compared with data at lower incident momentum and with theoretical models. In ..pi../sup -/p..-->..n..pi../sup -/..pi../sup +/..pi../sup 0/, ..omega.. production is observed with a differential cross section having a deep dip near u' = 0.2 (GeV/c)/sup 2/. In ..pi../sup -/p..-->..n..pi../sup -/..pi../sup -/..pi../sup +/..pi../sup +/, ..delta../sup -/, rho and f production is observed. The observed mass distributions appear to indicate the production of wide resonances decaying into rho..pi pi... Some evidence for rho-..omega.. interference is also observed.

  12. 17 CFR 259.5s - Form U5S, for annual reports filed under section 5(c) of the Act.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form U5S, for annual reports filed under section 5(c) of the Act. 259.5s Section 259.5s Commodity and Securities Exchanges SECURITIES... 1935 Forms for Registration and Annual Supplements § 259.5s Form U5S, for annual reports filed under...

  13. Decadal Anthropogenic Carbon Storage Along P16 and P02

    Science.gov (United States)

    Carter, B. R.; Feely, R. A.; Talley, L. D.; Cross, J. N.; Macdonald, A. M.; Mecking, S.; Siedlecki, S. A.

    2016-02-01

    The Pacific Ocean has the largest ocean basin anthropogenic carbon (Canth) inventory due to the large size of the basin. We estimate anthropogenic carbon (Canth) concentrations and decadal storages along the meridional P16 and zonal P02 lines since the mid 90s using a modified version of the extended multiple linear regression (EMLR) technique with data from the WOCE, CLIVAR, and GO-SHIP occupations of these lines. We present our estimates and map the aragonite saturation state (ΩA) decreases and saturation horizon shoaling resulting from continued Canth storage. The average storage rate was larger along both sections during the most recent decade (2000's to 2010's) than during the previous decade (1990's to 2000's), especially along P02. Significant decadal concentration increases were found in the mixed layers, shallow thermoclines, mode waters, and portions of the intermediate water masses.

  14. Overexpression of c-myc and loss of heterozigosity on 2p, 3p, 5q, 17p and 18q in sporadic colorectal carcinoma Sobreexpresión de c-myc y pérdida de heterozigosidad en 2p, 3p, 5q, 17p y 18q en carcinoma colorrectal esporádico

    Directory of Open Access Journals (Sweden)

    A. Sánchez-Pernaute

    2005-03-01

    Full Text Available Aim: the aim of the present study is to evaluate the prognostic influence of loss of heterozygosity on 2p, 3p, 5q, 17p and 18q, and c-myc overexpression on surgically treated sporadic colorectal carcinoma. Methods: tumor and non-tumor tissue samples from 153 patients were analyzed. Fifty-one percent of patients were male, and mean age in the series was 67 years. Tumors were located in the proximal colon in 37 cases, in the distal bowel in 37, and in the rectum in 79 patients. c-myc overexpression was studied by means of Northern blot analysis, and loss of heterozigosity through microsatellite analysis. Results: c-myc overexpression was detected in 25% of cases, and loss of heterozygosity in at least one of the studied regions in 48%. There was no association between clinical and pathologic features, and genetic alterations. The disease-free interval was significantly shorter for patients with both genetic alterations; the presence of both events was an independent prognostic factor for poor outcome in the multivariate analysis (RR: 4.34, p Objetivo: el objetivo del presente trabajo es evaluar la importancia pronóstica de la pérdida de heterozigosidad en las regiones 2p, 3p, 5q, 17p y 18q y de la sobreexpresión del gen c-myc en el carcinoma colorrectal esporádico, mediante el estudio de la supervivencia libre de enfermedad tras cirugía potencialmente curativa. Métodos: se han analizado muestras tumorales y no tumorales de mucosa colónica de 153 pacientes. El 51% de los pacientes eran varones y la edad media de la serie fue 67 años. Los tumores fueron proximales en 37 casos, distales en 37 y localizados en recto en 79. Se analizó la sobreexpresión del RNA de c-myc por Northern blot, y la presencia de pérdida de heterozigosidad en las diferentes regiones consideradas por análisis de microsatélites. Resultados: se detectó sobreexpresión de c-myc en el 25% de los casos, y pérdida de heterozigosidad en alguna de las regiones estudiadas

  15. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Knorr Cruises in the North Atlantic Ocean on WOCE Sections AR24 (November 2-December 5, 1996) and A24, A20, and A22 (May 30-September 3, 1997)

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, K.M.

    2003-10-23

    This documentation describes the procedures and methods used to measure total carbon dioxide (TCO{sub 2}) total alkalinity (TALK), and partial pressure of CO{sub 2} (pCO{sub 2}) at hydrographic stations on the North Atlantic Ocean sections AR24, A24, A20, and A22 during the R/V Knorr Cruises 147-2, 151-2, 151-3, and 151-4 in 1996 and 1997. Conducted as part of the World Ocean Circulation Experiment (WOCE), the expeditions began at Woods Hole, Massachusetts, on October 24, 1996, and ended at Woods Hole on September 3, 1997. Instructions for accessing the data are provided. A total of 5,614 water samples were analyzed for discrete TCO{sub 2} using two single-operator multiparameter metabolic analyzers (SOMMAs) coupled to a coulometer for extracting and detecting CO{sub 2}. The overall accuracy of the TCO{sub 2} determination was {+-} 1.59 {micro}mol/kg. The TALK was determined in a total of 6,088 discrete samples on all sections by potentiometric titration using an automated titration system developed at the University of Miami. The accuracy of the TALK determination was {+-} 3 {micro}mol/kg. A total of 2,465 discrete water samples were collected for determination of pCO{sub 2} in seawater on sections A24, A20, and A22. The pCO{sub 2} was measured by means of an equilibrator-IR system by scientists from Lamont-Doherty Earth Observatory. The precision of the measurements was estimated to be about {+-} 0.15%, based on the reproducibility of the replicate equilibrations on a single hydrographic station. The North Atlantic data set is available as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center. The NDP consists of 12 ASCII data files, one Ocean Data View-formatted data file, a NDP-082 ASCII text file, a NDP-082 PDF file, and this printed documentation, which describes the contents and format of all files, as well as the procedures and methods used to obtain the data.

  16. Energy spectra of protons emitted in the p+Xe→p+... interactions at 2.34 GeV/c and π-+Xe→p+... at 9 GeV/c

    International Nuclear Information System (INIS)

    Slovinskij, B.; Mulas, Eh.

    1981-01-01

    The energy spectra of protons (ESP) emitted in reactions p+Xe→kp+... at 2.34 GeV/c (k=1-9) and π - +Xe→kp+... at 9 GeV/c (k=1-17) have been studied. An evidence has been obtained for a unified description of those spectra by an exponential dependence of the invariant cross sections upon the kinetic energy independently of the proton emission angle. It is found that the ESP temperature becomes independent of the proton emission frequency when the energy of the interaction induced hadron is greater than approximately 3 GeV [ru

  17. C4P cross-section libraries for safety analyses with SIMMER and related studies

    International Nuclear Information System (INIS)

    Rineiski, A.; Sinitsa, V.; Gabrielli, F.; Maschek, W.

    2011-01-01

    A code and data system, C 4 P, is under development at KIT. It includes fine-group master libraries and tools for generating problem-oriented cross-section libraries, primarily for safety studies with the SIMMER code and related analyses. In the paper, the 560-group master library and problem oriented 40-group and 72-group cross-section libraries, for thermal and fast systems, respectively, are described and their performances are investigated. (author)

  18. Exact finite range DWBA results for the /sup 12/C(p,d)/sup 11/C reaction at 700 MeV. [Differential cross sections

    Energy Technology Data Exchange (ETDEWEB)

    Rost, E; Shepard, J R [Colorado Univ., Boulder (USA). Nuclear Physics Lab.

    1975-12-08

    The differential cross sections for the /sup 12/C(p,d)/sup 11/C(g.s.) reaction at 700 MeV have been calculated in a full finite range DWBA approach. The absolute cross sections agree with the data and are dominated by contributions arising from the deuteron D-state.

  19. Development of improved space sampling strategies for ocean chemical properties: Total carbon dioxide and dissolved nitrate

    Science.gov (United States)

    Goyet, Catherine; Davis, Daniel; Peltzer, Edward T.; Brewer, Peter G.

    1995-01-01

    Large-scale ocean observing programs such as the Joint Global Ocean Flux Study (JGOFS) and the World Ocean Circulation Experiment (WOCE) today, must face the problem of designing an adequate sampling strategy. For ocean chemical variables, the goals and observing technologies are quite different from ocean physical variables (temperature, salinity, pressure). We have recently acquired data on the ocean CO2 properties on WOCE cruises P16c and P17c that are sufficiently dense to test for sampling redundancy. We use linear and quadratic interpolation methods on the sampled field to investigate what is the minimum number of samples required to define the deep ocean total inorganic carbon (TCO2) field within the limits of experimental accuracy (+/- 4 micromol/kg). Within the limits of current measurements, these lines were oversampled in the deep ocean. Should the precision of the measurement be improved, then a denser sampling pattern may be desirable in the future. This approach rationalizes the efficient use of resources for field work and for estimating gridded (TCO2) fields needed to constrain geochemical models.

  20. 26 CFR 1.381(c)(17)-1 - Deficiency dividend of personal holding company.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Deficiency dividend of personal holding company. 1.381(c)(17)-1 Section 1.381(c)(17)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(17)-1...

  1. A compilation of K+p --> K0 DELTA++ cross sections below 2 GeV/c

    CERN Document Server

    Giacomelli, G; Piccinini, M; Rimondi, F; Serra-Lugaresi, P

    1976-01-01

    Data published up to June 1976 on the quasi-two-body reaction K+p --> K0 DELTA++, with DELTA++ -->ppi+, are compiled for laboratory momenta from 0.7 to 2 GeV/c. They include integrated cross-sections, differencial cross-sections, average and differential density matrix elements, as well as coefficients of the Legendre polynomial expensions of the production differential distributions. The data are presented in the form og graphs and computer-produced tables. The method of computation is the same as in a previous report (CERN-HERA-75-1) on K+N cross-sections below2 GeV/c, to which the reader is referred for details on cards formats, notations, etc.

  2. Comparison of the 12C(e,e'p) cross section at low momentum transfer with a relativistic calculation

    International Nuclear Information System (INIS)

    Tamae, T.; Sato, Y.; Yokokawa, T.; Asano, Y.; Kawabata, M.; Konno, O.; Nakagawa, I.; Nishikawa, I.; Hirota, K.; Yamazaki, H.; Kimura, R.; Miyase, H.; Tsubota, H.; Giusti, C.; Meucci, A.

    2009-01-01

    The (e,e ' p 0 ) cross section of 12 C has been measured at an energy transfer of 60 MeV and a momentum transfer of 104.4 MeV/c using a 197.5 MeV continuous electron beam. The cross section at missing momenta between 181.5 and 304.8 MeV/c obtained from the experiment is compared with theoretical calculations based on the relativistic distorted-wave impulse approximation with and without meson-exchange currents (MEC). The contribution of MEC due to the seagull current is large in the high-missing-momentum region, in particular for the longitudinal component. The cross sections calculated using three different current-conserving operators (cc1, cc2, and cc3) are similar, in contrast to the (γ,p) reaction, where the operators give very different results. The shape of the measured cross section is well described by the calculations, whereas its magnitude is slightly smaller than that described by the calculations.

  3. [Caesarean section in german hospitals: validity of hospital quality report data for monitoring C-section rates].

    Science.gov (United States)

    Junghänel, K; Renz-Polster, H; Jarczok, M N; Hornemann, A; Böhler, T; De Bock, F

    2015-04-01

    It is not known if "hospital quality reports" (HQR) document Caesarean (C-) section rates at the hospital level accurately enough for use as a reliable data source when it comes to explaining regional variations of C-sections in Germany by factors at the hospital level. We aimed to answer this question using HQR from hospitals in Baden-Württemberg as data source. Diagnostic and procedure codes from HQR for the year 2008 (HQRdata), were used to calculate numbers of births, numbers of C-sections, and rates of births by C-section (CSR) for 94 of 97 hospitals in Baden-Württemberg. These numbers were compared to internal hospital (IH) data delivered upon request by 80 of 97 hospitals and stemming from vital statistics, birth registry forms, or external quality assurance datasets. There was no difference in the number of births between HQR data and IH data, but the number of C-sections and the CSR differed significantly (pCSR calculated using HQR data was 4.9 ± 17.9% higher than CSR from IH data (absolute difference 1.5 ± 5.8%). The correlation between the 2 data sources was moderate (r=0.73). Only 55% of the variance in IH data-based CSR was explained by HQR data. The proportion between highest and lowest CSR in hospitals in Baden-Württemberg was 4.9 for HQR data and 3.6 for IH data. There are significant and relevant differences between C-section rates based on ei-ther HQR or IH data. This questions routine data from HQR for 2008 as a reliable data source for research work. © Georg Thieme Verlag KG Stuttgart · New York.

  4. The 65 keV resonance in the {sup 17}O(p,alpha){sup 14}N thermonuclear reaction

    Energy Technology Data Exchange (ETDEWEB)

    Sergi, M.L. [Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Metodologie Fisiche e Chimiche per l' Ingegneria, Universita di Catania, Catania (Italy); Centro Siciliano di Fisica Nucleare e Struttura della Materia, Catania (Italy); Spitaleri, C. [Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Metodologie Fisiche e Chimiche per l' Ingegneria, Universita di Catania, Catania (Italy); Coc, A. [CSNSM, UMR 8609, CNRS/IN2P3and Universite Paris Sud 11, Batiment 104, 91405 Orsay Campus (France); Mukhamedzhanov, A. [Cyclotron Institute, Texas A and M University, College Station, TX 77843 (United States); Burjan, S.V. [Nuclear Physics Institute of ASCR Rez near Prague (Czech Republic); Gulino, M. [Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Metodologie Fisiche e Chimiche per l' Ingegneria, Universita di Catania, Catania (Italy); Hammache, F. [IPN, IN2P3-CNRS et Universite de Paris-Sud 11, 91406 Orsay Cedex (France); Hons, Z. [Nuclear Physics Institute of ASCR Rez near Prague (Czech Republic); Irgaziev, B. [GIK Institute of Engineering Sciences and Technology Topi District Swabi NWFP (Pakistan); Kiss, G.G. [Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Metodologie Fisiche e Chimiche per l' Ingegneria, Universita di Catania, Catania (Italy); Kroha, V. [Nuclear Physics Institute of ASCR Rez near Prague (Czech Republic); La Cognata, M. [Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Metodologie Fisiche e Chimiche per l' Ingegneria, Universita di Catania, Catania (Italy); Centro Siciliano di Fisica Nucleare e Struttura della Materia, Catania (Italy); Lamia, L.; Pizzone, R.G. [Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Metodologie Fisiche e Chimiche per l' Ingegneria, Universita di Catania, Catania (Italy); Sereville, N. de [IPN, IN2P3-CNRS et Universite de Paris-Sud 11, 91406 Orsay Cedex (France); Somorjai, E. [ATOMKI, Debrecen (Hungary)

    2010-03-01

    The indirect measurement of {sup 17}O(p,alpha){sup 14}N cross section was performed by means of the Trojan Horse Method. This approach allowed to investigate the ultra-low energy range (E{sub c.m.}=0-300 keV) relevant for several astrophysics environments, where two resonant levels of {sup 18}F at E{sub c.m.}{sup R}=65 keV and E{sub c.m.}{sup R}=183 keV play a significant role in the reaction rate determination.

  5. Ultrasonic measurement of elastic moduli of 17-4 pH stainless steel and uranium -2 molybdenum from -400C to 8000C

    International Nuclear Information System (INIS)

    Gieske, J.H.

    1980-10-01

    Young's Modulus, shear modulus, and Poisson's ratio for 17-4 pH stainless steel and uranium -2 molybdenum are calculated from ultrasonic longitudinal and shear velocities determined from -40 0 C to 800 0 C. The ultrasonic velocities were determined at elevated temperatures using a through-transmission buffer rod arrangement. An indium-gallium slurry bond was used as an ultrasonic couplant between Cupernickel 10 alloy buffer rods and the specimen. Microstructural changes and phase transitions in the specimens are evident from the temperature dependence of the ultrasonic data. 10 figures, 3 tables

  6. Study of the reaction 14 C (p,p) 14 C

    International Nuclear Information System (INIS)

    Murillo, G.; Ramirez, J.; Avila, O.; Fernandez, M.; Darden, S.E.; Prior, R.P.; Sen, S.

    1991-04-01

    The study of the elastic scattering of polarized protons in 14 C, it has been very limited. Some angular distributions exists to low energy, as well as measures of excitation functions to several angles for the differential section and the vectorial analyzer power. A detailed study of the elastic scattering of protons by 14 C, it give us experimental information of the excited states in 15 N. The study of these states, is since of considerable interest it is not very easy to obtain a target of 14 C also in a reaction 14 C (p,p) 14 C is possible to obtain information of levels in 15 N to an excitation energy E X >14.95 MeV. (Author)

  7. 17 CFR 240.15c1-2 - Fraud and misrepresentation.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...

  8. Indirect measurement of the 15N(p,α)12C reaction cross section through the THM

    International Nuclear Information System (INIS)

    Romano, S.; La Cognata, M.; Spitaleri, C.; Cherubini, S.; Gulino, M.; Lamia, L.; Musumarra, A.; Tribble, R.; Trache, C.L.; Fu, C.

    2005-01-01

    Among the reactions of the stellar CNO cycle, the 15 N(p,α) 12 C plays a crucial role. In particular its reaction rate is important for understanding the CNOI escape towards CNOII. Thus it is important to study its bare nucleus cross section at the energies typical of such astrophysical environments, i.e. few tens of keV. At these energies such a measurement is hard to perform in a direct way because of the electron screening effect as pointed out for several cases. A possibility is then given by indirect methods and in particular the Trojan Horse Method (THM) has been applied in this case. The preliminary validity test for the study of 15 N(p,α) 12 C via the 15 N(d,α 12 C)n three body reaction is reported in this work. A 15 N beam was provided by the cyclotron at Texas A and M University with energy 60 MeV/c and delivered onto a CD 2 target. A ΔE/E telescope (PSD + ionization chamber) and a pair of PSD's were mounted in a coplanar geometry. Coincidences between the detectors were considered and the 15 N-p quasi-free contribution to the overall three-body cross-section was selected. Data analysis and preliminary results will be discussed and compared with direct data. (author)

  9. The DHEA-sulfate depot following P450c17 inhibition supports the case for AKR1C3 inhibition in high risk localized and advanced castration resistant prostate cancer.

    Science.gov (United States)

    Tamae, Daniel; Mostaghel, Elahe; Montgomery, Bruce; Nelson, Peter S; Balk, Steven P; Kantoff, Philip W; Taplin, Mary-Ellen; Penning, Trevor M

    2015-06-05

    Prostate cancer is the second leading cause of cancer death in the United States. Treatment of localized high-risk disease and de novo metastatic disease frequently leads to relapse. These metastatic castration resistant prostate cancers (mCRPC) claim a high mortality rate, despite the extended survival afforded by the growing armamentarium of androgen deprivation, radiation and immunotherapies. Here, we review two studies of neoadjuvant treatment of high-risk localized prostate cancer prior to prostatectomy, the total androgen pathway suppression (TAPS) trial and the neoadjuvant abiraterone acetate (AA) trial. These two trials assessed the efficacy of the non-specific P450c17 inhibitor, ketoconazole and the specific P450c17 inhibitor, AA, to inhibit tissue and serum androgen levels. Furthermore, a novel and validated stable isotope dilution liquid chromatography electrospray ionization selected reaction monitoring mass spectrometry assay was used to accurately quantify adrenal and gonadal androgens in circulation during the course of these trials. The adrenal androgens, Δ(4)-androstene-3,17-dione, dehydroepiandrosterone and dehydroepiandrosterone sulfate were significantly reduced in the patients receiving ketoconazole or AA compared to those who did not. However, in both trials, a significant amount of DHEA-S (∼20 μg/dL) persists and thus may serve as a depot for intratumoral conversion to the potent androgen receptor ligands, testosterone (T) and 5α-dihydrotestosterone (DHT). The final step in conversion of Δ(4)-androstene-3,17-dione and 5α-androstanedione to T and DHT, respectively, is catalyzed by AKR1C3. We therefore present the case that in the context of the DHEA-S depot, P450c17 and AKR1C3 inhibition may be an effective combinatorial treatment strategy. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  10. High IL-17E and low IL-17C dermal expression identifies a fibrosis-specific motif common to morphea and systemic sclerosis.

    Directory of Open Access Journals (Sweden)

    Paola Adele Lonati

    Full Text Available BACKGROUND: High interleukin (IL-17A levels are characteristically found in the skin of systemic sclerosis (SSc individuals. Our aim was to investigate whether the dermal expression of IL-17A and related IL-17 family members (i.e. IL-17C, IL-17E and IL-17F could distinguish fibrotic from healthy skin and could show similarities in SSc and morphea, two disorders with presumed distinct pathogenesis, but characterized by skin fibrosis. METHODS: Biopsies were obtained from the involved skin of 14 SSc, 5 morphea and 8 healthy donors (HD undergoing plastic surgery. Immunohistochemistry/immunofluorescence techniques were coupled to a semi-automated imaging quantification approach to determine the presence of the IL-17 family members in the skin. The in vitro effects induced by the IL-17 family members on fibroblasts from normal and SSc individuals were assessed by ELISA and RIA. RESULTS: Positive cells for each of the IL-17 isoforms investigated were present in the dermis of all the individuals tested, though with variable frequencies. SSc individuals had increased frequency of IL-17A+ (p = 0.0237 and decreased frequency of IL-17F+ (p = 0.0127 and IL-17C+ cells (p = 0.0008 when compared to HD. Similarly, morphea individuals had less frequent IL-17C+ cells (p = 0.0186 in their skin but showed similar number of IL-17A+ and IL-17F+ cells when compared to HD. Finally, IL-17E+ cells were more numerous in morphea (p = 0.0109 and tended to be more frequent in SSc than in HD. Fibroblast production of IL-6, MMP-1 and MCP-1 was enhanced in a dose-dependent manner in the presence of IL-17E and IL-17F, but not in the presence of IL-17C. None of the cytokine tested had significant effect on type I collagen production. Of interest, in SSc the frequency of both IL-17A and IL-17F positive cells increased with disease duration. CONCLUSIONS: The frequency of IL-17A and IL-17F distinguish SSc to morphea individuals while dermal expression of IL-17C (low and IL-17E (high

  11. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  12. Carbon Dioxide, Hydrographic and Chemical Data Obtained During the Nine R/V Knorr Cruises Comprising the Indian Ocean CO2 Survey (WOCE Sections I8SI9S, I9N, I8NI5E, I3, I5WI4, I7N, I1, I10, and I2; December 1, 1994 - January 22, 1996) (NODC Accession 0115009)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115009 includes chemical, discrete sample, physical and profile data collected from R/V Knorr Cruises Comprising the Indian Ocean CO2 Survey (WOCE...

  13. 17 CFR 270.3c-1 - Definition of beneficial ownership for certain 3(c)(1) funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial... AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-1 Definition of beneficial ownership for certain 3(c)(1) funds. (a) As used in this section: (1) The term...

  14. Photoneutron cross sections measurements in 9Be, 13C e 17O with thermal neutron capture gamma-rays

    International Nuclear Information System (INIS)

    Semmler, Renato

    2006-01-01

    Photoneutron cross sections measurements of 9 Be, 13 C and 17 O have been obtained in the energy interval between 1,6 and 10,8 MeV, using neutron capture gamma-rays with high resolution in energy (3 a 21 eV), produced by 21 target materials, placed inside a tangential beam port, near the core of the IPEN/CNEN-SP IEA-R1 (5 MW) research reactor. The samples have been irradiated inside a 4π geometry neutron detector system 'Long Counter', 520,5 cm away from the capture target. The capture gamma-ray flux was determined by means of the analysis of the gamma spectrum obtained by using a Ge(Li) solid-state detector (EG and G ORTEC, 25 cm 3 , 5%), previously calibrated with capture gamma-rays from a standard target of Nitrogen (Melamine). The neutron photoproduction cross section has been measured for each target capture gamma-ray spectrum (compound cross section). A inversion matrix methodology to solve inversion problems for unfolding the set of experimental compound cross sections, was used in order to obtain the cross sections at specific excitation energy values (principal gamma line energies of the capture targets). The cross sections obtained at the energy values of the principal gamma lines were compared with experimental data reported by other authors, with have employed different gamma-ray sources. A good agreement was observed among the experimental data in this work with reported in the literature. (author)

  15. Study of the /sup 12/N 2. 43 MeV level. [Differential cross sections; 44 MeV /sup 3/He; 52 MeV p

    Energy Technology Data Exchange (ETDEWEB)

    Cecil, F E; Shepard, J R; Sercely, R R; Peterson, R J [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; King, N S.P. [California Univ., Davis (USA). Crocker Nuclear Lab.

    1976-10-11

    The differential cross sections have been measured for the reactions /sup 12/C(/sup 3/He, /sup 3/He')/sup 12/C(17.77 MeV 0/sup +/ T = 1) and /sup 12/C(/sup 3/He, t)/sup 12/N(2.43 MeV) at Esub(/sup 3/He) = 44 MeV. The similar shapes of the angular distributions and the relative magnitudes of the cross sections suggest that the /sup 12/N 2.43 MeV level is the 0/sup +/ T = 1 analog to the /sup 12/C 17.77 MeV level. The reaction /sup 14/N(p, t)/sup 12/N(2.43 MeV) at Esub(p) = 52 MeV is also studied. The strength with which this level is excited in this reaction is consistent with reasonable two-step calculations assuming the 2.43 MeV level to have Jsup(..pi..) = 0/sup +/.

  16. Rapid acidification of mode and intermediate waters in the southwestern Atlantic Ocean

    NARCIS (Netherlands)

    Salt, L.A.; van Heuven, S.M.A.C.; Claus, M.E.; Jones, E.M.; de Baar, H.J.W.

    2015-01-01

    Observations along the southwestern Atlantic WOCE A17 line made during the Dutch GEOTRACESNL programme (2010-2011) were compared with historical data from 1994 to quantify the changes in the anthropogenic component of the total pool of dissolved inorganic carbon (Delta C-ant). Application of the

  17. A cross section measurement of charm hyperons Ξc+ and Ξc0 in 250 GeV p/K/π-nucleon interactions

    International Nuclear Information System (INIS)

    Francisco, J.; Vergara, A.

    1995-01-01

    Fermilab Experiment 769 used a charge-selected, hadron beam of mean energy 250 GeV/c, composed of pions, kaons, and protons, impinging on beryllium, aluminum, copper and tungsten targets. Using a sample of approximately 4000 Ξ s - → Λ 0 π - decays, measurements of the charm baryon forward cross sections times branching ratio π ± N → Ξ c + X and π ± N → Ξ c 0 X are presented. Upper limits on α x BR are also determined for the states Ξ c + → Ξ s - π + π + and Ξ c 0 → Ξ s - π + produced in (p, π + , π - , K + , K - )-nucleon interactions

  18. Measurement of the Cross Section for High-$p_T$ Hadron Production in Scattering of 160 GeV/c Muons off Nucleons

    CERN Document Server

    Adolph, C; Alexakhin, V Yu; Alexandrov, Yu; Alexeev, G D; Amoroso, A; Antonov, A A; Austregesilo, A; Badelek, B; Balestra, F; Barth, J; Baum, G; Bedfer, Y; Bernhard, J; Bertini, R; Bettinelli, M; Bicker, K; Bieling, J; Birsa, R; Bisplinghoff, J; Bordalo, P; Bradamante, F; Braun, C; Bravar, A; Bressan, A; Burtin, E; Chiosso, M; Chung, S U; Cicuttin, A; Crespo, M L; Dalla Torre, S; Das, S; Dasgupta, S S; Dasgupta, S; Denisov, O Yu; Dhara, L; Donskov, S V; Doshita, N; Duic, V; Dünnweber, W; Dziewiecki, M; Efremov, A; Elia, C; Eversheim, P D; Eyrich, W; Faessler, M; Ferrero, A; Filin, A; Finger, M; Finger, M; Fischer, H; Franco, C; du Fresne von Hoheneschedu, N; Friedrich, J M; Frolov, V; Garfagnini, R; Gautheron, F; Gavrichtchouk, O P; Gerassimov, S; Geyer, R; Giorgi, M; Gnesi, I; Gobbo, B; Goertz, S; Grabmüller, S; Grasso, A; Grube, B; Gushterski, R; Guskov, A; Guthörl, T; Haas, F; von Harrach, D; Heinsius, F H; Herrmann, F; Hess, C; Hinterberger, F; Horikawa, N; Höppner, Ch; d'Hose, N; Ishimoto, S; Ivanov, O; Ivanshin, Yu; Iwata, T; Jahn, R; Jary, V; Jasinski, P; Joosten, R; Kabuss, E; Kang, D; Ketzer, B; Khaustov, G V; Khokhlov, Yu A; Kisselev, Yu; Klein, F; Klimaszewski, K; Koblitz, S; Koivuniemi, J H; Kolosov, V N; Kondo, K; Königsmann, K; Konorov, I; Konstantinov, V F; Korzenev, A; Kotzinian, A M; Kouznetsov, O; Krämer, M; Kroumchtein, Z V; Kuhn, R; Kunne, F; Kurek, K; Lauser, L; Lednev, A A; Lehmann, A; Levorato, S; Lichtenstadt, J; Liska, T; Maggiora, A; Magnon, A; Makke, N; Mallot, G K; Mann, A; Marchand, C; Martin, A; Marzec, J; Matsuda, T; Meshcheryakov, G; Meyer, W; Michigami, T; Mikhailov, Yu V; Moinester, M A; Morreale, A; Mutter, A; Nagaytsev, A; Nagel, T; Negrini, T; Nerling, F; Neubert, S; Neyret, D; Nikolaenko, V I; Nowak, W -D; Nunes, A S; Olshevsky, A G; Ostrick, M; Padee, A; Panknin, R; Panzieri, D; Parsamyan, B; Paul, S; Perevalova, E; Pesaro, G; Peshekhonov, D V; Piragino, G; Platchkov, S; Pochodzalla, J; Polak, J; Polyakov, V A; Pretz, J; Quaresma, M; Quintans, C; Rajotte, J -F; Ramos, S; Rapatsky, V; Reicherz, G; Richter, A; Rocco, E; Rondio, E; Rossiyskaya, N S; Ryabchikov, D I; Samoylenko, V D; Sandacz, A; Sapozhnikov, M G; Sarkar, S; Savin, I A; Sbrizzai, G; Schiavon, P; Schill, C; Schlüter, T; Schmidt, K; Schmitt, L; Schönning, K; Schopferer, S; Schott, M; Schröder, W; Shevchenko, O Yu; Silva, L; Sinha, L; Sissakian, A N; Slunecka, M; Smirnov, G I; Sosio, S; Sozzi, F; Srnka, A; Steiger, L; Stolarski, M; Sulc, M; Sulej, R; Sznajder, P; Takekawa, S; Ter Wolbeek, J; Tessaro, S; Tessarotto, F; Tkatchev, L G; Uhl, S; Uman, I; Vandenbroucke, M; Virius, M; Vlassov, N V; Wang, L; Windmolders, R; Wislicki, W; Wollny, H; Zaremba, K; Zavertyaev, M; Zemlyanichkina, E; Ziembicki, M; Zhuravlev, N; Zvyagin, A

    2013-01-01

    The cross section for production of charged hadrons with high transverse momenta in scattering of 160 GeV/c muons off nucleons at low photon virtualities has been measured at the COMPASS experiment at CERN. The results, which cover transverse momenta from 1.1 to 3.6 GeV/c, are compared to a next-to-leading order perturbative Quantum Chromodynamics (NLO pQCD) calculation in order to evaluate the applicability of pQCD to this process in the kinematic domain of the experiment. The shape of the calculated differential cross section as a function of transverse momentum is found to be in good agreement with the experimental data, but the normalization is underestimated by NLO pQCD. This discrepancy may point towards the relevance of terms beyond NLO in the pQCD framework. The dependence of the cross section on the pseudo-rapidity and on the charge of the hadrons is also discussed.

  19. Cryptotanshinone Regulates Androgen Synthesis through the ERK/c-Fos/CYP17 Pathway in Porcine Granulosa Cells

    Directory of Open Access Journals (Sweden)

    Danfeng Ye

    2017-01-01

    Full Text Available The aim of the study is to investigate the molecular mechanism behind androgen reduction in porcine granulosa cells (pGCs with Salvia miltiorrhiza Bunge extract cryptotanshinone. PGCs were isolated from porcine ovaries and identified. Androgen excess model of the pGCs was induced with the MAPK inhibitor PD98059 and then treated with cryptotanshinone. The testosterone level was measured by radioimmunoassay in the culture media. The protein levels of P-ERK1/2, c-Fos, and CYP17 in the cells were measured by western blot. Cryptotanshinone decreased the concentration of testosterone and the protein level of CYP17 and increased the protein levels of P-ERK1/2 and c-Fos in the androgen excess mode. After the c-Fos gene was silenced by infection with c-Fos shRNA lentivirus, we measured the mRNA expression by quantitative RT-PCR and protein level by western blot of P-ERK1/2, c-Fos, and CYP17. This showed that the mRNA expression and protein level of P-ERK1/2 and c-Fos were significantly reduced in the shRNA–c-Fos group compared to the scrambled group, while those of CYP17 were significantly increased. So we concluded that cryptotanshinone can significantly reduce the androgen excess induced by PD98059 in pGCs. The possible molecular mechanism for this activity is regulating the ERK/c-Fos/CYP17 pathway.

  20. [Effects of electroacupuncture of "Guanyuan" (CV 4)-"Zhongji" (CV 3) on ovarian P450 arom and P450c 17alpha expression and relevant sex hormone levels in rats with polycystic ovary syndrome].

    Science.gov (United States)

    Sun, Jie; Zhao, Ji-meng; Ji, Rong; Liu, Hui-rong; Shi, Yin; Jin, Chun-lan

    2013-12-01

    To observe the effect of electroacupuncture (EA) on ovarian P 450 arom and P 450 c 17 alpha (aromatases) expression and related sex hormone levels in polycystic ovary syndrome (PCOS) rats. Thirty SD rats were randomly divided into normal control group, model group and EA group (10 rats/group). PCOS model was made by intragastric administration of letrozole at 1 mg/kg per day for consecutive 21 days. "Guanyuan" (CV 4) and "Zhongji" (CV 3) acupoints were stimulated 20 min by EA (2 mA, 2 Hz), once daily for consecutive 14 days. The damp ovarian weight was weighed and the pathological changes of the ovarian tissue were observed after H. E. staining. Ultrastructural changes of the ovarian tissue were observed by transmission electron microscope. Immunohistochemical staining was adopted to detect ovarian follicle granulosa cell P 450 arom and follicle membrane cell P 450 c 17 alpha expression. The contents of estradiol (E 2), estrone (E 1), androstenedione (ASD), testosterone (T), follicle-stimulating hormone (FSH) and luteinizing hormone (LH) in the ovarian tissue were measured by ELISA. Compared with the normal group, there was a significant increase in the damp weight of both left and right ovarian tissues in the model group (P ovarian weight was remarkably reduced (P ovarian tissue such as thickening of the superficial albugineous coat of the ovary, thinning of the granular cell layer, and disappearance of the intraovular oocytes and coronaradiata under light microscope, and mitochondrion swelling, fracture or disappearance of mitochondrial cristae, and enlargement of the endoplasmic reticulum, etc. after modeling were obviously improved in the EA group. In comparison to the control group, the expression of the follicle granulosa cell P450 arom was significantly down-regulated and that of follicle membrane cell P 450 c 17 alpha was significantly upregulated in the model group (P ovarian tissues (P ovarian E 1 and E2 (P ovarian ASD, T and LH levels were notably

  1. Neutral strange particle production and inelastic cross section in p-bar+Ta reaction at 4 GeV/c

    International Nuclear Information System (INIS)

    Miyano, K.; Noguchi, Y.; Yoshimura, Y.

    1988-01-01

    The inclusive production of K/sub s//sup 0/, /Lambda/ Lambda-bar, and K/sub s//sup 0//Lambda/in the p-barTa reaction at 4 GeV/c was measured and compared with that in the p-barp reaction. The total inelastic and topological cross sections were also measured. The number of /Lambda/s produced in the p-barTa reaction was 11.3 times larger than that expected from the geometrical cross section, which is defined as A/sup 2/3/ times the cross section for the p-barp reaction. The yield ratio Lambda-bar//Lambda/was found to be 2 x 10/sup -2/. These values cannot be accounted for by a straightforward extension of the p-barN reaction. Besides, a correlation of 2 vees like K/sub s//sup 0/-/Lambda/could not prove their simultaneous production. Nuclear temperatures of 135 and 97 MeV were obtained from the kinetic energy spectra of K/sub s//sup 0/ and /Lambda/ respectively. The kinematical characteristics of the K/sub s//sup 0/ and /Lambda/produced were analyzed in terms of the fireball model

  2. The 600 °C and 450 °C isothermal sections of the Zn–Fe–B system

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Fucheng, E-mail: fuchengyin@xtu.edu.cn; Ruan, Xinglong; Zhao, Manxiu; Liu, Yongxiong; Li, Zhi

    2013-07-15

    Highlights: •The 600°C and 450°C isothermal sections of the Zn-Fe-B system are determined. •The solubility of Zn in Fe{sub 2}B and FeB at 600°C is 1.8 at.% and 2.5 at.%, respectively. •The solubility of Zn in Fe{sub 2}B and FeB at 450°C is 1.7 at.% and 2.1 at.%, respectively. •All Fe-Zn compounds can be in equilibrium with Fe{sub 2}B at 450°C. •Both FeB and Fe{sub 2}B are in equilibrium with the liquid phase at 600°C. -- Abstract: The isothermal sections of Zn–Fe–B ternary system at 600 °C and 450 °C have been determined experimentally using scanning electron microscopy, electron probe microanalysis and X-ray diffraction. Five three-phase regions exist in the isothermal section at 600 °C, seven three-phase regions exist at 450 °C. The experimental results indicate that B is almost insoluble in Fe–Zn compounds and α-Fe. The solubility of Zn in Fe{sub 2}B and FeB at 600 °C is 1.8 at.% and 2.5 at.%, respectively, and that at 450 °C is 1.7 at.% and 2.1 at.%, respectively. All Fe–Zn compounds can be in equilibrium with Fe{sub 2}B, the equilibrium between FeB and ζ prohibits the coexistence of Fe{sub 2}B and liquid at 450 °C. Both FeB and Fe{sub 2}B are in equilibrium with the liquid phase at 600 °C.

  3. Measurements of the total CO2 concentration and partial pressure of CO2 in seawater during WOCE expeditions in the South Pacific Ocean

    International Nuclear Information System (INIS)

    Takahashi, T.; Goddard, J.G.; Chipman, D.W.; Rubin, S.I.

    1993-01-01

    During the first year of the grant, we participated in three WOCE expeditions (a total of 152 days at sea) in the South Pacific Ocean, and the field phase of the proposed investigation has been successfully completed. The total CO 2 concentration and pCO 2 were determined at sea in 4419 water samples collected at 422 stations. On the basis of the shipboard analyses of SIO Reference Solutions for CO, and a comparison with the results of previous expeditions, the overall precision of our total CO 2 determinations is estimated to be about ±2 uM/kg. The deep water data indicate that there is a CO 2 maximum centered about 2600 meters deep. This appears to represent a southward return flow from the North Pacific. The magnitude and distribution of the CO, maximum observed along the 135.0 degrees W meridian differ from those observed along the 150.5 degrees W meridian due to Tuamotu Archipelago, a topographic high which interferes with the southward return flow. The surface water pCO 2 data indicate that the South Pacific sub-tropical gyre water located between about 15 degrees S and 50 degrees S is a sink for atmospheric CO 2

  4. 17 CFR 240.15c2-7 - Identification of quotations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Identification of quotations... quotations. (a) It shall constitute an attempt to induce the purchase or sale of a security by making a “fictitious quotation” within the meaning of section 15(c)(2) of the Act, for any broker or dealer to furnish...

  5. 17 CFR 240.15c1-9 - Use of pro forma balance sheets.

    Science.gov (United States)

    2010-04-01

    ... pro forma balance sheets. The term manipulative, deceptive, or other fraudulent device or contrivance... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Use of pro forma balance sheets. 240.15c1-9 Section 240.15c1-9 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...

  6. Anomalous low mass e+e- pair production in 17 GeV/c π-p collisions

    International Nuclear Information System (INIS)

    Abshire, G.; Adams, M.; Brown, C.

    1980-01-01

    An experiment was performed at the Multiparticle Spectrometer using 17 GeV/c π - from the BNL AGS, triggering upon inclusive e + e - production. Electron identification was based on two transition radiator detectors and lead-scintillator shower detectors. Good acceptance for the e + e - pair covered the region x/sub F/ > 0.3 for all p/sub T/ and pair masses. Charged particles and photons associated with the e + e - pair are detected over a large solid angle. e + e - pairs of mass up to 1.2 GeV/c 2 were produced. A clear peak due to rho, ω → e + e - is observed. For e + e - masses below the rho, ω, an excess of events is found over those expected from known sources such as eta → e + e - γ and ω → e + e - π 0 . This anomalous excess is more strongly produced at small x/sub F/. The structure of events containing anomalous e + e - pairs is reported in an attempt to elucidate their origin. In particular, effective mass distributions of e + e - γ, e + e - π 0 , e + e - charged hadrons are presented

  7. Mechanism of Cytochrome P450 17A1-Catalyzed Hydroxylase and Lyase Reactions

    DEFF Research Database (Denmark)

    Bonomo, Silvia; Jorgensen, Flemming Steen; Olsen, Lars

    2017-01-01

    Cytochrome P450 17A1 (CYP17A1) catalyzes C17 hydroxylation of pregnenolone and progesterone and the subsequent C17C20 bond cleavage (lyase reaction) to form androgen precursors. Compound I (Cpd I) and peroxo anion (POA) are the heme-reactive species underlying the two reactions. We have characte...... the concept that the selectivity of the steroidogenic CYPs is ruled by direct interactions with the enzyme, in contrast to the selectivity of drug-metabolizing CYPs, where the reactivity of the substrates dominates....... characterized the reaction path for both the hydroxylase and lyase reactions using density functional theory (DFT) calculations and the enzyme–substrate interactions by molecular dynamics (MD) simulations. Activation barriers for positions subject to hydroxylase reaction have values close to each other and span...

  8. Forward $\\pi^{+-}$ production in p-$O_2$ and p-$N_2$ interactions at 12 GeV/c

    CERN Document Server

    Catanesi, M.G.; Edgecock, R.; Ellis, M.; Gossling, C.; Bunyatov, S.; Krasnoperov, A.; Popov, B.; Tereschenko, V.; Di Capua, E.; Vidal-Sitjes, G.; Artamonov, A.; Giani, S.; Gilardoni, S.; Gorbunov, P.; Grant, A.; Grossheim, A.; Ivanchenko, A.; Ivanchenko, V.; Kayis-Topaksu, A.; Panman, J.; Papadopoulos, I.; Tcherniaev, E.; Tsukerman, I.; Wiebusch, C.; Zucchelli, P.; Blondel, A.; Borghi, S.; Morone, M.C.; Prior, G.; Schroeter, R.; Meurer, C.; Gastaldi, U.; Mills, G.B.; Graulich, J.S.; Gregoire, G.; Bonesini, M.; Ferri, F.; Kirsanov, M.; Bagulya, A.; Grichine, V.; Polukhina, N.; Palladino, V.; Coney, L.; Schmitz, D.; Barr, G.; Bobisut, F.; Gibin, D.; Guglielmi, A.; Mezzetto, M.; Dumarchez, J.; Dore, U.; Orestano, D.; Pastore, F.; Tonazzo, A.; Tortora, L.; Booth, C.; Howlett, L.; Bogomilov, M.; Kolev, D.; Tsenov, R.; Piperov, Stefan; Temnikov, P.; Apollonio, M.; Chimenti, P.; Giannini, G.; Burguet-Castell, J.; Cervera-Villanueva, A.; Gomez-Cadenas, J.J.; Martin-Albo, J.; Sorel, M.

    2008-01-01

    Measurements of double-differential charged pion production cross-sections in interactions of 12 GeV/c protons on O_2 and N_2 thin targets are presented in the kinematic range 0.5 GeV/c < p_{\\pi} < 8 GeV/c and 50 mrad < \\theta_{\\pi} < 250 mrad (in the laboratory frame) and are compared with p--C results. For p--N_2 (p--O_2) interactions the analysis is performed using 38576 (7522) reconstructed secondary pions. The analysis uses the beam instrumentation and the forward spectrometer of the HARP experiment at CERN PS. The measured cross-sections have a direct impact on the precise calculation of atmospheric neutrino fluxes and on the improved reliability of extensive air shower simulations by reducing the uncertainties of hadronic interaction models in the low energy range. In particular, the present results allow the common hypothesis that p--C data can be used to predict the p--N_2 and p--O_2 pion production cross-sections to be tested.

  9. The Trojan Horse Method as a tool to investigate low-energy resonances: the 18O(p, α)15N and 17O(p, α)14N cases

    International Nuclear Information System (INIS)

    La Cognata, M.; Sergi, M. L.; Spitaleri, C.; Cherubini, S.; Gulino, M.; Kiss, G.; Lamia, L.; Pizzone, R. G.; Romano, S.; Mukhamedzhanov, A.; Goldberg, V.; Tribble, R.; Coc, A.; Hammache, F.; Sereville, N. de; Irgaziev, B.; Tumino, A.

    2010-01-01

    The 18 O(p, α) 15 N and 17 O(p, α) 14 N reactions are of primary importance in several as-trophysical scenarios, including nucleosynthesis inside Asymptotic Giant Branch stars and oxygen and nitrogen isotopic ratios in meteorite grains. They are also key reactions to understand exotic systems such as R-Coronae Borealis stars and novae. Thus, the measurement of their cross sections in the low energy region can be crucial to reduce the nuclear uncertainty on theoretical predictions, because the resonance parameters are poorly determined. The Trojan Horse Method, in its newly developed form particularly suited to investigate low-energy resonances, has been applied to the 2 H( 18 O, α 15 N)n and 2 H( 17 O, α 14 N)n reactions to deduce the 18 O(p, α) 15 N and 17 O(p, α) 14 N cross sections at low energies. Resonances in the 18 O(p, α) 15 N and 17 O(p, α) 14 N excitation functions have been studied and the resonance parameters deduced.

  10. Differential cross sections measurement of {sup 31}P(p,pγ{sub 1}){sup 31}P reaction for PIGE applications

    Energy Technology Data Exchange (ETDEWEB)

    Jokar, A., E-mail: arezajokar@gmail.com; Kakuee, O.; Lamehi-Rachti, M.

    2016-09-15

    Differential cross sections of proton induced gamma-ray emission from the {sup 31}P(p,pγ{sub 1}){sup 31}P (E{sub γ} = 1266 keV) nuclear reaction were measured in the proton energy range of 1886–3007 keV at the laboratory angle of 90°. For these measurements a thin Zn{sub 3}P{sub 2} target evaporated onto a self-supporting C film was used. The gamma-rays and backscattered protons were detected simultaneously. An HPGe detector placed at an angle of 90° with respect to the beam direction was employed to collect gamma-rays while an ion implanted Si detector placed at a scattering angle of 165° was used to detect backscattered protons. Simultaneous collection of gamma-rays and RBS spectra is a great advantage of this approach which makes differential cross-section measurements independent on the collected beam charge. The obtained cross-sections were compared with the previously only measured data in the literature. The validity of the measured differential cross sections was verified through a thick target benchmarking experiment. The overall systematic uncertainty of cross section values was estimated to be better than ±9%.

  11. Gadolinium heteropoly complex K 17[Gd(P 2W 17O 61) 2] as a potential MRI contrast agent

    Science.gov (United States)

    Sun, Guoying; Feng, Jianghua; Wu, Huifeng; Pei, Fengkui; Fang, Ke; Lei, Hao

    2004-10-01

    Gadolinium heteropoly complex K17[Gd(P2W17O61)2] has been evaluated by in vitro and in vivo experiments as a potential contrast agent for magnetic resonance imaging (MRI). The thermal analysis and conductivity study indicate that this complex has good thermal stability and wide pH stability range. The T1 relaxivity is 7.59 mM-1 s-1 in aqueous solution and 7.97 mM-1 s-1 in 0.725 mmol l-1 bovine serum albumin (BSA) solution at 25 °C and 9.39 T, respectively. MR imaging of three male Sprague-Dawley rats showed remarkable enhancement in rat liver after intravenous injection, which persisted longer than with Gd-DTPA. The signal intensity increased by 57.1±16.9% during the whole imaging period at 0.082 mmol kg-1dose. Our preliminary in vitro and in vivo studies indicate that K17[Gd(P2W17O61)2] is a potential liver-specific MRI contrast agent.

  12. Electron collision cross sections of mercury

    International Nuclear Information System (INIS)

    Suzuki, Susumu; Kuzuma, Kiyotaka; Itoh, Haruo

    2006-01-01

    In this paper, we propose a new collision cross section set for mercury which revises the original set summarized by Hayashi in 1989. Hanne reported three excitation collision cross sections (6 3 P 0 , 6 3 P 1 , 6 3 P 2 ) determined from an electron beam experiment in 1988. As a matter for regret, no attentive consideration was given to combining these three excitation cross sections with the cross section set of Hayashi. Therefore we propose a new set where these three excitation cross sections are included. In this study, other two excitation cross sections (6 1 P 1 , 6 3 D 3 ) except for the three excitation collision cross sections (6 3 P 0 , 6 3 P 1 , 6 3 P 2 ) are taken from the original set of Hayashi. The momentum transfer cross section and the ionization collision cross section are also taken from Hayashi. A Monte Carlo Simulation (MCS) technique is applied for evaluating our new cross section set. The present results of the electron drift velocity and the ionization coefficient are compared to experimental values. Agreement is secured in relation to the electron drift velocity for 1.5 Td 2 ) is the reduced electric field, E (V/cm) is the electric field, N (1/cm 3 ) is the number density of mercury atoms at 0degC, 1 Torr, E/N is also equal to 2.828 x 10 -17 E/p 0 from the relation of the ideal gas equation, p 0 (Torr) is gas pressure at 0degC, 1 Torr=1.33322 x 10 -2 N/cm -2 and 10 -17 V/cm 2 is called 1 Td. Thus it is ensured that our new cross section set is reasonable enough to be used up to 100 eV when considering with the electron drift velocity and the ionization coefficient. (author)

  13. 17 CFR 270.22c-1 - Pricing of redeemable securities for distribution, redemption and repurchase.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redeemable securities for distribution, redemption and repurchase. 270.22c-1 Section 270.22c-1 Commodity and Securities... 1940 § 270.22c-1 Pricing of redeemable securities for distribution, redemption and repurchase. (a) No...

  14. 17 CFR 270.3c-2 - Definition of beneficial ownership in small business investment companies.

    Science.gov (United States)

    2010-04-01

    ... 1940 § 270.3c-2 Definition of beneficial ownership in small business investment companies. For the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial ownership in small business investment companies. 270.3c-2 Section 270.3c-2 Commodity and Securities...

  15. 17 CFR 200.19c - Director of the Office of Compliance Inspections and Examinations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Director of the Office of Compliance Inspections and Examinations. 200.19c Section 200.19c Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Organization and Program Management General Organizatio...

  16. A study of the reactions 14C( vector d, dprime)14C and 14C ( vector d, p)15C at 16.0 MeV

    International Nuclear Information System (INIS)

    Murillo, G.; Sen, S.; Darden, S.E.

    1994-01-01

    Cross-section and vector-analyzing-power measurements for 14 C(d, d prime) and 14 C(d, p) reactions have been carried out for E d =16 MeV. The inelastic-scattering data have been analyzed using the DWBA with a collective and a microscopic model form-factor and also by using the coupled-channels formalism with a vibrational model form-factor. It is observed that while the cross-section angular-distribution data for the two 2 + states at E x =7.012 and 8.318 MeV are very similar, the corresponding vector analyzing powers are quite different. The results of the analyses indicate that the distinctive characteristics probably arise from the difference in the relative importance of the proton and neutron components in the transition amplitude. The 3 - state at E x =6.728 MeV is identified as predominantly a 1p-3h state. Although the deformation parameters are relatively large, the single-particle structure aspects play a more dominant role than channel-coupling effects in populating the inelastic states. The transfer reaction data have been analyzed using the DWBA for bound and unbound states. The importance of two-step processes has been investigated via coupled-reaction-channels calculations. The g.s. and the states with excitation energies 0.770, 3.103 and 4.78 MeV in 15 C are populated primarily by a one-step process with a small two-step contribution in the case of the 3.103 MeV state. The 4.22 MeV state is populated predominantly by two-step processes. The 4.78 and the 5.83 MeV states have been identified as 1p-2h and 3p-4h, [3]/[2] + state, respectively, in an earlier report. There is close similarity in the level structures and reaction mechanisms between the states of 15 C and 17 O populated via the (d, p) reaction. ((orig.))

  17. Experimental study of the reaction π++42He→π+π-ppd at 1.7 GeV/c

    International Nuclear Information System (INIS)

    Bogdanski, M.; Jeanneret, J.-B.; Jeannet, E.

    1978-01-01

    Events of the type π +4 2 He→π + π - ppd produced by π + of 1.7 GeV/c incident momentum in a helium bubble chamber have been analysed. The cross-section for this reaction is found to be (1.22+-0.16)mb. This process is characterized by a large amount of deuterons acting as spectators and by an abundant production of Δ(1232) and rho(770) resonances associated to a π + n→π + π - p reaction on a bound neutron of the helium nucleus. (Auth.)

  18. A measurement of π+p backward elastic differential cross-sections from 1.282 to 2.472 GeV/c

    International Nuclear Information System (INIS)

    Candlin, D.J.; Lowe, D.C.; Peach, K.J.

    1984-02-01

    New high statistics measurements of π + p elastic scattering differential cross-sections are presented at 30 momentum points between 1.282 and 2.472 GeV/c, covering most of the angular distribution outside the forward diffractive peak. These data show significant disagreements at some momenta with previous high statistics experiments and with current partial wave analyses. (author)

  19. Search for structure in the low-energy anti p-p annihilation cross section

    International Nuclear Information System (INIS)

    Jastrzembski, E.; Haik, N.; McFarlane, W.K.; Mandelkern, M.A.; Schultz, D.C.; Amsler, C.; Hermann, C.C.; Wolfe, D.M.

    1980-01-01

    The relative cross section for annihilation of antiprotons on hydrogen into one or more charged pions was measured. Incident beam momentum was 600 MeV/c. Numbers of observed events (relative) were compared with those expected from the sensitivity of the apparatus. A phase-space model was used for p-barp annihilation. Relative cross sections are plotted vs invariant mass. Upper limits on cross sections for the formation of narrow resonances in the S region are given; previously reported structures are not confirmed. 2 figures, 1 table

  20. A novel approach for a C-11C bond formation: synthesis of 17α-([11C]prop-1-ynyl)-3-methoxy-3,17β-estradiol

    International Nuclear Information System (INIS)

    Wuest, F.; Zessin, J.

    2002-01-01

    A novel method for a 11 C-C bond formation was developed, employing a cross-coupling reaction between a terminal acetylene and [ 11 C]methyl iodide. The method was used for the synthesis of 17α-([ 11 C]prop-1-ynyl)-3-methoxy-3,17β-estadiol. (orig.)

  1. Study of Sigma /sup +or-/(1385) inclusive production in K/sup -/p interactions at 42 GeV/c

    CERN Document Server

    Barreiro, F; Blokzijl, R; Engelen, J J; Ganguli, S N; Gavillet, P; Hemingway, R J; Kittel, E W; Kluyver, J C; Shephard, W D; Wolters, G F

    1977-01-01

    Properties of Sigma /sup +or-/(1385) inclusively produced in 4.2 GeV/c K/sup -/p interactions are studied. Inclusive cross sections are presented together with differential cross sections as functions of x and p/sub t//sup 2/ for both Sigma /sup +/(1385) and Sigma /sup - /(1385). The complete density matrix for Sigma /sup +/(1385) production at small momentum transfer is studied as a function of t and of recoil mass MM/sup 2/. Substantial agreement with the predictions of the additive quark model is found. The Sigma /sup + /(1385) production in the target fragmentation region is studied in the framework of the triple-Regge model. (17 refs).

  2. Energy Dependence of Nuclear Transparency in C (p,2p) Scattering

    Science.gov (United States)

    Leksanov, A.; Alster, J.; Asryan, G.; Averichev, Y.; Barton, D.; Baturin, V.; Bukhtoyarova, N.; Carroll, A.; Heppelmann, S.; Kawabata, T.; Makdisi, Y.; Malki, A.; Minina, E.; Navon, I.; Nicholson, H.; Ogawa, A.; Panebratsev, Yu.; Piasetzky, E.; Schetkovsky, A.; Shimanskiy, S.; Tang, A.; Watson, J. W.; Yoshida, H.; Zhalov, D.

    2001-11-01

    The transparency of carbon for (p,2p) quasielastic events was measured at beam momenta ranging from 5.9 to 14.5 GeV/c at 90° c.m. The four-momentum transfer squared (Q2) ranged from 4.7 to 12.7 (GeV/c)2. We present the observed beam momentum dependence of the ratio of the carbon to hydrogen cross sections. We also apply a model for the nuclear momentum distribution of carbon to obtain the nuclear transparency. We find a sharp rise in transparency as the beam momentum is increased to 9 GeV/c and a reduction to approximately the Glauber level at higher energies.

  3. P17, an Original Host Defense Peptide from Ant Venom, Promotes Antifungal Activities of Macrophages through the Induction of C-Type Lectin Receptors Dependent on LTB4-Mediated PPARγ Activation

    Directory of Open Access Journals (Sweden)

    Khaddouj Benmoussa

    2017-11-01

    Full Text Available Despite the growing knowledge with regard to the immunomodulatory properties of host defense peptides, their impact on macrophage differentiation and on its associated microbicidal functions is still poorly understood. Here, we demonstrated that the P17, a new cationic antimicrobial peptide from ant venom, induces an alternative phenotype of human monocyte-derived macrophages (h-MDMs. This phenotype is characterized by a C-type lectin receptors (CLRs signature composed of mannose receptor (MR and Dectin-1 expression. Concomitantly, this activation is associated to an inflammatory profile characterized by reactive oxygen species (ROS, interleukin (IL-1β, and TNF-α release. P17-activated h-MDMs exhibit an improved capacity to recognize and to engulf Candida albicans through the overexpression both of MR and Dectin-1. This upregulation requires arachidonic acid (AA mobilization and the activation of peroxisome proliferator-activated receptor gamma (PPARγ nuclear receptor through the leukotriene B4 (LTB4 production. AA/LTB4/PPARγ/Dectin-1-MR signaling pathway is crucial for P17-mediated anti-fungal activity of h-MDMs, as indicated by the fact that the activation of this axis by P17 triggered ROS production and inflammasome-dependent IL-1β release. Moreover, we showed that the increased anti-fungal immune response of h-MDMs by P17 was dependent on intracellular calcium mobilization triggered by the interaction of P17 with pertussis toxin-sensitive G-protein-coupled receptors on h-MDMs. Finally, we also demonstrated that P17-treated mice infected with C. albicans develop less severe gastrointestinal infection related to a higher efficiency of their macrophages to engulf Candida, to produce ROS and IL-1β and to kill the yeasts. Altogether, these results identify P17 as an original activator of the fungicidal response of macrophages that acts upstream PPARγ/CLRs axis and offer new immunomodulatory therapeutic perspectives in the field of

  4. 17 CFR 240.15c3-1e - Deductions for market and credit risk for certain brokers or dealers (Appendix E to 17 CFR 240...

    Science.gov (United States)

    2010-04-01

    ... credit risk for certain brokers or dealers (Appendix E to 17 CFR 240.15c3-1). 240.15c3-1e Section 240....15c3-1(c)(2)(vi) and (c)(2)(vii) and to compute deductions for credit risk pursuant to this Appendix E... the broker or dealer will use to calculate deductions for market and credit risk on those categories...

  5. VBAC (Vaginal Birth After C-Section)

    Science.gov (United States)

    Vaginal birth after C-section (VBAC) Overview If you've delivered a baby by C-section and ... between scheduling a repeat C-section or attempting vaginal birth after C-section (VBAC). For many women, ...

  6. Investigations of neutron-rich nuclei at the dripline through their analogue states : The cases of $^{10}$Li - $^{10}$Be (T=2) and $^{17}$C - $^{17}$N (T=5/2)

    CERN Multimedia

    2002-01-01

    We propose to study the elastic resonance scattering reactions $^{9}$Li+p and $^{16}$C+p to investigate the energies, spins and parities of the lowest T=2 states in $^{10}$Be and the T=5/2 states in $^{17}$N. These are analogue states of the ground states and first excited states in $^{10}$Li and $^{17}$C.

  7. P-wave excited {B}_{c}^{* * } meson photoproduction at the LHeC

    Science.gov (United States)

    Kai, He; Huan-Yu, Bi; Ren-You, Zhang; Xiao-Zhou, Li; Wen-Gan, Ma

    2018-05-01

    As an important sequential work of the S-wave {B}c(* ) ({}1{S}0({}3{S}1) ) meson production at the large hadron electron collider (LHeC), we investigate the production of the P-wave excited {B}c* * states (1 P 1 and 3 P J with J = 0, 1, 2) via photoproduction mechanism within the framework of nonrelativistic QCD at the LHeC. Generally, the {e}-+P\\to γ +g\\to {B}c* * +b+\\bar{c} process is considered as the main production mechanism at an electron–proton collider due to the large luminosity of the gluon. However, according to our experience on the S-wave {B}c(* ) meson production at the LHeC, the extrinsic production mechanism, i.e., {e}-+P\\to γ +c\\to {B}c* * +b and {e}-+P\\to γ +\\bar{b} \\to {B}c* * +\\bar{c}, could also provide dominating contributions at low p T region. A careful treatment between these channels is performed and the results on total and differential cross sections, together with main uncertainties are discussed. Taking the quark masses m b = 4.90 ± 0.40 GeV and m c = 1.50 ± 0.20 GeV into account and summing up all the production channels, we expect to accumulate ({2.48}-1.75+3.55)× {10}4 {B}c* * ({}1{P}1), ({1.14}-0.82+1.49)× {10}4 {B}c* * ({}3{P}0),({2.38}-1.74+3.39)× {10}4 {B}c* * ({}3{P}1) and ({5.59}-3.93+7.84)× {10}4 {B}c* * ({}3{P}2) events at the \\sqrt{S}=1.30 {{T}}{{e}}{{V}} LHeC in one operation year with luminosity { \\mathcal L }={10}33 cm‑2 s‑1. With such sizable events, it is worth studying the properties of excited P-wave {B}c* * states at the LHeC.

  8. THE RGB AND AGB STAR NUCLEOSYNTHESIS IN LIGHT OF THE RECENT {sup 17}O(p, {alpha}){sup 14}N AND {sup 18}O(p, {alpha}){sup 15}N REACTION-RATE DETERMINATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Palmerini, S.; Sergi, M. L.; La Cognata, M.; Pizzone, R. G.; Spitaleri, C. [INFN-Laboratori Nazionali del Sud, Catania (Italy); Lamia, L. [Dipartimento di Fisica e Astronomia, Universita di Catania, Catania (Italy)

    2013-02-20

    In recent years, the Trojan Horse Method (THM) has been used to investigate the low-energy cross sections of proton-induced reactions on A = 17 and A = 18 oxygen isotopes, overcoming extrapolation procedures and enhancement effects due to electron screening. In particular, the strengths of the 20 keV and 65 keV resonances in the {sup 18}O(p, {alpha}){sup 15}N and {sup 17}O(p, {alpha}){sup 14}N reactions, respectively, have been extracted, as well as the contribution of the tail of the broad 656 keV resonance in the {sup 18}O(p, {alpha}){sup 15}N reaction inside the Gamow window. The strength of the 65 keV resonance in the {sup 17}O(p, {alpha}){sup 14}N reaction, measured by means of the THM, has been used to renormalize the corresponding resonance strength in the {sup 17}O + p radiative capture channel. As a result, more accurate reaction rates for the {sup 18}O(p, {alpha}){sup 15}N, {sup 17}O(p, {alpha}){sup 14}N, and {sup 17}O(p, {gamma}){sup 18}F processes have been deduced, devoid of systematic errors due to extrapolation or the electron screening effect. Such rates have been introduced into state-of-the-art red giant branch and asymptotic giant branch (AGB) models for proton-capture nucleosynthesis coupled with extra-mixing episodes. The predicted abundances have been compared with isotopic compositions provided by geochemical analysis of presolar grains. As a result, an improved agreement is found between the models and the isotopic mix of oxide grains of AGB origins, whose composition is the signature of low-temperature proton-capture nucleosynthesis. The low {sup 14}N/{sup 15}N found in SiC grains cannot be explained by the revised nuclear reaction rates and remains a serious problem that has not been satisfactorily addressed.

  9. Signaling through IL-17C/IL-17RE is dispensable for immunity to systemic, oral and cutaneous candidiasis.

    Science.gov (United States)

    Conti, Heather R; Whibley, Natasha; Coleman, Bianca M; Garg, Abhishek V; Jaycox, Jillian R; Gaffen, Sarah L

    2015-01-01

    Candida albicans is a commensal fungal microbe of the human orogastrointestinal tract and skin. C. albicans causes multiple forms of disease in immunocompromised patients, including oral, vaginal, dermal and disseminated candidiasis. The cytokine IL-17 (IL-17A) and its receptor subunits, IL-17RA and IL-17RC, are required for protection to most forms of candidiasis. The importance of the IL-17R pathway has been observed not only in knockout mouse models, but also in humans with rare genetic mutations that impact generation of Th17 cells or the IL-17 signaling pathway, including Hyper-IgE Syndrome (STAT3 or TYK2 mutations) or IL17RA or ACT1 gene deficiency. The IL-17 family of cytokines is a distinct subclass of cytokines with unique structural and signaling properties. IL-17A is the best-characterized member of the IL-17 family to date, but far less is known about other IL-17-related cytokines. In this study, we sought to determine the role of a related IL-17 cytokine, IL-17C, in protection against oral, dermal and disseminated forms of C. albicans infection. IL-17C signals through a heterodimeric receptor composed of the IL-17RA and IL-17RE subunits. We observed that IL-17C mRNA was induced following oral C. albicans infection. However, mice lacking IL-17C or IL-17RE cleared C. albicans infections in the oral mucosa, skin and bloodstream at rates similar to WT littermate controls. Moreover, these mice demonstrated similar gene transcription profiles and recovery kinetics as WT animals. These findings indicate that IL-17C and IL-17RE are dispensable for immunity to the forms of candidiasis evaluated, and illustrate a surprisingly limited specificity of the IL-17 family of cytokines with respect to systemic, oral and cutaneous Candida infections.

  10. Signaling through IL-17C/IL-17RE Is Dispensable for Immunity to Systemic, Oral and Cutaneous Candidiasis

    Science.gov (United States)

    Conti, Heather R.; Whibley, Natasha; Coleman, Bianca M.; Garg, Abhishek V.; Jaycox, Jillian R.; Gaffen, Sarah L.

    2015-01-01

    Candida albicans is a commensal fungal microbe of the human orogastrointestinal tract and skin. C. albicans causes multiple forms of disease in immunocompromised patients, including oral, vaginal, dermal and disseminated candidiasis. The cytokine IL-17 (IL-17A) and its receptor subunits, IL-17RA and IL-17RC, are required for protection to most forms of candidiasis. The importance of the IL-17R pathway has been observed not only in knockout mouse models, but also in humans with rare genetic mutations that impact generation of Th17 cells or the IL-17 signaling pathway, including Hyper-IgE Syndrome (STAT3 or TYK2 mutations) or IL17RA or ACT1 gene deficiency. The IL-17 family of cytokines is a distinct subclass of cytokines with unique structural and signaling properties. IL-17A is the best-characterized member of the IL-17 family to date, but far less is known about other IL-17-related cytokines. In this study, we sought to determine the role of a related IL-17 cytokine, IL-17C, in protection against oral, dermal and disseminated forms of C. albicans infection. IL-17C signals through a heterodimeric receptor composed of the IL-17RA and IL-17RE subunits. We observed that IL-17C mRNA was induced following oral C. albicans infection. However, mice lacking IL-17C or IL-17RE cleared C. albicans infections in the oral mucosa, skin and bloodstream at rates similar to WT littermate controls. Moreover, these mice demonstrated similar gene transcription profiles and recovery kinetics as WT animals. These findings indicate that IL-17C and IL-17RE are dispensable for immunity to the forms of candidiasis evaluated, and illustrate a surprisingly limited specificity of the IL-17 family of cytokines with respect to systemic, oral and cutaneous Candida infections. PMID:25849644

  11. Circadian expression of steroidogenic cytochromes P450 in the mouse adrenal gland--involvement of cAMP-responsive element modulator in epigenetic regulation of Cyp17a1.

    Science.gov (United States)

    Košir, Rok; Zmrzljak, Ursula Prosenc; Bele, Tanja; Acimovic, Jure; Perse, Martina; Majdic, Gregor; Prehn, Cornelia; Adamski, Jerzy; Rozman, Damjana

    2012-05-01

    The cytochrome P450 (CYP) genes Cyp51, Cyp11a1, Cyp17a1, Cyb11b1, Cyp11b2 and Cyp21a1 are involved in the adrenal production of corticosteroids, whose circulating levels are circadian. cAMP signaling plays an important role in adrenal steroidogenesis. By using cAMP responsive element modulator (Crem) knockout mice, we show that CREM isoforms contribute to circadian expression of steroidogenic CYPs in the mouse adrenal gland. Most striking was the CREM-dependent hypomethylation of the Cyp17a1 promoter at zeitgeber time 12, which resulted in higher Cyp17a1 mRNA and protein expression in the knockout adrenal glands. The data indicate that products of the Crem gene control the epigenetic repression of Cyp17 in mouse adrenal glands. © 2011 The Authors Journal compilation © 2011 FEBS.

  12. $\\pi \\pi$ phase-shift analysis from an experiment $\\pi^{-}p \\rightarrow \\pi^{-} \\pi^{+} n$ at 17.2 GeV/c

    CERN Document Server

    Grayer, G; Dietl, H; Hyams, Bernard David; Jones, C; Koch, W; Lorenz, E; Lütjens, G; Männer, W; Meissburger, J; Ochs, W; Schlein, P E; Stierlin, U; Weilhammer, P

    1972-01-01

    The pi pi phase-shifts have been determined by a Chew-Low extrapolation in the pi pi mass region from 500 to 1500 MeV using data of a spark chamber experiment on pi /sup -/p to pi /sup -/ pi /sup +/n at 17.2 GeV/c, which yielded 318000 events. The authors find an I=0 s- wave phase shift which increases slowly, passing through 90 degrees near 900 MeV, and then rises very rapidly. The old 'up' solution is eliminated on the basis of fits in the mass region from 900-1000 MeV. (13 refs).

  13. 17 CFR 240.15c1-7 - Discretionary accounts.

    Science.gov (United States)

    2010-04-01

    ... transactions or purchase or sale which are excessive in size or frequency in view of the financial resources... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-7 Discretionary...

  14. Cross sections and beam asymmetries for $\\vev{e}p \\to en\\pi^+$ in the nucleon resonance region for $1.7 \\le Q^2 \\le 4.5 (GeV)^2$

    Energy Technology Data Exchange (ETDEWEB)

    K. Park; V.D. Burkert; W. Kim; CLAS Collaboration

    2008-01-01

    The exclusive electroproduction process $\\vec{e}p \\to e^\\prime n \\pi^+$ was measured in the range of the photon virtuality $Q^2 = 1.7 - 4.5 \\rm{GeV^2}$, and the invariant mass range for the $n\\pi^+$ system of $W = 1.15 - 1.7 \\rm{GeV}$ using the CEBAF Large Acceptance Spectrometer. For the first time, these kinematics are probed in exclusive $\\pi^+$ production from protons with nearly full coverage in the azimuthal and polar angles of the $n\\pi^+$ center-of-mass system. The $n\\pi^+$ channel has particular sensitivity to the isospin 1/2 excited nucleon states, and together with the $p\\pi^0$ final state will serve to determine the transition form factors of a large number of resonances. The largest discrepancy between these results and present modes was seen in the $\\sigma_{LT'}$ structure function. In this experiment, 31,295 cross section and 4,184 asymmetry data points were measured. Because of the large volume of data, only a reduced set of structure functions and Legendre polynomial moments can be presented that are obtained in model-independent fits to the differential cross sections.

  15. Search for the rare decay of ψ (3686 )→Λc+p ¯ e+e-+c .c . at BESIII

    Science.gov (United States)

    Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Alekseev, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bai, Y.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Begzsuren, K.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, P. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Cossio, F.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garillon, B.; Garzia, I.; Gilman, A.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guo, A. Q.; Guo, R. P.; Guo, Y. P.; Guskov, A.; Haddadi, Z.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Irshad, M.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jin, Y.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Khoukaz, A.; Kiese, P.; Kliemt, R.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuessner, M.; Kupsc, A.; Kurth, M.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, J. W.; Li, Jin; Li, K. J.; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, L. Z.; Libby, J.; Lin, C. X.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, D. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. L.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, X. L.; Lusso, S.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mangoni, A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Meng, Z. X.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Muchnoi, N. Yu.; Muramatsu, H.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peng, Z. Y.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Pitka, A.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qi, T. Y.; Qian, S.; Qiao, C. F.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rolo, M.; Rong, G.; Rosner, Ch.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shan, X. Y.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shi, X.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, L.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tan, Y. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, Meng; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, F.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Yang, Yifan; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, T. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Q.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, A. N.; Zhu, J.; Zhu, J.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Besiii Collaboration

    2018-05-01

    Based on a data sample of (448.1 ±2.9 )×106ψ (3686 ) decays collected with the BESIII experiment, a search for the flavor changing neutral current transition ψ (3686 )→Λc+p ¯ e+e-+c .c . is performed for the first time. No signal candidates are observed and the upper limit on the branching fraction of ψ (3686 )→Λc+p ¯e+e- is determined to be 1.7 ×10-6 at the 90% confidence level. The result is consistent with expectations from the standard model, and no evidence for new physics is found.

  16. Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections

    Science.gov (United States)

    Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.

    2012-01-01

    The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.

  17. Investigation of 17F+p elastic scattering at near-barrier energies

    International Nuclear Information System (INIS)

    El-Azab Farid, M.; Ibraheem, Awad A.; Al-Hajjaji, Arwa S.

    2015-01-01

    The 17 F +p elastic scattering at two near-barrier energies of 3.5 and 4.3 MeV/nucleon, have been analyzed in the framework of the single folding approach. The folded potentials are constructed by folding the density-dependent (DDM3Y) effective nucleon-nucleon interaction over the nuclear density of the one-proton halo nucleus 17 F. Two versions of the density are considered. In addition, two versions of the one-nucleon knock-on exchange potentials are introduced to construct the real microscopic potentials. The derived potentials supplemented by phenomenological Woods-Saxon imaginary and spin-orbit potentials produced excellent description of the differential elastic scattering cross sections at the higher energy without need to introduce any renormalization. At the lower energy, however, in order to successfully reproduce the data, it is necessary to reduce the strength of the constructed real DDM3Y potential by about 25% of its original value. Furthermore, good agreement with data is obtained using the extracted microscopic DDM3Y potentials for both real and imaginary parts. Moreover, the interesting notch test is applied to investigate the sensitivity of the elastic scattering cross section to the radial distribution of the constructed microscopic potentials. The extracted reaction (absorption) cross sections are, also, investigated. (orig.)

  18. Signaling through IL-17C/IL-17RE is dispensable for immunity to systemic, oral and cutaneous candidiasis.

    Directory of Open Access Journals (Sweden)

    Heather R Conti

    Full Text Available Candida albicans is a commensal fungal microbe of the human orogastrointestinal tract and skin. C. albicans causes multiple forms of disease in immunocompromised patients, including oral, vaginal, dermal and disseminated candidiasis. The cytokine IL-17 (IL-17A and its receptor subunits, IL-17RA and IL-17RC, are required for protection to most forms of candidiasis. The importance of the IL-17R pathway has been observed not only in knockout mouse models, but also in humans with rare genetic mutations that impact generation of Th17 cells or the IL-17 signaling pathway, including Hyper-IgE Syndrome (STAT3 or TYK2 mutations or IL17RA or ACT1 gene deficiency. The IL-17 family of cytokines is a distinct subclass of cytokines with unique structural and signaling properties. IL-17A is the best-characterized member of the IL-17 family to date, but far less is known about other IL-17-related cytokines. In this study, we sought to determine the role of a related IL-17 cytokine, IL-17C, in protection against oral, dermal and disseminated forms of C. albicans infection. IL-17C signals through a heterodimeric receptor composed of the IL-17RA and IL-17RE subunits. We observed that IL-17C mRNA was induced following oral C. albicans infection. However, mice lacking IL-17C or IL-17RE cleared C. albicans infections in the oral mucosa, skin and bloodstream at rates similar to WT littermate controls. Moreover, these mice demonstrated similar gene transcription profiles and recovery kinetics as WT animals. These findings indicate that IL-17C and IL-17RE are dispensable for immunity to the forms of candidiasis evaluated, and illustrate a surprisingly limited specificity of the IL-17 family of cytokines with respect to systemic, oral and cutaneous Candida infections.

  19. Invariant mass spectroscopy of {sup 19,17}C and {sup 14}B using proton inelastic and charge-exchange reactions

    Energy Technology Data Exchange (ETDEWEB)

    Satou, Y., E-mail: satou@phya.snu.ac.k [Department of Physics and Astronomy, Seoul National University, Seoul (Korea, Republic of); Nakamura, T. [Department of Physics, Tokyo Institute of Technology, Tokyo (Japan); Fukuda, N. [Institute of Physical and Chemical Research (RIKEN), Saitama (Japan); Sugimoto, T.; Kondo, Y.; Matsui, N.; Hashimoto, Y.; Nakabayashi, T.; Okumura, Y.; Shinohara, M. [Department of Physics, Tokyo Institute of Technology, Tokyo (Japan); Motobayashi, T.; Yanagisawa, Y.; Aoi, N.; Takeuchi, S.; Gomi, T.; Togano, Y. [Institute of Physical and Chemical Research (RIKEN), Saitama (Japan); Kawai, S. [Department of Physics, Rikkyo University, Tokyo (Japan); Sakurai, H. [Institute of Physical and Chemical Research (RIKEN), Saitama (Japan); Ong, H.J.; Onishi, T.K. [Department of Physics, University of Tokyo, Tokyo (Japan)

    2010-03-01

    The neutron-rich carbon isotopes {sup 19,17}C and the boron isotope {sup 14}B have been investigated, respectively, by the proton inelastic and charge-exchange reactions on a liquid hydrogen target at around 70 MeV/nucleon. The invariant mass method in inverse kinematics was employed to map the energy spectrum above the neutron decay threshold of the residual nuclei. New states on carbon isotopes are reported. An experimental capability of extracting beta-decay strengths via forward angle (p,n) cross sections on unstable nuclei is shown.

  20. Human Blood CD1c+ Dendritic Cells Promote Th1 and Th17 Effector Function in Memory CD4+ T Cells.

    Science.gov (United States)

    Leal Rojas, Ingrid M; Mok, Wai-Hong; Pearson, Frances E; Minoda, Yoshihito; Kenna, Tony J; Barnard, Ross T; Radford, Kristen J

    2017-01-01

    Dendritic cells (DC) initiate the differentiation of CD4 + helper T cells into effector cells including Th1 and Th17 responses that play an important role in inflammation and autoimmune disease pathogenesis. In mice, Th1 and Th17 responses are regulated by different conventional (c) DC subsets, with cDC1 being the main producers of IL-12p70 and inducers of Th1 responses, while cDC2 produce IL-23 to promote Th17 responses. The role that human DC subsets play in memory CD4 + T cell activation is not known. This study investigated production of Th1 promoting cytokine IL-12p70, and Th17 promoting cytokines, IL-1β, IL-6, and IL-23, by human blood monocytes, CD1c + DC, CD141 + DC, and plasmacytoid DC and examined their ability to induce Th1 and Th17 responses in memory CD4 + T cells. Human CD1c + DC produced IL-12p70, IL-1β, IL-6, and IL-23 in response to R848 combined with LPS or poly I:C. CD141 + DC were also capable of producing IL-12p70 and IL-23 but were not as proficient as CD1c + DC. Activated CD1c + DC were endowed with the capacity to promote both Th1 and Th17 effector function in memory CD4 + T cells, characterized by high production of interferon-γ, IL-17A, IL-17F, IL-21, and IL-22. These findings support a role for CD1c + DC in autoimmune inflammation where Th1/Th17 responses play an important role in disease pathogenesis.

  1. Genotype distribution of estrogen receptor-alpha, catechol-O-methyltransferase, and cytochrome P450 17 gene polymorphisms in Caucasian women with uterine leiomyomas.

    Science.gov (United States)

    Denschlag, Dominik; Bentz, Eva-Katrin; Hefler, Lukas; Pietrowski, Detlef; Zeillinger, Robert; Tempfer, Clemens; Tong, Dan

    2006-02-01

    To evaluate the association between the presence of uterine leiomyomas and three functional single nucleotide polymorphisms (SNPs) of the estrogen receptor alpha (ESR1), catechol-O-methyltransferase (COMT), and cytochrom P450 17 (CYP17A) genes, which have been described to modify the estrogen metabolism. Prospective case control study. Academic research institution. One hundred thirty women with clinically and surgically diagnosed uterine leiomyomas and 139 population controls. Peripheral venous puncture. Polymerase chain reaction and pyrosequencing were performed to genotype women with respect to the ESR1 IVS1-397 T/C (PvuII), COMT G158A, and the CYP17A 34T-->C SNPs. Comparing women with uterine leiomyomas and controls, no statistically significant differences with respect to allele frequency and genotype distribution were ascertained for ESR1 IVS 1-397 T/C (PvuII) (P=0.9 and P=0.6, respectively), COMT G158A (P=0.3 and P=0.6, respectively), and CYP17A 34T-->C (P=0.1 and P=0.5, respectively). When all two-way interactions of investigated SNPs were ascertained, no significant interactions were observed. In a multivariate model, no SNP was significantly associated with leiomyomas. Carriage of the ESR1 IVS1-397 T/C (PvuII), COMT G158A, and the CYP17A 34T-->C SNPs is not associated with the susceptibility to uterine leiomyoma in a Caucasian population.

  2. 17 CFR 240.17a-7 - Records of non-resident brokers and dealers.

    Science.gov (United States)

    2010-04-01

    ... brokers and dealers. 240.17a-7 Section 240.17a-7 Commodity and Securities Exchanges SECURITIES AND... Stabilizing Activities § 240.17a-7 Records of non-resident brokers and dealers. (a)(1) Except as provided in paragraphs (b) and (c) of this section, each non-resident broker or dealer registered or applying for...

  3. Vaginal birth after C-section

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000589.htm Vaginal birth after C-section To use the sharing ... the same way again. Many women can have vaginal deliveries after having a C-section in the ...

  4. Hyperhomocysteinemia, methylenetetrahydrofolate reductase c.677C>T polymorphism and risk of cancer: cross-sectional and prospective studies and meta-analyses of 75,000 cases and 93,000 controls

    DEFF Research Database (Denmark)

    Zacho, Jeppe; Yazdanyar, Shiva; Bojesen, Stig E

    2011-01-01

    including 74,671 cases and 93,344 controls. Cross-sectionally, plasma homocysteine levels were 12.9 and 11.6 µmol/L in those with and without cancer (p homocysteine levels increased with age and age-adjusted odds ratio for any cancer in those with homocysteine levels >12.4 versus ....4 µmol/L did not differ from 1.0. In cancer-free participants, plasma homocysteine levels were 14.7 and 11.7 µmol/L in MTHFR c.677C>T homozygtes and noncarriers (p T homozygotes versus noncarriers did not differ...... from 1.0. However, in meta-analyses odds ratio for MTHFR c.677C>T homozygotes versus noncarriers were 1.07 (95% CI: 1.01-1.12) for any cancer, 1.77 (1.17-2.68) for esophagus cancer, 1.40 (1.19-1.66) for gastric cancer and 0.85 (0.77-0.94) for colorectal cancer. Increased plasma homocysteine levels...

  5. 17 CFR 230.160 - Registered investment company exemption from Section 101(c)(1) of the Electronic Signatures in...

    Science.gov (United States)

    2010-04-01

    ... exemption from Section 101(c)(1) of the Electronic Signatures in Global and National Commerce Act. 230.160...(c)(1) of the Electronic Signatures in Global and National Commerce Act. A prospectus for an... 101(c)(1) of the Electronic Signatures in Global and National Commerce Act. [65 FR 47284, Aug. 2, 2000] ...

  6. Differential cross section measurement of radiative capture of protons by nuclei 12C

    International Nuclear Information System (INIS)

    Burtebayev, N.; Zazulin, D.M.; Buminskii, V.P.; Zarifov, R.A.; Tohtarov, R.N.; Sagindykov, Sh.Sh.; Baktibayev, M.K.

    2003-01-01

    Measurements of differential cross sections of nuclear reaction 12 C(p, γ) 13 N at 0, 45, 90, 135 Deg. to beam direction of flying protons in the field of E p = 350-1100 KeV with an error it is not worse than 10 % have been carried out. Most important was studied, from the astrophysical point of view, process of capture of protons by nucleuses 12 C on the ground state of a nucleus 13 N. It is experimentally shown isotropy of angular distribution of differential cross sections of reaction 12 C(p, γ) 13 N, in the given field energy of protons

  7. Differential cross sections of proton Compton scattering at photon laboratory energies between 1.2 and 1.7 GeV

    International Nuclear Information System (INIS)

    Duda, J.; Hoefner, F.W.; Jung, M.; Kleissler, R.; Kueck, H.; Leu, P.; Marne, K.D. de; Munk, B.; Vogl, W.; Wedemeyer, R.

    1982-11-01

    Differential cross sections of proton Compton scattering have been measured at the Bonn 2.5 GeV synchrotron. The experiment covers photon laboratory energies between 1.2 GeV and 1.7 GeV and the square of the four-momentum transfer ranges from t = -0.17 GeV 2 to -0.98 GeV 2 corresponding to c.m. scattering angles between 35 0 and 80 0 . The cross sections exhibit a forward peak followed by a monotone fall-off up to the largest measured vertical stroketvertical stroke-values. Fits of the form dsigma/dt = A.exp(Bt) to the data points with vertical stroketvertical stroke 2 yield forward cross sections A, which are consistent with the 0 0 cross sections calculated from the measured total photon-proton cross section. The average slope is B = 5.6 +- 0.14 GeV 2 . (orig.)

  8. Investigation of p+, p- and P0 production in π+p interactions at 16 GeV/c and pp interactions at 24 GeV/c and quark model predictions

    International Nuclear Information System (INIS)

    Blobel, V.; Laven, H.; Boeckmann, K.; Heilmann, H.G.; Holt, K. von; Idschok, U.; Nussbaumer, H.; Roedel, R.

    1977-11-01

    Quasi- and total inclusive rho + , rho - and rho 0 cross sections have been studied, using data of a π + p and a pp bubble chamber experiment at 16 and 24 GeV/c, respectively. In pp collisions it is found that the total inclusive cross sections for rho + , rho - and rho - production are about equal. This equality also holds for the differential cross sections dsigma/dy*, all showing the characteristics of dominantly central production. In the π + p reactions the rho - are mainly produced centrally, whereas there are strong additional contributions in the beam fragmentation region for rho + and rho 0 mesons. In the central region, however, the cross sections for rho + , rho - and rho 0 production are almost equal within errors. All our findings agree with what is expected from quark model predictions. (orig.) [de

  9. Precision measurement of the $^{7}$Be(p, $\\gamma$)$\\,^{8}$B cross section with an implanted $^{7}$Be target

    CERN Document Server

    Baby, L.T.; Goldring, G.; Hass, M.; Weissman, L.; Fedoseyev, V.N.; Koester, U.; Nir-El, Y.; Haquin, G.; Gaggeler, H.W.; Weinreich, R.

    2003-01-01

    The $^{7}$Be(p, $\\gamma$) $\\,^{8}$B reaction plays a central role in the evaluation of solar neutrino fluxes. We report on a new precision measurement of the cross section of this reaction, following our previous experiment with an implanted $^{7}$Be target, a raster- scanned beam, and the elimination of the backscattering loss. The new measurement incorporates a more abundant $^{7}$Be target and a number of improvements in design and procedure. The point at E$_{lab}$ = 991 keV was measured several times under varying experimental conditions, yielding a value of S$_{17}$(E$_{c.m.}$ = 850 keV) = 24.0 $\\pm$ 0.5 eV b. Measurements were carried out at lower energies as well. Because of the precise knowledge of the implanted $^{7}$Be density profile, it was possible to reconstitute both the off- and on-resonance parts of the cross section and to obtain from the entire set of measurements an extrapolated value of S$_{17}$(0)=21.2 $\\pm$ 0.7 eV b.

  10. Measurement of the $^{12}$C($n,p$)$^{12}$B cross section at n_TOF (CERN) by in-beam activation analysis

    CERN Document Server

    Žugec, P.; Bosnar, D.; Mengoni, A.; Altstadt, S.; Andrzejewski, J.; Audouin, L.; Barbagallo, M.; Bécares, V.; Bečvář, F.; Belloni, F.; Berthoumieux, E.; Billowes, J.; Boccone, V.; Brugger, M.; Calviani, M.; Calviño, F.; Cano-Ott, D.; Carrapiço, C.; Cerutti, F.; Chiaveri, E.; Chin, M.; Cortés, G.; Cortés-Giraldo, M.A.; Cosentino, L.; Diakaki, M.; Domingo-Pardo, C.; Dressler, R.; Duran, I.; Eleftheriadis, C.; Ferrari, A.; Finocchiaro, P.; Fraval, K.; Ganesan, S.; García, A.R.; Giubrone, G.; Gómez-Hornillos, M.B.; Gonçalves, I.F.; González-Romero, E.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Gurusamy, P.; Heinitz, S.; Jenkins, D.G.; Jericha, E.; Käppeler, F.; Karadimos, D.; Kivel, N.; Kokkoris, M.; Krtička, M.; Kroll, J.; Langer, C.; Lederer, C.; Leeb, H.; Leong, L.S.; Lo Meo, S.; Losito, R.; Manousos, A.; Marganiec, J.; Martínez, T.; Massimi, C.; Mastinu, P.; Mastromarco, M.; Mendoza, E.; Milazzo, P.M.; Mingrone, F.; Mirea, M.; Mondalaers, W.; Musumarra, A.; Paradela, C.; Pavlik, A.; Perkowski, J.; Plompen, A.; Praena, J.; Quesada, J.; Rauscher, T.; Reifarth, R.; Riego, A.; Roman, F.; Rubbia, C.; Sarmento, R.; Saxena, A.; Schillebeeckx, P.; Schmidt, S.; Schumann, D.; Tagliente, G.; Tain, J.L.; Tarrío, D.; Tassan-Got, L.; Tsinganis, A.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Versaci, R.; Vermeulen, M.J.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Ware, T.; Weigand, M.; Weiß, C.; Wright, T.

    2014-01-01

    The integral cross section of the $^{12}$C($n,p$)$^{12}$B reaction has been determined for the first time in the neutron energy range from threshold to several GeV at the n_TOF facility at CERN. The measurement relies on the activation technique, with the $\\beta$-decay of $^{12}$B measured over a period of four half-lives within the same neutron bunch in which the reaction occurs. The results indicate that model predictions, used in a variety of applications, are mostly inadequate. The value of the integral cross section reported here can be used as a benchmark for verifying or tuning model calculations.

  11. 17 CFR 240.15c3-1d - Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1).

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Satisfactory Subordination...-Counter Markets § 240.15c3-1d Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1). (a) Introduction. (1) This Appendix sets forth minimum and non-exclusive requirements for satisfactory...

  12. Kerma factors and reaction cross sections for n + 12C between 15 and 18 MeV

    International Nuclear Information System (INIS)

    Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.

    1988-01-01

    Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from 12 C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The 12 C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range. (author)

  13. Comparison of cross sections for C+O reactions in the second regime of complete fusion

    International Nuclear Information System (INIS)

    Beck, C.; Haas, F.; Freeman, R.M.; Heusch, B.; Coffin, J.P.; Guillaume, G.; Rami, F.; Wagner, P.

    1985-01-01

    Kinetic energy spectra, angular distributions, and elemental yield distributions have been measured for the 12 C + 16 O, 12 C + 18 O and 13 C + 17 O reaction products over an energy range from 2 to 7 times the Coulomb barrier energy. A careful kinematic analysis of the evaporation residues and comparisons with statistical model calculations show that fusion proceeds with full momentum transfer followed by a statistical decay of the compound nucleus. The competition between complete fusion process and peripheral reactions in the 12 C + 16 O system is less important than for the 12 C + 18 O and 13 C + 17 O reactions. The unexpectedly high 12 C + 16 O complete fusion cross sections are related to the possible occurence of a superdeformation of the 28 Si compound nucleus

  14. Investigation of {sup 17}F+p elastic scattering at near-barrier energies

    Energy Technology Data Exchange (ETDEWEB)

    El-Azab Farid, M. [Assiut University, Physics Department, Assiut (Egypt); Ibraheem, Awad A. [Al-Azhar University, Physics Department, Assiut (Egypt); King Khalid University, Physics Department, Abha (Saudi Arabia); Al-Hajjaji, Arwa S. [Taiz University, Physics Department, Taiz (Yemen)

    2015-10-15

    The {sup 17}F +p elastic scattering at two near-barrier energies of 3.5 and 4.3 MeV/nucleon, have been analyzed in the framework of the single folding approach. The folded potentials are constructed by folding the density-dependent (DDM3Y) effective nucleon-nucleon interaction over the nuclear density of the one-proton halo nucleus {sup 17}F. Two versions of the density are considered. In addition, two versions of the one-nucleon knock-on exchange potentials are introduced to construct the real microscopic potentials. The derived potentials supplemented by phenomenological Woods-Saxon imaginary and spin-orbit potentials produced excellent description of the differential elastic scattering cross sections at the higher energy without need to introduce any renormalization. At the lower energy, however, in order to successfully reproduce the data, it is necessary to reduce the strength of the constructed real DDM3Y potential by about 25% of its original value. Furthermore, good agreement with data is obtained using the extracted microscopic DDM3Y potentials for both real and imaginary parts. Moreover, the interesting notch test is applied to investigate the sensitivity of the elastic scattering cross section to the radial distribution of the constructed microscopic potentials. The extracted reaction (absorption) cross sections are, also, investigated. (orig.)

  15. Absolute cross sections measurement for the 12C + 12C system at astrophysically relevant energies

    International Nuclear Information System (INIS)

    Barron-Palos, L.; Aguilera, E.F.; Aspiazu, J.; Huerta, A.; Martinez-Quiroz, E.; Monroy, R.; Moreno, E.; Murillo, G.; Ortiz, M.E.; Policroniades, R.; Varela, A.; Chavez, E.

    2006-01-01

    The 12 C + 12 C fusion reaction has been studied in the center-of-mass energy range of 2.25 to 6.01 MeV. Through the detection of gamma rays from the first excited states of the residual nuclei 20 Ne, 23 Na and 23 Mg, absolute cross sections for the 12 C( 12 C,-bar α), 12 C( 12 C,-bar p) and 12 C( 12 C,-bar n) reactions have been obtained. In this new measurement, the energy dependence of the S-factor is found to increase as the energy decreases below 3 MeV in the center of mass. This tendency was observed in previous measurements by Mazarakis et al., and has since then become a subject of controversy. In this work, where the cross sections are measured at even lower energies, we confirm the rise in the S-factor toward the energy region relevant for star evolution and nucleosynthesis calculations (E c.m. =1-3 MeV)

  16. C P Gopalakrishnan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C P Gopalakrishnan. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 6 June 2004 pp 74-85 Classroom. The Real Effects of Pseudo Forces · P Chaitanya Das G Srinivasa Murthy C P Gopalakrishnan P C Deshmukh · More Details ...

  17. Contribution of 194.1 keV Resonance to 17O(p, alpha) 14N Reaction Rate using R Matrix Code

    International Nuclear Information System (INIS)

    Chafa, A.; Messili, F.Z.; Barhoumi, S.

    2009-01-01

    Knowledge of the 17 O(p, alpha ) 14 N reaction rates is required for evaluating elemental abundances in a number of hydrogen - burning stellar sites. This reaction is specifically very important for nucleosynthesis of the rare oxygen isotope 17 O. Classical novae are thought to be a major source of 17 O in the Galaxy and produce the short-live radioisotope 18 F whose + decay is followed by a gamma ray emission which could be observed with satellites such as the Integral observatory. As the 17 O(p, alpha) 14 N and 17 O(p, alpha ) 18 F reactions govern the destruction of 17 O and the formation of 1 '8F, their rates are decisive in determining the final abundances of these isotopes. Stellar temperatures of primary importance for nucleosynthesis are typically in the ranges T = 0.01-0.1 GK for red giant, AGB, and massive stars, and T 0.01-0.4 GK for classical nova explosions In recent work, we observed, for the first time, a resonance a 183.3 keV corresponding to level in 18 F at Ex 5789.8 ± 0.3 keV. A new astrophysical parameters of this resonance are found. In this work we study this reaction using numerical code based on R matrix method including the new values of level energy and parameters of 183.3 keV resonance in order to show his contribution to 17 O(p, alpha) 14 N reaction rates. We also use old parameters values of this resonance given in Keiser work for comparison. We show that this resonance predominate the reaction rates in all range of stellar temperature for classical nova explosions. This is in good agreement with our work with experimental method. We also study cross section and differential cross section 17 O(p, alpha ) 14 N reaction with R matrix method

  18. Neutron scattering from 12C between 15.6 and 17.3 MeV

    International Nuclear Information System (INIS)

    Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L.

    1993-01-01

    The differential cross section σ(θ) for neutron elastic scattering from 12 C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The σ(θ) data, together with published analysing power A y (θ) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present 12 C(n,n) 12 C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in 11 C via an iterative-moment approach or a dispersive optical-model analysis. (author)

  19. Application of the Trojan Horse Method to study neutron induced reactions: the 17O(n, α14C reaction

    Directory of Open Access Journals (Sweden)

    Gulino M.

    2014-03-01

    Full Text Available The reaction 17O(n, α14C was studied using virtual neutrons coming from the quasi-free deuteron break-up in the three body reaction 17O+d → α+14C+p. This technique, called virtual neutron method, extends the Trojan Horse method to neutron-induced reactions allowing to study the reaction cross section avoiding the suppression effects coming from the penetrability of the centrifugal barrier. For incident neutron energies from thermal up to a few hundred keV, direct experiments have shown the population of two out of three expected excited states at energies 8213 keV and 8282 keV and the influence of the sub-threshold level at 8038 keV. In the present experiment the 18O excited state at E* = 8.125 MeV, missing in the direct measurement, is observed. The angular distributions of the populated resonances have been measured for the first time. The results unambiguously indicate the ability of the method to overcome the centrifugal barrier suppression effect and to pick out the contribution of the bare nuclear interaction.

  20. Isotopes as tracers of the oceanic circulation: Results from the World Ocean Circulation Experiment

    International Nuclear Information System (INIS)

    Schlosser, P.; Jenkins, W.J.; Key, R.; Lupton, J.

    2002-01-01

    During the past decades, natural and anthropogenic isotopes such as tritium ( 3 H), radiocarbon ( 14 C), 3 He, or the stable isotopes of water have been used in studies of the dynamics of natural systems. Early applications of tracers to studies of the ocean were directed at determination of circulation patterns and mean residence times of specific water masses, as well as estimates of mixing coefficients. These exploratory studies suggested that tracers can add significantly to our understanding of the oceanic circulation. In order to fully exploit this potential, the first global tracer study, the GEochemical Ocean SECtions Study (GEOSECS), was launched. From the GEOSECS results it was immediately apparent that very close coordination of tracer programs with physical oceanography studies is required for full utilization of tracer data. During the 1980s plans for the World OCean Experiment (WOCE) were developed. As part of its Hydrographic Program (WHP), especially during the one-time survey, a set of tracers were measured on a global scale with unprecedented spatial resolution (both lateral and vertical). The original plan included a larger number of tracers (CFCs, 3 H/ 3 He, 14 C, 39 Ar, stable isotopes of water, helium isotopes, 228 Ra, 90 Sr, 137 Cs, 85 Kr) than could actually be measured systematically (CFCs, 3 H/ 3 He, 14 C, H 2 18 O/H 2 16 O, helium isotopes). Nevertheless, the resulting data set, which presently is under evaluation, exceeds those obtained from pre-WOCE tracer studies by a wide margin. In this contribution, we describe the existing WOCE data set and demonstrate the type of results that can be expected from its interpretation on the basis of a few selected examples. These examples include: (1) the application of tritium and 3 He to studies of the ventilation of the upper waters in the Pacific Ocean, (2) the spreading of intermediate water in the Pacific and Indian oceans as derived from the distribution of 3 He, and (3) the evaluation of

  1. Quasielastic C-12(e,e ' p) reaction at high momentum transfer

    NARCIS (Netherlands)

    Morrison, JH; Baghaei, H; Bertozzi, W; Gilad, S; Glickman, J; Hyde-Wright, CE; Kalantar-Nayestanaki, N; Lourie, RW; Penn, S; Ulmer, PE; Weinstein, LB; Cottman, BH; Ghedira, L; Winhold, EJ; Calarco, J.R.; Wise, J; Boberg, P; Chang, CC; Zhang, D; Aniol, K; Epstein, MB; Margaziotis, DJ; Finn, JM; Perdrisat, C; Punjabi, P.

    We measured the C-12(e,e'p) cross section as a function of missing energy in parallel kinematics for (q,omega)=(970 MeV/c, 330 MeV) and (990 MeV/c, 475 MeV). At omega=475 MeV, at the maximum of the quasielastic peak, there is a large continuum (E-m>50 MeV) cross section extending out to the deepest

  2. Thermonuclear reaction rate of 17O(p,γ)18F

    International Nuclear Information System (INIS)

    Fox, C.; Iliadis, C.; Champagne, A.E.; Fitzgerald, R.P.; Longland, R.; Newton, J.; Pollanen, J.; Runkle, R.

    2005-01-01

    The 17 O(p,γ) 18 F and 17 O(p,α) 14 N reactions have a profound influence on hydrogen-burning nucleosynthesis in a number of stellar sites, including red giants, asymptotic giant branch (AGB) stars, massive stars, and classical novae. Previously evaluated thermonuclear rates for both reactions carry large uncertainties. We investigated the proton-capture reaction on 17 O in the bombarding energy range of E p lab = 180-540 keV. We observed a previously undiscovered resonance at E R lab = 193.2 ± 0.9 keV. The resonance strength amounts to (ωγ) pγ (1.2±0.2)x10 -6 eV. With this value, the uncertainties of the 17 O(p,γ) 18 F reaction rates are reduced by orders of magnitude in the peak temperature range of classical novae (T=0.1-0.4 GK). We also report on a reevaluation of the 17 O(p,γ) 18 F reaction rates at lower temperatures that are pertinent to red giants, AGB stars, or massive stars. The present work establishes the 17 O(p,γ) 18 F reaction rates over a temperature range of T= 0.01-1.5 GK with statistical uncertainties of 10-50%. The new recommended reaction rates deviate from the previously accepted values by an order of magnitude around T≅0.2 GK and by factors of 2-3 at T < 0.1 GK

  3. 17 CFR 270.22e-2 - Pricing of redemption requests in accordance with Rule 22c-1.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redemption requests in accordance with Rule 22c-1. 270.22e-2 Section 270.22e-2 Commodity and Securities Exchanges....22e-2 Pricing of redemption requests in accordance with Rule 22c-1. An investment company shall not be...

  4. Shell model description of 16O(p,γ)17F and 16O(p,p)16O reactions

    International Nuclear Information System (INIS)

    Bennaceur, K.; Michel, N.; Okolowicz, J.; Ploszajczak, M.; Bennaceur, K.; Nowacki, F.; Okolowicz, J.

    2000-01-01

    We present shell model calculations of both the structure of 17 F and the reactions 16 O(p,γ) 17 F, 16 O(p,p) 16 O. We use the ZBM interaction which provides a fair description of the properties of 16 O and neighbouring nuclei and, in particular it takes account for the complicated correlations in coexisting low-lying states of 16 O. (authors)

  5. Kerma factors and reaction cross sections for n + /sup 12/C between 15 and 18 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.

    1988-07-01

    Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from /sup 12/C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The /sup 12/C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range.

  6. 17 CFR 240.19c-1 - Governing certain off-board agency transactions by members of national securities exchanges.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Governing certain off-board agency transactions by members of national securities exchanges. 240.19c-1 Section 240.19c-1 Commodity... members of national securities exchanges. The rules of each national securities exchange shall provide as...

  7. The 500 deg. C isothermal section of the Gd-Tb-Co ternary system

    International Nuclear Information System (INIS)

    Zhou, K.W.; Zhuang, Y.H.; Li, J.Q.; Zhu, Q.M.; Deng, J.Q.

    2006-01-01

    The isothermal section of the phase diagram of the Gd-Tb-Co ternary system at 500 deg. C was investigated by X-ray powder diffraction, differential thermal analysis and metallographic analysis techniques. In this isothermal section, there are nine single-phase regions, eight two-phase regions and none three-phase region. No ternary compound was found. The compounds Gd 2 Co 17 and Tb 2 Co 17 , Gd 2 Co 7 and Tb 2 Co 7 , GdCo 3 and TbCo 3 , GdCo 2 and TbCo 2 , Gd 4 Co 3 and Tb 4 Co 3 , Gd 12 Co 7 and Tb 12 Co 7 , Gd 3 Co and Tb 3 Co, Gd and Tb form a continuous series of solid solutions. In addition, we experimentally determined the vertical section of pseudobinary system and the Curie temperature of Gd 1-x Tb x Co 2 (x from 0 to 1) series alloys

  8. 17 CFR 240.15c1-3 - Misrepresentation by brokers, dealers and municipal securities dealers as to registration.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Misrepresentation by brokers...-The-Counter Markets § 240.15c1-3 Misrepresentation by brokers, dealers and municipal securities..., as used in section 15(c)(1) of the Act, is hereby defined to include any representation by a broker...

  9. 17,20β-P and cortisol are the main in vitro metabolites of 17-hydroxy-progesterone produced by spermiating testes of Micropogonias furnieri (Desmarest, 1823 (Perciformes: Sciaenidae

    Directory of Open Access Journals (Sweden)

    Denise Vizziano Cantonnet

    Full Text Available The aim was to investigate the major C21 steroids produced by spermiating white croaker Micropogonias furnieri (Sciaenidae in order to establish the potential mediator of gamete maturation in males of this species. The testes steroid production at the spawning season was identified incubating the 3H-17-hydroxy-4-pregnene-3,20-dione precursor through thin layer chromatography, high pressure liquid chromatography, enzymatic oxydation, acetylation and immunochemistry analyses. 17,20β-Dihydroxy-4-pregnen-3-one (17,20β-P and 11β,17,21-Trihydroxy-4-pregnene-3,20-dione (cortisol were the main metabolites produced. Contrary to what we expected, 17,20β,21-Trihydroxy-4-pregnen-3-one was not detected. Circulating levels of 17,20β-P were undetectable in immature testes and in those at the first spermatogenesis stages, while a clear increase was observed during the whole spermatogenesis and spermiation phases (from undetectable to 1047 pg mL-1. In vitro studies together with plasma detection suggest that 17,20β-P is a good steroid candidate involved in M. furnieri testes maturation. The role of cortisol during late phases of testes development needs further studies.

  10. Contribution to the study of 12C excited levels resulting from the reactions 11B (P/ α0) and 11B (p, α1)

    International Nuclear Information System (INIS)

    Longequeue, J.P.

    1963-11-01

    This work is made up of two parts. In the first part the differential cross-sections have been determined of the reactions 11 B (p,α) from 130 to 500 keV thus confirming, at the 163 keV resonance, the (2 + ) characteristics of the 16.11 MeV level of 12 C. Furthermore, the experimental results in the neighbourhood of the 163 keV resonance can be explained by the interference of the 12 C levels: 2 + at 16.11 MeV and 1 - at 17.23 MeV for the α 0 , 2 + at 16.11 MeV and 2 - at 16.58 MeV for the α 1 . In the second part the (α -8Be ) disintegration process of 12 C has been studied in the neighbourhood of the 16.11 MeV level. It is shown that, if the (α -8Be ) mode of disintegration is preponderant outside the E p = 163 keV resonance, it is also preponderant at this same resonance; a direct disintegration of the 12 C to 3 α, with an approximate magnitude of 40 per cent has however not been excluded. (author) [fr

  11. Cross sections for the reactions 54Fe(n,α)51Cr, 54Fe(n,p)54Mn, and 56Fe(n,p)56Mn

    International Nuclear Information System (INIS)

    Paulsen, A.; Widera, R.; Arnotte, F.; Liskien, H.

    1979-01-01

    Ratios of cross sections for the reactions 54 Fe(n,α) 51 Cr, 54 Fe(n,p) 54 Mn, and 56 Fe(n,p) 56 Mn were measured by the activation technique. In the 6- to 10-MeV energy range, quasi-monoenergetic neutrons produced by the D(d,n) source reaction were used, while additional data were obtained between 12 and 17 MeV by use of the T(d,n) source reaction. The cross-section ratios have accuracies between 1.5 and 4.5%. 1 figure, 3 tables

  12. Duplication of 17(p11.2p11.2) in a male child with autism and severe language delay.

    Science.gov (United States)

    Nakamine, Alisa; Ouchanov, Leonid; Jiménez, Patricia; Manghi, Elina R; Esquivel, Marcela; Monge, Silvia; Fallas, Marietha; Burton, Barbara K; Szomju, Barbara; Elsea, Sarah H; Marshall, Christian R; Scherer, Stephen W; McInnes, L Alison

    2008-03-01

    Duplications of 17(p11.2p11.2) have been associated with various behavioral manifestations including attention deficits, obsessive-compulsive symptoms, autistic traits, and language delay. We are conducting a genetic study of autism and are screening all cases for submicroscopic chromosomal abnormalities, in addition to standard karyotyping, and fragile X testing. Using array-based comparative genomic hybridization analysis of data from the Affymetrix GeneChip(R) Human Mapping Array set, we detected a duplication of approximately 3.3 Mb on chromosome 17p11.2 in a male child with autism and severe expressive language delay. The duplication was confirmed by measuring the copy number of genomic DNA using quantitative polymerase chain reaction. Gene expression analyses revealed increased expression of three candidate genes for the Smith-Magenis neurobehavioral phenotype, RAI1, DRG2, and RASD1, in transformed lymphocytes from Case 81A, suggesting gene dosage effects. Our results add to a growing body of evidence suggesting that duplications of 17(p11.2p11.2) result in language delay as well as autism and related phenotypes. As Smith-Magenis syndrome is also associated with language delay, a gene involved in acquisition of language may lie within this interval. Whether a parent of origin effect, gender of the case, the presence of allelic variation, or changes in expression of genes outside the breakpoints influence the resultant phenotype remains to be determined. (c) 2007 Wiley-Liss, Inc.

  13. Study of coherent diffractive reactions p+C→[Ε(1385)0K+]+C and p+C→[Ε0K+]+C and search for exotic baryons

    International Nuclear Information System (INIS)

    Vavilov, D.V.; Viktorov, V.A.; Golovkin, S.V.

    1995-01-01

    In the experiments at the SPHINX facility in 70 GeV proton beam of the IHEP accelerator the coherent diffractive production reactions on carbon nuclei p+C→[Ε(1385) 0 K + ]+C and p+C→[Ε 0 K + ]+C were studied. In the effective mass spectrum M(YK) of the first reaction X(2050) peak with mass M=2052±6 MeV and width Γ=35 -35 +22 was observed and in the second reaction X(2000) state with M=1999±7 MeV and Γ=91±17 MeV was clearly seen. 18 refs.; 6 figs.; 2 tabs

  14. MMP-8 C-799T and MMP-8 C+17G polymorphisms in mild and severe preeclampsia: Association between MMP-8 C-799T with susceptibility to severe preeclampsia.

    Science.gov (United States)

    Rahimi, Ziba; Zangeneh, Maryam; Rezaeyan, Arezoo; Shakiba, Ebrahim; Rahimi, Zohreh

    2018-01-01

    The aim of present study was to determine the role of matrix metalloproteinase-8 (MMP-8) C-799T (rs11225395) and C+17 (rs2155052) polymorphisms in susceptibility to preeclampsia. In a case-control study, 256 pregnant women including 152 women with preeclampsia (86 women with mild preeclampsia and 66 women with severe preeclampsia) and 104 women with normal pregnancy from Western Iran with Kurdish ethnic background were investigated for MMP-8 C-799T and C + 17G polymorphisms using polymerase chain reaction-restriction fragment length polymorphism method. Comparing the MMP-8 TT genotype with the combined genotype of CC+CT (recessive model) indicated a significantly higher frequency of the MMP-8 TT genotype (47%) in severe preeclamptic patients than that in healthy pregnant women (30.8%) that was associated with 1.99-fold increased risk of severe preeclampsia (95% CI = 1.05-3.77, p = 0.034). The frequency of MMP-8 G allele was 27.3% in all preeclamptic patients compared to 30.2% in controls (p = 0.56). Also, no significant difference was detected comparing the frequency of G allele in mild (26.6%, p = 0.46) and severe preeclamptic patients (28.4%, p = 0.75) with controls (30.2%). Our study demonstrated that the MMP-8 C-799T is associated with the risk of developing severe preeclampsia during pregnancy. However, the MMP-8 C + 17G polymorphism might not be a risk factor for susceptibility to preeclampsia.

  15. Contribution to the study of {sup 12}C excited levels resulting from the reactions {sup 11}B (P/ {alpha}{sub 0}) and {sup 11}B (p, {alpha}{sub 1}); Contribution a l'etude des niveaux excites du {sup 12}C obtenus par les reactions {sup 11}B (p, {alpha}{sub 0}) et {sup 11}B (p, {alpha}{sub l})

    Energy Technology Data Exchange (ETDEWEB)

    Longequeue, J P [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1963-11-15

    This work is made up of two parts. In the first part the differential cross-sections have been determined of the reactions {sup 11}B (p,{alpha}) from 130 to 500 keV thus confirming, at the 163 keV resonance, the (2{sup +}) characteristics of the 16.11 MeV level of {sup 12}C. Furthermore, the experimental results in the neighbourhood of the 163 keV resonance can be explained by the interference of the {sup 12}C levels: 2{sup +} at 16.11 MeV and 1{sup -} at 17.23 MeV for the {alpha}{sub 0}, 2{sup +} at 16.11 MeV and 2{sup -} at 16.58 MeV for the {alpha}{sub 1}. In the second part the ({alpha}{sup -8Be}) disintegration process of {sup 12}C has been studied in the neighbourhood of the 16.11 MeV level. It is shown that, if the ({alpha}{sup -8Be}) mode of disintegration is preponderant outside the E{sub p} = 163 keV resonance, it is also preponderant at this same resonance; a direct disintegration of the {sup 12}C to 3 {alpha}, with an approximate magnitude of 40 per cent has however not been excluded. (author) [French] Ce travail comprend deux parties: Dans la premiere, on a determine la section efficace differentielle des reactions {sup 11}B (p,{alpha}) de 130 a 500 keV, confirmant, a la resonance de 163 keV, les caracteristiques (2{sup +}) du niveau de 16,11 MeV du {sup 12}C. En outre, les resultats experimentaux au voisinage de la resonance de 163 keV sont explicables par l'interference des niveaux du {sup 12}C: 2{sup +} a 16,11 MeV et 1{sup -} a 17,23 MeV pour les {alpha}{sub 0}, 2{sup +} a 16,11 MeV et 2{sup -} a 16,58 MeV pour les {alpha}{sub 1}. Dans la deuxieme partie, on a etudie le mode de desintegration ({alpha}{sup -8Be}) du {sup 12}C au voisinage du niveau de 16,11 MeV. On a montre que, si le mode de desintegration ({alpha}{sup -8Be}) est preponderant en dehors de la resonance E{sub p} = 163 keV, il est egalement preponderant a cette resonance; une desintegration directe en 3{alpha} du {sup 12}C, dont l'ordre de grandeur maximum serait de 40 pour cent, n

  16. Measurements of total cross sections between 23 and 280 GeV/c

    International Nuclear Information System (INIS)

    Koehler, P.F.M.

    1975-01-01

    The high precision measurements of the total cross sections for π/sup +-/, K/sup +-/, p, and anti p scattering from H 2 and D 2 were continued with an extension of the energy range from 23 to 280 GeV/c

  17. $\\overline{p}p$ Total Cross-Sections and Spin Effects in $\\overline{p}p \\rightarrow K^{+}K^{-},\\pi^{+}\\pi^{-},\\overline{p}p$ above 200 MeV/c

    CERN Multimedia

    2002-01-01

    The main objective of this proposal is a measurement of d@s/d@W and P in .tb 20 50 .tb set & & @*p @A @p|+@p|- & (1) & @*p @A K|+K|- & (2) & @*p @A @*p & (3) .tb \\\\ \\\\ in the momentum range 300-1550 MeV/c at about 20 different momenta using a conventional polarized target. In reactions (1) and (2) the complete angular range 0-180|0 will be covered. Reaction (3) will be studied over the angular range where p and @* have sufficient range to escape from the target. Statistics will be $>$ 10|4 per momentum for reaction (2), and correspondingly higher for other channels. With the same set-up, a subsidiary measurements is possible. At those energies and angles where the proton from reaction (3) has sufficient energy, a measurement of its polarization can be made parasitically to determine the Wolfenstein paramet D @- I(0,n; 0,n). An important preliminary in deciding whether polarized @* beams can be made by scattering from carbon, and also in devising a polarimeter for @* polarization, i...

  18. Increased protein expression of LHCG receptor and 17α-hydroxylase/17-20-lyase in human polycystic ovaries.

    Science.gov (United States)

    Comim, F V; Teerds, K; Hardy, K; Franks, S

    2013-11-01

    Does the expression of LHCG receptor (LHCGR) protein and key enzymes in the androgen biosynthetic pathway differ in normal human versus polycystic ovarian tissue? LHCGR and 17α-hydroxylase/17-20-lyase (CYP17A1) protein levels are increased in polycystic ovaries (PCOs). The predominant source of excess androgen secretion in women with polycystic ovary syndrome (PCOS) is ovarian theca cells but few studies have directly assessed the presence and abundance of protein for key molecules involved in androgen production by theca, including LHCGR and the rate-limiting enzyme in androgen production, CYP17A1. This is a laboratory-based, cross-sectional study comparing protein expression of key molecules in the androgen biosynthetic pathway in archived ovarian tissue from women with normal ovaries (n = 10) with those with PCOs (n = 16). A quantitative morphometric study was performed using sections of archived human ovaries (n = 26) previously characterized as normal or polycystic. The distribution and abundance of LHCGR, CYP17A1, 3β-hydroxysteroid dehydrogenase type 2 (3βHSDII) and 17β-hydroxysteroid dehydrogenase type 5 (17βHSD5) proteins were evaluated by immunohistochemistry and quantified. A higher proportion of theca cells from anovulatory PCO expressed LHCGR protein when compared with control ovaries (P = 0.01). A significant increase in the intensity of immunostaining for CYP17A1 was identified in antral follicles in sections of PCO compared with ovaries from normal women (P = 0.04). As the study used formalin-fixed ovarian tissue sections, it was not possible to carry out studies 'in vitro' using the same ovarian tissues in order to also demonstrate increased functional activity of LHCGR and CYP17A1. The data are in keeping with the results of previous studies in isolated theca cells and support the notion of an intrinsic abnormality of theca cell androgen production in women with PCOS. The research was supported by a Programme Grant, G0802782, from the Medical

  19. Neutron scattering from [sup 12]C between 15. 6 and 17. 3 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L. (Duke Univ., Durham, NC (United States). Dept. of Physics Triangle Universities Nuclear Lab., Durham, NC (United States))

    1993-06-01

    The differential cross section [sigma]([theta]) for neutron elastic scattering from [sup 12]C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The [sigma]([theta]) data, together with published analysing power A[sub y]([theta]) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present [sup 12]C(n,n)[sup 12]C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in [sup 11]C via an iterative-moment approach or a dispersive optical-model analysis. (author).

  20. Experimental comparison of J/psi production by π+-, K+-, p and anti p beams at 39.5 GeV/c

    International Nuclear Information System (INIS)

    Corden, M.J.; Dowell, J.D.; Eastwood, D.; Garvey, J.; Homer, R.J.; Jobes, M.; Kenyon, I.R.; McMahon, T.; Vallance, R.J.; Watkins, P.M.; Wilson, J.A.; Gago, J.; Jung, M.; Sonderegger, P.; Treille, D.; Woodworth, P.L.; Eckardt, V.; Fent, J.; Pretzl, K.; Seyboth, P.; Seyerlein, J.; Perrin, D.; Sumorok, K.C.T.O.

    1977-01-01

    Measurements have been made of relative production cross sections of the J/psi by π +- , K +- , p and anti p at 39.5 GeV/c incident on copper. J/psi production rates from π - , K - and anti p are similar. The J/psi relative particle/anti-particle production cross sections for x > 0 are sigma(π + )/sigma(π - ) = (0.87+-0.14), sigma(K + )/sigma(K - ) = (0.85+-0.5) and sigma(p)/sigma(anti p) = (0.15+-0.08). The small p/anti p cross section ratio disagrees with models of J/psi production by gluon amalgamation. (Auth.)

  1. Dissolving mechanism of strain P17 on insoluble phosphorus of yellow-brown soil

    Directory of Open Access Journals (Sweden)

    Zhong Chuan-qing

    2014-09-01

    Full Text Available Strain P17 was a bacterial strain identified as Bacillus megaterium isolated from ground accumulating phosphate rock powder. The fermentation broth of strain P17 and the yellow-brown soil from Nanjing Agricultural University garden were collected to conduct this study. The simulation of fixed insoluble phosphorous forms after applying calcium superphosphate into yellow-brown soil was performed in pots, while available P and total P of soil were extremely positive correlative with those of groundwater. Then the dissolving effect of strain P17 on insoluble P of yellow-brown soil was studied. Results showed that Bacillus megaterium strain P17 had notable solubilizing effect on insoluble phosphates formed when too much water-soluble phosphorous fertilizer used. During 100 days after inoculation, strain P17 was dominant. Until the 120th day, compared with water addition, available P of strain P17 inoculation treated soil increased by 3 times with calcium superphosphate addition. Besides available P, pH, activity of acid and alkaline phosphatase and population of P-solubilizing microbes were detected respectively. P-solubilizing mechanism of P-solubilizing bacteria strain P17 seems to be a synergetic effect of pH decrease, organic acids, phosphatase, etc.

  2. Total (p,n), (p,γ), (p,p'γ) and differential (p,p) cross-sections measurements for /sup 61,64/Ni

    International Nuclear Information System (INIS)

    Hershberger, R.L.; Gabbard, F.; Laird, C.E.

    1985-01-01

    Absolute total (p,n) and differential elastic (p,p) cross sections have been measured for /sup 61,64/Ni in the energy range of E/sub p/ = 2 to 7 MeV. The (p,γ) and (p,p'γ) cross sections were measured from as low an energy as feasible to approximately one MeV above the (p,n) threshold. Standard optical potentials have been used with a Hauser-Feshbach model to analyze the data. The adopted model values are used to deduce a total proton strength function which displays features of the 3s single particle resonance

  3. Charged pion production in 32 GeV/c K+p interactions

    International Nuclear Information System (INIS)

    Ajinenko, I.V.; Belokopitov, Y.A.; Chliapnikov, P.V.; Falaleev, V.P.; Fenyuk, A.B.; Gerdyukov, L.N.; Kurnosenko, A.I.; Rybin, A.M.; Wolf, E.A.; Dumont, J.J.

    1980-01-01

    Final data on topological cross sections are presented. Inclusive single particle distributions for the reactions K + p → π + -X at 32 GeV/c are discussed and compared with data at lower energies. Early scaling in the fragmentation regions is confirmed, while cross sections in the central region continue to rise with energy even faster than in pp interactions. The x- and psub(T)-dependence of the π + /π - ratio K + p interactions is discussed and a comparison of reactions K + p → π + -X and K - p → π + -X at 32 GeV/c is made in the context of constituent models. We also present transverse momentum distributions, show prominent seagull effects and study how they are influenced by resonance production. (orig.) 891 HSI/orig. 892 MKO

  4. Study of p-4He Total Reaction cross section using Glauber and Modified Glauber Models

    International Nuclear Information System (INIS)

    Tag El Din, I.M.A.; Taha, M.M.; Hassan, S.S.A.

    2012-01-01

    The total nuclear reaction cross-section for p - 4 He in the energy range from 25 to 1000 MeV is calculated within Glauber and modified Glauber models. The modified Glauber model is introduced via both Coulomb trajectory of the projectile and calculation of the effective radius of interaction. The effects of density dependent total cross-section and phase variation of nucleon-nucleon scattering amplitude are studied. It is pointed out that the phase variation of the nucleon-nucleon amplitude plays a significant role in describing σR at E p 2 at e = e0 = 0 and γ=2fm 2 at e = e0 = 0.17fm -3 .

  5. Measurements of the branching fractions of Lambda(+)(c) -> p pi(-)pi(+), Lambda(+)(c) -> pK(-)K(+), and Lambda(+)(c) -> p pi K--(+)

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Dufour, L.; Mulder, M; Onderwater, C. J. G.; Pellegrino, A.; Tolk, S.; van Veghel, M.

    2018-01-01

    The ratios of the branching fractions of the decays do Lambda(+)(c) -> , p pi(-)pi(+), Lambda(+->)(c) pK(-)K(+), and Lambda(+)(c) -> p pi K--(+) with respect to the Cabibbo-favoured Lambda(+)(c) -> pK(-)pi(+) decay are measured using proton-proton collision data collected with the LHCb experiment at

  6. Nuclear transparency in 90 deg.c.m. quasielastic A(p,2p) reactions

    International Nuclear Information System (INIS)

    Aclander, J.; Alster, J.; Kosonovsky, I.; Malki, A.; Mardor, I.; Mardor, Y.; Navon, I.; Piasetzky, E.; Asryan, G.; Barton, D.S.; Buktoyarova, N.; Bunce, G.; Carroll, A.S.; Gushue, S.; Makdisi, Y.I.; Roser, T.; Tanaka, M.; Averiche, Y.; Panebratsev, Y.; Shimanskiy, S.

    2004-01-01

    We summarize the results of two experimental programs at the Alternating Gradient Synchrotron of BNL to measure the nuclear transparency of nuclei measured in the A(p,2p) quasielastic scattering process near 90 deg. in the pp center of mass. The incident momenta varied from 5.9 to 14.4 GeV/c, corresponding to 4.8 2 2 . Taking into account the motion of the target proton in the nucleus, the effective incident momenta extended from 5.0 to 15.8 GeV/c. First, we describe the measurements with the newer experiment, E850, which had more complete kinematic definition of quasielastic events. E850 covered a larger range of incident momenta, and thus provided more information regarding the nature of the energy dependence of the nuclear transparency. In E850 the angular dependence of the nuclear transparency near 90 deg. and the nuclear transparency deuterons were studied. Second, we review the techniques used in an earlier experiment, E834, and show that the two experiments are consistent for the carbon data. E834 also determines the nuclear transparencies for lithium, aluminum, copper, and lead nuclei as well as for carbon. A determination of the (π + ,π + p) transparencies is also reported. We find for both E850 and E834 that the A(p,2p) nuclear transparency, unlike that for A(e,e ' p) nuclear transparency, is incompatible with a constant value versus energy as predicted by Glauber calculations. The A(p,2p) nuclear transparency for carbon and aluminum increases by a factor of two between 5.9 and 9.5 GeV/c incident proton momentum. At its peak the A(p,2p) nuclear transparency is ∼80% of the constant A(e,e ' p) nuclear transparency. Then the nuclear transparency falls back to a value at least as small as that at 5.9 GeV/c, and is compatible with the Glauber level again. This oscillating behavior is generally interpreted as an interplay between two components of the pN scattering amplitude; one short ranged and perturbative, and the other long ranged and strongly absorbed

  7. /sup 13/C, /sup 17/O, and /sup 33/S NMR spectra of alkyl phenyl sulfones C/sub 6/H/sub 5/SO/sub 2/Alk

    Energy Technology Data Exchange (ETDEWEB)

    Bzhezovskii, V.M.; Valeev, R.B.; Kalabin, G.A.; Aliev, I.A.

    1987-06-20

    The /sup 13/C, /sup 17/O, and /sup 33/S NMR spectra of alkyl phenyl sulfones C/sub 6/H/sub 5/SO/sub 2/Alk were obtained. The changes in the screening of the /sup 13/C, /sup 17/O, and /sup 33/S nuclei in these compounds are determined by the effect of the alkyl substituents, which alternates in sign and decreases along the chain of atoms in the order: CH/sub 3/, C/sub 2/H/sub 5/, iso-C/sub 3/H/sub 7/, and tert-C/sub 4/H/sub 9/. In the alkyl phenyl sulfides C/sub 6/H/sub 5/SAlk the additional effect of disruption in the p,..pi.. interaction between the sulfur atom and the benzene ring as a result of conformational changes is superimposed on the screening of the /sup 13/C/sup ortho/ nuclei. For the changes in the screening of the /sup 13/C/sup para/ nuclei in C/sub 6/H/sub 5/SAlk the steric disruption of the p,..pi.. conjugation by the alkyl substituents is determining.

  8. Different effects of histone deacetylase inhibitors nicotinamide and trichostatin A (TSA) in C17.2 neural stem cells.

    Science.gov (United States)

    Wang, Haifeng; Cheng, Hua; Wang, Kai; Wen, Tieqiao

    2012-11-01

    Histone deacetylase inhibitors are involved in proliferation, apoptosis, cell cycle, mRNA transcription, and protein expression in various cells. However, the molecular mechanism underlying such functions is still not fully clear. In this study, we used C17.2 neural stem cell (NSC) line as a model to evaluate the effects of nicotinamide and trichostatin A (TSA) on cell characteristics. Results show that nicotinamide and TSA greatly inhibit cell growth, lead to cell morphology changes, and effectively induce cell apoptosis in a dose-dependent manner. Western blot analyses confirmed that nicotinamide significantly decreases the expression of bcl-2 and p38. Further insight into the molecular mechanisms shows the suppression of phosphorylation in eukaryotic initiation factor 4E-binding protein 1 (4EBP1) by nicotinamide, whereas, an increased expression of bcl-2 and p38 and phosphorylation of 4EBP1 by TSA. However, both nicotinamide and TSA significantly increase the expression of cytochrome c (cyt c). These results strongly suggest that bcl-2, p38, cyt c, and p-4EBP1 could suppress proliferation and induce apoptosis of C17.2 NSCs mediated by histone deacetylase inhibitors, nicotinamide and TSA, involving different molecular mechanisms.

  9. c p chaudhari

    Indian Academy of Sciences (India)

    C P CHAUDHARI. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 24. A logical explanation of structurally unfit X-ray diffraction peaks in nanoferroelectrics · C M DUDHE B K SAKHARE S S PANCHBHAI S J KHAMBADKAR N V DHOKE C P CHAUDHARI U A PALIKUNDWAR.

  10. Measurement of the $\\bar{p}p \\rightarrow \\bar{n}n$ Charge-Exchange Differential Cross-Section

    CERN Multimedia

    2002-01-01

    The aim of this proposal is a measurement of the differential cross-section of the $\\bar{p}$p $\\rightarrow$ $\\bar{n}$n charge-exchange reaction with a point-to-point precision of 1\\% in the forward direction, and an absolute normalization error of 3\\%. The high precision of the data should allow, inter alia, a determination of the $\\pi$NN coupling constant to better than 2\\%.\\\\ \\\\ The measurement will be done using the existing neutron and antineutron detectors built for experiment PS199 and liquid hydrogen target. In one week of running time, with a $\\bar{p}$ beam intensity of 3 $ 10 ^{5} $ $\\bar{p}$/sec, the reaction will be measured at a few $\\bar{p}$ momenta, in the range 500 to 900~MeV/c.

  11. Inclusive dimuon and b-quark production cross sections in p bar p collisions at √s = 1.8 TeV

    International Nuclear Information System (INIS)

    Abachi, S.; Abbott, B.; Abolins, M.

    1995-07-01

    We report on a preliminary measurement of the inclusive dimuon cross section in p bar p collisions at √s = 1.8 TeV using the D0 detector at the Fermilab Tevatron. From these results, we extract the inclusive b-quark production cross section for the kinematic range |y b | T b min < 25 GeV/c. The difference in azimuthal angle in the transverse plane for dimuon pairs from b bar b production is also shown

  12. 46 CFR 61.20-17 - Examination intervals.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Examination intervals. 61.20-17 Section 61.20-17... INSPECTIONS Periodic Tests of Machinery and Equipment § 61.20-17 Examination intervals. (a) A lubricant that... examination interval. (b) Except as provided in paragraphs (c) through (f) of this section, each tailshaft on...

  13. 7 CFR 1221.17 - Net market value.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Net market value. 1221.17 Section 1221.17 Agriculture... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Definitions § 1221.17 Net market value. Net market value means: (a) Except as provided in paragraph (b)and (c) of this section, the value...

  14. Increased Dietary Intake of Saturated Fatty Acid Heptadecanoic Acid (C17:0 Associated with Decreasing Ferritin and Alleviated Metabolic Syndrome in Dolphins.

    Directory of Open Access Journals (Sweden)

    Stephanie K Venn-Watson

    Full Text Available Similar to humans, bottlenose dolphins (Tursiops truncatus can develop metabolic syndrome and associated high ferritin. While fish and fish-based fatty acids may protect against metabolic syndrome in humans, findings have been inconsistent. To assess potential protective factors against metabolic syndrome related to fish diets, fatty acids were compared between two dolphin populations with higher (n = 30, Group A and lower (n = 19, Group B mean insulin (11 ± 12 and 2 ± 5 μIU/ml, respectively; P < 0.0001 and their dietary fish. In addition to higher insulin, triglycerides, and ferritin, Group A had lower percent serum heptadecanoic acid (C17:0 compared to Group B (0.3 ± 0.1 and 1.3 ± 0.4%, respectively; P < 0.0001. Using multivariate stepwise regression, higher percent serum C17:0, a saturated fat found in dairy fat, rye, and some fish, was an independent predictor of lower insulin in dolphins. Capelin, a common dietary fish for Group A, had no detectable C17:0, while pinfish and mullet, common in Group B's diet, had C17:0 (41 and 67 mg/100g, respectively. When a modified diet adding 25% pinfish and/or mullet was fed to six Group A dolphins over 24 weeks (increasing the average daily dietary C17:0 intake from 400 to 1700 mg, C17:0 serum levels increased, high ferritin decreased, and blood-based metabolic syndrome indices normalized toward reference levels. These effects were not found in four reference dolphins. Further, higher total serum C17:0 was an independent and linear predictor of lower ferritin in dolphins in Group B dolphins. Among off the shelf dairy products tested, butter had the highest C17:0 (423mg/100g; nonfat dairy products had no detectable C17:0. We hypothesize that humans' movement away from diets with potentially beneficial saturated fatty acid C17:0, including whole fat dairy products, could be a contributor to widespread low C17:0 levels, higher ferritin, and metabolic syndrome.

  15. Coulomb Dissociation of {sup 17}Ne and its role for nuclear astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Marganiec, Justyna [ExtreMe Matter Institute EMMI, GSI, Darmstadt (Germany); Aumann, Thomas; Wamers, Felix [Kernreaktion und Nuklear Astrophysik, GSI, Darmstadt (Germany); Institut fuer Kernphysik, TU, Darmstadt (Germany); Heil, Michael [Kernreaktion und Nuklear Astrophysik, GSI, Darmstadt (Germany); Plag, Ralf [Kernreaktion und Nuklear Astrophysik, GSI, Darmstadt (Germany); Goethe-Universitaet, Frankfurt am Main (Germany); Collaboration: R3B-Collaboration

    2011-07-01

    The study of the Coulomb break up of {sup 17}Ne gives us an access to information about the time-reversed reaction {sup 15}O(2p,{gamma}){sup 17}Ne, which could serve as a bypass of {sup 15}O waiting point during the rp process, and move the initial CNO material towards heavier nuclei. The three-body radiative capture can proceed sequentially (J. Goerres, et al., Phys. Rev. C 51, 392, 1995) or directly from the three-body continuum (L.V. Grigorenko, M.V. Zhukov, Phys. Rev. C 72, 015803, 2005). It has been suggested that the reaction rate can be enhanced by a few orders of magnitude by taking into account the three-body continuum. In order to verify these calculations, the {sup 15}O(2p,{gamma}){sup 17}Ne cross section has been investigated. The experiment has been performed at the LAND/R{sup 3}B setup at GSI, using the fragment separator FRS to select a {sup 17}Ne secondary beam.

  16. Resonance strength measurement at astrophysical energies: The {sup 17}O(p,α){sup 14}N reaction studied via Trojan Horse Method

    Energy Technology Data Exchange (ETDEWEB)

    Sergi, M. L., E-mail: sergi@lns.infn.it; La Cognata, M.; Pizzone, R. G. [INFN, Laboratori Nazionali del Sud, Catania (Italy); Spitaleri, C. [INFN, Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Fisica e Astronomia, Università degli studi di Catania, Catania (Italy); Lamia, L.; Rapisarda, G. G. [Dipartimento di Fisica e Astronomia, Università degli studi di Catania, Catania (Italy); Mukhamedzhanov, A. [Cyclotron Institute, Texas A& M University, College Station, Texas 77843 (United States); Irgaziev, B. [GIK Institute of Engineering Sciences and Technology, Topi, Districti Swabi, Khyber Pakhtunkhwa (Pakistan); Tang, X. D.; Wiescher, M. [Department of Physics, Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame 46556, Indiana (United States); Mrazek, J.; Kroha, V. [Nuclear Physics Institute of ASCR, Rez (Czech Republic)

    2015-10-15

    In recent years, the Trojan Horse Method (THM) has been used to investigate the low-energy cross sections of proton-induced reactions on {sup 17}O nuclei, overcoming extrapolation procedures and enhancement effects due to electron screening. We will report on the indirect study of the {sup 17}O(p,α){sup 14}N reaction via the THM by applying the approach developed for extracting the resonance strength of narrow resonance in the ultralow energy region. Two measurements will be described and the experimental THM cross sections will be shown for both experiments.

  17. Photoneutron cross sections measurements in {sup 9}Be, {sup 13}C e {sup 17}O with thermal neutron capture gamma-rays; Medidas das secoes de choque de fotoneutrons do {sup 9}Be, {sup 13}C e {sup 17}O com radiacao gama de captura de neutrons termicos

    Energy Technology Data Exchange (ETDEWEB)

    Semmler, Renato

    2006-07-01

    Photoneutron cross sections measurements of {sup 9}Be, {sup 13}C and {sup 17}O have been obtained in the energy interval between 1,6 and 10,8 MeV, using neutron capture gamma-rays with high resolution in energy (3 a 21 eV), produced by 21 target materials, placed inside a tangential beam port, near the core of the IPEN/CNEN-SP IEA-R1 (5 MW) research reactor. The samples have been irradiated inside a 4{pi} geometry neutron detector system 'Long Counter', 520,5 cm away from the capture target. The capture gamma-ray flux was determined by means of the analysis of the gamma spectrum obtained by using a Ge(Li) solid-state detector (EG and G ORTEC, 25 cm{sup 3}, 5%), previously calibrated with capture gamma-rays from a standard target of Nitrogen (Melamine). The neutron photoproduction cross section has been measured for each target capture gamma-ray spectrum (compound cross section). A inversion matrix methodology to solve inversion problems for unfolding the set of experimental compound cross sections, was used in order to obtain the cross sections at specific excitation energy values (principal gamma line energies of the capture targets). The cross sections obtained at the energy values of the principal gamma lines were compared with experimental data reported by other authors, with have employed different gamma-ray sources. A good agreement was observed among the experimental data in this work with reported in the literature. (author)

  18. Experimental study of isospin mixing in 12C + n → 13C(T = 3/2) and 16O + n → 17O(T = 3/2) resonances

    International Nuclear Information System (INIS)

    Cierjacks, S.; Schmalz, G.; Hinterberger, F.; Rossen, P. v.

    1981-12-01

    Narrow resonances of 13 C and 17 O have been studied by a measurement of the total neutron cross sections of carbon and oxygen between 3 and 30 MeV. Employing the improved time-of-flight spectrometer at the Karlsruhe Isochronous Cyclotron and precise calibration methods, resonance cross sections were measured with an energy resolution of 1:2100 at 10 MeV and energy accuracies between 10 -4 and 10 -5 . Resonance analysis of the measured data provided parameters for numerous narrow states of both isospins, T = 1/2 and T = 3/2. These data in conjunction with information from broad T = 1/2 resonances provided a good means to experimentally determine isospin mixing matrix elements. Results were obtained for the first five T = 3/2 resonances in 17 O and the first T = 3/2 resonance in 13 C. The obtained mixing matrix elements are compared with previous experimental results and shell-modell predictions of this quantity. (orig.) [de

  19. Microdeletion in distal 17p13.1

    DEFF Research Database (Denmark)

    Zeesman, Susan; Kjaergaard, Susanne; Hove, Hanne Buciek

    2012-01-01

    Array comparative genomic hybridization has led to the identification of new syndromes by identifying genomic imbalances not detectable by standard karyotyping methods and by allowing correlations with physical findings. Deletions in the 17p13.1 region have been reported in patients with dysmorphic...

  20. THE SEARCH FOR THE DIFFUSE INTERSTELLAR BANDS AND OTHER MOLECULES IN COMETS 17P (HOLMES) AND C/2007 W1 (BOATTINI)

    International Nuclear Information System (INIS)

    O'Malia, K. K. J.; Snow, T. P.; Thorburn, J. A.; Hammergren, M.; Dembicky, J.; Hobbs, L. M.; York, D. G.

    2010-01-01

    We present the search for both diffuse interstellar bands (DIBs) and molecules in Comet 17P (Holmes) and Comet C/2007 W1 (Boattini) occultation observations. Absorption spectra were taken during stellar occultations by Comet Holmes of 31 and β Persei, and the occultation of BD+22 216 by Comet Boattini. While no signature of the comets was detected, we present upper limits for some common cometary molecules such as C 2 , C 3 , CH, CN and for the most common DIBs. We did not detect either comet in absorption, most likely because of the large distance between the line of sight to the star and the nucleus of the comet. Interstellar sight lines with comparable reddening to what was measured in Comet Holmes have DIB equivalent widths between 5 and 50 mA. However, future observations with closer approaches to a background star have great potential for spatially mapping molecule distributions in comets, and in discovering DIBs, if they are present, in comets. Future observations could detect DIBs and molecules if they are done: (1) less than ∼10 4 -10 3 km from the nucleus (2) with a signal to noise in the background star of ∼300 and (3) with a resolving power of at least 38,000.

  1. In Situ Proteolysis for Crystallization of Membrane Bound Cytochrome P450 17A1 and 17A2 Proteins from Zebrafish.

    Science.gov (United States)

    Lei, Li; Egli, Martin

    2016-04-01

    Fish and human cytochrome P450 (P450) 17A1 catalyze both steroid 17α-hydroxylation and 17α,20-lyase reactions. Fish P450 17A2 catalyzes only 17α-hydroxylation. Both enzymes are microsomal-type P450s, integral membrane proteins that bind to the membrane through their N-terminal hydrophobic segment, the signal anchor sequence. The presence of this N-terminal region renders expression of full-length proteins challenging or impossible. For some proteins, variable truncation of the signal anchor sequence precludes expression or results in poor expression levels. To crystallize P450 17A1 and 17A2 in order to gain insight into their different activities, we used an alternative N-terminal sequence to boost expression together with in situ proteolysis. Key features of our approach to identify crystallizable P450 fragments were the use of an N-terminal leader sequence, a screen composed of 12 proteases to establish optimal cleavage, variations of protease concentration in combination with an SDS-PAGE assay, and analysis of the resulting fragments using Edman sequencing. Described in this unit are protocols for vector preparation, expression, purification, and in situ proteolytic crystallization of two membrane-bound P450 proteins. Copyright © 2016 John Wiley & Sons, Inc.

  2. Double Regge pole exchange model analysis of a 7 Gev/c. pi. /sup -/p experiment. [Absolute cross sections, one-particle exchange, diffraction scattering

    Energy Technology Data Exchange (ETDEWEB)

    Chao, A C.L.

    1973-01-01

    A double Regge Pole Exchange Model is used to analyze Quasi-Three-Body final states selected from a 7 GeV/c - /sup -/p experiment. Three sets of data are analyzed namely: I ..pi../sup -/p ..-->.. p..pi../sup +/..pi../sup -/..pi../sup -/; II ..pi../sup -/p ..-->.. p..pi../sup +/..pi../sup -/..pi../sup -/..pi../sup 0/; III ..pi../sup -/p ..-->.. ..pi../sup +/..pi../sup +/..pi../sup -/..pi../sup -/n. The final states, selected from data sets I, II and III are (rho/sup 0/..pi../sup -/p, f/sup 0/..pi../sup -/p, ..pi../sup -/..pi../sup -/..delta../sup + +/), (rho/sup 0/..pi../sup -/..delta../sup +/, rho/sup -/..pi..-..delta../sup + +/, ..omega pi../sup -/p) and (rho/sup 0/..pi../sup -/..delta../sup +/), respectively. It is found that these channels after appropriate kinematic cuts can be well described by exchanging two Regge Trajectories. Predictions for the absolute cross-sections were also obtained by taking limits of one particle exchange and a diffraction scattering approximation. (auth)

  3. Neutron Scattering Differential Cross Sections for 12C

    Science.gov (United States)

    Byrd, Stephen T.; Hicks, S. F.; Nickel, M. T.; Block, S. G.; Peters, E. E.; Ramirez, A. P. D.; Mukhopadhyay, S.; McEllistrem, M. T.; Yates, S. W.; Vanhoy, J. R.

    2016-09-01

    Because of the prevalence of its use in the nuclear energy industry and for our overall understanding of the interactions of neutrons with matter, accurately determining the effects of fast neutrons scattering from 12C is important. Previously measured 12C inelastic neutron scattering differential cross sections found in the National Nuclear Data Center (NNDC) show significant discrepancies (>30%). Seeking to resolve these discrepancies, neutron inelastic and elastic scattering differential cross sections for 12C were measured at the University of Kentucky Acceleratory Laboratory for incident neutron energies of 5.58, 5.83, and 6.04 MeV. Quasi mono-energetic neutrons were scattered off an enriched 12C target (>99.99%) and detected by a C6D6 liquid scintillation detector. Time-of-flight (TOF) techniques were used to determine scattered neutron energies and allowed for elastic/inelastic scattering distinction. Relative detector efficiencies were determined through direct measurements of neutrons produced by the 2H(d,n) and 3H(p,n) source reactions, and absolute normalization factors were found by comparing 1H scattering measurements to accepted NNDC values. This experimental procedure has been successfully used for prior neutron scattering measurements and seems well-suited to our current objective. Significant challenges were encountered, however, with measuring the neutron detector efficiency over the broad incident neutron energy range required for these measurements. Funding for this research was provided by the National Nuclear Security Administration (NNSA).

  4. Spectral distribution of Fe2+ photoionization cross section in InP:Fe

    International Nuclear Information System (INIS)

    Iikawa, F.

    1985-01-01

    Measurements of Fe 2+ ( 5 E) photoionization cross section in InP at 80 0 K, using constant current photoconductivity technique, were done. The spectrum presents a threshold energy of ∼ 0,65 eV due to the transition from Fe 2+ charge state, in the ground state, to Fe 3+ with an electron emission for the minimum conduction band. In the measurement of photoluminescence at ∼ 2 0 K, a wide emission of Fe complexe with the strong lattice interaction. In order to analyse the experimental data of Fe 2+ cross section in InP, a theoretical model was used. (M.C.K.) [pt

  5. Contribution to the study of the reaction {pi}{+-} + p {yields} {pi}{+-} + p + {pi}{sup 0} between 0,5 and 1.5 GeV/c (1963); Contribution a l'etude des reactions {pi}{+-} + p {yields} {pi}{+-} + p + {pi}{sup 0} entre 0,5 et 1,5 GeV/c (1963)

    Energy Technology Data Exchange (ETDEWEB)

    Thevenet, B [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1963-06-15

    We measured, with {gamma} rays counters, the total production cross section of {gamma} accompanied by charged secondaries in {pi}{sup {+-}} p interactions between 0.5 and 1.5 GeV/c. We obtained the cross section of the reaction {pi}{sup +} p {yields} {pi}{sup +} {pi}{sup 0} p, with incident {pi}{sup -} we could determined only the cross section of {pi}{sup -} p {yields} {pi}{sup 0} + (charged particles) because the lack of information on multiple production. We compared our experimental results with the predictions of simple production models. A method for calculation of high energy {gamma} rays efficiency of detectors with lead converters is given in the appendix. (author) [French] Nous avons mesure, au moyen de compteurs sensibles aux photons, la section efficace totale de production de {gamma} accompagnes de secondaires charges dans les interactions {pi}{sup {+-}} p entre 0,5 et 1,5 GeV/c. Nous avons obtenu la section efficace de la reaction {pi}{sup +} p {yields} {pi}{sup +} {pi}{sup 0} p, mais avec des {pi}{sup -} incidents nous n'avons pu determiner que la section efficace de la reaction {pi}{sup -} p {yields} {pi}{sup 0} + particules chargees, par manque d'information sur la production multiple. Nous avons compare nos resultats aux predictions des principaux modeles de production simple. En appendice, nous donnons une methode de calcul de l'efficacite de detecteurs a ecrans de plomb pour les photons de grande energie. (auteur)

  6. Backward rho /sup -/ production in the reaction pi /sup -/p to p pi /sup -/ pi /sup 0/ at 9 GeV/c and 12 GeV/c

    CERN Document Server

    Benkheiri, P; D'Almagne, B; De Rosny, G; Eisenstein, B I; Ferrer, A; Fleury, P; Jacholkowski, A; Petroff, P; Richard, F; Rivet, P; Roudeau, P; Rougé, A; Six, J; Thénard, J M; Treille, D; Volte, A; Yoshida, H

    1977-01-01

    The backward production of mesons is studied in the reaction pi /sup - /p to p rho /sup -/. The differential cross section and the rho /sup - / density matrix are obtained using a Monte Carlo analysis of high statistics CERN experimental data on pi /sup -/p to p pi /sup -/ pi /sup 0/ reactions at 9 and 12 GeV/c. (10 refs).

  7. C P Vinod

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C P Vinod. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 247-249 Experimental Techniques. A method employing STM for the estimation of relative changes in the work function of modified metal tips · R B Sharma C P Vinod G U Kulkarni.

  8. P. C. Agrawal

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. P. C. Agrawal. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 1-2 June 2000 pp 29-38. X-ray Observation of XTE J2012+381 during the 1998 Outburst · S. Naik P. C. Agrawal B. Paul A. R. Rao S. Seetha Κ. Kasturirangan · More Details ...

  9. Resonance Strength Measurement at Astrophysical Energies: The 17O(p,α14N Reaction Studied via THM

    Directory of Open Access Journals (Sweden)

    Sergi M.L.

    2016-01-01

    Full Text Available In recent years, the Trojan Horse Method (THM has been used to investigate the low-energy cross sections of proton-induced reactions on 17O nuclei, overcoming extrapolation procedures and enhancement effects due to electron screening. We will report on the indirect study of the 17O(p,α14N reaction via the Trojan Horse Method by applying the approach developed for extracting the resonance strength of narrow resonance in the ultralow energy region. The mean value of the strengths obtained in the two measurements was calculated and compared with the direct data available in literature.

  10. 17 CFR 37.7 - Additional requirements.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Additional requirements. 37.7 Section 37.7 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION DERIVATIVES... of section 5c(c) of the Act and § 40.2 of this chapter, derivatives transaction execution facilities...

  11. Desequilíbrio imunológico periférico mediado por células Th17/Treg em pacientes com rinite alérgica

    Directory of Open Access Journals (Sweden)

    Xuekun Huang

    2014-04-01

    Full Text Available Introdução: A rinite alérgica (RA é uma doença não infecciosa da mucosa nasal mediada por IgE após o contato com alérgenos. Objetivo: Investigar as células Th17 periféricas e CD4 + CD25 + Foxp3 + células T reguladoras (Treg e a expressão sérica de citocinas em pacientes com RA. Métodos: De março a maio de 2012, foi coletado o sangue periférico de 14 pacientes com RA (grupo RA e seis indivíduos saudáveis (grupo controle. A detecção das células Th17 e células Treg foi realizada através da citometria de fluxo e os níveis séricos de IL -17 e TGF- β1. Foram medidos por ELISA. Resultados: A percentagem de células Th17 no grupo RA foi bem maior do que no grupo controle (p < 0,01. A proporção de células Treg no grupo RA também foi drasticamente menor quando comparada ao grupo controle (p < 0,01. No grupo RA, o nível sérico de IL-17 foi significativamente maior do que no grupo controle (p < 0,01. Conclusão: O desequilíbrio de células Th17/Treg periféricas desempenha um papel importante na patogênese da RA.

  12. The AGB star nucleosynthesis in the light of the recent {sup 17}O(p,α){sup 14}N and {sup 18}O(p,α){sup 15}N reaction rate determinations

    Energy Technology Data Exchange (ETDEWEB)

    Palmerini, S.; Sergi, M. L.; La Cognata, M.; Pizzone, R. G. [INFN-Laboratori Nazionali del Sud, Catania (Italy); Lamia, L. [Dipartimento di Fisica e Astronomia, Universitá degli Studi di Catania (Italy); Spitaleri, C. [INFN-Laboratori Nazionali del Sud, Catania, Italy and Dipartimento di Fisica e Astronomia, Universitá degli Studi di Catania (Italy)

    2015-02-24

    Presolar grains form in the cold and dusty envelopes of Asymptotic Giant Branch (AGB) stars. These solides, once that have been ejected by stellar winds, come to us as inclusions in meteorites providing invaluable benchmarks and constraints for our knowledge of low temeperature H-burning in stars. The Trojan Horse Method (THM) has been used to investigate the low-energy cross sections of the {sup 17}O(p,α){sup 14}N and {sup 18}O(p,α){sup 15}N reactions. Moreover, the strength of the 65 keV resonance in the {sup 17}O(p,α){sup 14}N reaction, measured by means of the THM, has been used to renormalize the corresponding resonance strength in the {sup 17}O+p radiative capture channel. The new estimates of the reaction rates have been introduced into calculations of AGB star nucleosynthesis and the results have been compared with geochemical analysis of 'presolar' grains to determine their impact on astrophysical environments.

  13. 29 CFR 457.17 - Administrative Law Judge.

    Science.gov (United States)

    2010-07-01

    ... Administrative Law Judge to conduct a hearing in cases under 5 U.S.C. 7120 or 22 U.S.C. 4117 as implemented by... 29 Labor 2 2010-07-01 2010-07-01 false Administrative Law Judge. 457.17 Section 457.17 Labor... GENERAL Meaning of Terms as Used in This Chapter § 457.17 Administrative Law Judge. Administrative Law...

  14. Two-body hypercharge-exchange reactions in K-p and π+p interactions at 10 and 16 GeV/c

    International Nuclear Information System (INIS)

    Girtler, P.; Otter, G.; Sliwa, K.; Barnham, K.W.J.; Eason, R.M.; Newham, P.; Pollock, B.; Wells, J.; Mandl, F.; Markytan, M.

    1979-01-01

    Cross section values or upper limits are presented for twenty-five two-body hypercharge-exchange reactions in K - p and π + p interactions at 10 and 16 GeV/c. The 16 GeV/c results are compared with some predictions of line-reversal plus exchange-degenerate Regge poles, of SU(3) and of the additive quark model. Agreement is found in all cases. (author)

  15. 49 CFR 241.17 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 241.17 Section 241.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... OPERATIONS § 241.17 Preemptive effect. Under 49 U.S.C. 20106, the regulations in this part preempt any State...

  16. Measurement of continuum spectrum from {sup 12}C(p,p`x) at energy of 392 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Hiroki; Konishi, Daisuke; Uozumi, Yusuke; Wakabayashi, Genichiro; Sakae, Takeji; Matoba, Masaru [Kyushu Univ., Fukuoka (Japan); Nohtomi, Akihiro; Maki, Takashi; Koori, Norihiko

    1998-03-01

    Continuum spectra from {sup 12}C(p,p`x) reaction at 392 MeV were measured by using plastic and GSO(Ce) scintillators. The spectra of energy-angle double differential cross sections are compared with that of Quantum Molecular Dynamics (QMD) simulation. Significant differences were found in the results at the forward angles. (author)

  17. Induction of neutrophil gelatinase-associated lipocalin expression by co-stimulation with interleukin-17 and tumor necrosis factor-alpha is controlled by IkappaB-zeta but neither by C/EBP-beta nor C/EBP-delta

    DEFF Research Database (Denmark)

    Karlsen, Joachim R; Borregaard, Niels; Cowland, Jack B

    2010-01-01

    -alpha in the presence of IL-17, a pro-inflammatory cytokine produced by the newly discovered subset of CD4(+) T helper cells, T(H)-17. In contrast to the murine NGAL orthologue, 24p3/lipocalin 2, we found no requirement for C/EBP-beta or C/EBP-delta for NGAL induction by IL-17 and TNF-alpha as neither small interfering...

  18. Core cooling and thermal responses during whole-head, facial, and dorsal immersion in 17 degrees C water.

    Science.gov (United States)

    Pretorius, Thea; Gagnon, Dominique D; Giesbrecht, Gordon G

    2010-10-01

    This study isolated the effects of dorsal, facial, and whole-head immersion in 17 degrees C water on peripheral vasoconstriction and the rate of body core cooling. Seven male subjects were studied in thermoneutral air (approximately 28 degrees C). On 3 separate days, they lay prone or supine on a bed with their heads inserted through the side of an adjustable immersion tank. Following 10 min of baseline measurements, the water level was raised such that the water immersed the dorsum, face, or whole head, with the immersion period lasting 60 min. During the first 30 min, the core (esophageal) cooling rate increased from dorsum (0.29 ± 0.2 degrees C h-1) to face (0.47 ± 0.1 degrees C h-1) to whole head (0.69 ± 0.2 degrees C h(-1)) (p whole-head immersion (114 ± 52% h(-1)) than in either facial (51 ± 47% h-1) or dorsal (41 ± 55% h(-1)) immersion (p whole-head (120.5 ± 13 kJ), facial (86.8 ± 17 kJ), and dorsal (46.0 ± 11 kJ) immersion (p whole head elicited a higher rate of vasoconstriction, the face did not elicit more vasoconstriction than the dorsum. Rather, the progressive increase in core cooling from dorsal to facial to whole-head immersion simply correlates with increased heat loss.

  19. /sup 13/C(p vector,d)/sup 12/C and /sup 208/Pb(p vector,d)/sup 207/Pb reactions at 123 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Kraushaar, J J; Shepard, J R [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; Miller, D W; Jacobs, W W; Jones, W P; Devins, D W [Indiana Univ., Bloomington (USA). Dept. of Physics

    1983-02-01

    Cross-section and analyzing power angular distributions have been measured for /sup 13/C(p vector,d) and /sup 208/Pb(p vector, d) at 123 MeV to the strong low-lying residual states in both final nuclei. The data have been compared with the results of both zero- and exact-finite-range distorted wave calculations and some serious discrepancies were noted for the analyzing powers. For the case of the /sup 13/C calculations, marked improvement in the description of the data was achieved with the use of a damping factor in the nuclear interior.

  20. Requirement of TPO/c-mpl for IL-17A-induced granulopoiesis and megakaryopoiesis.

    Science.gov (United States)

    Tan, Weihong; Liu, Bainan; Barsoum, Adel; Huang, Weitao; Kolls, Jay K; Schwarzenberger, Paul

    2013-12-01

    IL-17A is a critical, proinflammatory cytokine essential to host defense and is induced in response to microbial invasion. It stimulates granulopoiesis, leading to neutrophilia, neutrophil activation, and mobilization. TPO synergizes with other cytokines in stimulating and expanding hematopoietic progenitors, also leading to granulopoiesis and megakaryopoiesis, and is required for thrombocytopoiesis. We investigated the effects of in vivo expression of IL-17A on granulopoiesis and megakaryopoiesis in TPO receptor c-mpl-/- mice. IL-17A expression expanded megakaryocytes by 2.5-fold in normal mice but had no such effect in c-mpl-/- mice. The megakaryocyte expansion did not result in increased peripheral platelet counts. IL-17A expression did not impact bone marrow precursors in c-mpl-/- mice; however, it expanded splenic precursors, although to a lesser extent compared with normal controls (CFU-HPP). No peripheral neutrophil expansion was observed in c-mpl-/- mice. Moreover, in c-mpl-/- mice, release of IL-17A downstream cytokines was reduced significantly (KC, MIP-2, GM-CSF). The data suggest that IL-17A requires the presence of functional TPO/c-mpl to exert its effects on granulopoiesis and megakaryopoiesis. Furthermore, IL-17A and its downstream cytokines are important regulators and synergistic factors for the physiologic function of TPO/c-mpl on hematopoiesis.

  1. Clonal Ordering of 17p and 5q Allelic Losses in Barrett Dysplasia and Adenocarcinoma

    Science.gov (United States)

    Blount, Patricia L.; Meltzer, Stephen J.; Yin, Jing; Huang, Ying; Krasna, Mark J.; Reid, Brian J.

    1993-04-01

    Both 17p and 5q allelic losses appear to be involved in the pathogenesis or progression of many human solid tumors. In colon carcinogenesis, there is strong evidence that the targets of the 17p and 5q allelic losses are TP53, the gene encoding p53, and APC, respectively. It is widely accepted that 5q allelic losses precede 17p allelic losses in the progression to colonic carcinoma. The data, however, supporting this proposed order are largely based on the prevalence of 17p and 5q allelic losses in adenomas and unrelated adenocarcinomas from different patients. We investigated the order in which 17p and 5q allelic losses developed during neoplastic progression in Barrett esophagus by evaluating multiple aneuploid cell populations from the same patient. Using DNA content flow cytometric cell sorting and polymerase chain reaction, 38 aneuploid cell populations from 14 patients with Barrett esophagus who had high grade dysplasia, cancer or both were evaluated for 17p and 5q allelic losses. 17p allelic losses preceded 5q allelic losses in 7 patients, both 17p and 5q allelic losses were present in all aneuploid populations of 4 patients, and only 17p (without 5q) allelic losses were present in the aneuploid populations of 3 patients. In no patient did we find that a 5q allelic loss preceded a 17p allelic loss. Our data suggest that 17p allelic losses typically occur before 5q allelic losses during neoplastic progression in Barrett esophagus.

  2. Allelic imbalance and fine mapping of the 17p13.3 subregion in sporadic breast carcinomas

    DEFF Research Database (Denmark)

    Hoff, C; Mollenhauer, J; Waldau, B

    2001-01-01

    Chromosome arm 17p is frequently altered in a variety of human cancers, especially in breast cancer, and allelic imbalances (AIs) in the region 17p13.1 do not always coincide with mutations in the TP53 gene. A second interval that frequently shows AIs at 17p is the chromosomal band 17p13.3. This ......Chromosome arm 17p is frequently altered in a variety of human cancers, especially in breast cancer, and allelic imbalances (AIs) in the region 17p13.1 do not always coincide with mutations in the TP53 gene. A second interval that frequently shows AIs at 17p is the chromosomal band 17p13...

  3. Synthesis and Physicochemical Properties of [19,20-13C]-17α-Ethinylestradiol

    NARCIS (Netherlands)

    Kraan, G.P.B.; Drayer, N.M.; Kruizinga, W.H.; Vaalburg, W.; Hummelen, J.C.

    1989-01-01

    13C2-17α-ethinylestradiol (13C2-EE2) was synthesized from estrone and 13C2-C2H2-gas to measure the metabolic clearance rate and the plasma concentration of 17α-ethinylestradiol (EE2) in tall girls, who are treated with high dosages of this estrogen. Interesting characteristics determined by (i) MS:

  4. Evaluation of lansoprazole as a probe for assessing cytochrome P450 2C19 activity and genotype-phenotype correlation in childhood.

    Science.gov (United States)

    Gumus, Ersin; Karaca, Ozgur; Babaoglu, Melih O; Baysoy, Gökhan; Balamtekin, Necati; Demir, Hulya; Uslu, Nuray; Bozkurt, Atilla; Yuce, Aysel; Yasar, Umit

    2012-05-01

    Lansoprazole, a cytochrome P450 2C19 (CYP2C19) substrate, has been widely used in children to manage acid-related diseases. CYP2C19 exhibits marked genetic polymorphisms, and distribution of these polymorphisms varies among different ethnic groups. There is limited data regarding the use of probe drugs for determining CYP2C19 activity in children. The aim of this study was to evaluate lansoprazole as an in vivo phenotyping probe for assessing CYP2C19 activity in children. The CYP2C19*2, *3, and *17 variants were determined in 244 children. Three hours after a single oral dose of lansoprazole (n = 94) or omeprazole (n = 19), plasma lansoprazole and 5-hydroxy lansoprazole or omeprazole and 5-hydroxy omeprazole concentrations were analyzed by high-performance liquid chromatography. The CYP2C19*17 was the most frequent variant allele (24.4%). The group of patients with CYP2C19*17*17 genotype had a 70% lower (p lansoprazole plasma concentration compared with the CYP2C19*1*1 genotype group, whereas the CYP2C19*2*2 group had 6.9-fold higher (p lansoprazole plasma concentration. Lansoprazole metabolic ratios (lansoprazole/5-hydroxy-lansoprazole) were found to be significantly lower in the *17*17 [mean ± standard deviation (SD); 2.8 ± 2.1] group and higher in the *2*2 group (63.5 ± 12.2) compared with that of the *1*1 genotype group (6.1 ± 4.5). According to our results from a Turkish pediatric population, lansoprazole is a suitable probe drug for phenotyping CYP2C19. The CYP2C19*2 and *17 variants should be taken into consideration in predicting the clinical outcome of therapy with lansoprazole in the pediatric population.

  5. C P Anil Kumar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C P Anil Kumar. Articles written in Journal of Earth System Science. Volume 124 Issue 8 December 2015 pp 1721-1733. Variation of surface electric field during geomagnetic disturbed period at Maitri, Antarctica · N Jeni Victor C Panneerselvam C P Anil Kumar.

  6. Study of 17O(p,α)14N reaction via the Trojan Horse Method for application to 17O nucleosynthesis

    International Nuclear Information System (INIS)

    Sergi, M. L.; Spitaleri, C.; Pizzone, R. G.; Gulino, M.; Cherubini, S.; Crucilla, V.; La Cognata, M.; Lamia, L.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S.; Tudisco, S.; Tumino, A.; Coc, A.; Burjan, V.; Hons, Z.; Kroha, V.; Hammache, F.; Sereville, N. de; Kiss, G.

    2008-01-01

    Because of the still present uncertainties on its rate, the 17 O(p,α) 14 N is one of the most important reaction to be studied in order to get more information about the fate of 17 O in different astrophysical scenarios. The preliminary study of the three-body reaction 2 H( 17 O,α 14 N)n is presented here as a first stage of the indirect study of this important 17 O(p,α) 14 N reaction through the Trojan Horse Method (THM)

  7. Two decades of Pacific anthropogenic carbon storage and ocean acidification along Global Ocean Ship-based Hydrographic Investigations Program sections P16 and P02

    Science.gov (United States)

    Carter, B. R.; Feely, R. A.; Mecking, S.; Cross, J. N.; Macdonald, A. M.; Siedlecki, S. A.; Talley, L. D.; Sabine, C. L.; Millero, F. J.; Swift, J. H.; Dickson, A. G.; Rodgers, K. B.

    2017-02-01

    A modified version of the extended multiple linear regression (eMLR) method is used to estimate anthropogenic carbon concentration (Canth) changes along the Pacific P02 and P16 hydrographic sections over the past two decades. P02 is a zonal section crossing the North Pacific at 30°N, and P16 is a meridional section crossing the North and South Pacific at 150°W. The eMLR modifications allow the uncertainties associated with choices of regression parameters to be both resolved and reduced. Canth is found to have increased throughout the water column from the surface to 1000 m depth along both lines in both decades. Mean column Canth inventory increased consistently during the earlier (1990s-2000s) and recent (2000s-2010s) decades along P02, at rates of 0.53 ± 0.11 and 0.46 ± 0.11 mol C m-2 a-1, respectively. By contrast, Canth storage accelerated from 0.29 ± 0.10 to 0.45 ± 0.11 mol C m-2 a-1 along P16. Shifts in water mass distributions are ruled out as a potential cause of this increase, which is instead attributed to recent increases in the ventilation of the South Pacific Subtropical Cell. Decadal changes along P16 are extrapolated across the gyre to estimate a Pacific Basin average storage between 60°S and 60°N of 6.1 ± 1.5 PgC decade-1 in the earlier decade and 8.8 ± 2.2 PgC decade-1 in the recent decade. This storage estimate is large despite the shallow Pacific Canth penetration due to the large volume of the Pacific Ocean. By 2014, Canth storage had changed Pacific surface seawater pH by -0.08 to -0.14 and aragonite saturation state by -0.57 to -0.82.

  8. Differential cross section measurement of radiative capture of protons by nuclei 13C

    International Nuclear Information System (INIS)

    Baktibayev, M.K.; Burminskii, V.P.; Burtebayev, N.; Jazairov-Kakhramanov, V.; Kadyrzhanov, K.K.; Sagindykov, Sh.Sh.; Zarifov, R.A.; Zazulin, D.M.

    2004-01-01

    The reaction 13 C(p,γ ) 14 N is the important one for the astrophysics, not only for nuclear synthesis of CNO elements, but also for nuclear synthesis of elements participating in subsequent combustion of helium [1]. The predominant yield of the reaction occurs at protons energies of less than 1 MeV. However, the clearness of the capture mechanism in this energy region is made difficult because of the superposition of the contribution of the low - energy part of the resonance 1320 keV onto the cross section. Last experimental data for a wider energy region, informed in the work [1], and results of previous works, mentioned in that work, give reason for further continuation of the study of the reaction 13 C(p,γ ) 14 N. Measured data of the work [1] in the region of E P = (320 - 900) keV at the angles of 0 o and 90 o are obviously insufficient. In the present work measurements of differential cross sections of the reaction were carried out at protons energies E P = 991 - 365 keV, the accuracy is not worse than 10%. There was studied the most (from the astrophysical point of view) important process of protons capture by 13 C nuclei onto the ground state of the 14 N nucleus. The theoretical investigation of the given reaction included calculation of cross sections. The cross sections were calculated within the framework of model of direct capture with the using of optical potentials for the description of a channel of scattering. The wave functions of a bound state were generated in a potential reproducing binding energy of a proton in 14 N nucleus. Results of calculations were compared with the experimental data. (author)

  9. Isothermal section of the Y-Co-V ternary system at 500 deg. C

    International Nuclear Information System (INIS)

    Wei, X.X.; Yan, J.L.; Du, H.W.; Wu, C.L.; Zhou, K.W.; Zhuang, Y.H.; Li, J.Q.

    2011-01-01

    Research highlights: → The isothermal section of the Y-Co-V system at 500 deg. C has been established. → Only one ternary compound YV x Co 12-x was found in this system and it exhibits a linear homogeneity range for 1.30 ≤ x ≤ 3.64. → The maximum solid solubilities of V in the compounds Y 2 Co 17 , Y 2 Co 7 , YCo 3 , YCo 2 and Y 3 Co are about 10, 1.0, 3.0, 4.0 and 4.0 at.%, respectively. - Abstract: The isothermal section of the Y-Co-V system at 500 deg. C has been investigated by X-ray diffraction, scanning electron microscopy and energy dispersive X-ray spectroscopy. Only one ternary compound YV x Co 12-x with a homogeneity range of 1.30 ≤ x ≤3.64 was found in this system. The maximum solid solubilities of V in Y 2 Co 17 , Y 2 Co 7 , YCo 3 , YCo 2 and Y 3 Co are about 10.0, 1.0, 3.0, 4.0 and 4.0 at.% V, respectively. The compounds VCo and VCo 3 have a homogeneity range of 46-66 at.% V and 22-30 at.% V, respectively. The maximum solid solubility of Y in VCo is about 2.0 at.% Y.

  10. MicroRNA-17-5p post-transcriptionally regulates p21 expression in irradiated betel quid chewing-related oral squamous cell carcinoma cells

    International Nuclear Information System (INIS)

    Wu, S.Y.; HungKuang Univ., Taichung; Lin, K.C.; Chiou, J.F.; Taipei Medical Univ. Hospital, Taipei; Taipei Medical Univ. Hospital, Taipei; Taipei Medical Univ. Hospital, Taipei; Jeng, S.C.; Cheng, W.H.; Chang, C.I.; Lin, W.C.; Wu, L.L.; Lee, H.L.; Chen, R.J.

    2013-01-01

    Background and purpose: Betel nut chewing is associated with oral cavity cancer in Taiwan. OC3 is an oral carcinoma cell line that was established from cells collected from a long-term betel nut chewer who does not smoke. After we found that microRNA-17-5p (miR-17-5p) is induced in OC3 cells, we used this cell line to examine the biological role(s) of this microRNA in response to exposure to ionizing radiation. Materials and methods: A combined SYBR green-based real-time PCR and oligonucleotide ligation assay was used to examine the expression of the miR-17 polycistron in irradiated OC3 cells. The roles of miR-17-5p and p21 were evaluated with specific antisense oligonucleotides (ODN) that were designed and used to inhibit their expression. Expression of the p21 protein was evaluated by Western blotting. The clonogenic assay and annexin V staining were used to evaluate cell survival and apoptosis, respectively. Cells in which miR-17-5p was stably knocked down were used to create ectopic xenografts to evaluate in vivo the role of miR-17-5p. Results: A radiation dose of 5 Gy significantly increased miR-17-5p expression in irradiated OC3 cells. Inhibition of miR-17-5p expression enhanced the radiosensitivity of the OC3 cells. We found that miR-17-5p downregulates radiation-induced p21 expression in OC3 cells and, by using a tumor xenograft model, it was found that p21 plays a critical role in increasing the radiosensitivity of OC3 cells in vitro and in vivo. Conclusion: miR-17-5p is induced in irradiated OC3 cells and it downregulates p21 protein expression, contributing to the radioresistance of OC3 cells. (orig.)

  11. MicroRNA-17-5p post-transcriptionally regulates p21 expression in irradiated betel quid chewing-related oral squamous cell carcinoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Wu, S.Y. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Dept. of Radiation-Oncology; HungKuang Univ., Taichung (China). Dept. of Biotechnology; Lin, K.C. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Dept. of Oral and Maxillofacial Surgery; Chiou, J.F. [Taipei Medical Univ., Taipei (China). Dept. of Radiology; Taipei Medical Univ. Hospital, Taipei (China). Dept. of Radiation Oncology; Taipei Medical Univ. Hospital, Taipei (China). Dept. of Hospice and Palliative Center; Taipei Medical Univ. Hospital, Taipei (China). Cancer Center; Jeng, S.C. [Taipei Medical Univ. Hospital, Taipei (China). Dept. of Radiation Oncology; Cheng, W.H.; Chang, C.I. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Dept. of Hemato-Ongology; Lin, W.C. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Div. of Thoracic Surgery; Wu, L.L. [National Taiwan Univ. Hospital, Taipei (China). Dept. of Ophthalmology; Lee, H.L. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Dept. of Radiation-Oncology; Chen, R.J. [National Taiwan Univ. Hospital and National Taiwan Univ., Taipei (China). Dept. of Obstetrics and Gynecology

    2013-08-15

    Background and purpose: Betel nut chewing is associated with oral cavity cancer in Taiwan. OC3 is an oral carcinoma cell line that was established from cells collected from a long-term betel nut chewer who does not smoke. After we found that microRNA-17-5p (miR-17-5p) is induced in OC3 cells, we used this cell line to examine the biological role(s) of this microRNA in response to exposure to ionizing radiation. Materials and methods: A combined SYBR green-based real-time PCR and oligonucleotide ligation assay was used to examine the expression of the miR-17 polycistron in irradiated OC3 cells. The roles of miR-17-5p and p21 were evaluated with specific antisense oligonucleotides (ODN) that were designed and used to inhibit their expression. Expression of the p21 protein was evaluated by Western blotting. The clonogenic assay and annexin V staining were used to evaluate cell survival and apoptosis, respectively. Cells in which miR-17-5p was stably knocked down were used to create ectopic xenografts to evaluate in vivo the role of miR-17-5p. Results: A radiation dose of 5 Gy significantly increased miR-17-5p expression in irradiated OC3 cells. Inhibition of miR-17-5p expression enhanced the radiosensitivity of the OC3 cells. We found that miR-17-5p downregulates radiation-induced p21 expression in OC3 cells and, by using a tumor xenograft model, it was found that p21 plays a critical role in increasing the radiosensitivity of OC3 cells in vitro and in vivo. Conclusion: miR-17-5p is induced in irradiated OC3 cells and it downregulates p21 protein expression, contributing to the radioresistance of OC3 cells. (orig.)

  12. De novo duplication of 17p13.1-p13.2 in a patient with intellectual disability and obesity.

    Science.gov (United States)

    Kuroda, Yukiko; Ohashi, Ikuko; Tominaga, Makiko; Saito, Toshiyuki; Nagai, Jun-Ichi; Ida, Kazumi; Naruto, Takuya; Masuno, Mitsuo; Kurosawa, Kenji

    2014-06-01

    17p13.1 Deletion encompassing TP53 has been described as a syndrome characterized by intellectual disability and dysmorphic features. Only one case with a 17p13.1 duplication encompassing TP53 has been reported in a patient with intellectual disability, seizures, obesity, and diabetes mellitus. Here, we present a patient with a 17p13.1 duplication who exhibited obesity and intellectual disability, similar to the previous report. The 9-year-old proposita was referred for the evaluation of intellectual disability and obesity. She also exhibited insulin resistance and liver dysfunction. She had wide palpebral fissures, upturned nostrils, a long mandible, short and slender fingers, and skin hyperpigmentation. Array comparative genomic hybridization (array CGH) detected a 3.2 Mb duplication of 17p13.1-p13.2 encompassing TP53, FXR2, NLGN2, and SLC2A4, which encodes the insulin-responsive glucose transporter 4 (GLUT4) associated with insulin-stimulated glucose uptake in adipocytes and muscle. We suggest that 17p13.1 duplication may represent a clinically recognizable condition characterized partially by a characteristic facial phenotype, developmental delay, and obesity. © 2014 Wiley Periodicals, Inc.

  13. Measurements of the asymmetry in the. gamma. p. -->. p. pi. /sup 0/ cross section in the resonance region

    Energy Technology Data Exchange (ETDEWEB)

    Avakyan, R.O.; Avetisyan, A.; Bagdasaryan, A.S.; Vartapetyan, G.A.; Danagulyan, S.S.; Eganov, V.S.; Karapetyan, A.P.; Kosakov, I.K.; Marukyan, G.O.; Matevosyan, M.

    1983-11-01

    The energy dependence of the asymmetry in the cross section for the ..gamma..p..-->..p..pi../sup 0/ reaction induced by a polarized photon beam is measured in the energy region 0.75--1.3 GeV at the neutral-pion emission angle theta(0 = 70/sup 0/ in the c.m. system. The experimental data are compared with various theoretical predictions. A prediction based on the use of fixed-t dispersion relations is in satisfactory agreement with the experimental results.

  14. V{sub 18}P{sub 9}C{sub 2}. A complex phosphide carbide

    Energy Technology Data Exchange (ETDEWEB)

    Boller, Herbert [Linz Univ. (Austria). Inst. fuer Anorganische Chemie; Effenberger, Herta [Wien Univ. (Austria). Inst. fuer Mineralogie und Kristallographie

    2016-08-01

    V{sub 18}P{sub 9}C{sub 2} crystallizes in the orthorhombic space group Pmma with the lattice parameters a = 17.044(3), b = 3.2219(7), and c = 13.030(2) Aa, Z = 2. The crystal structure is composed of 19 symmetry-independent atoms. The crystal structure is considered as a network formed by the transition metal atoms exhibiting cubic, trigonal prismatic, and octahedral voids centered by V, P, and C atoms, respectively. Vice versa, the V and P atoms form a three-dimensional network. The two CV{sub 6} octahedra are edge- and corner-connected to chains running parallel to [010]. The five unique P atoms are trigonal prismatically coordinated by V atoms with one to three faces capped again by a V atom. The V atoms have mainly cubic environments formed solely by V or by V and P atoms. V{sub 18}P{sub 9}C{sub 2} exhibits some structural relations to other compounds of the ternary system V-P-C as well as to other intermetallic phases. Despite the low carbon content, V{sub 18}P{sub 9}C{sub 2} is considered as a ternary compound rather than an interstitially stabilized (binary) phosphide in view of its special structural features.

  15. Measurements of spin parameters in p-p elastic scattering at 6 GeV/c

    International Nuclear Information System (INIS)

    Linn, S.L.; Perlmutter, A.; Crosbie, E.A.; Ratner, L.G.; Schultz, P.F.; O'Fallon, J.R.; Cameron, P.R.; Crabb, D.G.; Fernow, R.C.; Hansen, P.H.; Krisch, A.D.; Salthouse, A.J.; Sandler, B.; Shima, T.; Terwilliger, K.M.

    1982-01-01

    We measured the differential cross section for proton-proton elastic scattering in 6 GeV/c, with both initial spins oriented normal to the scattering plane. The analyzing power A shows significant structure with a large broad peak reaching about 24% near P/sub perpendicular/ 2 = 1.6 (GeV/c) 2 . The spin-spin correlation parameter A/sub n/n exhibits more dramatic structure, with a small but very sharp peak rising rapidly to about 13% at 90 0 /sub tsc.m./. This sharp peak may be caused by particle-identity effects

  16. Measurements of Lα, Lβ X-ray production cross sections of Bi by 17-40 keV electron impact

    International Nuclear Information System (INIS)

    Wu, Y.; An, Z.; Duan, Y.M.; Liu, M.T.

    2010-01-01

    We present results of measurements of L α , L β X-ray production cross sections for the element Bi (Z = 83) by 17-40 keV electron impact. The target used in the experiment was prepared by evaporating the element Bi to the thick pure carbon substrate. The effects of multiple scattering of electrons when penetrating the target film, of electrons reflected from the thick pure carbon substrate and of bremsstrahlung photons produced by the impact of incident electrons on the target are corrected by means of Monte Carlo simulation. The experimental data, reported here for the first time in the energy region of 17-40 keV, are compared with the DWBA theory and the PWBA-C-Ex theory. They are in good agreement.

  17. File list: InP.Bld.50.AllAg.Th17 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.Bld.50.AllAg.Th17 mm9 Input control Blood Th17 SRX288138,SRX495621,SRX288137,SR...X220933,SRX172342,SRX1328057,SRX1328056 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Bld.50.AllAg.Th17.bed ...

  18. 23 CFR 658.17 - Weight.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Weight. 658.17 Section 658.17 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS TRUCK SIZE AND WEIGHT, ROUTE... agency transit passenger bus, is excluded from the axle weight limits in paragraphs (c) through (e) of...

  19. THM determination of the 65 keV resonance strength intervening in the {sup 17}O(p,α){sup 14}N reaction rate

    Energy Technology Data Exchange (ETDEWEB)

    Sergi, M. L.; La Cognata, M.; Pizzone, R. G. [INFN-Laboratori Nazionali del Sud, Catania (Italy); Spitaleri, C.; Cherubini, S.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S. [Università di Catania, Catania, Italy and INFN-Laboratori Nazionali del Sud, Catania (Italy); Burjan, S. V.; Hons, Z.; Kroha, V. [Nuclear Physics Institute of ASCR Rez near Prague (Czech Republic); Coc, A. [CSNSM, UMR 8609, CNRS/IN2P3 and Universitè Paris Sud 11, Bâtiment 104, 91405 Orsay Campus (France); Gulino, M.; Tumino, A. [Università di Catania, Catania, Italy and INFN-Laboratori Nazionali del Sud, Catania, Italy and Universitá Kore di Enna, Enna (Italy); Hammache, F. [IPN, IN2P3-CNRS et Université de Paris-Sud 91406 Orsay Cedex (France); Irgaziev, B. [GIK Institute of Engineering Sciences and Technology Topi District Swabi NWFP (Pakistan); Kiss, G. G.; Somorjai, E. [ATOMKI, Debrecen (Hungary); Lamia, L. [Università di Catania, Catania (Italy); Mukhamedzhanov, A. [Cyclotron Institute,Texas A and M University College Station (United States); and others

    2015-02-24

    The {sup 17}O(p,α){sup 14}N reaction is of paramount importance for the nucleosynthesis in a number of stellar sites, including red giants (RG), asymptotic giant branch (AGB) stars, massive stars and classical novae. We report on the indirect study of the {sup 17}O(p,α){sup 14}N reaction via the Trojan Horse Method by applying the approach recently developed for extracting the resonance strength of the narrow resonance at E{sub c.m.}{sup R} = 65 keV (E{sub X} =5.673 MeV). The strength of the 65 keV resonance in the {sup 17}O(p,α){sup 14}N reaction, measured by means of the THM, has been used to renormalize the corresponding resonance strength in the {sup 17}O+p radiative capture channel.

  20. Exotic behavior of elastic scattering differential cross-sections of weakly bound nucleus 17F at small angles

    International Nuclear Information System (INIS)

    Han Jianlong; Hu Zhengguo; Zhang Xueyin; Yuan Xiaohua; Xu Huagen; Qi Huirong; Wang Yue; Jia Fei; Wu Lijie; Ding Xianli; Gao Qi; Gao Hui; Bai Zhen

    2006-01-01

    The differential cross-sections for elastic scattering of 17 F and 17 O on 208 Pb have been measured at Radioactive Ion Beam Line at Lanzhou (RIBLL). The variation of the logarithms of differential cross-sections with the square of scattering angles shows clearly that there exists a turning point in the range of small scattering angles (6 degree-20 degree) for 17 F having exotic structure, while no turning point was observed in the 17 O elastic scattering. The experimental results have been compared with previous data. Systematical analysis on the available data seems to conclude that there is an exotic behavior of elastic scattering differential cross-sections of weakly bound nuclei with halo or skin structure as compared with that of the ordinary nuclei near stable line. Therefore the fact that the turning point of the logarithms of differential cross-sections appears at small angle for weakly bound nuclei could be used as a new probe to investigate the halo and skin phenomenon. (authors)

  1. Differential cross section measurement of radiative capture of protons by nuclei 13C

    International Nuclear Information System (INIS)

    Baktibayev, M.K.; Burminskii, V.P.; Burtebayev, N.; Dzazairov-Kakhramanov, V.; Kadyrzhanov, K.K.; Sagindykov, Sh.Sh.; Zarifov, R.A.; Zazulin, D.M.

    2004-01-01

    Full text: The reaction 13 C(p,γ ) 14 N is the important one for the astrophysics, not only for nuclear synthesis of CNO elements, but and for nuclear synthesis of elements participating in subsequent combustion of helium [1]. The predominant yield of the reaction occurs at protons energies of less than 1 MeV. However, the clearness of the capture mechanism in this energy region is made difficult because of the superposition of the contribution of the low - energetical part of the resonance 1320 keV onto the cross section. Last experimental data for more wide energy region, informed in the work [1], and results of previous works, mentioned in that work, give reason for further continuation of the study of the reaction 13 C(p,γ ) 14 N. Measured data of the work [1] in the region of E ρ = (320 † 900) keV at the angles of 0 o and 90 o are obviously insufficient. In the present work measurements of differential cross sections of the reaction were carried out at protons energies E p = 991, 558 and 365 keV, the accuracy is not worse then 10%. There was studied the most (from the astrophysical point of view) important process of protons capture by 13 C nuclei onto the ground state of the 14 N nucleus. The 13 C (99%) targets, used in the experiment, were sprayed onto copper base. The target thickness was determined by incident protons energy losses in the target. The energy losses were clearly reflected in the corresponding spreading of transitions of radiation capture. The statement about the gamma-lines spreading is valid in this case, because energy losses in the target are here significantly more, than the energetical resolution of the detector. The peak width of the radiation capture gamma-line at half-height corresponds to energy losses of incident protons in the target. From the Table of brake values for protons in carbon [2] there was determined that the thickness of the target was 140 ± 5% μg/cm 2 . The upper part of gamma-lines in the spectrum repeats the

  2. Measurement of the D+-meson production cross section at low transverse momentum in p p ¯ collisions at √{s }=1.96 TeV

    Science.gov (United States)

    Aaltonen, T.; Amerio, S.; Amidei, D.; Anastassov, A.; Annovi, A.; Antos, J.; Apollinari, G.; Appel, J. A.; Arisawa, T.; Artikov, A.; Asaadi, J.; Ashmanskas, W.; Auerbach, B.; Aurisano, A.; Azfar, F.; Badgett, W.; Bae, T.; Barbaro-Galtieri, A.; Barnes, V. E.; Barnett, B. A.; Barria, P.; Bartos, P.; Bauce, M.; Bedeschi, F.; Behari, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Beretvas, A.; Bhatti, A.; Bland, K. R.; Blumenfeld, B.; Bocci, A.; Bodek, A.; Bortoletto, D.; Boudreau, J.; Boveia, A.; Brigliadori, L.; Bromberg, C.; Brucken, E.; Budagov, J.; Budd, H. S.; Burkett, K.; Busetto, G.; Bussey, P.; Butti, P.; Buzatu, A.; Calamba, A.; Camarda, S.; Campanelli, M.; Canelli, F.; Carls, B.; Carlsmith, D.; Carosi, R.; Carrillo, S.; Casal, B.; Casarsa, M.; Castro, A.; Catastini, P.; Cauz, D.; Cavaliere, V.; Cerri, A.; Cerrito, L.; Chen, Y. C.; Chertok, M.; Chiarelli, G.; Chlachidze, G.; Cho, K.; Chokheli, D.; Clark, A.; Clarke, C.; Convery, M. E.; Conway, J.; Corbo, M.; Cordelli, M.; Cox, C. A.; Cox, D. J.; Cremonesi, M.; Cruz, D.; Cuevas, J.; Culbertson, R.; d'Ascenzo, N.; Datta, M.; de Barbaro, P.; Demortier, L.; Deninno, M.; D'Errico, M.; Devoto, F.; Di Canto, A.; Di Ruzza, B.; Dittmann, J. R.; Donati, S.; D'Onofrio, M.; Dorigo, M.; Driutti, A.; Ebina, K.; Edgar, R.; Erbacher, R.; Errede, S.; Esham, B.; Farrington, S.; Fernández Ramos, J. P.; Field, R.; Flanagan, G.; Forrest, R.; Franklin, M.; Freeman, J. C.; Frisch, H.; Funakoshi, Y.; Galloni, C.; Garfinkel, A. F.; Garosi, P.; Gerberich, H.; Gerchtein, E.; Giagu, S.; Giakoumopoulou, V.; Gibson, K.; Ginsburg, C. M.; Giokaris, N.; Giromini, P.; Glagolev, V.; Glenzinski, D.; Gold, M.; Goldin, D.; Golossanov, A.; Gomez, G.; Gomez-Ceballos, G.; Goncharov, M.; González López, O.; Gorelov, I.; Goshaw, A. T.; Goulianos, K.; Gramellini, E.; Grosso-Pilcher, C.; Guimaraes da Costa, J.; Hahn, S. R.; Han, J. Y.; Happacher, F.; Hara, K.; Hare, M.; Harr, R. F.; Harrington-Taber, T.; Hatakeyama, K.; Hays, C.; Heinrich, J.; Herndon, M.; Hocker, A.; Hong, Z.; Hopkins, W.; Hou, S.; Hughes, R. E.; Husemann, U.; Hussein, M.; Huston, J.; Introzzi, G.; Iori, M.; Ivanov, A.; James, E.; Jang, D.; Jayatilaka, B.; Jeon, E. J.; Jindariani, S.; Jones, M.; Joo, K. K.; Jun, S. Y.; Junk, T. R.; Kambeitz, M.; Kamon, T.; Karchin, P. E.; Kasmi, A.; Kato, Y.; Ketchum, W.; Keung, J.; Kilminster, B.; Kim, D. H.; Kim, H. S.; Kim, J. E.; Kim, M. J.; Kim, S. H.; Kim, S. B.; Kim, Y. J.; Kim, Y. K.; Kimura, N.; Kirby, M.; Kondo, K.; Kong, D. J.; Konigsberg, J.; Kotwal, A. V.; Kreps, M.; Kroll, J.; Kruse, M.; Kuhr, T.; Kurata, M.; Laasanen, A. T.; Lammel, S.; Lancaster, M.; Lannon, K.; Latino, G.; Lee, H. S.; Lee, J. S.; Leo, S.; Leone, S.; Lewis, J. D.; Limosani, A.; Lipeles, E.; Lister, A.; Liu, Q.; Liu, T.; Lockwitz, S.; Loginov, A.; Lucchesi, D.; Lucà, A.; Lueck, J.; Lujan, P.; Lukens, P.; Lungu, G.; Lys, J.; Lysak, R.; Madrak, R.; Maestro, P.; Malik, S.; Manca, G.; Manousakis-Katsikakis, A.; Marchese, L.; Margaroli, F.; Marino, P.; Matera, K.; Mattson, M. E.; Mazzacane, A.; Mazzanti, P.; McNulty, R.; Mehta, A.; Mehtala, P.; Mesropian, C.; Miao, T.; Mietlicki, D.; Mitra, A.; Miyake, H.; Moed, S.; Moggi, N.; Moon, C. S.; Moore, R.; Morello, M. J.; Mukherjee, A.; Muller, Th.; Murat, P.; Mussini, M.; Nachtman, J.; Nagai, Y.; Naganoma, J.; Nakano, I.; Napier, A.; Nett, J.; Nigmanov, T.; Nodulman, L.; Noh, S. Y.; Norniella, O.; Oakes, L.; Oh, S. H.; Oh, Y. D.; Okusawa, T.; Orava, R.; Ortolan, L.; Pagliarone, C.; Palencia, E.; Palni, P.; Papadimitriou, V.; Parker, W.; Pauletta, G.; Paulini, M.; Paus, C.; Phillips, T. J.; Piacentino, G.; Pianori, E.; Pilot, J.; Pitts, K.; Plager, C.; Pondrom, L.; Poprocki, S.; Potamianos, K.; Pranko, A.; Prokoshin, F.; Ptohos, F.; Punzi, G.; Redondo Fernández, I.; Renton, P.; Rescigno, M.; Rimondi, F.; Ristori, L.; Robson, A.; Rodriguez, T.; Rolli, S.; Ronzani, M.; Roser, R.; Rosner, J. L.; Ruffini, F.; Ruiz, A.; Russ, J.; Rusu, V.; Sakumoto, W. K.; Sakurai, Y.; Santi, L.; Sato, K.; Saveliev, V.; Savoy-Navarro, A.; Schlabach, P.; Schmidt, E. E.; Schwarz, T.; Scodellaro, L.; Scuri, F.; Seidel, S.; Seiya, Y.; Semenov, A.; Sforza, F.; Shalhout, S. Z.; Shears, T.; Shepard, P. F.; Shimojima, M.; Shochet, M.; Shreyber-Tecker, I.; Simonenko, A.; Sliwa, K.; Smith, J. R.; Snider, F. D.; Song, H.; Sorin, V.; St. Denis, R.; Stancari, M.; Stentz, D.; Strologas, J.; Sudo, Y.; Sukhanov, A.; Suslov, I.; Takemasa, K.; Takeuchi, Y.; Tang, J.; Tecchio, M.; Teng, P. K.; Thom, J.; Thomson, E.; Thukral, V.; Toback, D.; Tokar, S.; Tollefson, K.; Tomura, T.; Tonelli, D.; Torre, S.; Torretta, D.; Totaro, P.; Trovato, M.; Ukegawa, F.; Uozumi, S.; Vázquez, F.; Velev, G.; Vellidis, C.; Vernieri, C.; Vidal, M.; Vilar, R.; Vizán, J.; Vogel, M.; Volpi, G.; Wagner, P.; Wallny, R.; Wang, S. M.; Waters, D.; Wester, W. C.; Whiteson, D.; Wicklund, A. B.; Wilbur, S.; Williams, H. H.; Wilson, J. S.; Wilson, P.; Winer, B. L.; Wittich, P.; Wolbers, S.; Wolfe, H.; Wright, T.; Wu, X.; Wu, Z.; Yamamoto, K.; Yamato, D.; Yang, T.; Yang, U. K.; Yang, Y. C.; Yao, W.-M.; Yeh, G. P.; Yi, K.; Yoh, J.; Yorita, K.; Yoshida, T.; Yu, G. B.; Yu, I.; Zanetti, A. M.; Zeng, Y.; Zhou, C.; Zucchelli, S.; CDF Collaboration

    2017-05-01

    We report on a measurement of the D+-meson production cross section as a function of transverse momentum (pT) in proton-antiproton (p p ¯) collisions at 1.96 TeV center-of-mass energy, using the full data set collected by the Collider Detector at Fermilab in Tevatron Run II and corresponding to 10 fb-1 of integrated luminosity. We use D+→K-π+π+ decays fully reconstructed in the central rapidity region |y |<1 with transverse momentum down to 1.5 GeV /c , a range previously unexplored in p p ¯ collisions. Inelastic p p ¯-scattering events are selected online using minimally biasing requirements followed by an optimized offline selection. The K-π+π+ mass distribution is used to identify the D+ signal, and the D+ transverse impact-parameter distribution is used to separate prompt production, occurring directly in the hard-scattering process, from secondary production from b -hadron decays. We obtain a prompt D+ signal of 2950 candidates corresponding to a total cross section σ (D+,1.5 <pT<14.5 GeV / c ,|y |<1 )=71.9 ±6.8 (stat )±9.3 (syst ) μ b . While the measured cross sections are consistent with theoretical estimates in each pT bin, the shape of the observed pT spectrum is softer than the expectation from quantum chromodynamics. The results are unique in p p ¯ collisions and can improve the shape and uncertainties of future predictions.

  3. C and P in aquatic food chain: A review on C:P stoichiometry and PUFA regulation

    Directory of Open Access Journals (Sweden)

    Saikia S.K.

    2010-09-01

    Full Text Available Carbon (C and phosphorous (P regulation in aquatic food chains are transferred from lower to upper trophic levels primarily as polyunsaturated fatty acids (PUFAs and C:P stoichiometry. The majority of C is transferred through algal based pathway. Microbial loop, though optionally contributes to C transfer, highly constrained by P limitation and bacterial predator type. Lack of essential PUFAs in bacteria is also responsible for its low trophic transfer of C. The seston size and algal taxonomic variations directly affect herbivore through P-dependent food quality and de novo synthesis of PUFAs. Change in algal community over a gradient could therefore determine C transfer. Feeding nature (herbivorous or carnivorous and predator sizes also regulate transfer efficiency of C and P to upper trophic levels. As trophic levels move up, P-limitation becomes higher compared to autotrophs. For Daphnia, as mostly studied aquatic herbivore member, P limitation becomes critical at C:P > 300 indicating excess C is not always invited under P-deficient situations. However, as a part of homeostasis mechanism for trophic upgrading, conversion of algal-zooplankton interface from qualitative to quantitative could minimize such critical C:P regulation at higher trophic levels. Protists, in turn, with high clearance rate by zooplankton predator could also compensate qualitative effect.

  4. Quasi-elastic cross sections for 1GeV proton incident on {sup 4}He and {sup 12}C

    Energy Technology Data Exchange (ETDEWEB)

    Nishimura, M.; Nakamoto, T.; Shigyo, N. [Kyushu Univ., Fukuoka (Japan). Faculty of Engineering] [and others

    1997-03-01

    The experiment of p-n quasi-elastic scattering cross sections was carried out for 1GeV protons on {sup 4}He and {sup 12}C. The coincident measurement was made at c.m. angles of {+-} 90deg. The experiment was simulated by the use of HETC (High Energy Transport Code). It was examined to apply the p-n quasi-elastic scattering cross sections to neutron flux measurement. (author)

  5. Comparison of one and two-neutron transfer near the Coulomb barrier for the 27Al(18O, 16O)29Al, 27Al(18O, 17O)28Al and 27Al(13C, 12C)28Al reactions

    International Nuclear Information System (INIS)

    Schiller, S.A.; Eck, J.S.

    1975-01-01

    Total reaction cross sections for the transfer reactions 27 Al( 18 O, 16 O) 29 Al, 27 Al( 18 O, 17 O) 28 Al and 27 Al( 13 C, 12 C) 28 Al are reported for center-of-mass energies between 13 and 20 MeV for 18 O projectiles and between 11 and 17.5 MeV for 13 C projectiles. The reaction products, 29 Al, and 28 Al, beta decay to 29 Si and 28 Si, respectively, and the subsequent γ decays of 29 Si and 28 Si were measured. Due to the relatively long beta decay half lives, data were taken in a beam-off mode, resulting in very clean spectra. Total cross sections were calculated and compared with a theoretical model for barrier penetration proposed by C.Y. Wong. Differences between 18 O induced one and two-neutron total transfer reaction cross sections are discussed. (orig.) [de

  6. C P Singh

    Indian Academy of Sciences (India)

    ... Simon-Gillo C P Singh V Singh M Sivertz A Soldatov R A Soltz S Sorensen P W Stankus N Starinsky P Steinberg E Stenlund A Ster S P Stoll M Sugioka T Sugitate J P Sullivan Y Sumi Z Sun M Suzuki E M Takagui A Taketani M Tamai K H Tanaka Y Tanaka E Taniguchi M J Tannenbaum J Thomas J H Thomas T L Thomas ...

  7. 17 CFR 249.619 - Form TA-Y2K, information required of transfer agents pursuant to section 17 of the Securities...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TA-Y2K, information... Certain Exchange Members, Brokers, and Dealers § 249.619 Form TA-Y2K, information required of transfer... affecting Form TA-Y2K, see the List of CFR Sections Affected, which appears in the Finding Aids section of...

  8. 31 CFR 17.110 - Self-evaluation.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Self-evaluation. 17.110 Section 17... § 17.110 Self-evaluation. (a) The agency shall, by two years after the effective date of this part... handicaps, to participate in the self-evaluation process. (c) The agency shall, until three years following...

  9. t anti-t production cross section measurement using soft electron tagging in p anti-p collisions at √s = 1.96-TeV

    Energy Technology Data Exchange (ETDEWEB)

    Chou, John Paul [Harvard Univ., Cambridge, MA (United States)

    2008-09-01

    We measure the production cross section of t$\\bar{t}$ events in p$\\bar{p}$ collisions at √s = 1.96 TeV. The data was collected by the CDF experiment in Run 2 of the Tevatron accelerator at the Fermi National Accelerator Laboratory between 2002 and 2007. 1.7 fb-1 of data was recorded during this time period. We reconstruct t$\\bar{t}$ events in the lepton+jets channel, whereby one W boson - resulting from the decay of the top quark pairs - decays leptonically and the other hadronically. The dominant background to this process is the production of W bosons in association with multiple jets. To distinguish t$\\bar{t}$ from background, we identify soft electrons from the semileptonic decay of heavy flavor jets produced in t$\\bar{t}$ events. We measure a cross section of σ$\\bar{p}$ = 7.8 ± 2.4(stat) ± 1.6(syst) ± 0.5(lumi).

  10. Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk

    Science.gov (United States)

    Broderick, Peter; Chen, Bowang; Johnson, David C; Försti, Asta; Vijayakrishnan, Jayaram; Migliorini, Gabriele; Dobbins, Sara E; Holroyd, Amy; Hose, Dirk; Walker, Brian A; Davies, Faith E; Gregory, Walter A; Jackson, Graham H; Irving, Julie A; Pratt, Guy; Fegan, Chris; Fenton, James AL; Neben, Kai; Hoffmann, Per; Nöthen, Markus M; Mühleisen, Thomas W; Eisele, Lewin; Ross, Fiona M; Straka, Christian; Einsele, Hermann; Langer, Christian; Dörner, Elisabeth; Allan, James M; Jauch, Anna; Morgan, Gareth J; Hemminki, Kari; Houlston, Richard S; Goldschmidt, Hartmut

    2016-01-01

    To identify variants for multiple myeloma risk, we conducted a genome-wide association study with validation in additional series totaling 4,692 cases and 10,990 controls. We identified four risk loci at 3q26.2 (rs10936599, P=8.70x10-14), 6p21.33 (rs2285803, PSORS1C2; P= 9.67x10-11), 17p11.2 (rs4273077, TNFRSF13B; P=7.67x10-9) and 22q13.1 (rs877529, CBX7; P=7.63x10-16). These data provide further evidence for genetic susceptibility to this B-cell hematological malignancy and insight into the biological basis of predisposition. PMID:23955597

  11. Measurement of the Production Cross Section for the Charmed Baryon $\\Lambda_c$ in 250 GeV/c Pion-Nucleon Interactions

    Energy Technology Data Exchange (ETDEWEB)

    dos Reis, Alberto Correa [Rio de Janeiro, CBPF

    1992-04-01

    This work a presents a measurement of the total cross section for the charmed baryon $\\Lambda_c$ times the branching fraction of the mode $\\Lambda_c \\to pK\\bar{\\mu}$, for the kinematical region $x_F$ > O in $\\pi$-nucleus interactions at 250 GeV/c. This measurement is made with data from the experiment E769, collected during 1987/1988 at the FERMILAB Tagged Photon Laboratory. A segmented target of berillium, aluminum, copper and tungsten was used. Based on the A dependence measurement, made by E769, and on the available branching fractions, the total cross section per nucleon is calculated. The result is compared with other experiments and with some theoretical predictions inspired on QCD.

  12. Cross section measurements of proton capture reactions on Se isotopes relevant to the astrophysical p process

    Science.gov (United States)

    Foteinou, V.; Harissopulos, S.; Axiotis, M.; Lagoyannis, A.; Provatas, G.; Spyrou, A.; Perdikakis, G.; Zarkadas, Ch.; Demetriou, P.

    2018-03-01

    Cross sections of proton capture reactions on 74Se, 78Se, and 80Se have been measured at incident beam energies from 2 to 6 MeV, 1.7 to 3 MeV, and 1.5 to 3.5 MeV, respectively. In the case of Se,8078, cross sections were obtained from in-beam γ -angular distribution measurements, whereas for the 74Se isotope they were derived from off-beam activity measurements. The measured cross sections were compared with calculations performed with the nuclear reaction code talys (version 1.6). A good agreement between theory and experiment was found. Astrophysical S factors and reaction rates deduced from the experimental and calculated cross sections were also compared and the impact of different nuclear ingredients in the calculations on the reaction rates was investigated. It was found that, for certain combinations of nuclear input models, the reaction rates obtained at temperatures relevant to p -process nucleosynthesis differ by a factor 2 at the most, differences that are well within the acceptable deviations of calculated p -nuclei abundances and observations.

  13. A measurement of the $C\\!P$ asymmetry difference in $\\varLambda_{c}^{+} \\to pK^{-}K^{+}$ and $p\\pi^{-}\\pi^{+}$ decays

    CERN Document Server

    Aaij, Roel; LHCb Collaboration; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Alfonso Albero, Alejandro; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Atzeni, Michele; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Balagura, Vladislav; Baldini, Wander; Baranov, Alexander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baryshnikov, Fedor; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Beiter, Andrew; Bel, Lennaert; Beliy, Nikita; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Beranek, Sarah; Berezhnoy, Alexander; Bernet, Roland; Berninghoff, Daniel; Bertholet, Emilie; Bertolin, Alessandro; Betancourt, Christopher; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Birnkraut, Alex; Bizzeti, Andrea; Bjørn, Mikkel; Blake, Thomas; Blanc, Frederic; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bordyuzhin, Igor; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Brodzicka, Jolanta; Brundu, Davide; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Byczynski, Wiktor; Cadeddu, Sandro; Cai, Hao; Calabrese, Roberto; Calladine, Ryan; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Cattaneo, Marco; Cavallero, Giovanni; Cenci, Riccardo; Chamont, David; Chapman, Matthew George; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu Faye; Chitic, Stefan-Gabriel; Chobanova, Veronika; Chrzaszcz, Marcin; Chubykin, Alexsei; Ciambrone, Paolo; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collins, Paula; Colombo, Tommaso; Comerma-Montells, Albert; Contu, Andrea; Coombs, George; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Da Silva, Cesar Luiz; Dall'Occo, Elena; Dalseno, Jeremy; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Del Buono, Luigi; Dembinski, Hans Peter; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Nezza, Pasquale; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Douglas, Lauren; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Durante, Paolo; Durham, John Matthew; Dutta, Deepanwita; Dzhelyadin, Rustem; Dziewiecki, Michal; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fazzini, Davide; Federici, Luca; Ferguson, Dianne; Fernandez, Gerard; Fernandez Declara, Placido; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Lopes, Lino; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Funk, Wolfgang; Furfaro, Emiliano; Färber, Christian; Gabriel, Emmy; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, Vladimir; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Govorkova, Ekaterina; Grabowski, Jascha Peter; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greim, Roman; Griffith, Peter; Grillo, Lucia; Gruber, Lukas; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hamilton, Brian; Han, Xiaoxue; Hancock, Thomas Henry; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Hasse, Christoph; Hatch, Mark; He, Jibo; Hecker, Malte; Heinicke, Kevin; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hopchev, Plamen Hristov; Hu, Wenhua; Huang, Wenqian; Huard, Zachary; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hutchcroft, David; Ibis, Philipp; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kazeev, Nikita; Kecke, Matthieu; Keizer, Floris; Kelsey, Matthew; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Klimkovich, Tatsiana; Koliiev, Serhii; Kolpin, Michael; Kopecna, Renata; Koppenburg, Patrick; Kosmyntseva, Alena; Kotriakhova, Sofia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreps, Michal; Kress, Felix Johannes; Krokovny, Pavel; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Pei-Rong; Li, Tenglin; Li, Yiming; Li, Zhuoming; Liang, Xixin; Likhomanenko, Tatiana; Lindner, Rolf; Lionetto, Federica; Lisovskyi, Vitalii; Liu, Xuesong; Loh, David; Loi, Angelo; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Macko, Vladimir; Mackowiak, Patrick; Maddrell-Mander, Samuel; Maev, Oleg; Maguire, Kevin; Maisuzenko, Dmitrii; Majewski, Maciej Witold; Malde, Sneha; Malecki, Bartosz; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Marangotto, Daniele; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marinangeli, Matthieu; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurice, Emilie; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McNab, Andrew; McNulty, Ronan; Mead, James Vincent; Meadows, Brian; Meaux, Cedric; Meier, Frank; Meinert, Nis; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Millard, Edward James; Minard, Marie-Noelle; Minzoni, Luca; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Mombächer, Titus; Monroy, Igancio Alberto; Monteil, Stephane; Morandin, Mauro; Morello, Michael Joseph; Morgunova, Olga; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Thi Dung; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Nogay, Alla; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Ossowska, Anna; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palutan, Matteo; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Pereima, Dmitrii; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pietrzyk, Guillaume; Pikies, Malgorzata; Pinci, Davide; Pisani, Flavio; Pistone, Alessandro; Piucci, Alessio; Placinta, Vlad-Mihai; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poli Lener, Marco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Ponce, Sebastien; Popov, Alexander; Popov, Dmitry; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Pullen, Hannah Louise; Punzi, Giovanni; Qian, Wenbin; Qin, Jia-Jia; Quagliani, Renato; Quintana, Boris; Rachwal, Bartlomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Ratnikov, Fedor; Raven, Gerhard; Ravonel Salzgeber, Melody; Reboud, Meril; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Robbe, Patrick; Robert, Arnaud; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Ruiz Vidal, Joan; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarpis, Gediminas; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schreiner, HF; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepulveda, Eduardo Enrique; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Soares Lavra, Lais; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavomira; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stepanova, Margarita; Stevens, Holger; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Stramaglia, Maria Elena; Straticiuc, Mihai; Straumann, Ulrich; Sun, Jiayin; Sun, Liang; Swientek, Krzysztof; Syropoulos, Vasileios; Szumlak, Tomasz; Szymanski, Maciej Pawel; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Tourinho Jadallah Aoude, Rafael; Tournefier, Edwige; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Usachov, Andrii; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagner, Alexander; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Verlage, Tobias Anton; Vernet, Maxime; Vesterinen, Mika; Viana Barbosa, Joao Vitor; Vieira, Daniel; Vieites Diaz, Maria; Viemann, Harald; Vilasis-Cardona, Xavier; Vitti, Marcela; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Walsh, John; Wang, Jianchun; Wang, Yilong; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Weisser, Constantin; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Winn, Michael Andreas; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wyllie, Kenneth; Xie, Yuehong; Xu, Menglin; Xu, Qingnian; Xu, Zehua; Xu, Zhirui; Yang, Zhenwei; Yang, Zishuo; Yao, Yuezhe; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zheng, Yangheng; Zhu, Xianglei; Zhukov, Valery; Zonneveld, Jennifer Brigitta; Zucchelli, Stefano

    2017-01-01

    The difference between the $C\\!P$ asymmetries in the decays $\\varLambda_{c}^{+} \\to pK^{-}K^{+}$ and $\\varLambda_{c}^{+} \\to p\\pi^{-}\\pi^{+}$ is presented. Proton-proton collision data taken at centre-of-mass energies of $7$ and $8\\,\\mathrm{TeV}$ collected by the LHCb detector in 2011 and 2012 are used, corresponding to an integrated luminosity of $3\\,\\mathrm{fb}^{-1}$. The $\\varLambda_{c}^{+}$ candidates are reconstructed as part of the $\\varLambda_{b}^{0} \\to \\varLambda_{c}^{+}\\mu^{-}X$ decay chain. In order to maximize the cancellation of production and detection asymmetries in the difference, the final-state kinematic distributions of the two samples are aligned by applying phase-space-dependent weights to the \\mbox{$\\varLambda_{c}^{+} \\to p\\pi^{-}\\pi^{+}$} sample. This alters the definition of the integrated $C\\!P$ asymmetry to $A_{C\\!P}^{\\text{wgt}}(p\\pi^{-}\\pi^{+})$. Both samples are corrected for reconstruction and selection efficiencies across the five-dimensional $\\varLambda_{c}^{+}$ decay phase s...

  14. Measurement of the /sup 12/C(n,γ0)/sup 13/C cross section in the giant dipole resonance region

    International Nuclear Information System (INIS)

    August, R.A.; Weller, H.R.; Tilley, D.R.

    1987-01-01

    The /sup 12/C(n,γ 0 ) /sup 13/C excitation function at 90 0 has been measured for neutron energies from 6.5 to 18.5 MeV. Whereas previous measurements disagreed at the lower energies with a direct-semidirect capture calculation based on /sup 12/C(p,γ 0 ) /sup 13/N data, the present results, especially when the uncertainty in absolute cross section is considered, indicate reasonable qualitative agreement with the calculation

  15. Measurement and interpretation of momentum spectra of the inclusive reaction np→pX between 1.4 and 1.9GeV/c. Determination of cross sections for the np→pΔ330 channel

    International Nuclear Information System (INIS)

    Laville, J.-L.

    1976-01-01

    The creation of a high intensity beam of monokinetic neutrons obtained from stripping deuterons extracted from the synchrotron Saturne (C.E.N., Saclay) has allowed to measure with good statistical accuracy 43 momentum spectra of the final proton of the inclusive reaction np→pX at 1.39, 1.56, 1.73 and 1.90GeV/c (approximately 10 spectra per incident momentum). The final proton was analyzed with a magnetic spectrometer in the angular region between 0 and 20 deg in the laboratory. The set of results has been the object of two analyses: at first, the experimental spectra were compared with a pion exchange model modified by the off-shell parametrization of BENECKE-DURR-PILKUHN overall, this model correctly reproduces the measured spectra, both in form and absolute normalization. In the second analysis, the total and differential cross sections of the np→pΔ 33 0 channel were determined from the spectra measured using a subtraction procedure. The differential cross sections obtained in this way show an angular dependence that differs from the predictions of the pion exchange model. It is concluded that, at low energy, near its threshold, the reaction NN→NΔ 33 involves a set of more complex mechanisms than pion exchange alone, even if the latter remains dominant [fr

  16. Non-structural proteins P17 and P33 are involved in the assembly of the internal membrane-containing virus PRD1

    Energy Technology Data Exchange (ETDEWEB)

    Karttunen, Jenni; Mäntynen, Sari [Centre of Excellence in Biological Interactions, Department of Biological and Environmental Science and Nanoscience Center, University of Jyväskylä, P.O. Box 35, 40014 Jyväskylä (Finland); Ihalainen, Teemu O. [Stem Cells in Neurological Applications Group, BioMediTech, University of Tampere, Tampere (Finland); Bamford, Jaana K.H. [Centre of Excellence in Biological Interactions, Department of Biological and Environmental Science and Nanoscience Center, University of Jyväskylä, P.O. Box 35, 40014 Jyväskylä (Finland); Oksanen, Hanna M., E-mail: hanna.oksanen@helsinki.fi [Institute of Biotechnology and Department of Biosciences, University of Helsinki, Biocenter 2, P.O. Box 56 (Viikinkaari 5), FIN-00014 Helsinki (Finland)

    2015-08-15

    Bacteriophage PRD1, which has been studied intensively at the structural and functional levels, still has some gene products with unknown functions and certain aspects of the PRD1 assembly process have remained unsolved. In this study, we demonstrate that the phage-encoded non-structural proteins P17 and P33, either individually or together, complement the defect in a temperature-sensitive GroES mutant of Escherichia coli for host growth and PRD1 propagation. Confocal microscopy of fluorescent fusion proteins revealed co-localisation between P33 and P17 as well as between P33 and the host chaperonin GroEL. A fluorescence recovery after photobleaching assay demonstrated that the diffusion of the P33 fluorescent fusion protein was substantially slower in E. coli than theoretically calculated, presumably resulting from intermolecular interactions. Our results indicate that P33 and P17 function in procapsid assembly, possibly in association with the host chaperonin complex GroEL/GroES. - Highlights: • Two non-structural proteins of PRD1 are involved in the virus assembly. • P17 and P33 complement the defect in GroES of Escherichia coli. • P33 co-localises with GroEL and P17 in the bacterium. • Slow motion of P33 in the bacterium suggests association with cellular components.

  17. Increased Dietary Intake of Saturated Fatty Acid Heptadecanoic Acid (C17:0) Associated with Decreasing Ferritin and Alleviated Metabolic Syndrome in Dolphins

    Science.gov (United States)

    Venn-Watson, Stephanie K.; Parry, Celeste; Baird, Mark; Stevenson, Sacha; Carlin, Kevin; Daniels, Risa; Smith, Cynthia R.; Jones, Richard; Wells, Randall S.; Ridgway, Sam; Jensen, Eric D.

    2015-01-01

    Similar to humans, bottlenose dolphins (Tursiops truncatus) can develop metabolic syndrome and associated high ferritin. While fish and fish-based fatty acids may protect against metabolic syndrome in humans, findings have been inconsistent. To assess potential protective factors against metabolic syndrome related to fish diets, fatty acids were compared between two dolphin populations with higher (n = 30, Group A) and lower (n = 19, Group B) mean insulin (11 ± 12 and 2 ± 5 μIU/ml, respectively; P dolphins. Capelin, a common dietary fish for Group A, had no detectable C17:0, while pinfish and mullet, common in Group B’s diet, had C17:0 (41 and 67 mg/100g, respectively). When a modified diet adding 25% pinfish and/or mullet was fed to six Group A dolphins over 24 weeks (increasing the average daily dietary C17:0 intake from 400 to 1700 mg), C17:0 serum levels increased, high ferritin decreased, and blood-based metabolic syndrome indices normalized toward reference levels. These effects were not found in four reference dolphins. Further, higher total serum C17:0 was an independent and linear predictor of lower ferritin in dolphins in Group B dolphins. Among off the shelf dairy products tested, butter had the highest C17:0 (423mg/100g); nonfat dairy products had no detectable C17:0. We hypothesize that humans’ movement away from diets with potentially beneficial saturated fatty acid C17:0, including whole fat dairy products, could be a contributor to widespread low C17:0 levels, higher ferritin, and metabolic syndrome. PMID:26200116

  18. Photoionization of Xe inside C60: Atom-fullerene hybridization, giant cross-section enhancement, and correlation confinement resonances

    International Nuclear Information System (INIS)

    Madjet, Mohamed E.; Renger, Thomas; Hopper, Dale E.; McCune, Matthew A.; Chakraborty, Himadri S.; Rost, Jan-M.; Manson, Steven T.

    2010-01-01

    A theoretical study of the subshell photoionization of the Xe atom endohedrally confined in C 60 is presented. Powerful hybridization of the Xe 5s state with the bottom edge of C 60 π band is found that induces strong structures in the 5s ionization, causing the cross section to differ significantly from earlier results that omit this hybridization. The hybridization also affects the angular distribution asymmetry parameter of Xe 5p ionization near the Cooper minimum. The 5p cross section, on the other hand, is greatly enhanced by borrowing considerable oscillator strength from the C 60 giant plasmon resonance via the atom-fullerene dynamical interchannel coupling. Beyond the C 60 plasmon energy range the atomic subshell cross sections display confinement-induced oscillations in which, over the large 4d shape resonance region, the dominant 4d oscillations induce their ''clones'' in all degenerate weaker channels known as correlation confinement resonances.

  19. Measurement of the real part of the forward scattering amplitude in K/sup + -/p elastic scattering at 10. 4 and 14 GeV/c. [Differential cross sections, interference, coulomb and nuclear interactions

    Energy Technology Data Exchange (ETDEWEB)

    Carnegie, R K; Cashmore, R J; Davier, M; Leith, D W.G.S.; Richard, F; Schacht, P; Walden, P; Williams, S H [Stanford Linear Accelerator Center, Calif. (USA)

    1975-11-10

    The differential cross section for K/sup + -/p elastic scattering has been measured in the very low t region (0.003c. The interference effect observed between the Coulomb and the nuclear interaction has been used to determine ..cap alpha.., the ratio of real to imaginary part of the forward scattering amplitude. At 10.4 GeV/c the authors measure ..cap alpha..(K/sup +/p)=-0.21+-0.06 and ..cap alpha..(K/sup -/p)=0.08+-0.04, and at 14 GeV/c, ..cap alpha..(K/sup +/p)=-0.13+-0.03 and ..cap alpha..(K/sup -/p)=0.00+-0.04 in agreement with the predictions of dispersion theory calculations.

  20. Synthesis of organic substances labelled with 14C and 35S

    International Nuclear Information System (INIS)

    Pichat, L.

    1958-01-01

    After a brief history of the development of the Section des Molecules marquees of the French Atomic Energy Commission, the author gives an outline of the synthesis of the following labelled compounds: benzene 14 C-6; phenyl-p-fluorophenyl, thienyl-2 β alanines β 14 C; noradrenaline β 14 C (arterenol β 14 C), dotriacontane 14 C-16-17, aminoethane sulfinic acid (hypotaurine 35 S). (author) [fr

  1. Inclusive muon and b quark production cross sections in p bar p collisions at √s = 1.8 TeV

    International Nuclear Information System (INIS)

    Abachi, S.

    1995-07-01

    We report on the measurement of inclusive muon and b quark production by the D0 collaboration in p bar p collisions at √s = 1.8 TeV at the Fermilab Tevatron Collider. The results represent a refined analysis of the previously published 1992--93 data. We measure the muon cross section due to b quark decays over the kinematic range 4 T μ μ | T μ > 6 GeV/c and |y b | < 1.0

  2. Measurement of the cross-section ratio $\\sigma(\\chi_{c2})/\\sigma(\\chi_{c1})$ for prompt $\\chi_c$ production at $\\sqrt{s}=7$ TeV

    CERN Document Server

    INSPIRE-00258707; Abellan Beteta, C.; Adeva, B.; Adinolfi, M.; Adrover, C.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Alkhazov, G.; Alvarez Cartelle, P.; Alves Jr, A.A.; Amato, S.; Amhis, Y.; Anderson, J.; Appleby, R.B.; Aquines Gutierrez, O.; Archilli, F.; Arrabito, L.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Bachmann, S.; Back, J.J.; Bailey, D.S.; Balagura, V.; Baldini, W.; Barlow, R.J.; Barschel, C.; Barsuk, S.; Barter, W.; Bates, A.; Bauer, C.; Bauer, Th.; Bay, A.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Benayoun, M.; Bencivenni, G.; Benson, S.; Benton, J.; Bernet, R.; Bettler, M.O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P.M.; Blake, T.; Blanc, F.; Blanks, C.; Blouw, J.; Blusk, S.; Bobrov, A.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Bowcock, T.J.V.; Bozzi, C.; Brambach, T.; van den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N.H.; Brown, H.; Buchler-Germann, A.; Burducea, I.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Callot, O.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cattaneo, M.; Cauet, Ch.; Charles, M.; Charpentier, Ph.; Chiapolini, N.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P.E.L.; Clemencic, M.; Cliff, H.V.; Closier, J.; Coca, C.; Coco, V.; Cogan, J.; Collins, P.; Comerma-Montells, A.; Constantin, F.; Conti, G.; Contu, A.; Cook, A.; Coombes, M.; Corti, G.; Cowan, G.A.; Currie, R.; D'Almagne, B.; D'Ambrosio, C.; David, P.; David, P.N.Y.; De Bonis, I.; De Capua, S.; De Cian, M.; De Lorenzi, F.; de Miranda, J.M.; De Paula, L.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Degaudenzi, H.; Deissenroth, M.; Del Buono, L.; Deplano, C.; Derkach, D.; Deschamps, O.; Dettori, F.; Dickens, J.; Dijkstra, H.; Diniz Batista, P.; Bonal, F.Domingo; Donleavy, S.; Dordei, F.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Dzhelyadin, R.; Dziurda, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; van Eijk, D.; Eisele, F.; Eisenhardt, S.; Ekelhof, R.; Eklund, L.; Elsasser, Ch.; Elsby, D.; Esperante Pereira, D.; Esteve, L.; Falabella, A.; Fanchini, E.; Farber, C.; Fardell, G.; Farinelli, C.; Farry, S.; Fave, V.; Fernandez Albor, V.; Ferro-Luzzi, M.; Filippov, S.; Fitzpatrick, C.; Fontana, M.; Fontanelli, F.; Forty, R.; Frank, M.; Frei, C.; Frosini, M.; Furcas, S.; Gallas Torreira, A.; Galli, D.; Gandelman, M.; Gandini, P.; Gao, Y.; Garnier, J-C.; Garofoli, J.; Garra Tico, J.; Garrido, L.; Gascon, D.; Gaspar, C.; Gauvin, N.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gibson, V.; Gligorov, V.V.; Gobel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Grabalosa Gandara, M.; Graciani Diaz, R.; Granado Cardoso, L.A.; Grauges, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Haefeli, G.; Haen, C.; Haines, S.C.; Hampson, T.; Hansmann-Menzemer, S.; Harji, R.; Harnew, N.; Harrison, J.; Harrison, P.F.; He, J.; Heijne, V.; Hennessy, K.; Henrard, P.; Hernando Morata, J.A.; van Herwijnen, E.; Hicks, E.; Holubyev, K.; Hopchev, P.; Hulsbergen, W.; Hunt, P.; Huse, T.; Huston, R.S.; Hutchcroft, D.; Hynds, D.; Iakovenko, V.; Ilten, P.; Imong, J.; Jacobsson, R.; Jaeger, A.; Jahjah Hussein, M.; Jans, E.; Jansen, F.; Jaton, P.; Jean-Marie, B.; Jing, F.; John, M.; Johnson, D.; Jones, C.R.; Jost, B.; Kaballo, M.; Kandybei, S.; Karacson, M.; Karbach, T.M.; Keaveney, J.; Kenyon, I.R.; Kerzel, U.; Ketel, T.; Keune, A.; Khanji, B.; Kim, Y.M.; Knecht, M.; Koppenburg, P.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kruzelecki, K.; Kucharczyk, M.; Kvaratskheliya, T.; La Thi, V.N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R.W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J.P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leroy, O.; Lesiak, T.; Li, L.; Li Gioi, L.; Lieng, M.; Liles, M.; Lindner, R.; Linn, C.; Liu, B.; Liu, G.; Lopes, J.H.; Lopez Asamar, E.; Lopez-March, N.; Lu, H.; Luisier, J.; Raighne, A.Mac; Machefert, F.; Machikhiliyan, I.V.; Maciuc, F.; Maev, O.; Magnin, J.; Malde, S.; Mamunur, R.M.D.; Manca, G.; Mancinelli, G.; Mangiafave, N.; Marconi, U.; Marki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martin, L.; Martin Sanchez, A.; Martinez Santos, D.; Massafferri, A.; Mathe, Z.; Matteuzzi, C.; Matveev, M.; Maurice, E.; Maynard, B.; Mazurov, A.; McGregor, G.; McNulty, R.; Mclean, C.; Meissner, M.; Merk, M.; Merkel, J.; Messi, R.; Miglioranzi, S.; Milanes, D.A.; Minard, M.N.; Molina Rodriguez, J.; Monteil, S.; Moran, D.; Morawski, P.; Mountain, R.; Mous, I.; Muheim, F.; Muller, K.; Muresan, R.; Muryn, B.; Muster, B.; Musy, M.; Mylroie-Smith, J.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Nedos, M.; Needham, M.; Neufeld, N.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Nikitin, N.; Nomerotski, A.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Orlandea, M.; Otalora Goicochea, J.M.; Owen, P.; Pal, K.; Palacios, J.; Palano, A.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C.J.; Passaleva, G.; Patel, G.D.; Patel, M.; Paterson, S.K.; Patrick, G.N.; Patrignani, C.; Pavel-Nicorescu, C.; Pazos Alvarez, A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perego, D.L.; Perez Trigo, E.; Perez-Calero Yzquierdo, A.; Perret, P.; Perrin-Terrin, M.; Pessina, G.; Petrella, A.; Petrolini, A.; Phan, A.; Picatoste Olloqui, E.; Pie Valls, B.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Plackett, R.; Playfer, S.; Plo Casasus, M.; Polok, G.; Poluektov, A.; Polycarpo, E.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; du Pree, T.; Prisciandaro, J.; Pugatch, V.; Puig Navarro, A.; Qian, W.; Rademacker, J.H.; Rakotomiaramanana, B.; Rangel, M.S.; Raniuk, I.; Raven, G.; Redford, S.; Reid, M.M.; dos Reis, A.C.; Ricciardi, S.; Rinnert, K.; Roa Romero, D.A.; Robbe, P.; Rodrigues, E.; Rodrigues, F.; Rodriguez Perez, P.; Rogers, G.J.; Roiser, S.; Romanovsky, V.; Rosello, M.; Rouvinet, J.; Ruf, T.; Ruiz, H.; Sabatino, G.; Saborido Silva, J.J.; Sagidova, N.; Sail, P.; Saitta, B.; Salzmann, C.; Sannino, M.; Santacesaria, R.; Santamarina Rios, C.; Santinelli, R.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schaack, P.; Schiller, M.; Schleich, S.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M.H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Seyfert, P.; Shao, B.; Shapkin, M.; Shapoval, I.; Shatalov, P.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, O.; Shevchenko, V.; Shires, A.; Coutinho, R.Silva; Skwarnicki, T.; Smith, A.C.; Smith, N.A.; Smith, E.; Sobczak, K.; Soler, F.J.P.; Solomin, A.; Soomro, F.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stoica, S.; Stone, S.; Storaci, B.; Straticiuc, M.; Straumann, U.; Subbiah, V.K.; Swientek, S.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Teodorescu, E.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tran, M.T.; Tsaregorodtsev, A.; Tuning, N.; Garcia, M.Ubeda; Ukleja, A.; Urquijo, P.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vecchi, S.; Velthuis, J.J.; Veltri, M.; Viaud, B.; Videau, I.; Vilasis-Cardona, X.; Visniakov, J.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Voss, H.; Wandernoth, S.; Wang, J.; Ward, D.R.; Watson, N.K.; Webber, A.D.; Websdale, D.; Whitehead, M.; Wiedner, D.; Wiggers, L.; Wilkinson, G.; Williams, M.P.; Williams, M.; Wilson, F.F.; Wishahi, J.; Witek, M.; Witzeling, W.; Wotton, S.A.; Wyllie, K.; Xie, Y.; Xing, F.; Xing, Z.; Yang, Z.; Young, R.; Yushchenko, O.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W.C.; Zhang, Y.; Zhelezov, A.; Zhong, L.; Zverev, E.; Zvyagin, A.

    2013-07-16

    The prompt production of the charmonium $\\chi_{c1}$ and $\\chi_{c2}$ mesons has been studied in proton-proton collisions at the Large Hadron Collider at a centre-of-mass energy of $\\sqrt{s}=7$~TeV. The $\\chi_c$ mesons are identified through their decays $\\chi_c\\,\\rightarrow\\,J/\\psi\\,\\gamma$ with $J/\\psi\\,\\rightarrow\\,\\mu^+\\,\\mu^-$ using 36~$\\mathrm{pb^{-1}}$ of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for the two $\\chi_c$ spin states, $\\sigma(\\chi_{c2})\\,/\\,\\sigma(\\chi_{c1})$, has been determined as a function of the $J/\\psi$ transverse momentum, $p_{\\mathrm{T}}^{J/\\psi}$, in the range from 2 to 15~GeV/$c$. The results are in agreement with the next-to-leading order non-relativistic QCD model at high $p_{\\mathrm{T}}^{J/\\psi}$ and lie consistently above the pure leading-order colour singlet prediction.

  3. Exploration and pharmacokinetic profiling of phenylalanine based carbamates as novel substance p 1-7 analogues.

    Science.gov (United States)

    Fransson, Rebecca; Nordvall, Gunnar; Bylund, Johan; Carlsson-Jonsson, Anna; Kratz, Jadel M; Svensson, Richard; Artursson, Per; Hallberg, Mathias; Sandström, Anja

    2014-12-11

    The bioactive metabolite of Substance P, the heptapeptide SP1-7 (H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-OH), has been shown to attenuate signs of hyperalgesia in diabetic mice, which indicate a possible use of compounds targeting the SP1-7 binding site as analgesics for neuropathic pain. Aiming at the development of drug-like SP1-7 peptidomimetics we have previously reported on the discovery of H-Phe-Phe-NH2 as a high affinity lead compound. Unfortunately, the pharmacophore of this compound was accompanied by a poor pharmacokinetic (PK) profile. Herein, further lead optimization of H-Phe-Phe-NH2 by substituting the N-terminal phenylalanine for a benzylcarbamate group giving a new type of SP1-7 analogues with good binding affinities is reported. Extensive in vitro as well as in vivo PK characterization is presented for this compound. Evaluation of different C-terminal functional groups, i.e., hydroxamic acid, acyl sulfonamide, acyl cyanamide, acyl hydrazine, and oxadiazole, suggested hydroxamic acid as a bioisosteric replacement for the original primary amide.

  4. Search for charm in 250 GeV/c π-p interactions

    International Nuclear Information System (INIS)

    Bogert, D.; Hanft, R.; Albright, J.R.

    1975-10-01

    A study was made of the reaction π - + p at 250 GeV/c in order to search for charmed particles. Cross sections, effective mass distributions, and an upper limit for each decay mode were found. However, no evidence was found for charmed particles

  5. Nucleus--nucleus total cross sections for light nuclei at 1.55 and 2.89 GeV/C/nucleon

    International Nuclear Information System (INIS)

    Jaros, J.A.

    1975-11-01

    Total cross sections have been measured for protons, deuterons, alphas, and 12 C on hydrogen, deuterium, helium, and carbon targets at 1.55 and 2.89 GeV/c/nucleon using the ''good geometry'' transmission method. In addition, the inelastic cross sections and elastic slope parameters were measured for reactions initiated by deuterons, alphas, and 12 C. The factorization relation sigma/sub T/(AA) = sigma/sub T/(AB) 2 /sigma/sub T/(BB) is violated for some of these reactions. The results generally agree with Glauber theory predictions except in their detailed energy behavior. It is found that sigma/sub T/ approximately equal to 144 (A/sub T//sup 1 / 3 / + A/sub P//sup 1 / 3 / - 1.48) 2 and sigma/sub IN/ approximately equal to 78 (A/sub T//sup 1 / 3 / + A/sub P//sup 1 / 3 / - 1.25) 2 , where A/sub T/(A/sub P/) is the atomic mass number of the target (projectile) and the cross sections are given in mb

  6. Longitudinal double-spin asymmetry and cross section for inclusive jet production in polarized proton collisions at square root of s = 200 GeV.

    Science.gov (United States)

    Abelev, B I; Aggarwal, M M; Ahammed, Z; Amonett, J; Anderson, B D; Anderson, M; Arkhipkin, D; Averichev, G S; Bai, Y; Balewski, J; Barannikova, O; Barnby, L S; Baudot, J; Bekele, S; Belaga, V V; Bellingeri-Laurikainen, A; Bellwied, R; Benedosso, F; Bhardwaj, S; Bhasin, A; Bhati, A K; Bichsel, H; Bielcik, J; Bielcikova, J; Bland, L C; Blyth, S-L; Bonner, B E; Botje, M; Bouchet, J; Brandin, A V; Bravar, A; Burton, T P; Bystersky, M; Cadman, R V; Cai, X Z; Caines, H; Sánchez, M Calderón de la Barca; Castillo, J; Catu, O; Cebra, D; Chajecki, Z; Chaloupka, P; Chattopadhyay, S; Chen, H F; Chen, J H; Cheng, J; Cherney, M; Chikanian, A; Christie, W; Coffin, J P; Cormier, T M; Cosentino, M R; Cramer, J G; Crawford, H J; Das, D; Das, S; Dash, S; Daugherity, M; de Moura, M M; Dedovich, T G; Dephillips, M; Derevschikov, A A; Didenko, L; Dietel, T; Djawotho, P; Dogra, S M; Dong, W J; Dong, X; Draper, J E; Du, F; Dunin, V B; Dunlop, J C; Mazumdar, M R Dutta; Eckardt, V; Edwards, W R; Efimov, L G; Emelianov, V; Engelage, J; Eppley, G; Erazmus, B; Estienne, M; Fachini, P; Fatemi, R; Fedorisin, J; Filip, P; Finch, E; Fine, V; Fisyak, Y; Fu, J; Gagliardi, C A; Gaillard, L; Ganti, M S; Ghazikhanian, V; Ghosh, P; Gonzalez, J E; Gorbunov, Y G; Gos, H; Grebenyuk, O; Grosnick, D; Guertin, S M; Guimaraes, K S F F; Gupta, N; Gutierrez, T D; Haag, B; Hallman, T J; Hamed, A; Harris, J W; He, W; Heinz, M; Henry, T W; Hepplemann, S; Hippolyte, B; Hirsch, A; Hjort, E; Hoffman, A M; Hoffmann, G W; Horner, M J; Huang, H Z; Huang, S L; Hughes, E W; Humanic, T J; Igo, G; Jacobs, P; Jacobs, W W; Jakl, P; Jia, F; Jiang, H; Jones, P G; Judd, E G; Kabana, S; Kang, K; Kapitan, J; Kaplan, M; Keane, D; Kechechyan, A; Khodyrev, V Yu; Kim, B C; Kiryluk, J; Kisiel, A; Kislov, E M; Klein, S R; Kocoloski, A; Koetke, D D; Kollegger, T; Kopytine, M; Kotchenda, L; Kouchpil, V; Kowalik, K L; Kramer, M; Kravtsov, P; Kravtsov, V I; Krueger, K; Kuhn, C; Kulikov, A I; Kumar, A; Kuznetsov, A A; Lamont, M A C; Landgraf, J M; Lange, S; LaPointe, S; Laue, F; Lauret, J; Lebedev, A; Lednicky, R; Lee, C-H; Lehocka, S; LeVine, M J; Li, C; Li, Q; Li, Y; Lin, G; Lin, X; Lindenbaum, S J; Lisa, M A; Liu, F; Liu, H; Liu, J; Liu, L; Liu, Z; Ljubicic, T; Llope, W J; Long, H; Longacre, R S; Love, W A; Lu, Y; Ludlam, T; Lynn, D; Ma, G L; Ma, J G; Ma, Y G; Magestro, D; Mahapatra, D P; Majka, R; Mangotra, L K; Manweiler, R; Margetis, S; Markert, C; Martin, L; Matis, H S; Matulenko, Yu A; McClain, C J; McShane, T S; Melnick, Yu; Meschanin, A; Millane, J; Miller, M L; Minaev, N G; Mioduszewski, S; Mironov, C; Mischke, A; Mishra, D K; Mitchell, J; Mohanty, B; Molnar, L; Moore, C F; Morozov, D A; Munhoz, M G; Nandi, B K; Nattrass, C; Nayak, T K; Nelson, J M; Netrakanti, P K; Nogach, L V; Nurushev, S B; Odyniec, G; Ogawa, A; Okorokov, V; Oldenburg, M; Olson, D; Pachr, M; Pal, S K; Panebratsev, Y; Panitkin, S Y; Pavlinov, A I; Pawlak, T; Peitzmann, T; Perevoztchikov, V; Perkins, C; Peryt, W; Phatak, S C; Picha, R; Planinic, M; Pluta, J; Poljak, N; Porile, N; Porter, J; Poskanzer, A M; Potekhin, M; Potrebenikova, E; Potukuchi, B V K S; Prindle, D; Pruneau, C; Putschke, J; Rakness, G; Raniwala, R; Raniwala, S; Ray, R L; Razin, S V; Reinnarth, J; Relyea, D; Ridiger, A; Ritter, H G; Roberts, J B; Rogachevskiy, O V; Romero, J L; Rose, A; Roy, C; Ruan, L; Russcher, M J; Sahoo, R; Sakuma, T; Salur, S; Sandweiss, J; Sarsour, M; Sazhin, P S; Schambach, J; Scharenberg, R P; Schmitz, N; Seger, J; Selyuzhenkov, I; Seyboth, P; Shabetai, A; Shahaliev, E; Shao, M; Sharma, M; Shen, W Q; Shimanskiy, S S; Sichtermann, E P; Simon, F; Singaraju, R N; Smirnov, N; Snellings, R; Sood, G; Sorensen, P; Sowinski, J; Speltz, J; Spinka, H M; Srivastava, B; Stadnik, A; Stanislaus, T D S; Stock, R; Stolpovsky, A; Strikhanov, M; Stringfellow, B; Suaide, A A P; Sugarbaker, E; Sumbera, M; Sun, Z; Surrow, B; Swanger, M; Symons, T J M; Szanto de Toledo, A; Tai, A; Takahashi, J; Tang, A H; Tarnowsky, T; Thein, D; Thomas, J H; Timmins, A R; Timoshenko, S; Tokarev, M; Trainor, T A; Trentalange, S; Tribble, R E; Tsai, O D; Ulery, J; Ullrich, T; Underwood, D G; Buren, G Van; van der Kolk, N; van Leeuwen, M; Molen, A M Vander; Varma, R; Vasilevski, I M; Vasiliev, A N; Vernet, R; Vigdor, S E; Viyogi, Y P; Vokal, S; Voloshin, S A; Waggoner, W T; Wang, F; Wang, G; Wang, J S; Wang, X L; Wang, Y; Watson, J W; Webb, J C; Westfall, G D; Wetzler, A; Whitten, C; Wieman, H; Wissink, S W; Witt, R; Wood, J; Wu, J; Xu, N; Xu, Q H; Xu, Z; Yepes, P; Yoo, I-K; Yurevich, V I; Zhan, W; Zhang, H; Zhang, W M; Zhang, Y; Zhang, Z P; Zhao, Y; Zhong, C; Zoulkarneev, R; Zoulkarneeva, Y; Zubarev, A N; Zuo, J X

    2006-12-22

    We report a measurement of the longitudinal double-spin asymmetry A(LL) and the differential cross section for inclusive midrapidity jet production in polarized proton collisions at square root of s = 200 GeV. The cross section data cover transverse momenta 5 < pT < 50 GeV/c and agree with next-to-leading order perturbative QCD evaluations. The A(LL) data cover 5 < pT < 17 GeV/c and disfavor at 98% C.L. maximal positive gluon polarization in the polarized nucleon.

  7. Q.C.D. estimates of hadronic cross sections

    International Nuclear Information System (INIS)

    Navelet, H.; Peschanski, R.

    1983-03-01

    Estimates for hadron-hadron cross-sections are made using the leading log approximation of Q.C.D. The rise of the total inelastic pp cross-sections at high energy is reproduced, thanks to the competition between the small parton-parton interaction and the large multiplicity of gluons predicted by Q.C.D

  8. 12C(n , 2 n )11C cross section from threshold to 26.5 MeV

    Science.gov (United States)

    Yuly, M.; Eckert, T.; Hartshaw, G.; Padalino, S. J.; Polsin, D. N.; Russ, M.; Simone, A. T.; Brune, C. R.; Massey, T. N.; Parker, C. E.; Fitzgerald, R.; Sangster, T. C.; Regan, S. P.

    2018-02-01

    The 12C(n ,2 n )11C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3H(d ,n )4He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β+ decay of 11C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1H(n ,p ) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.

  9. 28 CFR 55.6 - Coverage under section 203(c).

    Science.gov (United States)

    2010-07-01

    ... THE VOTING RIGHTS ACT REGARDING LANGUAGE MINORITY GROUPS Nature of Coverage § 55.6 Coverage under section 203(c). (a) Coverage formula. There are four ways in which a political subdivision can become subject to section 203(c). 2 2 The criteria for coverage are contained in section 203(b). (1) Political...

  10. P-glycoprotein confers acquired resistance to 17-DMAG in lung cancers with an ALK rearrangement

    International Nuclear Information System (INIS)

    Kim, Hee Joung; Lee, Kye Young; Kim, Young Whan; Choi, Yun Jung; Lee, Jung-Eun; Choi, Chang Min; Baek, In-Jeoung; Rho, Jin Kyung; Lee, Jae Cheol

    2015-01-01

    Because anaplastic lymphoma kinase (ALK) is dependent on Hsp90 for protein stability, Hsp90 inhibitors are effective in controlling growth of lung cancer cells with ALK rearrangement. We investigated the mechanism of acquired resistance to 17-(Dimethylaminoethylamino)-17-demethoxygeldanamycin (17-DMAG), a geldanamycin analogue Hsp90 inhibitor, in H3122 and H2228 non-small cell lung cancer cell lines with ALK rearrangement. Resistant cell lines (H3122/DR-1, H3122/DR-2 and H2228/DR) were established by repeated exposure to increasing concentrations of 17-DMAG. Mechanisms for resistance by either NAD(P)H/quinone oxidoreductase 1 (NQO1), previously known as a factor related to 17-DMAG resistance, or P-glycoprotein (P-gp; ABCB1/MDR1) were queried using RT-PCR, western blot analysis, chemical inhibitors, the MTT cell proliferation/survival assay, and cellular efflux of rhodamine 123. The resistant cells showed no cross-resistance to AUY922 or ALK inhibitors, suggesting that ALK dependency persists in cells with acquired resistance to 17-DMAG. Although expression of NQO1 was decreased in H3122/DR-1 and H3122/DR-2, NQO1 inhibition by dicumarol did not affect the response of parental cells (H2228 and H3122) to 17-DMAG. Interestingly, all resistant cells showed the induction of P-gp at the protein and RNA levels, which was associated with an increased efflux of the P-gp substrate rhodamine 123 (Rho123). Transfection with siRNA directed against P-gp or treatment with verapamil, an inhibitor of P-gp, restored the sensitivity to the drug in all cells with acquired resistance to 17-DMAG. Furthermore, we also observed that the growth-inhibitory effect of 17-DMAG was decreased in A549/PR and H460/PR cells generated to over-express P-gp by long-term exposure to paclitaxel, and these cells recovered their sensitivity to 17-DMAG through the inhibition of P-gp. P-gp over-expression is a possible mechanism of acquired resistance to 17-DMAG in cells with ALK rearrangement. The online

  11. Comet 17P/Holmes: Possibility of a CO driven explosion

    Science.gov (United States)

    Kossacki, Konrad J.; Szutowicz, Slawomira

    2011-04-01

    This work is a continuation of our previous paper about brightening of Comet 17P/Holmes (Kossacki, K.J., Szutowicz, S. [2010]. Icarus 207, 320-340). In that paper we presented results of simulations indicating that the nonuniform crystallization of amorphous water ice itself is probably not sufficient for an explosion. In the present work we investigate the possibility that the explosion is caused by a rapid sublimation of the CO ice leading to the rise of gas pressure above the tensile strength of the nucleus. We simulated evolution of a model nucleus in the orbit of Comet 17P/Holmes. The nucleus is composed of water ice, carbon monoxide ice and dust and has the shape of an elongated ellipsoid. The simulations include crystallization of amorphous ice in the nucleus, changes of the dust mantle thickness, and sublimation of the CO ice. In our model CO is mantling grains composed of dust and amorphous water ice. Orientation of the nuclear spin axis in space is the same as derived in Moreno et al. (Moreno, F., Ortiz, J.L., Santos-Sanz, P., Morales, N., Vidal-Nunez, M.J., Lara, L.M., Gutierrez, P.J. [2008]. Astrophys. J. 677, L63-L66) for Comet Holmes during recent brightening event. Hence, the angle between the orbital and the equatorial planes of the comet is I = 95°, and the cometocentric solar longitude at perihelion is Φ = 210°. The calculations are performed for the south pole being the sub-solar point close to time of the outburst. Our computations indicate, that the CO pressure within the comet nucleus can rise to high values. When the layer between the dust mantle and the crystallization front of the amorphous water ice is very fine grained, few microns in radius, the CO pressure within the nucleus can exceed 10 kPa. This value is the lowest estimate for the tensile strength of the nucleus of Comet Holmes (Reach, W.T., Vaubaillon, J., Lisse, C.M., Holloway, M., Rho, J. [2010]. Icarus 208, 276-292). Hence, when the gas pressure reaches this value the nucleus

  12. Structure effects in polarization and cross sections for A(p, p’)X inelastic reactions on {sup 40}Ca and {sup 12}C nuclei at 1 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Miklukho, O. V., E-mail: miklukho-ov@pnpi.rncki.ru; Kisselev, A. Yu., E-mail: kisselev@mail.desy.de; Amalsky, G. M.; Andreev, V. A.; Gavrilov, G. E.; Izotov, A. A.; Kozlenko, N. G.; Kravchenko, P. V.; Levchenko, M. P.; Novinskiy, D. V.; Prokofiev, A. N., E-mail: prokofiev-an@pnpi.rncki.ru; Shvedchikov, A. V.; Trush, S. I.; Zhdanov, A. A. [National Research Centre Kurchatov Institute, Petersburg Nuclear Physics Institute (Russian Federation)

    2017-03-15

    The polarization of secondary protons in the (p, p’) inelastic reactions on {sup 40}Ca and {sup 12}C nuclei at the initial proton energy of 1 GeV was measured over a wide range of scattered-proton momenta at a laboratory angle of Θ = 21°. The reaction cross sections were also measured. Scattered protons were detected by means of magnetic spectrometer equipped with a polarimeter based on multiwire-proportional chambers. A structure in the polarization and cross-section data, which is probably related to scattering off nucleon correlations in the nuclei involved, was observed.

  13. Nuclear breakup of 17Ne and its two-proton halo structure

    Energy Technology Data Exchange (ETDEWEB)

    Wamers, Felix; Aumann, Thomas [Institut fuer Kernphysik, TU Darmstadt (Germany); Bertulani, Carlos [Texas A and M University-Commerce, Commerce (United States); Chulkov, Leonid; Heil, Michael; Simon, Haik [Kernreaktionen und Nukleare Astrophysik, GSI, Darmstadt (Germany); Marganiec, Justyna [Extreme Matter Institute, GSI, Darmstadt (Germany); JINA, Notre Dame (United States); Plag, Ralf [Kernreaktionen und Nukleare Astrophysik, GSI, Darmstadt (Germany); Goethe Universitaet, Frankfurt am Main (Germany); Collaboration: R3B-Collaboration

    2012-07-01

    {sup 17}Ne is a proton-dripline nucleus that has raised interest in nuclear-structure physics in recent years. As a ({sup 15}O+2p) Borromean 3-body system, it is often considered to be a 2-proton-halo nucleus, yet lacking concluding experimental quantification of structure. We have studied breakup reactions of 500 AMeV {sup 17}Ne secondary beams in inverse kinematics using the R3B-LAND setup at GSI. The foci were on (p,2p) quasi-free scattering on a CH{sub 2} target, and on one-proton-knockout reactions on a carbon target. Recoil protons have been detected with Si-Strip detectors and a surrounding 4{pi} NaI spectrometer. Furthermore, projectile-like forward protons after one-proton knockout from {sup 17}Ne have been measured in coincidence with the {sup 15}O residual core. The resulting relative-energy spectrum of the unbound {sup 16}F, as well as proton-removal cross sections with CH{sub 2} and C targets, and the transverse-momentum distributions of the residual fragments are presented. Conclusions on the ground-state structure of {sup 17}Ne are discussed.

  14. Neutron fragmentation in the reaction pn to pX at 19 GeV/c

    CERN Document Server

    Bakken, V; Lundborg, P; Makela, J; Pimiä, M; Selldén, B; Sundell, E; Tuominiemi, J

    1979-01-01

    Data on the reaction pn to pX are extracted from a pd experiment in the CERN 2 m DBC at 10 GeV/c. The cross-section for neutron fragmentation events with mod t mod <1 (GeV/c)/sup 2/ determined and compared with data at high energies at fixed M/sub x//sup 2//s and t. The cross-section can be described with the triple-Regge formula taking into account only the pion exchange contributions, i.e. the pi pi P and pi pi R terms. A leading-particle effect consistent with the pion exchange model is observed in the longitudinal-momentum distribution of the negative pions in the final state of the reaction pn to pX, when transformed to the rest frame of the recoiling system X. (10 refs).

  15. Use of an immunodominant p17 antigenic fraction of Neospora caninum in detection of antibody response in cattle

    Directory of Open Access Journals (Sweden)

    Gema Álvarez García

    2006-08-01

    Full Text Available A Neospora caninum 17 kDa protein fraction (p17 has been described as an immunodominant antigen (IDA under reducing and non-reducing conditions. The aim of the present study was to investigate the diagnostic utility of p17 in cattle. In order to achieve this, p17 was purified by electroelution from whole N. caninum tachyzoite soluble extract and a p17-based Western blot (WB-p17 was developed. The p17 recognition was measured by densitometry and expressed as OD values to check the validity of the WB-p17. A total of 131 sera including sequential samples from naturally- and experimentally-infected calves and breeding cattle were analysed by WB-p17 and compared with IFAT using whole formalin-fixed tachyzoites as a reference test. The results obtained highlight the feasibility of using the N. caninum p17 in a diagnostic test in cattle. Firstly, the assay based on the p-17 antigen discriminated between known positive and negative sera from different cattle populations, breeding cattle and calves. Secondly, the p17 antigen detected fluctuations in the antibody levels and seroconversion in naturally- and experimentally-infected cattle. Significant differences in p-17 antigen recognition were observed between naturally infected aborting and non-aborting cattle, as well as significant antibody fluctuations over time in experimentally infected cattle, which varied between groups. Furthermore, the results obtained with WB-p17 are in accordance with the results obtained with the IFAT, as high agreement values were obtained when all bovine subpopulations were included (kappa = 0.86.

  16. Quark (diquark) fragmentation in soft π-p interactions at P=40 GeV/c

    International Nuclear Information System (INIS)

    Didenko, L.A.; Grishin, V.G.; Kuznetsov, V.A.

    1984-01-01

    The quark and diquark fragmentation into π +- -, K 0 -mesons and Λ-hyperons in soft π - p-interactions at 40 GeV/c is studied. Fragmentation Dsup(πsup(+-)) (Xsub(F)) and invariant Fsup(πsup(+-)) (Xsub(F)) functions are compared with analogous data on ν(anti ν)p - interactions. It is shown that a good agreement exists in the region Xsub(F) > or approximately 0.15 for these different processes. The Xsub(E)-dependence of the quark and diquark fragmentation function for neutral kaons is similar to that in e + e - annihilation. The pickup probability of strange s(anti s) quark (lambda sub(s)) and diquark (lambda sub(qq)) relative to u(anti u) and d(anti d) quarks from the sea has been found to be equal to lambda sub(s)=0.17 and lambda sub(qq)=0.14+-0.03

  17. 29 CFR 779.504 - The retailer and section 12(c).

    Science.gov (United States)

    2010-07-01

    ... Child Labor Provisions § 779.504 The retailer and section 12(c). Section 12(c) was amended in 1961 to prohibit the employment of oppressive child labor in any enterprise engaged in commerce or in the... comply with section 12(c) of the child labor provisions of the Act. As stated in § 779.503, compliance...

  18. Analyzing power measurements for the /sup 13/C(p vector,d)/sup 12/C reaction at 200 and 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Liljestrand, R P; Cameron, J M; Hutcheon, D A; MacDonald, R; McDonald, W J; Miller, C A; Olsen, W C [Alberta Univ., Edmonton (Canada); Kraushaar, J J; Shepard, J R [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; Rogers, J G [British Columbia Univ., Vancouver (Canada). TRIUMF Facility

    1981-02-26

    Cross sections and analyzing powers for the /sup 13/C(p vector,d) reaction have been measured at 200 and 400 MeV to the O/sup +/, ground state and 2/sup +/, 4.44 MeV state of /sup 12/C. While the cross sections are rather structureless, DWBA calculations in exact finite range account well for both the magnitude and shape of the angular distributions. On the other hand, the measured analyzing powers are in serious disagreement with the DWBA calculations.

  19. Measurements of Cross Sections and Charged Pion Spectra in Proton-Carbon Interactions at 31 GeV/c

    CERN Document Server

    Abgrall, N; Andrieu, B; Anticic, T; Antoniou, N; Argyriades, J; Asryan, A G; Baatar, B; Blondel, A; Blumer, J; Bogusz, M; Boldizsar, L; Bravar, A; Brooks, W; Brzychczyk, J; Bubak, A; Bunyatov, S A; Busygina, O; Cetner, T; Choi, K -U; Christakoglou, P; Chung, P; Czopowicz, T; Davis, N; Diakonos, F; Di Luise, S; Dominik, W; Dumarchez, J; Engel, R; Ereditato, A; Esposito, L S; Feofilov, G A; Fodor, Z; Ferrero, A; Fulop, A; Garrido, X; Gazdzicki, M; Golubeva, M; Grebieszkow, K; Grzeszczuk, A; Guber, F; Hakobyan, H; Hasegawa, T; Igolkin, S; Ivanov, A S; Ivanov, Y; Ivashkin, A; Kadija, K; Kapoyannis, A; Katrynska, N N; Kielczewska, D; Kikola, D; Kim, J -H; Kirejczyk, M; Kisiel, J; Kobayashi, T; Kochebina, O; Kolesnikov, V I; Kolev, D; Kondratiev, V P; Korzenev, A; Kowalski, S; Kuleshov, S; Kurepin, A; Lacey, R; Lagoda, J; Laszlo, A; Lyubushkin, V V; Mackowiak, M; Majka, Z; Malakhov, A I; Marchionni, A; Marcinek, A; Maris, I; Marin, V; Matulewicz, T; Matveev, V; Melkumov, G L; Meregaglia, A; Messina, M; Mrowczynski, St; Murphy, S; Nakadaira, T; Naumenko, P A; Nishikawa, K; Palczewski, T; Palla, G; Panagiotou, A D; Peryt, W; Petukhov, O; Planeta, R.; Pluta, J; Popov, B A; Posiadala, M; Pu lawski, S; Rauch, W; Ravonel, M; Renfordt, R; Robert, A; Rohrich, D; Rondio, E; Rossi, B; Roth, M; Rubbia, A; Rybczynski, M; Sadovsky, A; Sakashita, K; Sekiguchi, T; Seyboth, P; Shibata, M; Sissakian, A N; Skrzypczak, E; Slodkowski, M.; Sorin, A S; Staszel, P; Stefanek, G; Stepaniak, J; Strabel, C; Strobele, H; Susa, T; Szaik, P; Szuba, M; Tada, M; Taranenko, A; Tsenov, R; Ulrich, R; Unger, M; Vassiliou, M; Vechernin, V V; Vesztergombi, G; Wilczek, A; lodarczyk, Z W; Wojtaszek, A; Yi, J -G; Yoo, I -K; Zipper, W

    2011-01-01

    Interaction cross sections and charged pion spectra in p+C interactions at 31 GeV/c were measured with the large acceptance NA61/SHINE spectrometer at the CERN SPS. These data are required to improve predictions of the neutrino flux for the T2K long baseline neutrino oscillation experiment in Japan. A set of data collected during the first NA61/SHINE run in 2007 with an isotropic graphite target with a thickness of 4% of a nuclear interaction length was used for the analysis. The measured p+C inelastic and production cross sections are 257.2 +- 1.9 +- 8.9 mb and 229.3 +- 1.9 +- 9.0 mb, respectively. Inclusive production cross sections for negatively and positively charged pions are presented as a function of laboratory momentum in 10 intervals of the laboratory polar angle covering the range from 0 up to 420 mrad. The spectra are compared with predictions of several hadron production models.

  20. 17 CFR 240.36a1-1 - Exemption from Section 7 for OTC derivatives dealers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from Section 7 for OTC derivatives dealers. 240.36a1-1 Section 240.36a1-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, SECURITIES EXCHANGE ACT OF 1934...

  1. A Rapid ELISA Method for 17, 20b-dihydroxy-4-pregenen-3-one (17,20bP Hormone Using Acetylcholinesterase Enzyme as Tracer

    Directory of Open Access Journals (Sweden)

    M Ebrahimi

    2004-06-01

    Full Text Available Background: During the past 15 years Enzyme Linked ImmunoSorbent Assay (ELISA has been described as an alternative to radioimmunoassay for steroid detection. In addition to gonads, sperm itself is capable of producing reduced progesterone metabolites. In this study we introduced a method to extend the applicability of previous measures by describing a general preparation procedure for the enzyme label which is applicable to any steroid hormone. Methods: A simple and rapid Enzyme Linked Immunosorbant Assay (ELISA is described and validated for 17,20β- dihydroxy-4-pregnen-3-one (17,20βP. A general procedure for preparation of the acetylcholinesterase labelled steroid is described which is applicable to any steroid. Results: Use of acetylcholinesterase tracer increased the sensitivity of assay so that reliable measurements of each steroid could be achieved with only 10 µl of plasma. ELISA was applied to measure of 17,20βP steroid production by sperm of trout which has sufficient amount of potent and active 20βHSD enzyme to convert 17α-hydroxy-4-pregnen-3-one (17αP substrate to 17,20βP product. The results showed that a clear shift in 17,20βP production was found with increase in substrate concentration in all in vitro incubations. Conclusion: ELISA method presented in this study has greater sensitivity and accuracy compared to previously described method that uses radiolabelled substances. Keywords: Immunoassay, ELISA, Steroids, Hormone, Assay

  2. New reaction rate for 16O( p, γ )17F and its influence on the oxygen isotopic ratios in massive AGB stars

    NARCIS (Netherlands)

    Iliadis, C.; Angulo, C.; Descouvement, P.; Lugaro, M.A.|info:eu-repo/dai/nl/304833975; Mohr, P.

    2008-01-01

    The 16O(p, γ )17F reaction rate is revisited with special emphasis on the stellar temperature range of T=60-100 MK, important for hot bottom burning in asymptotic giant branch (AGB) stars. We evaluate existing cross-section data that were obtained since 1958 and, if appropriate, correct published

  3. Search for charm in 250 GeV/c π-p interactions

    International Nuclear Information System (INIS)

    Harris, R.; Bogert, D.; Hanft, R.

    1975-01-01

    Inclusive cross sections are found for strange particle production in π - p interactions at 250 GeV/c in a search for charmed particles using neutral particle decays in a bubble chamber. The results are preliminary, but at the present statistical level no evidence was found for charmed particle production

  4. Existence of halo-structure for the first excited levels of both the 13C-13N and the 17O-17F nuclei

    International Nuclear Information System (INIS)

    Gridnev, K.A.; Novatskij, B.G.

    2003-01-01

    From calculated the Coulomb shifts difference for the carbon and oxygen isotopes analog levels the valent nucleons the orbit radius values R C and the density parameter r 0 are presented. It is shown that the density parameter values are slightly varying for the all analog nuclear pairs. The exception constitutes the first excited states of the 13 C- 13 N and the 17 O- 17 F nuclei, whose valent nucleons populate the 2s-shell (L=0). These states one can to consider as structures with brightly distinguished of the ( 13 C * , 17 O * ) neutron halo and the( 13 N * , 17 F * ) proton halo

  5. 47 CFR 17.7 - Antenna structures requiring notification to the FAA.

    Science.gov (United States)

    2010-10-01

    ... the FAA. 17.7 Section 17.7 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL CONSTRUCTION... Antenna structures requiring notification to the FAA. A notification to the Federal Aviation... area of each heliport specified in paragraph (d) of this section. (c) When requested by the FAA, any...

  6. Double-differential cross section for ionization of H2O molecules by 4-MeV/u C6 + and Si13 + ions

    Science.gov (United States)

    Bhattacharjee, Shamik; Biswas, S.; Monti, J. M.; Rivarola, R. D.; Tribedi, L. C.

    2017-11-01

    Double-differential cross section (DDCS) for electrons ejected in collisions of fast C6 + and Si13 + projectiles, with a H2O vapor target, were measured. The electrons were detected over an energy range of 1-600 eV and an angular range of 20∘-160∘. The obtained DDCS spectra, for both the ions, were compared with the CDW-EIS model. Occasional reference has been made to the DDCS data for the case of 3.75-MeV/u O8 + colliding on the same molecule for an overall comparison. A reasonable agreement with theoretical results was seen for the case of C6 + and O8 + projectiles. However, between C6 + and O8 + projectiles, the deviation from theory is larger for the case of the carbon projectile. Substantial deviation starts to show up for the case of the Si13 + projectile. By numerical integration of the DDCS data, the single-differential cross section (SDCS) and total cross section (TCS) were obtained and compared with theoretical models. The present TCS data along with the other available data for p , He , and C ions were plotted together. A clear and gradual deviation from the Bethe-Born predicted q2 scaling was observed, where q is the projectile charge state. From all the data we find TCS varies as qn where n = 1.7 ± 0.1. The provided data set will be valuable in order to help model the radiation damage in hadron therapy, particularly in the Bragg peak region.

  7. Two-particle inclusive and semi-inclusive rapidity distributions of π+-mesons in K-p interactions at 32 GeV/c

    International Nuclear Information System (INIS)

    Bumazhnov, V.A.; Babintsev, V.V.; Bogolyubskij, M.Yu.

    1983-01-01

    The inclusive and semiinclusive invariant differential cross sections of pair π +- mesons for different charged states in K - p-interactions at 32 GeV/c a K - p-interactions at 32 GeV/c are presented as functions of rapidity. Inclusive and semiinclusive pΩduction cross sections of pai pair π +- mesons are determined. The obtained experimental distributions are compared with predictions of quark recombination model

  8. Analytical continuous slowing down model for nuclear reaction cross-section measurements by exploitation of stopping for projectile energy scanning and results for {sup 13}C({sup 3}He,α){sup 12}C and {sup 13}C({sup 3}He,p){sup 15}N

    Energy Technology Data Exchange (ETDEWEB)

    Möller, S., E-mail: s.moeller@fz-juelich.de

    2017-03-01

    Ion beam analysis is a set of precise, calibration free and non-destructive methods for determining surface-near concentrations of potentially all elements and isotopes in a single measurement. For determination of concentrations the reaction cross-section of the projectile with the targets has to be known, in general at the primary beam energy and all energies below. To reduce the experimental effort of cross-section measurements a new method is presented here. The method is based on the projectile energy reduction when passing matter of thick targets. The continuous slowing down approximation is used to determine cross-sections from a thick target at projectile energies below the primary energy by backward calculation of the measured product spectra. Results for {sup 12}C({sup 3}He,p){sup 14}N below 4.5 MeV are in rough agreement with literature data and reproduce the measured spectra. New data for reactions of {sup 3}He with {sup 13}C are acquired using the new technique. The applied approximations and further applications are discussed.

  9. 47 CFR 17.17 - Existing structures.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Existing structures. 17.17 Section 17.17... STRUCTURES Federal Aviation Administration Notification Criteria § 17.17 Existing structures. (a) The requirements found in § 17.23 relating to painting and lighting of antenna structures shall not apply to those...

  10. C-Section Recovery: What to Expect

    Science.gov (United States)

    ... Mood changes. Childbirth triggers a jumble of powerful emotions. Many new moms experience a period of feeling ... labor-and-delivery/in-depth/c-section-recovery/art-20047310 . Mayo Clinic Footer Legal Conditions and Terms ...

  11. Theoretical charge-exchange total cross sections for B+3 + He and C+4 + He collisions

    International Nuclear Information System (INIS)

    Shipsey, E.J.; Browne, J.C.; Olson, R.E.

    1977-01-01

    Charge-exchange total cross sections for the B +3 + He and C +4 + He systems have been calculated in the velocity range v = (1--10) x 10 7 cm/sec. Ab initio potential-energy curves and coupling-matrix elements were computed and employed in the impact-parameter classical-coupled equations that describe the collision to obtain the cross sections. For the B +3 + He system, our calculations are in excellent agreement with experimental results with the finding that the single-electron-transfer cross section rises rapidly to a maximum of 1.45 x 10 -15 cm 2 at v = 5.5 x 10 7 cm/sec. For the C +4 + He system, however, we find that the double-electron-transfer process is more important than the single-electron-transfer process. For example, at v = 5 x 10 7 cm/sec, the double-electron-transfer cross section is found to be 0.6 x 10 -16 cm 2 vs 5.5 x 10 -17 for the single-electron transfer. This is in disagreement with an experiment of Crandall which gave the single-charge-transfer process as dominant. However, the more recent experiment reported by Crandall, Olson, Browne, and Shipsey verifies the double charge transfer as the dominant process for low energies

  12. Inclusive production of charged pions in p+C collisions at 158 GeV/c beam momentum

    CERN Document Server

    Alt, C; Barna, D; Barr, G; Bartke, Jerzy; Betev, L; Biakowska, H; Blume, C; Boimska, B; Bracinik, J; Bramm, R; Buncic, P; Cerny, V; Christakoglou, P; Chvala, O; Dinkelaker, P; Dolejsi, J; Eckardt, V; Fischer, H G; Flierl, D; Fodor, Z; Foka, P; Friese, V; Gazdzicki, M; Georgopoulos, G; Höhne, C; Karev, A; Kniege, S; Kollegger, T; Kolesnikov, V I; Kornas, E; Kowalski, M; Kraus, I; Kreps, M; Litov, L; Makariev, M; Malakhov, A I; Mateev, M; Melkumov, G L; Mitrovski, M; Pálla, G; Panagiotou, A D; Panayotov, D; Pattison, C; Petridis, A; Renfordt, R; Rybicki, A; Sandoval, A; Schmitz, N; Seyboth, P; Siklér, F; Stock, R; Ströbele, H; Sziklai, J; Szymanski, P; Trubnikov, V; Varga, D; Vassiliou, Maria; Veres, G I; Vesztergombi, G; Vranic, D; Wenig, S; Wetzler, A; Zaranek, J

    2007-01-01

    The production of charged pions in minimum bias p+C interactions is studied using a sample of 377000 inelastic events obtained with the NA49 detector at the CERN SPS at 158 GeV/c beam momentum. The data cover a phase space area ranging from 0 to 1.8 GeV/c in transverse momentum and from -0.1 to 0.5 in Feynman x. Inclusive invariant cross sections are given on a grid of 270 bins per charge thus offering for the first time a dense coverage of the projectile hemisphere and of the cross-over region into the target fragmentation zone.

  13. 12C(3He,3He n)11C cross section at 910 MeV

    International Nuclear Information System (INIS)

    Aslanides, E.; Fassnacht, P.; Dellacasa, G.; Gallio, M.; Tuyn, J.W.N.

    1981-01-01

    The 12 C( 3 He, 3 He n) 11 C cross section at 910 MeV was measured by using a Ge(Li) gamma spectrometer to determine the disintegration rate and measuring the incident flux by means of a scintillator telescope. Cross sections for the production of 7 Be in C and Al and for the production of 24 Na in Al are then determined using the measured cross section as a monitor

  14. The 12C(n, 2n)11C cross section from threshold to 26.5 MeV.

    Science.gov (United States)

    Yuly, M; Eckert, T; Hartshaw, G; Padalino, S J; Polsin, D N; Russ, M; Simone, A T; Brune, C R; Massey, T N; Parker, C E; Fitzgerald, R; Sangster, T C; Regan, S P

    2018-02-01

    The 12 C(n, 2n) 11 C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3 H(d,n) 4 He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β + decay of 11 C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1 H(n,p) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.

  15. Oculocutaneous albinism in a patient with 17p13.2-pter duplication - a review on the molecular syndromology of 17p13 duplication.

    Science.gov (United States)

    Kucharczyk, Marzena; Jezela-Stanek, Aleksandra; Gieruszczak-Bialek, Dorota; Kugaudo, Monika; Cieslikowska, Agata; Pelc, Magdalena; Krajewska-Walasek, Malgorzata

    2015-06-01

    Chromosomal duplications involving 17p13.3 have recently been defined as a new distinctive syndrome with several diagnosed patients. Some variation is known to occur in the breakpoints of the duplicated region and, consequently, in the phenotype as well. We report on a patient, the fifth to our knowledge, a 4-year-old girl with a pure de novo subtelomeric 17p13.2-pter duplication. She presents all of the facial features described so far for this duplication and in addition, a unilateral palmar transversal crease and oculocutaneous albinism which has not been reported previously. A detailed molecular description of the reported aberration and correlation with the observed phenotypical features based on a literature review. We discuss the possible molecular etiology of albinism in regard to the mode of inheritance. The new data provided here may be useful for further genotype correlations in syndromes with oculocutaneous albinism, especially of autosomal dominant inheritance.

  16. The analysis of B, C, N, and O by nuclear reactions

    International Nuclear Information System (INIS)

    Debras, G.; Deconninck, G.

    1979-01-01

    Nuclear reactions induced on light elements by lower energy deuterons are investigated. Differential cross section for 10 B(d,α 0 ) 8 Be, 10 B(d,α 1 ) 8 Be, 12 C(d,p 0 ) 13 C, 14 N(d,α 1 ) 12 C, 16 O(d,p 0 ) 17 O, 16 O(d,p 1 ) 17 O and 16 O(d,α 0 ) 14 N reactions are measured between 0.5 and 3 MeV at an observation angle of 135 0 with respect to the incident beam. Possible application of these reactions to the measurement of surface concentration is considered. Special emphasis was given on nitrogen determination in order to study nitrogen concentration in industrial glasses. Surface nitrogen repartition on glass, origin of nitrogen, influence of oxidizing and reducing conditions and glass structure are discussed. (author)

  17. The accurate calculation about p(p-bar)→p(p-bar)' differential cross-section of the renormalized π0 chain propagator

    International Nuclear Information System (INIS)

    Jiang Zaifu; Jingchu Univ. of Technology, Jingmen; Fang Zhenyun; Chen Wensuo; Xu Jin; Yi Junmei

    2008-01-01

    In the Lorentz coupling model of strong interaction between neutral meson π 0 and N-N-bar, we have strictly analytic calculated the scattering differential cross-section of p-(p-bar) about the π 0 renormalized chained propagator and obtained accurate theoretical outcome. Moreover, after comparing with the differential cross- section of π 0 tree propagator, we have obtained related radiation correction outcome. All these, we have done, can be reference for further researching p-(p-bar) elastic collision at high, middle or low ergo region and description Lorentz invariant coupling model theory with strong interaction. (authors)

  18. 17F breakup reactions: a touchstone for indirect measurements

    International Nuclear Information System (INIS)

    De Napoli, M.; Raciti, G.; Sfienti, C.; Capel, P.; Baye, D.; Descouvemont, P.; Sparenberg, J.-M.; Giacoppo, F.; Rapisarda, E.; Cardella, G.; Mazzocchi, C.

    2011-01-01

    An exclusive study of 17 F breakup reactions has been performed at the FRIBs facility of the Laboratori Nazionali del Sud in Catania (Italy). The experiment has been performed with the aim of testing the accuracy of the Coulomb-breakup indirect technique used to infer radiative-capture cross sections at low energies. This technique has been used in the 7 Be(p,γ) 8 B case, but has never been tested. By measuring the breakup of 17 F into 16 O+p, and comparing the inferred cross section for 16 O(p,γ) 17 F to direct precise measurements, the influence of E2 transitions and higher-order effects, that are predicted to be significant in Coulomb-breakup reactions, can be evaluated. The first results and preliminary model comparison are reported.

  19. Induction of C-Mip by IL-17 Plays an Important Role in Adriamycin-Induced Podocyte Damage

    Directory of Open Access Journals (Sweden)

    Yanbo Liu

    2015-07-01

    Full Text Available Background/Aims: Although the disturbance of T lymphocyte and glomerular podocyte exerts a crucial function in the pathogenesis of proteinuria, the potential link is still unclear. Methods: The balance of Treg and Th17 cells, and the expression of IL-17/IL-17R and c-mip were investigated in adrimycin-induced nephropathy (AN mice. The effect and mechanism of IL-17 on podocyte were explored in cultured podocytes. Results: The proportion of Th17 cells in peripheral blood mononuclear cells, the amount of IL-17 in serum and kidney cortical homogenates, and the expression of IL-17R and c-mip in glomerular podocyte were increased obviously in AN mice. In cultured podocytes, recombinant IL-17 led to an induction of apoptosis and cytoskeletal disorganization, an overproduction of c-mip while down-regulation of phosphor-nephrin, and an increased binding of c-mip to NF-κB/RelA. Silence of c-mip prevented podocyte apoptosis and reduction of phosphor-nephrin by prompting nuclear translocation of NF-κB/RelA in IL-17 treated cells. Persistent activation of NF-κB up-regulated pro-survival protein Bcl-2 and decreased podocyte apoptosis, but had no effect on phosphor-nephrin level. Conclusion: These findings demonstrated that induction of IL-17 released by Th17 cells plays a key role in podocytopathy most likely through down-regulation of phosphor-nephrin and Bcl-2 level via overproduction of c-mip.

  20. Forest wildfire increases soil microbial biomass C:N:P stoichiometry in long-term effects

    Science.gov (United States)

    Zhou, Xuan

    2017-04-01

    Boreal forest fire strongly influences carbon (C) stock in permafrost soil by thawing permafrost table which accelerated microbe decomposition process. We studied soil microbial biomass stoichiometry in a gradient of four (3 yr, 25 yr, 46 yr and more than 100 yr) ages since fire in Canada boreal forest. Soil microbial biomass (MB) in long-term after fire is significantly higher than in short-term. MB C and nitrogen (N) were mainly dominated by corresponding soil element concentration and inorganic P, while MB phosphorus (P) changes were fully explained by soil N. Fire ages and soil temperature positively increased MB N and P, indicating the negative impact by fire. Microbial C:N:P gradually increased with fire ages from 15:2:1 to 76:6:1 and then drop down to 17:2:1 in the oldest fire ages. The degree of homeostasis of microbial C, N and P are close to 1 indicates non-homoeostasis within microbial elements, while it of C:N:P is close to 8 shows a strong homeostasis within element ratios and proved microbial stoichiometric ratio is not driven by soil element ratios. In conclusion, i) microbial biomass elements highly depends on soil nutrient supply rather than fire ages; ii) wildfire decreased microbial stoichiometry immediate after fire but increased with years after fire (YF) which at least 3 times higher than > 100 fire ages; iii) microbial biomass C, N and P deviated from strict homeostasis but C:N:P ratio reflects stronger homeostasis.

  1. Surface freshwater from Bay of Bengal runoff and Indonesian throughflow in the tropical Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sengupta, D.; Raj, B.; Shenoi, S.S.C.

    ]); monthly evaporation from the Southampton Oceanography Centre (SOC) data (Josey et al. [1998]), and monthly 2openbulletby 2openbulletsurface currents in the tropical Indian Ocean, based on 1985-2002 trajecto- ries of drogued WOCE drifters (Shenoi et al..., Deep-Sea Re- search II, 50, 2111?2127, 2003. Josey, S. A., E. C. Kent, and P. K. Taylor, The Southampton Oceanography Centre (SOC) Ocean - Atmosphere Heat, Mo- mentum and Freshwater Flux Atlas, Tech. Rep. 6, Southamp- ton Oceanography Centre, 1998...

  2. Measurement of the 64Zn,47Ti(n,p) cross sections using a DD neutron generator for medical isotope studies

    Science.gov (United States)

    Voyles, A. S.; Basunia, M. S.; Batchelder, J. C.; Bauer, J. D.; Becker, T. A.; Bernstein, L. A.; Matthews, E. F.; Renne, P. R.; Rutte, D.; Unzueta, M. A.; van Bibber, K. A.

    2017-11-01

    Cross sections for the 47Ti(n,p)47Sc and 64Zn(n,p)64Cu reactions have been measured for quasi-monoenergetic DD neutrons produced by the UC Berkeley High Flux Neutron Generator (HFNG). The HFNG is a compact neutron generator designed as a "flux-trap" that maximizes the probability that a neutron will interact with a sample loaded into a specific, central location. The study was motivated by interest in the production of 47Sc and 64Cu as emerging medical isotopes. The cross sections were measured in ratio to the 113In(n,n‧)113mIn and 115In(n,n‧)115mIn inelastic scattering reactions on co-irradiated indium samples. Post-irradiation counting using an HPGe and LEPS detectors allowed for cross section determination to within 5% uncertainty. The 64Zn(n,p)64Cu cross section for 2.76-0.02+0.01 MeV neutrons is reported as 49.3 ± 2.6 mb (relative to 113In) or 46.4 ± 1.7 mb (relative to 115In), and the 47Ti(n,p)47Sc cross section is reported as 26.26 ± 0.82 mb. The measured cross sections are found to be in good agreement with existing measured values but with lower uncertainty (neutron sources for nuclear data measurements and potentially the production of radionuclides for medical applications.

  3. The K/sup -/p charge exchange and elastic scattering reactions at 42 GeV/c

    CERN Document Server

    Marzano, F; Gavillet, P; Gay, J B; Grossmann, P; Heinen, P M; Hemingway, R J; Jongejans, B; Kluyver, J C; Maréchal, B; Schotanus, D J; Toet, D Z; Wells, J; Wolters, G F

    1977-01-01

    Results are presented on the reactions K/sup -/p to K/sup 0/n and K /sup -/p to K/sup -/p from a high statistics CERN 2-metre hydrogen bubble chamber exposure at 4.15 GeV/c. The behaviour of the differential cross section as a function of four-momentum transfer shows remarkable similarities between the two reactions studied. From a comparison of their data with K/sup +/p elastic scattering at 4.27 GeV/c the authors draw some conclusions concerning the magnitude of the contributing amplitudes. (10 refs).

  4. Experimental results on J/psi production by πsup(+-), Ksup(+-), p and anti p incident on hydrogen at 39.5 GeV/c

    International Nuclear Information System (INIS)

    Corden, M.J.; Dowell, J.D.; Garvey, J.; Homer, R.J.; Jobes, M.; Kenyon, I.R.; McMahon, T.; Owen, R.C.; Sumorok, K.C.T.; Vallance, R.J.

    1981-01-01

    J/psi production at 40 GeV/c by πsup(+-), Ksup(+-), p and anti p incident on hydrogen has been studied and results compared with those obtained on tungsten in the same experiment. On hydrogen, J/psi cross-section ratios relative to π - have been measured to be (for xsub(F) > 0) sigma(π - ) : sigma(π + ) : sigma(anti p) : sigma(p) = 1 : (0.78 +- 0.09) : (0.83 +- 0.35) : (0.07 +- 0.04). The suppression of the proton induced cross sections shows the importance of calence quark-antiquark fusion in J/psi production at this energy (i.e., M 2 sub(J)sub(/)sub(psi)/s = 0.13). (orig.)

  5. Quasi-free knockout reactions with the proton-dripline nucleus {sup 17}Ne

    Energy Technology Data Exchange (ETDEWEB)

    Wamers, Felix; Aumann, Thomas [Institut fuer Kernphysik, TU, Darmstadt (Germany); Heil, Michael [Kernreaktionen und Nukleare Astrophysik, GSI, Darmstadt (Germany); Marganiec, Justyna [ExtreMe Matter Institute EMMI, GSI, Darmstadt (Germany); Plag, Ralf [Kernreaktionen und Nukleare Astrophysik, GSI, Darmstadt (Germany); Goethe Universitaet, Frankfurt a.M. (Germany); Collaboration: R3B-Collaboration

    2011-07-01

    {sup 17}Ne is a proton-dripline nucleus that has raised special interest in nuclear-structure physics in recent years. As a ({sup 15}O+2p) Borromean 3-body system, it is often considered to be a 2-proton-halo nucleus, yet lacking concluding experimental evidence about its structure. We have studied breakup reactions of 500 AMeV {sup 17}Ne secondary beams using the R{sup 3}B-LAND setup at GSI. One focus was on the quasi-free one-proton knockout in a proton-rich paraffin (CH{sub 2}) target in inverse kinematics, i.e., {sup 17}Ne(p,2p){sup 16}F{yields}{sup 15}O+p, in comparison to the one-proton knockout with a carbon target. Recoil protons have been detected with Si-Strip detectors and the surrounding 4{pi} NaI spectrometer ''Crystal Ball'', thus providing a clean signature for quasi-free knockout. First results on two-proton removal cross sections with CH{sub 2} and C targets will be presented, as well as transverse momentum distributions of the {sup 15}O core in {sup 17}Ne. Projectile-like forward protons after one-proton knockout from {sup 17}Ne have been measured in coincidence with the {sup 15}O residual core, leading to the relative-energy spectrum of the unbound {sup 16}F. Possible interpretations and implications regarding the structure of {sup 17}Ne are discussed.

  6. contribution to the study of the reaction π± + p → π± + p + π0 between 0,5 and 1.5 GeV/c (1963)

    International Nuclear Information System (INIS)

    Thevenet, B.

    1963-06-01

    We measured, with γ rays counters, the total production cross section of γ accompanied by charged secondaries in π ± p interactions between 0.5 and 1.5 GeV/c. We obtained the cross section of the reaction π + p → π + π 0 p, with incident π - we could determined only the cross section of π - p → π 0 + (charged particles) because the lack of information on multiple production. We compared our experimental results with the predictions of simple production models. A method for calculation of high energy γ rays efficiency of detectors with lead converters is given in the appendix. (author) [fr

  7. Study of the (p,pd), (p,pt) and (p,p3He) reactions on 12C and 16O at 75MeV

    International Nuclear Information System (INIS)

    Grossiord, Jean-Yves.

    1976-01-01

    These experiments have been performed at the Louvain-la-Neuve cyclotron (Belgium). Protons were detected by a two-detector telescope (one of them being a 7mm thick intrinsic germanium detector) and detection of d, t, 3 He was made with a three-detector telescope. The energy signals coming from these detectors together with the time difference between the two outgoing particles were registered on magnetic tapes. An off-line analysis of these data enabled to construct the excitation spectra of the residual nuclei 10 B, 9 B, 9 Be and 14 N, 13 N, 13 C; the energy resolution was about 400keV. For some of the levels of these nuclei, it has been possible to extract the momentum distribution of the corresponding cluster in 12 C and 16 O. The quasi-free scattering mechanism with distorted waves gives a good representation of the measured distributions and then seems to represent correctly the reaction mechanism. Moreover, assuming for the two and three particle spectroscopic amplitudes the values computed in the framework of the shell model with an effective interaction, it appears that the off-shell scattering cross-sections values are close to the free scattering cross-sections values taken at a proton energy which gives the same relative impulsion p-x as in the incident channel of the three body reaction. Finally, other informations can be obtained from the comparison of these data with experimental results from transfer reactions (p, 3 He) and (p,α): in particular, the population of the T=1 levels of 10 B (1.74MeV) and 14 N(2.31MeV) can be explained by the scattering of a proton on an n-p pair in singlet state (S=0) followed by a transition to the triplet state [fr

  8. Early recurrence in standard-risk medulloblastoma patients with the common idic(17)(p11.2) rearrangement

    Science.gov (United States)

    Bien-Willner, Gabriel A.; López-Terrada, Dolores; Bhattacharjee, Meena B.; Patel, Kayuri U.; Stankiewicz, Paweł; Lupski, James R.; Pfeifer, John D.; Perry, Arie

    2012-01-01

    Medulloblastoma is diagnosed histologically; treatment depends on staging and age of onset. Whereas clinical factors identify a standard- and a high-risk population, these findings cannot differentiate which standard-risk patients will relapse and die. Outcome is thought to be influenced by tumor subtype and molecular alterations. Poor prognosis has been associated with isochromosome (i)17q in some but not all studies. In most instances, molecular investigations document that i17q is not a true isochromosome but rather an isodicentric chromosome, idic(17)(p11.2), with rearrangement breakpoints mapping within the REPA/REPB region on 17p11.2. This study explores the clinical utility of testing for idic(17)(p11.2) rearrangements using an assay based on fluorescent in situ hybridization (FISH). This test was applied to 58 consecutive standard- and high-risk medulloblastomas with a 5-year minimum of clinical follow-up. The presence of i17q (ie, including cases not involving the common breakpoint), idic(17)(p11.2), and histologic subtype was correlated with clinical outcome. Overall survival (OS) and disease-free survival (DFS) were consistent with literature reports. Fourteen patients (25%) had i17q, with 10 (18%) involving the common isodicentric rearrangement. The presence of i17q was associated with a poor prognosis. OS and DFS were poor in all cases with anaplasia (4), unresectable disease (7), and metastases at presentation (10); however, patients with standard-risk tumors fared better. Of these 44 cases, tumors with idic(17)(p11.2) were associated with significantly worse patient outcomes and shorter mean DFS. FISH detection of idic(17)(p11.2) may be useful for risk stratification in standard-risk patients. The presence of this abnormal chromosome is associated with early recurrence of medulloblastoma. PMID:22573308

  9. Proton angular distribution of {sup 16}O(d,p){sup 17}O{sup *} near a deuteron capture resonance; Evolution de la distribution angulaire des protons {sup 16}O(d,p){sup 17}O{sup *} au voisinage d'une resonance de capture du deuteron

    Energy Technology Data Exchange (ETDEWEB)

    Berthelot, R; Cohen, E; Cotton, H; Farraggi, T; Grjebine, A; Leveque, V; Naggiar, M; Roclawski-Conjeaud, D; Szteinsznaider, D [Commissariat a l' Energie Atomique, Saclay(France). Centre d' Etudes Nucleaires

    1954-07-01

    The study of angular distributions of the protons from the reaction {sup 16}O(d,p){sup 17}O{sup *} (level at 875 keV) was made, using a photographic method, at seven different deuteron energies, from 1.66 to 2.20 MeV (obtained with the Saclay electrostatic generator). The analysis of results shows that the angular distribution for forward angles is for each chosen energy in good agreement with the stripping theory (l = 0), even at the maximum of the capture resonance of the deuteron, about 2.1 MeV. Moreover, the differential cross section at 7 deg reaches a maximum for this resonance energy. (author) [French] L'etude des distributions angulaires des protons emis au cours de la reaction {sup 16}O(d,p){sup 17}O{sup *} (niveau a 875 key) a ete effectuee, par une methode photographique, pour 7 energies differentes de deuterons comprises entre 1,66 et 2,20 MeV (obtenues grace a l'accelerateur electrostatique de Saclay). L'analyse des resultats montre que la distribution angulaire vers l'avant est, pour toutes ces energies, en bon accord avec la theorie du ''stripping'' ( 1=0), meme au maximum de la resonance de capture du deuteron situee vers 2,1 MeV. De plus, la section efficace differentielle a 7 deg passe par un maximum pour cette energie de resonance. (auteur)

  10. Measurement of the inclusive jet cross section using the k(T) algorithm in p anti-p collisions at s**(1/2) = 1.96-TeV

    Energy Technology Data Exchange (ETDEWEB)

    Abulencia, A.; Acosta, D.; Adelman, Jahred A.; Affolder, Anthony A.; Akimoto, T.; Albrow, M.G.; Ambrose, D.; Amerio, S.; Amidei, D.; Anastassov, A.; Anikeev, K.; /Taiwan,

    2005-12-01

    The authors report on a measurement of the inclusive jet production cross section in p{bar p} collisions at {radical}s = 1.96 TeV using data collected with the upgraded Collider Detector at Fermilab in Run II (CDF II) corresponding to an integrated luminosity of 385 pb{sup -1}. Jets are reconstructed using the k{sub T} algorithm. The measurement is carried out for jets with rapidity 0.1 < |y{sup jet}| < 0.7 and transverse momentum in the range 54 < p{sub T}{sup jet} < 700 GeV/c. The measured cross section is in good agreement with next-to-leading order perturbative QCD predictions after the necessary non-perturbative parton-to-hadron corrections are included.

  11. Measurement of the cross-section ratio {sigma}({chi}{sub c2})/{sigma}({chi}{sub c1}) for prompt {chi}{sub c} production at {radical}(s)=7 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Abellan Beteta, C. [Universitat de Barcelona, Barcelona (Spain); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Universite, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Universite, Universite Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J.; Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amhis, Y. [Ecole Polytechnique Federale de Lausanne (EPFL), Lausanne (Switzerland); Anderson, J. [Physik-Institut, Universitaet Zuerich, Zuerich (Switzerland); Appleby, R.B. [School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); Aquines Gutierrez, O. [Max-Planck-Institut fuer Kernphysik (MPIK), Heidelberg (Germany); Archilli, F. [Laboratori Nazionali dell' INFN di Frascati, Frascati (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Arrabito, L. [CC-IN2P3, CNRS/IN2P3, Lyon-Villeurbanne (France); and others

    2012-08-14

    The prompt production of the charmonium {chi}{sub c1} and {chi}{sub c2} mesons has been studied in proton-proton collisions at the Large Hadron Collider at a centre-of-mass energy of {radical}(s)=7 TeV. The {chi}{sub c} mesons are identified through their decays {chi}{sub c}{yields}J/{psi}{gamma} with J/{psi}{yields}{mu}{sup +}{mu}{sup -} using 36 pb{sup -1} of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for the two {chi}{sub c} spin states, {sigma}({chi}{sub c2})/{sigma}({chi}{sub c1}), has been determined as a function of the J/{psi} transverse momentum, p{sub T}{sup J/{psi}}, in the range from 2 to 15 GeV/c. The results are in agreement with the next-to-leading order non-relativistic QCD model at high p{sub T}{sup J/{psi}} and lie consistently above the pure leading-order colour-singlet prediction.

  12. NLO NRQCD disfavors the interpretation of X(3872) as {chi}{sub c1}(2P)

    Energy Technology Data Exchange (ETDEWEB)

    Butenschoen, Mathias [Wien Univ. (Austria). Fakultaet fuer Physik; He, Zhi-Guo; Kniehl, Bernd A. [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik

    2013-03-15

    We study {chi}{sub c1}(2P) inclusive hadroproduction at next-to-leading order (NLO) within the factorization formalism of nonrelativistic quantum chromodynamics (NRQCD), including both the color-singlet {sup 3}P{sub 1}{sup [1]} and color-octet {sup 3}S{sub 1}{sup [8]} c anti c Fock states. Assuming the recently discovered X(3872) hadron to be the 2P (1{sup ++}) charmonium state, we perform a fit to the cross sections measured by the CDF, CMS, and LHCb Collaborations. We either obtain an unacceptably high value of {chi}{sup 2} or a value of vertical stroke R{sub 2P}{sup '}(0) vertical stroke incompatible with well-established potential models. We thus conclude that NLO NRQCD is incompatible with the hypothesis X(3872){identical_to}{chi}{sub c1}(2P).

  13. HIGH-PRECISION C17O, C18O, AND C16O MEASUREMENTS IN YOUNG STELLAR OBJECTS: ANALOGUES FOR CO SELF-SHIELDING IN THE EARLY SOLAR SYSTEM

    International Nuclear Information System (INIS)

    Smith, Rachel L.; Young, Edward D.; Pontoppidan, Klaus M.; Morris, Mark R.; Van Dishoeck, Ewine F.

    2009-01-01

    Using very high resolution (λ/Δλ ∼ 95 000) 4.7 μm fundamental and 2.3 μm overtone rovibrational CO absorption spectra obtained with the Cryogenic Infrared Echelle Spectrograph infrared spectrometer on the Very Large Telescope (VLT), we report detections of four CO isotopologues-C 16 O, 13 CO, C 18 O, and the rare species, C 17 O-in the circumstellar environment of two young protostars: VV CrA, a binary T Tauri star in the Corona Australis molecular cloud, and Reipurth 50, an intermediate-mass FU Ori star in the Orion Molecular Cloud. We argue that the observed CO absorption lines probe a protoplanetary disk in VV CrA, and a protostellar envelope in Reipurth 50. All CO line profiles are spectrally resolved, with intrinsic line widths of ∼3-4 km s -1 (FWHM), permitting direct calculation of CO oxygen isotopologue ratios with 5%-10% accuracy. The rovibrational level populations for all species can be reproduced by assuming that CO absorption arises in two temperature regimes. In the higher temperature regime, in which the column densities are best determined, the derived oxygen isotope ratios in VV CrA are: [C 16 O]/[C 18 O] =690 ± 30; [C 16 O]/[C 17 O] =2800 ± 300, and [C 18 O]/[C 17 O]=4.1 ± 0.4. For Reipurth 50, we find [C 16 O]/[C 18 O] =490 ± 30; [C 16 O]/[C 17 O] =2200 ± 150, [C 18 O]/[C 17 O] = 4.4 ± 0.2. For both objects, 12 C/ 13 C are on the order of 100, nearly twice the expected interstellar medium (ISM) ratio. The derived oxygen abundance ratios for the VV CrA disk show a significant mass-independent deficit of C 17 O and C 18 O relative to C 16 O compared to ISM baseline abundances. The Reipurth 50 envelope shows no clear differences in oxygen CO isotopologue ratios compared with the local ISM. A mass-independent fractionation can be interpreted as being due to selective photodissociation of CO in the disk surface due to self-shielding. The deficits in C 17 O and C 18 O in the VV CrA protoplanetary disk are consistent with an analogous

  14. Platelet factor-4 and its p17-70 peptide inhibit myeloma proliferation and angiogenesis in vivo

    International Nuclear Information System (INIS)

    Yang, Longjiang; Du, Juan; Hou, Jian; Jiang, Hua; Zou, Jianfeng

    2011-01-01

    Angiogenesis plays an important role in the development of multiple myeloma (MM). The interaction between MM cells and the bone marrow microenvironment stimulates the proliferation and migration of endothelial progenitor cells (EPCs). Vascular endothelial growth factor (VEGF) contributes to the formation of new blood vessels by actively recruiting circulating EPCs. The production of proangiogenic and antiangiogenic factors is also dysregulated in MM. Platelet factor 4 (PF4) is a potent angiostatic cytokine that inhibits angiogenesis and tumor growth in several animal models. In this study, we stably transfected human myeloma cell lines with the PF4 gene or the sequence encoding its more potent p17-70 peptide and investigated the effects of PF4 and p17-70 on angiogenesis and tumor growth in vitro and in a SCID-rab myeloma model. PF4 and p17-70 significantly attenuated VEGF production, both in vitro and in vivo. In a migration study using a Transwell system, PF4 or p17-70 markedly suppressed the migration of co-cultured human endothelial progenitor cells. PF4 or p17-70 also caused a significant reduction in microvessel densities in myeloma xenografts and markedly reduced the tumor volume in the SCID mice. Kaplan-Meier analysis demonstrated that PF4 and p17-70 significantly extended the overall survival of SCID mice bearing human myeloma xenografts. Our findings indicate that PF4 or p17-70 could be valuable in combating multiple myeloma by disrupting tumor angiogenesis

  15. Benchmarking theoretical formalisms for (p ,p n ) reactions: The 15C(p ,p n )14C case

    Science.gov (United States)

    Yoshida, K.; Gómez-Ramos, M.; Ogata, K.; Moro, A. M.

    2018-02-01

    Background: Proton-induced knockout reactions of the form (p ,p N ) have experienced a renewed interest in recent years due to the possibility of performing these measurements with rare isotopes, using inverse kinematics. Several theoretical models are being used for the interpretation of these new data, such as the distorted-wave impulse approximation (DWIA), the transition amplitude formulation of the Faddeev equations due to Alt, Grassberger, and Sandhas (FAGS) and, more recently, a coupled-channels method here referred to as transfer-to-the- continuum (TC). Purpose: Our goal is to compare the momentum distributions calculated with the DWIA and TC models for the same reactions, using whenever possible the same inputs (e.g., distorting potential). A comparison with already published results for the FAGS formalism is performed as well. Method: We choose the 15C(p ,p n )14C reaction at an incident energy of 420 MeV/u, which has been previously studied with the FAGS formalism. The knocked-out neutron is assumed to be in a 2 s single-particle orbital. Longitudinal and transverse momentum distributions are calculated for different assumed separation energies. Results: For all cases considered, we find a very good agreement between DWIA and TC results. The energy dependence of the distorting optical potentials is found to affect in a modest way the shape and magnitude of the momentum distributions. Moreover, when relativistic kinematics corrections are omitted, our calculations reproduce remarkably well the FAGS result. Conclusions: The results found in this work provide confidence on the consistency and accuracy of the DWIA and TC models for analyzing momentum distributions for (p ,p n ) reactions at intermediate energies.

  16. High IL-17E and Low IL-17C Dermal Expression Identifies a Fibrosis-Specific Motif Common to Morphea and Systemic Sclerosis

    OpenAIRE

    Lonati, Paola Adele; Brembilla, Nicolò Costantino; Montanari, Elisa; Fontao, Lionel; Gabrielli, Armando; Vettori, Serena; Valentini, Gabriele; Laffitte, Emmanuel; Kaya, Gurkan; Meroni, Pier-Luigi; Chizzolini, Carlo

    2014-01-01

    BACKGROUND: High interleukin (IL)-17A levels are characteristically found in the skin of systemic sclerosis (SSc) individuals. Our aim was to investigate whether the dermal expression of IL-17A and related IL-17 family members (i.e. IL-17C, IL-17E and IL-17F) could distinguish fibrotic from healthy skin and could show similarities in SSc and morphea, two disorders with presumed distinct pathogenesis, but characterized by skin fibrosis. METHODS: Biopsies were obtained from the involved skin of...

  17. Line C17: alpha and medium-level beta-gamma laboratory pilot facility

    International Nuclear Information System (INIS)

    Calor, J.N.; Mauborgne, B.; Montuir, M.

    2000-01-01

    The Process Development Laboratory (LDP) uses the ATALANTE C17 line for integral testing in order to develop and validate spent fuel reprocessing methods and for overall qualification of calculation codes. Line C 17 comprises shielded cells and glove boxes, equipped with centrifugal extractors and laboratory-scale mixer-settlers to test liquid-liquid extraction processes in an alpha and medium-level beta-gamma environment. The high reliability and precision of the process instrumentation and control system allow full control of operating parameters and comprehensive operating data recording, meeting the experimentation quality requirements necessary for qualifying calculation codes. Direct online spectrophotometric analysis at various points in the process provides real-time concentration data for vital elements, some of which are difficult to analyze offline because of their poor chemical stability. Online analyses, supplemented when necessary by gamma spectrometry, provide valuable process control input for reaching stabilized operating conditions. Fifteen radioactive test campaigns have been successfully completed since line C 17 was commissioned in June 1995. (authors)

  18. Stress corrosion cracking in 17-4PH and 17-7PH stainless steels in NaCl and NaOH (20%) a 90 deg C

    International Nuclear Information System (INIS)

    Gaona-Tiburcio, C.; Almeraya-Calderon, F.; Martinez-Villafane, A.

    2000-01-01

    One of the problems that affects to the electric industry is the not programmed stoppages in the power plants, due to the failure of any main component: boiler, turbine and generator. In the turbine, the combined action of a corrosive agent (humid polluted vapor) and a mechanical effort, generally will result in Stress Corrosion Cracking (SCC). In this work the SCC susceptibility of the precipitation hardening stainless steels 17-4PH and 17-17PH, thoroughly used in steam turbine blades of power stations is analyzed. The specimens were tested in the presence of NaCl and NaOH(20%) to 90 deg C and different pH. The CERT test (Constant Extension Rate Test) was used, at 10''-6 s''-1, supplementing it with electrochemical noise, the aim was to identify the conditions of maximum susceptibility and the performance of the studied materials. The fractographic analysis revealed ductile and brittle fracture. Intergranular cracking, characteristic of the anodic dissolution mechanisms of the materials was observed. Nevertheless, the main mechanism responsible the failure was hydrogen embrittlement. (Author) 6 refs

  19. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Hesperides Cruise in the Atlantic Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Millero, F.J.

    2000-06-09

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO{sub 2}), total alkalinity (TALK), and pH at hydrographic stations during the R/V Hesperides oceanographic cruise in the Atlantic Ocean (Section A5). Conducted as part of the Work Ocean Circulation Experiment (WOCE), the cruise began in Cadiz, Spain, on July 14, 1992, and ended in Miami, Florida, on August 15, 1992. Measurements made along WOCE Section A5 included CTD pressure, temperature, salinity, and oxygen; and bottle salinity, oxygen, phosphate, nitrate, nitrite, silicate, TCO{sub 2}, TALK, and pH. The TALK, TCO{sub 2}, and pH were determined from titrations of seawater collected at 33 stations. The titration systems for measuring TALK and TCO{sub 2} were calibrated in the laboratory with certified reference materials (CRMs) before the cruise to ensure traceable results. Standard reference seawater provided by Andrew Dickson of Scripps Institution of Oceanography (SIO) was used at sea to monitor the performance of the titration systems. The results agree with the laboratory results to {+-} 2 {micro}mol/kg for TALK and {+-} 1 {micro}mol/kg for TCO{sub 2}. The titration systems used to measure pH were calibrated with TRIS seawater buffers prepared in the laboratory and measured with an H{sub 2}, Pt/AgCl, Ag electrode. The initial electromotive force (emf) of the titrations was used to determine the pH. The values of pH are thought to be reliable to {+-} 0.01 and are internally consistent with the measured values of TALK and TCO{sub 2} to {+-} 7 {micro}mol/kg. The measured carbon dioxide system parameters have been used to calculate the in situ values of the fugacity of CO{sub 2} (fCO{sub 2}) for the surface water. The surface results are briefly discussed.

  20. LAMBDA p total cross-section measurement

    CERN Multimedia

    CERN PhotoLab

    1970-01-01

    A view of the apparatus used for the LAMBDA p total cross-section measurement at the time of its installation. The hyperons decaying into a proton and a pion in the conical tank in front were detected in the magnet spectrometer in the upper half of the picture. A novel detection technique using exclusively multiwire proportional chambers was employed.

  1. Sedimentary constraints on the duration of the Marinoan Oxygen-17 Depletion (MOSD) event

    Science.gov (United States)

    Killingsworth, Bryan A.; Hayles, Justin A.; Zhou, Chuanming; Bao, Huiming

    2013-10-01

    The ∼635 Ma Marinoan glaciation is marked by dramatic Earth system perturbations. Deposition of nonmass-dependently 17O-depleted sulfate (SO42-) in worldwide postglacial sediments is, thus far, unique to this glaciation. It is proposed that an extremely high-pCO2 atmosphere can result in highly 17O-depleted atmospheric O2, or the Marinoan Oxygen-17 Depletion (MOSD) event. This anomalous 17O signal was imparted to sulfate of oxidative weathering origin. However, 17O-depleted sulfate occurs in limited sedimentary intervals, suggesting that Earth surface conditions conducive to the MOSD had a finite duration. An MOSD duration can, therefore, provide much needed constraint on modeling Earth system responses at that time. Unfortunately, the sulfate 17O record is often sparse or lacks radiometric dates. Here, we report 11 barite layers from a post-Marinoan dolostone sequence at Wushanhu in the South China Block. The 17O depletion fluctuates in magnitude in lower layers but is persistently absent up section, providing the most confident first and last sedimentary appearance of the anomaly. δ13C chemostratigraphy is used to correlate the Wushanhu section to two proximal sections on the same shallow platform that lack barite layers but have published U-Pb dates that occur in dolostone and shale. Assuming a similar pattern and rate for carbonate and shale deposition among the different sections, we estimate the MOSD duration at 0-0.99 My. This number can be further constrained by new radiometric dates from equivalent sequences worldwide, thus underpinning models on the nonsteady-state Earth system response in the immediate aftermath of the Marinoan meltdown.

  2. 19 CFR 201.17 - Procedures for requesting access to records.

    Science.gov (United States)

    2010-04-01

    ... to inform the public about the government activity involved in the request, beyond the public's right....17 Section 201.17 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Availability of Information to the Public Pursuant to 5 U.S.C. 552 § 201.17 Procedures...

  3. The Impact of MicroRNA-223-3p on IL-17 Receptor D Expression in Synovial Cells.

    Directory of Open Access Journals (Sweden)

    Nozomu Moriya

    Full Text Available Rheumatoid arthritis (RA is an autoimmune inflammatory disease affecting joints. Elevated plasma levels of microRNA-223-3p (miR-223-3p in patients with RA are implicated in the pathogenesis of the disease. This study aimed to analyze the functional role of miR-223-3p in the pathogenesis of RA by overexpressing miR-223-3p in synovial cell lines.Arthritis was induced in the RA model of SKG mice by injection of ß-glucan. The histopathologic features of joints were examined using hematoxylin and eosin and immunohistochemical staining. Plasma levels of miRNA were determined by panel real-time PCR analysis. Target genes of the differentially expressed miRNAs in SKG mice were analyzed using miRNA target prediction algorithms. The dual-luciferase reporter system was used to evaluate the relationship between miR-223-3p and IL-17 receptor D (IL-17RD. The activity of miR-223-3p was analyzed by transfection of plasmid vectors overexpressing miR-223-3p into IL-17RD-expressing NIH3T3 and MH7A cell lines. Il6 and Il17rd mRNA expression was analyzed by quantitative real-time PCR. IL-17RD protein expression was analyzed by western blot analysis.We identified 17 upregulated miRNAs (fold change > 2.0 in plasma of SKG mice injected with ß-glucan relative to untreated SKG mice. Il17rd was identified as the candidate target gene of miR-223-3p using five miRNA target prediction algorithms. The transfection of plasmid vectors overexpressing miR-223-3p into NIH3T3 and MH7A cells resulted in the downregulation of Il17rd expression and upregulation of Il6 expression. Expression of miR-223-3p and Il6 mRNA in MH7A cells was upregulated; however, that of Il17rd mRNA was downregulated following TNF-α stimulation. IL-17RD expression in synovial tissues from SKG mice and RA patients was inversely correlated with the severity of arthritis.This study is the first to demonstrate that miR-223-3p downregulates IL-17RD in both mouse and human cells; miR-223-3p may contribute to

  4. Study of the p+{sup 12}C reaction at energies up to 30 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Harada, Masahide; Yamamoto, A.; Yoshioka, S. [Kyushu Univ., Fukuoka (Japan)] [and others

    1998-03-01

    Double differential cross sections of charged-particles emitted in the p+{sup 12}C reaction were measured in the energy region from 14 to 26 MeV. The observed continuous components of emitted protons and {alpha}-particles were analyzed by assuming sequential decay of intermediate reaction products and/or simultaneous breakup process. It was found that the three body simultaneous decay, p+{alpha}+{sup 8}Be, and the sequential decay via p+{sup 12}C{sup *}{sub 3-} and {alpha}+{sup 9}B{sub g.s.} are most important in the proton-induced breakup of {sup 12}C for energies up to 30 MeV. (author)

  5. Cross sections for 12C+12C→12C(0+2)+12C(g.s.) using breathing mode doorways

    International Nuclear Information System (INIS)

    Ahmed, M.U.; Beres, W.P.

    1982-01-01

    A previously derived projection operator method is applied to the calculation of the cross section for 12 C+ 12 C→ 12 C(0 + 2 )+ 12 C(g.s.) with a breathing mode model being used to describe the 0 + 2 (7.68 MeV) state of 12 C. The relationship to processes leading to alpha particle channels is discussed. The cross section for 12 C+ 12 C→ 12 C(3 - )+ 12 C(g.s.) is also calculated and possible correlations with inelastic scattering to the 0 + 2 and 2 + states of 12 C are discussed. The results for both 0 + 2 and 3 - inelastic scattering are in reasonable agreement with experiment

  6. Avian Reovirus Protein p17 Functions as a Nucleoporin Tpr Suppressor Leading to Activation of p53, p21 and PTEN and Inactivation of PI3K/AKT/mTOR and ERK Signaling Pathways.

    Directory of Open Access Journals (Sweden)

    Wei-Ru Huang

    Full Text Available Avian reovirus (ARV protein p17 has been shown to regulate cell cycle and autophagy by activation of p53/PTEN pathway; nevertheless, it is still unclear how p53 and PTEN are activated by p17. Here, we report for the first time that p17 functions as a nucleoporin Tpr suppressor that leads to p53 nuclear accumulation and consequently activates p53, p21, and PTEN. The nuclear localization signal (119IAAKRGRQLD128 of p17 has been identified for Tpr binding. This study has shown that Tpr suppression occurs by p17 interacting with Tpr and by reducing the transcription level of Tpr, which together inhibit Tpr function. In addition to upregulation of PTEN by activation of p53 pathway, this study also suggests that ARV protein p17 acts as a positive regulator of PTEN. ARV p17 stabilizes PTEN by stimulating phosphorylation of cytoplasmic PTEN and by elevating Rak-PTEN association to prevent it from E3 ligase NEDD4-1 targeting. To activate PTEN, p17 is able to promote β-arrestin-mediated PTEN translocation from the cytoplasm to the plasma membrane via a Rock-1-dependent manner. The accumulation of p53 in the nucleus induces the PTEN- and p21-mediated downregulation of cyclin D1 and CDK4. Furthermore, Tpr and CDK4 knockdown increased virus production in contrast to depletion of p53, PTEN, and LC3 reducing virus yield. Taken together, our data suggest that p17-mediated Tpr suppression positively regulates p53, PTEN, and p21 and negatively regulates PI3K/AKT/mTOR and ERK signaling pathways, both of which are beneficial for virus replication.

  7. Expression of p27 and c-Myc by immunohistochemistry in breast ductal cancers in African American women.

    Science.gov (United States)

    Khan, Farhan; Ricks-Santi, Luisel J; Zafar, Rabia; Kanaan, Yasmine; Naab, Tammey

    2018-06-01

    Proteins p27 and c-Myc are both key players in the cell cycle. While p27, a tumor suppressor, inhibits progression from G1 to S phase, c-Myc, a proto-oncogene, plays a key role in cell cycle regulation and apoptosis. The objective of our study was to determine the association between expression of c-Myc and the loss of p27 by immunohistochemistry (IHC) in the four major subtypes of breast cancer (BC) (Luminal A, Luminal B, HER2, and Triple Negative) and with other clinicopathological factors in a population of 202 African-American (AA) women. Tissue microarrays (TMAs) were constructed from FFPE tumor blocks from primary ductal breast carcinomas in 202 AA women. Five micrometer sections were stained with a mouse monoclonal antibody against p27 and a rabbit monoclonal antibody against c-Myc. The sections were evaluated for intensity of nuclear reactivity (1-3) and percentage of reactive cells; an H-score was derived from the product of these measurements. Loss of p27 expression and c-Myc overexpression showed statistical significance with ER negative (p c-Myc expression/p27 loss and luminal A/B and Her2 overexpressing subtypes. In our study, a statistically significant association between c-Myc expression and p27 loss and the triple negative breast cancers (TNBC) was found in AA women. A recent study found that constitutive c-Myc expression is associated with inactivation of the axin 1 tumor suppressor gene. p27 inhibits cyclin dependent kinase2/cyclin A/E complex formation. Axin 1 and CDK inhibitors may represent possible therapeutic targets for TNBC. Copyright © 2018 Elsevier Inc. All rights reserved.

  8. Isothermal section of the Er-Fe-Al ternary system at 800 oC

    International Nuclear Information System (INIS)

    Jemmali, M.; Walha, S.; Pasturel, M.; Tougait, O.; Ben Hassen, R.; Noel, H.

    2010-01-01

    Physico-chemical analysis techniques, including X-ray diffraction and Scanning Electron Microscope-Energy Dispersive X-ray Spectroscopy, were employed to construct the isothermal section of the Er-Fe-Al system at 800 o C. At this temperature, the phase diagram is characterized by the formation of five intermediate phases, ErFe 12-x Al x with 5 ≤ x ≤ 8 (ThMn 12 -type), ErFe 1+x Al 1-x with -0.2 ≤ x ≤ 0.75 (MgZn 2 -type), ErFe 3-x Al x with 0.5 2 Al-type), Er 2 Fe 17-x Al x with 4.74 ≤ x ≤ 5.7 (TbCu 7 -type) and Er 2 Fe 17-x Al x with 5.7 2 Zn 17 -type), seven extensions of binaries into the ternary system; ErFe x Al 3-x with x 3 Cu-type), ErFe x Al 2-x with x ≤ 0.68 (MgCu 2 -type), Er 2 Fe x Al 1-x with x ≤ 0.25 (Co 2 Si-type), ErFe 2-x Al x with x ≤ 0.5 (MgCu 2 -type), ErFe 3-x Al x with x ≤ 0.5 (Be 3 Nb-type), Er 6 Fe 23-x Al x with x ≤ 8 (Th 6 Mn 23 -type), and Er 2 Fe 17-x Al x with x ≤ 4.75 (Th 2 Ni 17 -type) and one intermetallic compound; the ErFe 2 Al 10 (YbFe 2 Al 10 -type).

  9. C-O volatiles in Apollo 15 and Apollo 17 picritic glasses

    Science.gov (United States)

    Rutherford, Malcolm J.; Fogel, Robert A.

    1993-01-01

    A15 and A17 primitive picritic glasses have been examined by FTIR for the presence of dissolved C-O species to determine the role of C-O gasses on driving lunar fire-fountains. A15 green and yellow glasses were extensively studied and found to be free of dissolved C species down to FTIR detection limits (10-100 ppm; species and sample specific). Preliminary data on A17 orange glasses are similarly devoid of FTIR detectable C-O species. Re-analyses of the C-O driving mechanism theory for mare volcanism demonstrates the need to determine the fO2 of the lunar interior; the factor that most critically determined the role of C gasses in the fire-fountaining events. Oxygen fugacities equivalent to IW-0.5 and above imply dissolved CO3(=) in the primitive glasses at levels above FTIR detection. The f02's below IW-0.5 imply concentrations of CO3(=) below FTIR detection. Recent data suggesting lunar mantle fO2's of IW-2 or less, strongly mitigate against finding FTIR measurable dissolved CO3(=) consistent with the findings of this study.

  10. Expressão imuno-histoquímica de c-erb-B2 e p53 em carcinomas gástricos Imunohistochemical expression of c-erb-B2 and p53 in gastric carcinomas

    Directory of Open Access Journals (Sweden)

    Maria Dirlei F. S. Begnami

    2005-08-01

    Full Text Available INTRODUÇÃO: Em nosso meio, os carcinomas gástricos ainda são neoplasias bastante freqüentes e responsáveis por altas taxas de mortalidade. Recentemente, têm-se demonstrado a expressão de p53 e a amplificação do gene c-erb-B2 nos carcinomas gástricos. A relevância e o significado biológico destas alterações ainda não foram totalmente estabelecidos. OBJETIVO: Estudar as expressões imuno-histoquímicas de p53 e c-erb-B2 em 482 casos de carcinomas gástricos. MATERIAL E MÉTODOS: Foram construídos três blocos de tissue microarray (TMA utilizando-se duplicatas de 482 casos de carcinomas gástricos. Os cortes foram corados por hematoxilina e eosina (HE, tendo sido feita pesquisa para p53 e c-erb-B2. Foram considerados positivos para p53 os casos com marcação nuclear em mais de 10% das células tumorais. Para o c-erb-B2 foram considerados positivos os casos com marcação de membrana completa em mais de 10% das células tumorais. RESULTADOS: A expressão de p53 e c-erb-B2 foi observada em 30% e 12% dos casos, respectivamente. Em relação aos tipos histológicos observou-se correlação entre os carcinomas do tipo intestinal e a expressão de c-erb-B2 (p INTRODUCTION: Gastric cancer is one of the commonest cancers in our country being responsible for a high mortality rate. Recently, the expression of p53 and amplification of c-erb-B2 gene have been described in gastric carcinoma. The relevance and biological significance of these findings are not established yet. OBJECTIVE: The authors investigated p53, c-erb-B2 immunohistochemical expression in 482 cases of gastric carcinomas. MATERIAL AND METHODS: Tissue microarray (TMA blocks were designed using replicate samples of paraffin-embedded tissue from 482 gastric carcinomas. Sections were stained with HE, and antibodies to p53 and c-erb-B2. Cases were considered p53 positive if nuclear staining was detected in > 10% of the tumor cells. Cases were assessed c-erb-B2 positive if the

  11. Elastic scattering of antiprotons on 4He at 600 MeV/c

    International Nuclear Information System (INIS)

    Batusov, Yu.A.; Bunyatov, S.A.; Falomkin, I.V.

    1990-01-01

    The differential cross section for antiproton elastic scattering on 4 He at 607.7 MeV/c momentum is measured. The total elastic cross section σ el =(120.9±2.5) mb and the total p -4 He interaction cross section σ tot =(360.1±5.6) mb are determined. Partial wave analysis reveals that the P,D and F-waves are dominant in the scattering. The angular dependence of differential cross section exhibits the diffraction pattern typical of scattering on a strongly absorbing disk. Simply taking into account diffuseness of the disk provides good agreement of calculations with the experimental data. 17 refs.; 8 figs.; 1 tab

  12. Toxic C17-Sphinganine Analogue Mycotoxin, Contaminating Tunisian Mussels, Causes Flaccid Paralysis in Rodents

    Directory of Open Access Journals (Sweden)

    Riadh Marrouchi

    2013-11-01

    Full Text Available Severe toxicity was detected in mussels from Bizerte Lagoon (Northern Tunisia using routine mouse bioassays for detecting diarrheic and paralytic toxins not associated to classical phytoplankton blooming. The atypical toxicity was characterized by rapid mouse death. The aim of the present work was to understand the basis of such toxicity. Bioassay-guided chromatographic separation and mass spectrometry were used to detect and characterize the fraction responsible for mussels’ toxicity. Only a C17-sphinganine analog mycotoxin (C17-SAMT, with a molecular mass of 287.289 Da, was found in contaminated shellfish. The doses of C17-SAMT that were lethal to 50% of mice were 750 and 150 μg/kg following intraperitoneal and intracerebroventricular injections, respectively, and 900 μg/kg following oral administration. The macroscopic general aspect of cultures and the morphological characteristics of the strains isolated from mussels revealed that the toxicity episodes were associated to the presence of marine microfungi (Fusarium sp., Aspergillus sp. and Trichoderma sp. in contaminated samples. The major in vivo effect of C17-SAMT on the mouse neuromuscular system was a dose- and time-dependent decrease of compound muscle action potential amplitude and an increased excitability threshold. In vitro, C17-SAMT caused a dose- and time-dependent block of directly- and indirectly-elicited isometric contraction of isolated mouse hemidiaphragms.

  13. Distribution of spin dipole transition strength in the 15N(n,p)15C reaction

    International Nuclear Information System (INIS)

    Cellar, A.; Alford, W.P.; Helmer, R.; Abegg, R.; Frekers, D.; Haeusser, O.; Henderson, R.S.; Jackson, K.P.; Vetterli, M.; Yen, S.; Jeppesen, R.; Larson, B.; Mildenberger, J.; Pointon, B.W.; Trudel, A.

    1990-08-01

    The reaction 15 N(n,p) 15 C was studied at a neutron energy of 288 MeV using the TRIUMF (n,p) charge exchange facility and a high pressure gas target. The angular distributions for spin dipole (ΔL=1) transitions to the states in 15 C at energies 0 MeV and 0.740 MeV, as well as for higher excitation energies, were measured and the results were compared with DWIA calculations. The measured distribution of the spin dipole strength agrees well with shell model predictions, indicating that a rather simple model provides a satisfactory description of the 15 N ground state, and of positive parity states in 15 C up to about 18 MeV excitation. The magnitude of the peak cross sections (at ≅ 7 degrees) is described well by the calculations when the theoretical cross section is renormalized by a factor 0.7. The calculated cross sections near zero degrees are generally smaller than experimental data. It this is a general feature of ΔL=1 transitions, it suggests that estimates of GT strength based on a multipole decomposition of measured cross sections may be too high. (Author) (41 refs., 3 tabs., 14 figs.)

  14. First-forbidden mirror β-decays in A = 17 mass region and the role of proton halo in 17F

    International Nuclear Information System (INIS)

    Michel, N.; Okolowicz, J.; Ploszajczak, M.; Okolowicz, J.; Nowacki, F.; Ploszajczak, M.

    2001-01-01

    The first-forbidden β-decay of 17 Ne into the 'halo' state J π 1/2 + 1 of 17 F presents one of the largest measured asymmetries for mirror β-decay feeding bound final states. This asymmetry is studied in the framework of the Shell Model Embedded in the Continuum (SMEC). The spatial extent of single particle orbits calculated in SMEC is constrained by the proton capture cross-section 16 O(p,γ) 17 F. This allows to estimate the mirror symmetry breaking in 17 F and 17 O nuclei. (authors)

  15. Investigation of the 600 C isothermal section of the Fe-Al-Ce ternary system

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Huiyun; Yin, Fucheng [Xiangtan Univ., Hunan (China). School of Materials Science and Engineering; Xiangtan Univ., Hunan (China). Key Laboratory of Materials Design and Preparation Technology of Hunan Province; Li, Zhi [Xiangtan Univ., Hunan (China). School of Materials Science and Engineering; Xiangtan Univ., Hunan (China). Key Laboratory of Materials Design and Preparation Technology of Hunan Province; Xiangtan Univ., Hunan (China). Key Laboratory of Key Film Materials and Application for Equipment (Hunan province); Ji, Li [South China University of Technology, Guangdong (China). School of Materials Science and Engineering

    2017-01-15

    The isothermal section of the Fe-Al-Ce system at 600 C was determined by means of scanning electron microscopy coupled with energy dispersive spectroscopy and X-ray powder diffraction. Twenty three-phase regions were confirmed experimentally, and two three-phase regions could be deduced in this section. Five ternary compounds, i. e., τ{sub 1}, τ{sub 2}, τ{sub 3}, τ{sub 5}, and τ{sub 6}, exist at 600 C. The Fe{sub 2}Ce phase contains 6.6 at.% Al in the Fe-Al-Ce system. The Fe solubility in α-Al, αAl{sub 11}Ce{sub 3}, αAl{sub 3}Ce, Al{sub 2}Ce, AlCe, and AlCe{sub 3} is approximately 1.7 at.%, 1.1 at.%, 1.2 at.%, 1.3 at.%, 5.8 at.%, and 0.1 at.%, respectively, and the solubility of Ce in α-Al, FeAl{sub 3}, Fe{sub 2}Al{sub 5}, FeAl{sub 2}, and FeAl is approximately 0.1 at.%, 1.2 at.%, 1.9 at.%, 0.9 at.%, and 3.7 at.%, respectively.

  16. Production of muon pairs in the continuum region by 39.5 GeV/c πsup(+-), Ksup(+-), p and anti p beams incident on a tungsten target

    International Nuclear Information System (INIS)

    Corden, M.; Dowell, J.D.; Garvey, J.; Homer, R.J.; Jobes, M.; Kenyon, I.R.; McMahon, T.J.; Owen, R.C.; Sumorok, K.C.T.; Vallance, R.J.

    1980-01-01

    Inclusive dimuon production by 39.5 GeV/c πsup(+-), Ksup(+-), p and panti p is described for masses greater than 2.0 GeV/c 2 . The π - , π + and (π - - π + ) continuum cross-sections exceed the naive Drell-Yan predictions by a factor approx. 2.4. The pion valence structure function has been measured and is consistent with a corresponding measurement at 200 GeV/c. (orig.)

  17. Isothermal sections at 500 deg C of the Dy-V-Al and Dy-Cr-Al systems in the aluminium rich regions

    International Nuclear Information System (INIS)

    Rykhal', R.M.; Zarechnyuk, O.S.; Mats'kiv, O.P.

    1979-01-01

    X-ray diffraction and microscopic analyses have been used to investigate the ternary system dysprosium-vanadium-aluminium in the aluminium rich region. In the system Dy-V-Al two ternary compounds have been found: DyV 2 Al 20 (cubic structure, CeCr 2 Al 20 type, a=14.54 A and approximately DyVAl 8 (hexagonal crystal system, structure unknown, a=10.86, c=17.71 A, c/a=1.631). In the system dysprosium-chromium-aluminium three ternary compounds have been found: DyCr 2 Al 20 (cubic structure, CeCr 2 Al 20 type, a=14.39), approximately equal to DyCrAl 8 ) hexagonal crystal system, structure type unkown a=10.75, c=17.60 A, c/a=1.637) and DyCr 4 Al 8 (tetragonal structure, CeMn 4 Al 8 type, a=8.87, c=5.04 A, c/a=0.568). Isothermal sections of the systems Dy-V-Al and Dy-Cr-Al have been plotted at 500 deg C

  18. Observation of $\\eta_{c}(2S) \\to p \\bar p$ and search for $X(3872) \\to p \\bar p$ decays

    CERN Document Server

    Aaij, Roel

    2017-06-10

    The first observation of the decay $\\eta_{c}(2S) \\to p \\bar p$ is reported using proton-proton collision data corresponding to an integrated luminosity of $3.0\\rm \\, fb^{-1}$ recorded by the LHCb experiment at centre-of-mass energies of 7 and 8 TeV. The $\\eta_{c}(2S)$ resonance is produced in the decay $B^{+} \\to [c\\bar c] K^{+}$. The product of branching fractions normalised to that for the $J/\\psi$ intermediate state, ${\\cal R}_{\\eta_{c}(2S)}$, is measured to be \\begin{align*} {\\cal R}_{\\eta_{c}(2S)}\\equiv\\frac{{\\mathcal B}(B^{+} \\to \\eta_{c}(2S) K^{+}) \\times {\\mathcal B}(\\eta_{c}(2S) \\to p \\bar p)}{{\\mathcal B}(B^{+} \\to J/\\psi K^{+}) \\times {\\mathcal B}(J/\\psi\\to p \\bar p)} =~& (1.58 \\pm 0.33 \\pm 0.09)\\times 10^{-2}, \\end{align*} where the first uncertainty is statistical and the second systematic. No signals for the decays $B^{+} \\to X(3872) (\\to p \\bar p) K^{+}$ and $B^{+} \\to \\psi(3770) (\\to p \\bar p) K^{+}$ are seen, and the 95\\% confidence level upper limits on their relative branching ratios ar...

  19. Observation of the decay $\\Lambda_b^0 \\to \\Lambda_c^+ p \\overline{p} \\pi^-$

    CERN Document Server

    Aaij, Roel; LHCb Collaboration; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albicocco, Pietro; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Alfonso Albero, Alejandro; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Atzeni, Michele; Auriemma, Giulio; Bachmann, Sebastian; Back, John; Baker, Sophie; Balagura, Vladislav; Baldini, Wander; Baranov, Alexander; Barlow, Roger; Barsuk, Sergey; Barter, William; Baryshnikov, Fedor; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Beiter, Andrew; Bel, Lennaert; Beliy, Nikita; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Beranek, Sarah; Berezhnoy, Alexander; Bernet, Roland; Berninghoff, Daniel; Bertholet, Emilie; Bertolin, Alessandro; Betancourt, Christopher; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Birnkraut, Alex; Bizzeti, Andrea; Bjørn, Mikkel; Blake, Thomas; Blanc, Frederic; Blusk, Steven; Bocci, Valerio; Boente Garcia, Oscar; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Brodski, Michael; Brodzicka, Jolanta; Brundu, Davide; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Byczynski, Wiktor; Cadeddu, Sandro; Cai, Hao; Calabrese, Roberto; Calladine, Ryan; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Cattaneo, Marco; Cavallero, Giovanni; Cenci, Riccardo; Chamont, David; Chapman, Matthew George; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Chitic, Stefan-Gabriel; Chobanova, Veronika; Chrzaszcz, Marcin; Chubykin, Alexsei; Ciambrone, Paolo; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collins, Paula; Colombo, Tommaso; Comerma-Montells, Albert; Contu, Andrea; Coombs, George; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Da Silva, Cesar Luiz; Dall'Occo, Elena; Dalseno, Jeremy; Danilina, Anna; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Del Buono, Luigi; Delaney, Blaise; Dembinski, Hans Peter; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Nezza, Pasquale; Didenko, Sergey; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Douglas, Lauren; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Durante, Paolo; Durham, John Matthew; Dutta, Deepanwita; Dzhelyadin, Rustem; Dziewiecki, Michal; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Ely, Scott; Ene, Alexandru; Escher, Stephan; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fazzini, Davide; Federici, Luca; Fernandez, Gerard; Fernandez Declara, Placido; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Lopes, Lino; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Funk, Wolfgang; Färber, Christian; Gabriel, Emmy; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; Garcia Plana, Beatriz; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, Vladimir; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Govorkova, Ekaterina; Grabowski, Jascha Peter; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greim, Roman; Griffith, Peter; Grillo, Lucia; Gruber, Lukas; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hamilton, Brian; Han, Xiaoxue; Hancock, Thomas Henry; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Hasse, Christoph; Hatch, Mark; He, Jibo; Hecker, Malte; Heinicke, Kevin; Heister, Arno; Hennessy, Karol; Henry, Louis; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hopchev, Plamen Hristov; Hu, Wenhua; Huang, Wenqian; Huard, Zachary; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hutchcroft, David; Ibis, Philipp; Idzik, Marek; Ilten, Philip; Ivshin, Kuzma; Jacobsson, Richard; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kazeev, Nikita; Kecke, Matthieu; Keizer, Floris; Kelsey, Matthew; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kim, Kyung Eun; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Klimkovich, Tatsiana; Koliiev, Serhii; Kolpin, Michael; Kopecna, Renata; Koppenburg, Patrick; Kotriakhova, Sofia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreps, Michal; Kress, Felix Johannes; Krokovny, Pavel; Krupa, Wojciech; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Pei-Rong; Li, Tenglin; Li, Zhuoming; Liang, Xixin; Likhomanenko, Tatiana; Lindner, Rolf; Lionetto, Federica; Lisovskyi, Vitalii; Liu, Xuesong; Loh, David; Loi, Angelo; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Macko, Vladimir; Mackowiak, Patrick; Maddrell-Mander, Samuel; Maev, Oleg; Maguire, Kevin; Maisuzenko, Dmitrii; Majewski, Maciej Witold; Malde, Sneha; Malecki, Bartosz; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Marangotto, Daniele; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marinangeli, Matthieu; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurice, Emilie; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McNab, Andrew; McNulty, Ronan; Mead, James Vincent; Meadows, Brian; Meaux, Cedric; Meier, Frank; Meinert, Nis; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Millard, Edward James; Minard, Marie-Noelle; Minzoni, Luca; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Mombächer, Titus; Monroy, Igancio Alberto; Monteil, Stephane; Morandin, Mauro; Morello, Gianfranco; Morello, Michael Joseph; Morgunova, Olga; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Thi Dung; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nogay, Alla; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Ossowska, Anna; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palutan, Matteo; Panshin, Gennady; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Pereima, Dmitrii; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Pietrzyk, Boleslaw; Pietrzyk, Guillaume; Pikies, Malgorzata; Pinci, Davide; Pisani, Flavio; Pistone, Alessandro; Piucci, Alessio; Placinta, Vlad-Mihai; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poli Lener, Marco; Poluektov, Anton; Polukhina, Natalia; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Ponce, Sebastien; Popov, Alexander; Popov, Dmitry; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Pullen, Hannah Louise; Punzi, Giovanni; Qian, Wenbin; Qin, Jia-Jia; Quagliani, Renato; Quintana, Boris; Rachwal, Bartlomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Ratnikov, Fedor; Raven, Gerhard; Ravonel Salzgeber, Melody; Reboud, Meril; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rinnert, Kurt; Robbe, Patrick; Robert, Arnaud; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Vidal, Joan; Saborido Silva, Juan Jose; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarpis, Gediminas; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schreiner, HF; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepulveda, Eduardo Enrique; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Iwan Thomas; Smith, Mark; Soares Lavra, Lais; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavomira; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stepanova, Margarita; Stevens, Holger; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Stramaglia, Maria Elena; Straticiuc, Mihai; Straumann, Ulrich; Strokov, Sergey; Sun, Jiayin; Sun, Liang; Swientek, Krzysztof; Syropoulos, Vasileios; Szumlak, Tomasz; Szymanski, Maciej Pawel; T'Jampens, Stephane; Tang, Zhipeng; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Tourinho Jadallah Aoude, Rafael; Tournefier, Edwige; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tully, Alison; Tuning, Niels; Ukleja, Artur; Usachov, Andrii; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagner, Alexander; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Verlage, Tobias Anton; Vernet, Maxime; Vesterinen, Mika; Viana Barbosa, Joao Vitor; Vieira, Daniel; Vieites Diaz, Maria; Viemann, Harald; Vilasis-Cardona, Xavier; Vitkovskiy, Arseniy; Vitti, Marcela; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Walsh, John; Wang, Jianchun; Wang, Mengzhen; Wang, Yilong; Wang, Zhenzi; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Weisser, Constantin; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Winn, Michael Andreas; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wyllie, Kenneth; Xiao, Dong; Xie, Yuehong; Xu, Ao; Xu, Menglin; Xu, Qingnian; Xu, Zehua; Xu, Zhirui; Yang, Zhenwei; Yang, Zishuo; Yao, Yuezhe; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zheng, Yangheng; Zhu, Xianglei; Zhukov, Valery; Zonneveld, Jennifer Brigitta; Zucchelli, Stefano; Aaij, Roel

    2018-01-01

    The decay $\\Lambda_b^0 \\to \\Lambda_c^+ p \\overline{p} \\pi^-$ is observed using $pp$ collision data collected with the LHCb detector at centre-of-mass energies of $\\sqrt{s}=$ 7 and 8 TeV, corresponding to an integrated luminosity of 3 $fb^{-1}$. The ratio of branching fractions between $\\Lambda_b^0 \\to \\Lambda_c^+ p \\overline{p} \\pi^-$ and $\\Lambda_b^0 \\to \\Lambda_c^+ \\pi^-$ decays is measured to be \\begin{equation*} \\frac{\\mathcal{B}(\\Lambda_b^0 \\to \\Lambda_c^+ p \\overline{p}\\pi^-)}{\\mathcal{B}(\\Lambda_b^0 \\to \\Lambda_c^+ \\pi^-)} = 0.0540 \\pm 0.0023 \\pm 0.0032. \\end{equation*} Two resonant structures are observed in the $ \\Lambda_c^+ \\pi^-$ mass spectrum of the ${\\Lambda_b^0 \\to \\Lambda_c^+ p\\overline{p} \\pi^-}$ decays, corresponding to the $\\Sigma_c(2455)^0$ and $\\Sigma_c^{*}(2520)^0$ states. The ratios of branching fractions with respect to the decay $\\Lambda_b^0 \\to \\Lambda_c^+ p \\overline{p} \\pi^-$ are \\begin{align*} \\frac{\\mathcal{B} (\\Lambda_b^0 \\to \\Sigma_c^0 p\\overline{p})\\times\\mathcal{B}(\\Sigma_c^0\\...

  20. New results from the NA49 experiment on hadron production in p+p and p+C interactions and survey of backward hadrons in p+C collisions

    Directory of Open Access Journals (Sweden)

    Makariev M.

    2013-06-01

    Full Text Available Recent results on proton, anti-proton, neutron and charged kaon production in proton-proton and proton, anti-proton, neutron, deuteron and triton production in proton-carbon collisions at 158 GeV/c beam momentum are presented. Data samples of 4.8 million and 385 734 inelastic events in p+p and p+C, respectively, are obtained with the NA49 detector at the CERN SPS accelerator. The charged particles are identified by energy loss measurement in a system of four TPC chambers, while the neutrons are detected in a forward hadronic calorimeter. The data cover a major fraction of the phase space, ranging from 0 to 1.9 GeV in pT and in Feynman x variable from -0.8 to 0.95 for protons, from -0.2 to 0.3 for anti-protons, from 0.1 to 0.95 for neutrons and from 0 to 0.5 for kaons. The comparison of the results on proton and neutron production in p+p interactions and deep inelastic e+p collisions at HERA reveals an independence of target fragmentation on the projectile type. Using the charged kaon data in p+p collisions as a reference, a new evaluation of the energy dependence of kaon production, including neutral kaons, is conducted over a range from 3 GeV to p+p− collider energies. A survey of backward production of protons and pions in p+C collisions in the range of lab angles from 10 to 180 degrees, from 0.2 to 1.2 GeV/c in lab momentum and from 1 to 400 GeV/c in projectile momentum has been performed.

  1. Synthesis of organic substances labelled with {sup 14}C and {sup 35}S; Syntheses de molecules organiques marquees par le carbone-14 et le soufre-35

    Energy Technology Data Exchange (ETDEWEB)

    Pichat, L [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    After a brief history of the development of the Section des Molecules marquees of the Frenchmic Energy Commission, the author gives an outline of the synthesis of the following labelled compounds: benzene {sup 14}C-6; phenyl-p-fluorophenyl, thienyl-2 {beta} alanines {beta} {sup 14}C; noradrenaline {beta} {sup 14}C (arterenol {beta} {sup 14}C), dotriacontane {sup 14}C-16-17, aminoethane sulfinic acid (hypotaurine {sup 35}S). (author)Fren. [French] Apres un bref historique du developpement de la Section des Molecules marquees du Commissariat a l'Energie Atomique fran is, l'auteur donne un resume des syntheses des composes marques suivants: benzene {sup 14}C-6; phenyl-p-fluorophenyl, thienyl-2 {beta} alamines {beta} {sup 14}C; noradrenaline {beta} {sup 14}C (arterenol {beta} {sup 14}C), dotriacontane {sup 14}C-16-17, acide aminoethane sulfinique (hypotaurine {sup 35}S). (auteur)

  2. Metabolism of 4-/sup 14/C-dehydroepiandrosterone and 4-/sup 14/C-4-Androstene-3, 17-dione by isolated cells of early human placenta

    Energy Technology Data Exchange (ETDEWEB)

    Dziadkowiec, I; Czarnik, Z; Rembiesa, R [Department of Endocrinology, Institute of Pharmacology, Polish Academy of Sciences, Krakow

    1977-03-01

    The preparation of isolated cells was used for the study of the metabolism of 4-/sup 14/C-dehydroepiandrosterone and 4-/sup 14/C-4-androstene-3,17-dione in early human placenta. Free cell suspension converted dehydroepiandrosterone and 4-androstene-3,17-dione into estrone, estradiol-17..beta.., 4-androstene-3,17-dione and testosterone.

  3. K-p backward elastic scattering between 476 and 1084 MeV/c

    International Nuclear Information System (INIS)

    Hamilton, R.P.

    1979-09-01

    The differential cross-section for K - p backward elastic scattering was measured in steps of 10-20 MeV/c between 476 and 1084 MeV/c at the Brookhaven AGS. A negative kaon beam was focused onto a 21 cm long liquid hydrogen target and the forward scattered protons were identified kinematically by means of a single arm magnetic spectrometer. A Monte Carlo computer program aided in the subtraction of background events and in the calculation of correction factors. The new data have an average statistical precision of 2.5% which is an order of magnitude improvement over previous results. Together with a new partial wave analysis, the new data give additional evidence for a resonance between 1700 and 1725 MeV. The best fit to the data finds this to be a D 13 resonance with a mass of 1708 MeV and a width of 27 MeV. Comparable improvement in precision was also obtained in a measurement of the differential cross section for K - p → Σ - π + in which the π + emerges at 0 0 . 47 references

  4. Measurement of the B Meson Differential Cross Section dσ/dpT in p bar p Collisions at √s=1.8 TeV

    International Nuclear Information System (INIS)

    Abe, F.; Albrow, M.G.; Amendolia, S.R.; Amidei, D.; Antos, J.; Anway-Wiese, C.; Apollinari, G.; Areti, H.; Atac, M.; Auchincloss, P.; Azfar, F.; Azzi, P.; Bacchetta, N.; Badgett, W.; Bailey, M.W.; Bao, J.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Bensinger, J.; Benton, D.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhatti, A.; Biery, K.; Binkley, M.; Bird, F.; Bisello, D.; Blair, R.E.; Blocker, C.; Bodek, A.; Bokhari, W.; Bolognesi, V.; Bortoletto, D.; Boswell, C.; Boulos, T.; Brandenburg, G.; Bromberg, C.; Buckley-Geer, E.; Budd, H.S.; Burkett, K.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Cammerata, J.; Campagnari, C.; Campbell, M.; Caner, A.; Carithers, W.; Carlsmith, D.; Castro, A.; Cen, Y.; Cervelli, F.; Chao, H.Y.; Chapman, J.; Cheng, M.; Chiarelli, G.; Chikamatsu, T.; Chiou, C.N.; Christofek, L.; Cihangir, S.; Clark, A.G.; Cobal, M.; Contreras, M.; Conway, J.; Cooper, J.; Cordelli, M.; Couyoumtzelis, C.; Crane, D.; Cunningham, J.D.; Daniels, T.; DeJongh, F.; Delchamps, S.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Deninno, M.; Derwent, P.F.; Devlin, T.; Dickson, M.; Dittmann, J.R.; Donati, S.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Engels, E. Jr.; Eno, S.; Errede, D.; Errede, S.; Fan, Q.; Farhat, B.; Fiori, I.; Flaugher, B.; Foster, G.W.; Franklin, M.; Frautschi, M.; Freeman, J.; Friedman, J.; Fry, A.; Fuess, T.A.; Fukui, Y.; Funaki, S.; Gagliardi, G.; Galeotti, S.; Gallinaro, M.; Garfinkel, A.F.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Glenzinski, D.; Gold, M.; Gonzalez, J.; Gordon, A.; Goshaw, A.T.; Goulianos, K.; Grassmann, H.; Grewal, A.; Groer, L.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Hamilton, R.; Handler, R.; Hans, R.M.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.

    1995-01-01

    This paper presents the first direct measurement of the B meson differential cross section dσ/dp T in p bar p collisions at √s=1.8 TeV using a sample of 19.3±0.7 pb --1 accumulated by the Collider Detector at Fermilab. The cross section is measured in the central rapidity region |y| T (B)>6.0 GeV/c by fully reconstructing the B meson decays B + →J/ψK + and B 0 →J/ψK *0 (892), where J/ψ→μ + μ - and K *0 →K + π - . A comparison is made to the theoretical QCD prediction calculated at next-to-leading order

  5. Ecological stoichiometry of C, N and P on different time enclosed in desertification steppe soil

    Science.gov (United States)

    Yang, W. Z.; Jiao, Y.; Jia, Y. Q.

    2017-08-01

    It is the research object for the ecological stoichiometry of C, N and P on the different time of desertification grasslands enclosed and grazing grassland in Taibusi country of the Inner Mongolia, China. Through the measurement and analysis on ecological stoichiometric ratio of C, N and P in soil, the time of desertification grassland enclosed is determined. There are 13 soil of desertification grassland with different en-closure time, and 1 soil of grazing grassland. They are analyzed for the soil organic carbon, total nitro-gen, total phosphorus content and their density. The C/N of soil were increased with the extension of the time of desertification grassland enclosed. To 22 years enclosed, the C/N of grassland desertification soil enclosed is greater than the soil of grazing grassland that is 17. After the desertification grassland is en-closed, the C/N of soil is 13, and it is accumulated to maximum for C and N, and The grazing period is the best.

  6. Increased Th1, Th17 and pro-fibrotic responses in hepatitis C-infected patients are down-regulated after 12 weeks of treatment with pegylated interferon plus ribavirin.

    Science.gov (United States)

    Jimenez-Sousa, Maria Angeles; Almansa, Raquel; de la Fuente, Concha; Caro-Paton, Agustín; Ruiz, Lourdes; Sanchez-Antolín, Gloria; Gonzalez, Jose Manuel; Aller, Rocio; Alcaide, Noelia; Largo, Pilar; Resino, Salvador; de Lejarazu, Raul Ortiz; Bermejo-Martin, Jesus F

    2010-06-01

    Hepatitis C virus causes significant morbidity and mortality worldwide. The infection induces up-regulation of cytokine and chemokines commonly linked to the development of cellular and pro-inflammatory antiviral responses. The current standard in hepatitis C treatment consists of combination regimens of pegylated interferon-alpha plus ribavirin. The impact of combined treatment in the host immune response is still poorly understood. In the present study, we profiled 27 cytokines, chemokines and growth factors involved in the innate and adaptive responses to the virus in the serum of 27 hepatitis C virus-infected patients, before and after 12 weeks of combined treatment, and compared them to 10 healthy controls. Hepatitis C virus infection induced not only the secretion of chemokines and cytokines participating in Th1 responses (MIP-1 alpha, IP-10, TNF-alpha, IL-12p70, IL-2), but also cytokines involved in the development of Th17 responses (IL-6, IL-8, IL-9 and IL-17) and two pro-fibrotic factors (FGF-b, VEGF). The most important increases included MIP-1 alpha (4.7-fold increase compared to the control group), TNF-alpha (3.0-fold), FGF-b (3.4-fold), VEGF (3.5-fold), IP-10 (3.6-fold), IL-17 (107.0-fold), IL-9 (7.5-fold), IL-12p70 (7.0-fold), IL-2 (5.6-fold) and IL-7 (5.6-fold). Combined treatment with pegylated interferon-alpha plus ribavirin down-modulated the secretion of key Th1 and Th17 pro-inflammatory mediators, and pro-fibrotic growth factors as early as 12 weeks after treatment initiation. MIP-1 alpha, FGF-b, IL-17 decreased in a more dramatic manner in the group of responder patients than in the group of non-responders (fold-change in cEVR; fold-change in NcEVR): MIP-1 alpha (4.72;1.71), FGF-b (4.54;1.21), IL-17 (107.1;1.8). Correlation studies demonstrated that the decreases in the levels of these mediators were significantly associated with each other, pointing to a coordinated effect of the treatment on their secretion (r coefficient; p value): [ FGF

  7. Reaction π-p → eta'n in the 15-40 GeV/c momentum range

    International Nuclear Information System (INIS)

    Apel, W.D.; Augenstein, K.H.; Krueger, M.; Mueller, H.; Schinzel, D.; Schneider, H.; Sigurdsson, G.; Bertolucci, E.; Mannelli, I.; Pierazzini, G.M.; Quaglia, M.; Scribano, A.; Sergiampietri, F.; Vincelli, M.L.; Donskov, S.V.; Inyakin, A.V.; Johnson, R.; Kachanov, V.A.; Krasnokutsky, R.N.; Lednev, A.A.; Mikhailov, Yu.V.; Prokoshkin, Yu.D.; Shuvalov, R.S.; Kittenberger, V.; Leder, G.; Steuer, M.

    1979-01-01

    Measurements were made of the cross section of the reactions π - p → eta'(958)n, eta' → 2γ at momenta of 15, 20, 25, 30, and 40 GeV/c. The experiment was carried out on the IHEP 70 GeV accelerator using the 648 channel hodoscope spectrometer NICE for γ-ray detection. A total of 6000 eta' mesons were recorded. A sharp drop is seen in the differential cross section for t → 0. The dependences of the differential cross sections π - p → eta'n and π-p → etan on t are identical. On the basis of the ratio of the cross sections for these reactions at t = 0, i.e. R(eta'/n)sub(t=0) = 0.55 +- 0.06, the singlet-octet mixing angle for pseudoscalar mesons was determined to be β = -(18.2 +- 1.4) 0 . (Auth.)

  8. A survey of backward proton and pion production in p+C interactions at beam momenta from 1 to 400 GeV/c

    CERN Document Server

    Chvala, O.; Makariev, M.; Rybicki, A.; Varga, D.; Wenig, S.

    2013-01-01

    New data on proton and pion production in p+C interactions from the CERN PS and SPS accelerators are used in conjunction with other available data sets to perform a comprehensive survey of backward hadronic cross sections. This survey covers the complete backward hemisphere in the range of lab angles from 10 to 180 degrees, from 0.2 to 1.4 GeV/c in lab momentum and from 1 to 400 GeV/c in projectile momentum. Using the constraints of continuity and smoothness of the angular, momentum and energy dependences a consistent description of the inclusive cross sections is established which allows the control of the internal consistency of the nineteen available data sets.

  9. Differential cross sections for neutrino scattering on 12C

    International Nuclear Information System (INIS)

    Kolbe, E.

    1996-01-01

    Differential cross sections for neutrino scattering on 12 C are calculated within the (continuum) random phase approximation model. The charged current (ν e ,e - ) and (ν μ ,μ - ) capture reactions on 12 C are measured by the LSND Collaboration at LAMPF. We investigate and discuss the merits of such studies, especially the information that can be extracted from data for differential neutrino scattering cross sections. copyright 1996 The American Physical Society

  10. The reactions K/sup -/p to lambda pi /sup 0/, Lambda eta , Lambda eta ' at 42 GeV/c

    CERN Document Server

    Marzano, F; Hemingway, R J; Hoogland, W; Kluyver, J C; Loverre, P F; Maréchal, B; Massaro, G G G; Schrempp, Barbara; Tiecke, H G; Van de Walle, R T; Vergeest, J S M

    1977-01-01

    In a high statistics CERN 2 m bubble chamber experiment the different cross sections and polarizations of the Lambda for the reactions K/sup -/p to Lambda pi /sup 0/, Lambda eta , lambda eta ' at 4.2 GeV/c have been measured. The reaction K/sup -/p to Lambda eta exhibits a pronounced dip around -t approximately 0.5 (GeV/c)/sup 2/ and all three reactions show a significant backward peaking (-u<1.0 (GeV/c) /sup 2/). The Lambda polarization in the reaction K/sup -/p to Lambda pi /sup 0/ is measured to be significantly different from zero throughout most of the available t-range. Forward cross sections enable a determination of R/sub T/, the ratio of singlet/octet coupling eta /sub 1/KK**/ eta /sub 8/KK**. Backward cross sections are utilized to estimate the effective eta -nucleon coupling constant g /sub eta NN//sup 2/ over the -u range 0-1.5 (GeV/c)/sup 2/. (14 refs).

  11. Cyclopentanone: A raw material for production of C15 and C17 fuel precursors

    International Nuclear Information System (INIS)

    Hronec, Milan; Fulajtárova, Katarína; Liptaj, Tibor; Štolcová, Magdaléna; Prónayová, Naďa; Soták, Tomáš

    2014-01-01

    The synthesis of diesel or jet fuels intermediates from furfural or 5-hydroxymethylfurfural (HMF) via aqueous aldol-condensation with cyclopentanone was studied. Cyclopentanone is the product of furfural rearrangement in an aqueous system. Since the aldol-condensation reaction is conducted in an aqueous solution all these biomass-derived reactants can be applied as water solutions formed in the processes of their preparation. The aldol condensation of furfural with cyclopentanone is at low concentration of base and molar ratio of reactants 2:1 highly selective and after 40–80 min of reaction at a temperature of 40–100 °C more than 95 mol% yield of 2,5-bis (2-furylmethylidene) cyclopentan-1-one (F 2 C) was obtained. When instead of furfural as a reactant HMF was used higher than 98 mol% yield of 2,5-bis (5-hydroxymethyl-2-furylmethylidene) cyclopentan-1-one was achieved. The final products of aldol condensation of furfural and HMF are exclusively corresponding dimers, what enables to obtain after subsequent hydrogenation/hydrodeoxygenation step dialkylcyclopentane type of diesel or jet fuels having C 15 or C 17 molecules. - Highlights: • The aldol condensation of biomass derived cyclopentanone with furfural and HMF. • More than 95 mol % yields of products are achieved. • The products are compounds having exclusively 15 or 17 carbon atoms in molecule. • Reactants can be used as diluted aqueous solutions. • The products are separated as solids insoluble in water

  12. Wetlands Research Program. Corps of Engineers Wetlands Delineation Manual. Appendix C. Sections 1 and 2. Region 2 - Southeast.

    Science.gov (United States)

    1987-01-01

    22 7.V.: 14 -1b Jil -7 1 N.- .- WETLANDS RESEARCH PROGRAM TECHNICAL REPORT Y-87-1 CORPS OF ENGINEERS WETLANDS DELINEATION MANUAL APPENDIX C SECTIONS ...ARMYLA- US Army Corps of Engineers Washington, DC 20314-1000 B , , , -I *. 4 -w *" APPENDIX C SECTION 1 NATIONAL LIST OF PLANT SPECIES THAT OCCUR IN...Redtop FACW A. hiernalia (Walter) B.S.P. Winter bent FAC A. scabra Wilid. Rough bentgrass FAC A. st~nfyaL. Carpet bentgrass FACW Aletris aurea

  13. The (e,eprimep0) coincidence cross section for 12C at transfer energy of 40 MeV

    International Nuclear Information System (INIS)

    Tadokoro, T.; Hotta, T.; Miura, T.; Sugawara, M.; Takahashi, A.; Tamae, T.; Tanaka, E.; Miyase, H.; Tsubota, H.

    1994-01-01

    The energy spectra and angular distributions of protons from the 12 C(e,e primep ) coincidence reaction have been measured at azimuthal angles of φ p =-45 circle and -135 circle out of the scattering plane, at energy transfer of 40 MeV and momentum transfer of 0.35 fm -1 (69 MeV/c). The longitudinal-transverse interference term, as well as the non-interference term of the (e,e primep 0 ) cross section have been obtained, and the transition amplitudes are deduced in the LS coupling basis. The cross sections are compared with an RPA calculation. The photo-reaction cross section derived from the transverse term is in reasonable agreement with previous experimental results. ((orig.))

  14. Chapter A6. Section 6.4. pH

    Science.gov (United States)

    Wilde, Franceska D.; Busenberg, Eurybiades; Radtke, Dean B.

    2006-01-01

    Measurement of pH is critical to the understanding of the viability and vulnerability of environmental waters and is considered a master variable in determining the aqueous geochemistry of an aqueous system. pH is a measure that represents the hydrogen-ion concentration (activity) of a solution. This section of the National Field Manual (NFM) describes U.S. Geological Survey (USGS) guidance and protocols for measurement of pH in ground and surface waters.

  15. 12C(d,p) 13C reaction at Esub(d) = 30 MeV to the positive-parity states in 13C

    International Nuclear Information System (INIS)

    Ohnuma, H.; Hoshino, N.; Mikoshiba, O.

    1985-07-01

    The 12 C(d, p) 13 C reaction has been studied at Esub(d) = 30 MeV. All the known positive-parity states of 13 C below 10 MeV in excitation energy, including the 7/2 + and 9/2 + states, are observed in this reaction. The angular distributions for these positive-parity bound and unbound states are analyzed in CCBA frame work. The 13 C wave functions, which reproduce the resonant and non-resonant scattering of neutrons from 12 C, also give good accounts of the experimentally observed angular distributions and energy spectra of outgoing protons in the 12 C(d, p) 13 C reaction. In most cases the cross section magnitude and the angular distribution shape are primarily determined by the 0 + x j component, even if it is only a small fraction of the total wave function. An exception is the 7/2 + state, where the main contribution comes from the 2 + x dsub(5/2) component. The inclusion of the 4 + state in 12 C and the gsub(9/2) and gsub(7/2) neutron components in the n + 12 C system has very small effects on the low-spin states, but is indispensable for a good fit to the 7/2 + and 9/2 + angular distributions. The transitions to the negative-parity states, 1/2 1 - , 3/2 1 - , 5/2 - , 7/2 - and 1/2 3 - , are also observed experimentally, and analyzed by DWBA. (author)

  16. The 53Cr(γ,p)52V cross section

    International Nuclear Information System (INIS)

    Baciu, G.; Catana, D.; Galateanu, V.; Niculescu, R.I.V.

    1979-01-01

    The cross section of the photonuclear reaction 53 Cr(γ,p) 52 V between 14.4 MeV and 27 MeV was determined by the activation method. Chromium with natural isotopic abundance was irradiated in the bremsstrahlung beam of a betatron and γ rays were measured with a Ge(Li) spectrometer. Interfering reactions 52 Cr(n,p) 52 V and 54 Cr(γ,np) 52 V were evaluated. The stucture of the cross section curve is interpreted in terms of isospin splitting. (author)

  17. 29 CFR 1977.5 - Persons protected by section 11(c).

    Science.gov (United States)

    2010-07-01

    ... OCCUPATIONAL SAFETY AND HEALTH ACT OF 1970 General § 1977.5 Persons protected by section 11(c). (a) All employees are afforded the full protection of section 11(c). For purposes of the Act, an employee is defined... Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION...

  18. Detection of p62 on Paraffin Sections by Immunohistochemistry.

    Science.gov (United States)

    Watson, Alexander S; Soilleux, Elizabeth J

    2015-08-03

    The study of autophagy in human disease is a rapidly expanding field. Diagnostic paraffin sections of a variety of patient tissues, including bone marrow, are available to researchers-yet are unsuitable for traditional autophagy quantification methods such as western blot or electron microscopy. This protocol outlines the immunohistochemical detection of the protein p62 (sequestosome-1, encoded by the gene SQSTM1)-an indicator of autophagic degradative activity-in slide-mounted paraffin sections such as bone marrow samples cut by a trephine. The p62 protein is an autophagic cargo adaptor, capable of binding to ubiquitylated proteins as well as autophagosome membrane proteins (LC3B and GABA(A) receptor-associated protein [GABARAP] family members) and hypothesized thus to target protein aggregates for lysosomal degradation. p62 itself is degraded by autophagy, remaining at low levels when autophagy is induced, and has been shown to accumulate when autophagy is deficient. Qualitative assessment and comparison of p62 staining between healthy and disease sections or disease subtypes will help target further investigation into the potential roles for autophagy in a variety of disorders. © 2015 Cold Spring Harbor Laboratory Press.

  19. Differential electron scattering cross sections for the 3 (2)S to 3 (2)P0 h, k transitions in Mg II - Comparison of experiment and theory

    Science.gov (United States)

    Williams, I. D.; Chutjian, A.; Msezane, A. Z.; Henry, R. J. W.

    1985-01-01

    Angular differential electron scattering cross sections are reported for the unresolved inelastic 3s (2)S to 3p (2)P0 h, k transitions in Mg II for the first time. Relative differential cross sections have been measured at 35 eV and 50 eV in the angular range of Theta between 6 and 17 deg using the newly developed electron energy loss technique in a crossed electron-ion beam geometry. Theoretical values have been calculated in a five-state close-coupling approximation in which 3s, 3p, 3d, 4s, and 4p states were included, and to which measurements were normalized at Theta = 12 deg.

  20. Deep Downhole Seismic Testing at the Waste Treatment Plant Site, Hanford, WA. Volume I P-Wave Measurements in Borehole C4993 Seismic Records, Wave-Arrival Identifications and Interpreted P-Wave Velocity Profile.

    Energy Technology Data Exchange (ETDEWEB)

    Stokoe, Kenneth H.; Li, Song Cheng; Cox, Brady R.; Menq, Farn-Yuh

    2007-07-06

    In this volume (I), all P-wave measurements are presented that were performed in Borehole C4993 at the Waste Treatment Plant (WTP) with T-Rex as the seismic source and the Lawrence Berkeley National Laboratory (LBNL) 3-D wireline geophone as the at-depth borehole receiver. P-wave measurements were performed over the depth range of 370 to 1400 ft, typically in 10-ft intervals. However, in some interbeds, 5-ft depth intervals were used, while below about 1200 ft, depth intervals of 20 ft were used. Compression (P) waves were generated by moving the base plate of T-Rex for a given number of cycles at a fixed frequency as discussed in Section 2. This process was repeated so that signal averaging in the time domain was performed using 3 to about 15 averages, with 5 averages typically used. In addition to the LBNL 3-D geophone, called the lower receiver herein, a 3-D geophone from Redpath Geophysics was fixed at a depth of 22 ft in Borehole C4993, and a 3-D geophone from the University of Texas was embedded near the borehole at about 1.5 ft below the ground surface. This volume is organized into 12 sections as follows: Section 1: Introduction, Section 2: Explanation of Terminology, Section 3: Vp Profile at Borehole C4993, Sections 4 to 6: Unfiltered P-wave records of lower vertical receiver, reaction mass, and reference receiver, Sections 7 to 9: Filtered P-wave signals of lower vertical receiver, reaction mass and reference receiver, Section 10: Expanded and filtered P-wave signals of lower vertical receiver, and Sections 11 and 12: Waterfall plots of unfiltered and filtered lower vertical receiver signals.

  1. Deep Downhole Seismic Testing at the Waste Treatment Plant Site, Hanford, WA. Volume III P-Wave Measurements in Borehole C4997 Seismic Records, Wave-Arrival Identifications and Interpreted P-Wave Velocity Profile.

    Energy Technology Data Exchange (ETDEWEB)

    Stokoe, Kenneth H.; Li, Song Cheng; Cox, Brady R.; Menq, Farn-Yuh

    2007-06-06

    In this volume (III), all P-wave measurements are presented that were performed in Borehole C4997 at the Waste Treatment Plant (WTP) with T-Rex as the seismic source and the Lawrence Berkeley National Laboratory (LBNL) 3-D wireline geophone as the at-depth borehole receiver. P-wave measurements were performed over the depth range of 390 to 1220 ft, typically in 10-ft intervals. However, in some interbeds, 5-ft depth intervals were used. Compression (P) waves were generated by moving the base plate of T-Rex for a given number of cycles at a fixed frequency as discussed in Section 2. This process was repeated so that signal averaging in the time domain was performed using 3 to about 15 averages, with 5 averages typically used. In addition to the LBNL 3-D geophone, called the lower receiver herein, a 3-D geophone from Redpath Geophysics was fixed at a depth of 40 ft (later relocated to 27.5 ft due to visibility in borehole after rain) in Borehole C4997, and a 3-D geophone from the University of Texas was embedded near the borehole at about 1.5 ft below the ground surface. This volume is organized into 12 sections as follows: Section 1: Introduction, Section 2: Explanation of Terminology, Section 3: Vp Profile at Borehole C4997, Sections 4 to 6: Unfiltered P-wave records of lower vertical receiver, reaction mass, and reference receiver, Sections 7 to 9: Filtered P-wave signals of lower vertical receiver, reaction mass and reference receiver, Section 10: Expanded and filtered P-wave signals of lower vertical receiver, and Sections 11 and 12: Waterfall plots of unfiltered and filtered lower vertical receiver signals.

  2. Deep Downhole Seismic Testing at the Waste Treatment Plant Site, Hanford, WA. Volume II P-Wave Measurements in Borehole C4996 Seismic Records, Wave-Arrival Identifications and Interpreted P-Wave Velocity Profile.

    Energy Technology Data Exchange (ETDEWEB)

    Stokoe, Kenneth H.; Li, Song Cheng; Cox, Brady R.; Menq, Farn-Yuh

    2007-07-06

    In this volume (II), all P-wave measurements are presented that were performed in Borehole C4996 at the Waste Treatment Plant (WTP) with T-Rex as the seismic source and the Lawrence Berkeley National Laboratory (LBNL) 3-D wireline geophone as the at-depth borehole receiver. P-wave measurements were performed over the depth range of 360 to 1400 ft, typically in 10-ft intervals. However, in some interbeds, 5-ft depth intervals were used, while below about 1180 ft, depth intervals of 20 ft were used. Compression (P) waves were generated by moving the base plate of T-Rex for a given number of cycles at a fixed frequency as discussed in Section 2. This process was repeated so that signal averaging in the time domain was performed using 3 to about 15 averages, with 5 averages typically used. In addition to the LBNL 3-D geophone, called the lower receiver herein, a 3-D geophone from Redpath Geophysics was fixed at a depth of 22 ft in Borehole C4996, and a 3-D geophone from the University of Texas was embedded near the borehole at about 1.5 ft below the ground surface. This volume is organized into 12 sections as follows: Section 1: Introduction, Section 2: Explanation of Terminology, Section 3: Vp Profile at Borehole C4996, Sections 4 to 6: Unfiltered P-wave records of lower vertical receiver, reaction mass, and reference receiver, Sections 7 to 9: Filtered P-wave signals of lower vertical receiver, reaction mass and reference receiver, Section 10: Expanded and filtered P-wave signals of lower vertical receiver, and Sections 11 and 12: Waterfall plots of unfiltered and filtered lower vertical receiver signals.

  3. Charm hadron properties in 360 GeV/c π-p-interactions

    International Nuclear Information System (INIS)

    Aguilar-Benitez, M.; Colino, N.; Ladron de Guevara, P.; Willmott, C.; Allison, W.W.M.; Colwill, S.; Lyons, L.; Wright, P.; Bailly, J.L.; Baland, J.F.; Grard, F.; Kesteman, J.; Pilette, P.; Banerjee, S.; Ganguli, S.; Malhotra, P.K.; Shankar, K.; Subramanian, A.; Bartl, W.; Epp, B.; Hrubec, J.; Pernicka, M.; Rohringer, H.; Begalli, M.; Otter, G.; Ransone, G.; Schulte, R.; Struczinski, W.; Belliere, P.; Defoix, C.; Dolbeau, J.; Laloum, M.; Bettini, A.; Checchia, P.; Cresti, M.; De-Angelis, A.; Gasparini, U.; Mazzucato, M.; Pinori, C.; Ventura, L.; Zotto, P.L.; Zumerle, G.; Billy, L. de; Briand, H.; Dumarchez, J.; Nguyen, H.K.; Touboul, M.C.; Bizarri, R.; Capua, E. di; Falciano, S.; Gentile, S.; Marel, G.; Marzano, F.; Piredda, G.; Zanello, L.; Borreani, G.; Garbellini, L.; Marchetto, F.; Rinaudo, G.; Brun, R.; Fernandez, C.; Goshaw, A.; Gurtu, A.; Hernandez, J.J.; Herve, A.; Iori, M.; Leutz, H.; Montanet, L.; Neuhofer, G.; Nowak, H.; Poppleton, A.; Powell, B.; Reucroft, S.; Richardson, J.; Schouten, M.; Bugg, W.M.; Handler, T.; Hart, E.L.; Caso, C.; Contri, R.; Fontanelli, F.; Monge, R.; Squarcia, S.; Trevisan, U.; Castelli, E.; Poropat, P.; Sessa, M.; Troncon, C.; Chliapnikov, P.; Fisyak, Yu.; Kistenev, E.; Kniazev, V.; Stopchenko, V.; Uvarov, V.; Vlasov, E.; Yarba, V.; Crennel, D.; Fisher, C.; Hughes, P.; MacDermott, M.; Dimarco, R.; Plano, R.; Stamer, P.; Fry, J.R.; Houlden, M.A.; Mason, P.; Patel, G.D.; Roberts, K.; Hamatsu, R.; Iga, Y.; Kita, I.; Kitamura, S.; Oshima, N.; Tsurugai, T.; Yamagata, T.; Haupt, L.; Hellman, S.; Holmgren, S.O.; Johanson, E.; Nilsson, S.; Sellden, B.; Huss, D.; Jegham, E.; Michalon, A.; Michalon-Mentzer, M.E.; Voltolini, C.; Lemonne, J.; Vilain, P.; Vonck, B.; Wickens, J.

    1986-01-01

    A study of the properties of charm particles produced in 360 GeV/c π - p interactions is reported. The experiment was performed using the high resolution hydrogen bubble chamber LEBC in association with the European Hybrid Spectrometer at the CERN SPS. Details of the exposure and operation of the spectrometer are given and the methods used to extract the charm data are presented. The essential physics results on the decay properties (lifetime, branching ratios) as well as on the hadroproduction properties (cross sections for D, anti D, F, Λsub(c), Dsup(*), correlations between charm particles) are given. (orig.)

  4. Peripheral pn production and decay angular distributions in the reaction pi /sup -/p to (pn)p at 12 GeV/c incident momentum

    CERN Document Server

    Ghidini, B; Cantore, A; Di Corato, M; Donald, R A; Eades, John; Edwards, D N; Edwards, M E; French, Bernard R; Fry, J R; Houlden, M A; Mandelli, L; Moebes, J P; Müller, K; Navach, F; Palano, A; Palazzi-Cerrina, C; Paul, E; Picciarelli, V; Renneberg, W; Rühmer, W; Smith, I; Zito, G

    1978-01-01

    The reaction pi /sup -/p to (pn)p/sub s/, where p/sub s/ is a slow proton, was measured at 12 GeV/c incident momentum with the CERN-OMEGA spectrometer. Both antiproton and proton were identified uniquely by electronics information. 1844 events with four-momentum transfer squared in the range 0.13section in this t range is determined to be sigma =4+or-0.4 mu b. Extrapolating the differential cross section over the whole t range assuming d sigma /dt approximately exp(5.3 t) a cross section of sigma =9.3+or-2.0 mu b is estimated. Comparison is made with data on pi /sup -/p to (pp)n/sub s/ (where n/sub s/ is a slow neutron) in the same t range. (12 refs).

  5. Measurement of the j/psi meson and b-hadron production cross sections in p anti-p collisions at √ s = 1960 GeV

    International Nuclear Information System (INIS)

    Acosta, D.; The CDF Collaboration

    2004-01-01

    The authors present a new measurement of the inclusive and differential production cross sections of J/ψ mesons and b-hadrons in proton-antiproton collisions at √s = 1960 GeV. The data correspond to an integrated luminosity of 39.7 pb -1 collected by the CDF Run II detector. They find the integrated cross section for inclusive J/ψ production for all transverse momenta from 0 to 20 GeV/c in the rapidity range |y| -0.33 +0.36 (syst) μb. They separate the fraction of J/ψ events from the decay of the long-lived b-hadrons using the lifetime distribution in all events with p T (J/ψ) > 1.25 GeV/c. They find the total cross section for b-hadrons, including both hadrons and anti-hadrons, decaying to J/ψ with transverse momenta greater than 1.25 GeV/c in the rapidity range |y(J/ψ)| -0.033 +0.036 (syst) μb. Using a Monte Carlo simulation of the decay kinematics of b-hadrons to all final states containing a J/ψ, they extract the first measurement of the total single b-hadron cross section down to zero transverse momentum at √s = 1960 GeV. They find the total single b-hadron cross section integrated over all transverse momenta for b-hadrons in the rapidity range |y| -2.3 +2.5 (syst) μb

  6. Search for $B_c^+$ decays to the $p\\overline p\\pi^+$ final state

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hongming, Li; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusardi, Nicola; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Niess, Valentin; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavomira; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhong, Liang; Zhukov, Valery; Zucchelli, Stefano

    2016-08-10

    A search for the decays of the $B_c^+$ meson to $p\\overline p\\pi^+$ is performed for the first time using a data sample corresponding to an integrated luminosity of 3.0 $\\mathrm{fb}^{-1}$ collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of $7$ and $8$ TeV. No signal is found and an upper limit, at 95$\\%$ confidence level, is set, $\\frac{f_c}{f_u}\\times\\mathcal{B}(B_c^+\\to p\\overline p\\pi^+)<3.6\\times10^{-8}$ in the kinematic region $m(p\\overline p)<2.85\\mathrm{\\,Ge\\kern -0.1em V\\!/}c^2$, $p_{\\rm T}(B)<20\\mathrm{\\,Ge\\kern -0.1em V\\!/}c$ and $2.0< {y}(B)<4.5$, where $\\mathcal{B}$ is the branching fraction and $f_c$ ($f_u$) is the fragmentation fraction of the $b$ quark into a $B_c^+$ ($B^+$) meson.

  7. 47 CFR 97.17 - Application for new license grant.

    Science.gov (United States)

    2010-10-01

    ... Section 97.17 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO... by the rules to an amateur radio organization having tax-exempt status under section 501(c)(3) of the Internal Revenue Code of 1986 that provides voluntary, uncompensated and unreimbursed services in providing...

  8. Measurement of N and C diffusion in Sm2Fe17 by magnetic relaxation

    International Nuclear Information System (INIS)

    Mommer, N.; Hirscher, M.; Gerlach, M.; Van Lier, J.; Kronmueller, H.; Kubis, M.; Mueller, K.-H.

    1998-01-01

    Magnetic after-effect (MAE) measurements of nitrided and carburized Sm 2 Fe 17 compounds were performed in the temperature range of 140 K to 480 K. Both nitrided and carburized compounds show relaxation maxima at 285 and 300 K, respectively, which are absent in pure Sm 2 Fe 17 compounds. Therefore, these relaxation maxima are attributed to jumps of interstitially dissolved nitrogen or carbon atoms. Numerical evaluation yielded an activation enthalpy Q N (0.84±0.05) eV and a pre-exponential factor τ 0 N =3.10 -15±1 s for the short-range diffusion of N atoms. The corresponding values for the carbon diffusion are Q C =(0.91±0.05) eV and τ 0 C =1.10 -15±1 s. The carbon and nitrogen content of the samples was determined from the increase in mass during nitrogenation or carburization to Sm 2 Fe 17 N 1.2 and Sm 2 Fe 17 C 2.6 . (orig.)

  9. Measurement of the differential γ+c-jet cross section and the ratio of differential γ+c and γ+b cross sections in pp¯ collisions at √(s)=1.96 TeV

    International Nuclear Information System (INIS)

    Abazov, V.M.; Abbott, B.; Acharya, B.S.; Adams, M.; Adams, T.; Alexeev, G.D.; Alkhazov, G.; Alton, A.; Askew, A.; Atkins, S.; Augsten, K.; Avila, C.; Badaud, F.; Bagby, L.; Baldin, B.; Bandurin, D.V.; Banerjee, S.; Barberis, E.; Baringer, P.; Bartlett, J.F.

    2013-01-01

    We present measurements of the differential cross section dσ/dp T γ for the associated production of a c-quark jet and an isolated photon with rapidity |y γ | T γ jet | T jet >15 GeV. The ratio of differential cross sections for γ+c to γ+b production as a function of p T γ is also presented. The results are based on data corresponding to an integrated luminosity of 8.7 fb −1 recorded with the D0 detector at the Fermilab Tevatron pp ¯ Collider at √(s)=1.96 TeV. The obtained results are compared to next-to-leading order perturbative QCD calculations using various parton distribution functions, to predictions based on the k T -factorization approach, and to predictions from the SHERPA and PYTHIA Monte Carlo event generators

  10. Neutron-proton scattering experiments and phase analyses for the n-p system in the energy range from 17 to 50 MeV

    International Nuclear Information System (INIS)

    Krupp, H.

    1986-01-01

    In the framework of the study of the nucleon-nucleon interaction neutron-proton scattering experiments were performed at the neutron collimator POLKA of the Karlsruhe cyclotron. Neutrons were produced by the source reaction D(d,n)X in the energy range between 17 and 50 MeV. Measured were the differential cross section, the analyzing power, and the spin correlation coefficient of the elastic n-p scattering. By means of the new data the knowledge of the isospin T=0 scattering phases could be improved. It is for the first time possible to determine the scattering phases for T=1 independently from n-p and p-p data with comparable accuracy. (orig./HSI) [de

  11. The effects of fabric for sleepwear and bedding on sleep at ambient temperatures of 17°C and 22°C

    Directory of Open Access Journals (Sweden)

    Shin M

    2016-04-01

    Full Text Available Mirim Shin,1 Mark Halaki,1 Paul Swan,2 Angus Ireland,2 Chin Moi Chow1 1Exercise, Health and Performance Research Group, Faculty of Health Sciences, The University of Sydney, Lidcombe, 2Australian Wool Innovation Limited, The Woolmark Company, Sydney, NSW, Australia Abstract: The fibers used in clothing and bedding have different thermal properties. This study aimed to investigate the influences of textile fabrics on sleep under different ambient temperature (Ta conditions. Seventeen healthy young participants (ten males underwent nine nights of polysomnography testing including an adaptation night. Participants were randomized to each of the three binary factors: sleepwear (cotton vs wool, bedding (polyester vs wool, and Ta (17°C vs 22°C with relative humidity set at 60%. Skin temperature (Tsk and core temperature (Tc were monitored throughout the sleep period. Sleep onset latency (SOL was significantly shortened when sleeping in wool with trends of increased total sleep time and sleep efficiency compared to cotton sleepwear. At 17°C, the proportion of sleep stages 1 (%N1 and 3 (%N3 and rapid eye movement sleep was higher, but %N2 was lower than at 22°C. Interaction effects (sleepwear × Ta showed a significantly shorter SOL for wool than cotton at 17°C but lower %N3 for wool than cotton at 22°C. A significantly lower %N2 but higher %N3 was observed for wool at 17°C than at 22°C. There was no bedding effect on sleep. Several temperature variables predicted the sleep findings in a stepwise multiple regression analysis and explained 67.8% of the variance in SOL and to a lesser degree the %N2 and %N3. These findings suggest that sleepwear played a contributory role to sleep outcomes and participants slept better at 17°C than at 22°C.Keywords: cotton, polyester, wool, polysomnography, skin temperature, core body temperature

  12. Benchmark experiment for the cross section of the 100Mo(p,2n)99mTc and 100Mo(p,pn)99Mo reactions

    Science.gov (United States)

    Takács, S.; Ditrói, F.; Aikawa, M.; Haba, H.; Otuka, N.

    2016-05-01

    As nuclear medicine community has shown an increasing interest in accelerator produced 99mTc radionuclide, the possible alternative direct production routes for producing 99mTc were investigated intensively. One of these accelerator production routes is based on the 100Mo(p,2n)99mTc reaction. The cross section of this nuclear reaction was studied by several laboratories earlier but the available data-sets are not in good agreement. For large scale accelerator production of 99mTc based on the 100Mo(p,2n)99mTc reaction, a well-defined excitation function is required to optimise the production process effectively. One of our recent publications pointed out that most of the available experimental excitation functions for the 100Mo(p,2n)99mTc reaction have the same general shape while their amplitudes are different. To confirm the proper amplitude of the excitation function, results of three independent experiments were presented (Takács et al., 2015). In this work we present results of a thick target count rate measurement of the Eγ = 140.5 keV gamma-line from molybdenum irradiated by Ep = 17.9 MeV proton beam, as an integral benchmark experiment, to prove the cross section data reported for the 100Mo(p,2n)99mTc and 100Mo(p,pn)99Mo reactions in Takács et al. (2015).

  13. Measurements of the total cross sections of SIGMA$^{-}$ and XI$^{-}$ on protons and deuterons between 74 and 137 GeV/c

    CERN Document Server

    Biagi, S F; Britten, A J; Brown, R M; Burckhart, Helfried J; Carter, A A; Carter, J R; Doré, C; Extermann, Pierre; Gailloud, M; Gee, C N P; Gibson, W M; Gordon, J C; Gray, R J; Igo-Kemenes, P; Louis, W C; Modis, T; Mühlemann, P; Perrier, J; Rosselet, P; Saunders, B J; Schirato, P; Siebert, Hans-Wolfgang; Smith, V J; Stickland, D P; Streit, K P; Thresher, J J; Weill, R

    1981-01-01

    The Sigma /sup -/ p and Xi /sup -/d total cross sections have been measured to a statistical accuracy of +or-1% and +or-0.5%, respectively, at five momenta from 7.45 to 136.9 GeV/c, using the hyperon beam at the CERN SPS. The Xi /sup -/p and Xi /sup -/d total cross sections have also been measured to the same statistical accuracy at 101.5 and 133.8 GeV/c. The systematic uncertainty at each momentum is estimated to be of the order of +or-0.5%. The hyperon- nucleon cross sections are shown to be rising with energy, and the data are compared with various phenomenological models. (18 refs).

  14. Word Frequency Analysis MOS: 17C. Skill Levels 1 & 2.

    Science.gov (United States)

    1981-05-01

    AP 1 BURNED 14 BUR ST 1 B UR STS I BURY - 4 BUSHES q BI.T 4A BUTT 12 AUTTON 4 RUTTPLATE P ROVEFR * 1’P? AV I ARI 148 C 1 C-PATIEN 7 C-1 I C-ts 2 C-2 2...I BRAEING I mvFAKS I RAT4 I ARFATHF 1 BREATHS I RPInGFS I1 BRIEF I1 RtrIC.NSS I PROWN I AliI AINIIs 1 Bu ILt. I IIIINKERS I BURNED I AP1KV I at 1 C...PREPARING 1PRESCR IBE I PRECRIBED Porr.RAN II ~NTFO PRIOR 1 PROCEDUREIN( I PaCPFRTY 1P21IO I PUA FADSIN I RAtE AIE I REACHING I READRE 1 R ED O R

  15. The fitted channels π-p→π-pπ+π- and π-p→π-p2π+2π- at 147 GeV/c incident momentum

    International Nuclear Information System (INIS)

    Brick, D.; Fong, D.; Heller, M.; Shapiro, A.M.; Widgoff, M.; Bruyant, F.; Bogert, D.; Johnson, M.; Burnstein, R.; Fu, C.; Petersen, D.; Robertson, M.; Rubin, H.; Sard, R.; Snyder, A.; Tortora, J.; Chien, C.Y.; Lucas, P.; Pevsner, A.; Zdanis, R.; Barreiro, F.; Benary, O.; Brau, J.E.; Grunhaus, J.; Hafen, E.S.; Hulsizer, R.I.; Karshon, U.; Kistiakowsky, V.; Levy, A.; Napier, A.; Pless, I.A.; Silverman, J.P.; Trepagnier, P.C.; Wolfson, J.; Yamamoto, R.K.; Cohn, H.; Jacques, P.F.; Ou, T.C.; Plano, R.J.; Watts, T.L.; Brucker, E.; Koller, E.; Stamer, P.; Taylor, S.; Bugg, W.; Condo, G.; Handler, T.; Hart, E.; Kraybill, H.; Ljung, D.; Ludlam, T.; Taft, H.D.; Alyea, E.D. Jr.

    The results are reported on the 4- and 6-prong final states in π - p interactions at 147 GeV/c incident momentum obtained from a 105 000 picture exposure of the 30 in. bubble chamber Fermilab Hybrid Proportional Wire System to a tagged negative beam of 147 GeV/c momentum. The final states of the π - p→π - pπ + π - and π - p→π - p2π + 2π - processes are analyzed and the values of cross sections and of invariant mass distributions are presented. (Z.J.)

  16. Differentiation of IL-17-Producing Invariant Natural Killer T Cells Requires Expression of the Transcription Factor c-Maf

    Directory of Open Access Journals (Sweden)

    Jhang-Sian Yu

    2017-10-01

    Full Text Available c-Maf belongs to the large Maf family of transcription factors and plays a key role in the regulation of cytokine production and differentiation of TH2, TH17, TFH, and Tr1 cells. Invariant natural killer T (iNKT cells can rapidly produce large quantity of TH-related cytokines such as IFN-γ, IL-4, and IL-17A upon stimulation by glycolipid antigens, such as α-galactosylceramide (α-GalCer. However, the role of c-Maf in iNKT cells and iNKT cells-mediated diseases remains poorly understood. In this study, we demonstrate that α-GalCer-stimulated iNKT cells express c-Maf transcript and protein. By using c-Maf-deficient fetal liver cell-reconstituted mice, we further show that c-Maf-deficient iNKT cells produce less IL-17A than their wild-type counterparts after α-GalCer stimulation. While c-Maf deficiency does not affect the development and activation of iNKT cells, c-Maf is essential for the induction of IL-17-producing iNKT (iNKT17 cells by IL-6, TGF-β, and IL-1β, and the optimal expression of RORγt. Accordingly, c-Maf-deficient iNKT17 cells lose the ability to recruit neutrophils into the lungs. Taken together, c-Maf is a positive regulator for the expression of IL-17A and RORγt in iNKT17 cells. It is a potential therapeutic target in iNKT17 cell-mediated inflammatory disease.

  17. 31 CFR 100.17 - Location of Federal Reserve banks and branches.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Location of Federal Reserve banks and branches. 100.17 Section 100.17 Money and Finance: Treasury Regulations Relating to Money and Finance... Locust Street (P.O. Box 442), St. Louis, MO 63166 Little Rock Branch—325 West Capitol Avenue (P.O. Box...

  18. By Targeting Stat3 microRNA-17-5p Promotes Cardiomyocyte Apoptosis in Response to Ischemia Followed by Reperfusion

    Directory of Open Access Journals (Sweden)

    Weijie Du

    2014-08-01

    Full Text Available Background: Several studies have confirmed the role of microRNAs in regulating ischemia/reperfusion-induced cardiac injury (I/R-I. MiR-17-5p has been regarded as an oncomiR in the development of cancer. However, its potential role in cardiomyocytes has not been exploited. The aim of this study is to investigate the role of miR-17-5p in I/R-I and the underlying mechanism through targeting Stat3, a key surviving factor in cardiomyocytes. Methods: MTT (3-[4, 5-dimethylthiazol-2-yl]-2, 5 diphenyl tetrazolium bromide assay was used to detect the cell viability. ELISA and TUNEL were performed to measure apoptosis of neonatal rat ventricular cardiomyocytes (NRVCs. Infarct area was estimated by TTC (triphenyltetrazolium chloride and Evans blue staining. Western blot analysis was employed to detect the Stat3 and p-Stat3 levels and real-time RT-PCR was used to quantify miR-17-5p level. Results: The miR-17-5p level was significantly up-regulated in I/R-I mice and in NRVCs under oxidative stress. Overexpression of miR-17-5p aggravated cardiomyocyte injury with reduced cell viability and enhanced apoptotic cell death induced by H2O2, whereas inhibition of miR-17-5p by its antisense AMO-17-5p abrogated the deleterious changes. Moreover, the locked nucleic acid-modified antisense (LNA-anti-miR-17-5p markedly decreased the infarct area and apoptosis induced by I/R-I in mice. Furthermore, overexpression of miR-17-5p diminished the p-Stat3 level in response to H2O2. The results from Western blot analysis and luciferase reporter gene assay confirmed Stat3 as a target gene for miR-17-5p. Conclusion: Upregulation of miR-17-5p promotes apoptosis induced by oxidative stress via targeting Stat3, accounting partially for I/R-I.

  19. NNS computing facility manual P-17 Neutron and Nuclear Science

    International Nuclear Information System (INIS)

    Hoeberling, M.; Nelson, R.O.

    1993-11-01

    This document describes basic policies and provides information and examples on using the computing resources provided by P-17, the Neutron and Nuclear Science (NNS) group. Information on user accounts, getting help, network access, electronic mail, disk drives, tape drives, printers, batch processing software, XSYS hints, PC networking hints, and Mac networking hints is given

  20. Measurement of the ratio of the p anti-p --> W+c-jet cross section to the inclusive p anti-p --> W+jets cross section

    Czech Academy of Sciences Publication Activity Database

    Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

    2008-01-01

    Roč. 666, č. 1 (2008), s. 23-30 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * collisions Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008

  1. Measurement of the $W+b$-jet and $W+c$-jet differential production cross sections in $p\\bar{p}$ collisions at $\\sqrt{s}=1.96$ TeV

    CERN Document Server

    Abazov, Victor Mukhamedovich; Acharya, Bannanje Sripath; Adams, Mark Raymond; Adams, Todd; Agnew, James P; Alexeev, Guennadi D; Alkhazov, Georgiy D; Alton, Andrew K; Askew, Andrew Warren; Atkins, Scott; Augsten, Kamil; Avila, Carlos A; Badaud, Frederique; Bagby, Linda F; Baldin, Boris; Bandurin, Dmitry V; Banerjee, Sunanda; Barberis, Emanuela; Baringer, Philip S; Bartlett, JFrederick; Bassler, Ursula Rita; Bazterra, Victor; Bean, Alice L; Begalli, Marcia; Bellantoni, Leo; Beri, Suman B; Bernardi, Gregorio; Bernhard, Ralf Patrick; Bertram, Iain A; Besancon, Marc; Beuselinck, Raymond; Bhat, Pushpalatha C; Bhatia, Sudeep; Bhatnagar, Vipin; Blazey, Gerald Charles; Blessing, Susan K; Bloom, Kenneth A; Boehnlein, Amber S; Boline, Daniel Dooley; Boos, Edward E; Borissov, Guennadi; Borysova, Maryna; Borysov, Oleksandr; Brandt, Andrew; Brandt, Oleg; Brock, Raymond L; Bross, Alan D; Brown, Duncan Paul; Bu, Xue-Bing; Buehler, Marc; Buescher, Volker; Bunichev, Viacheslav Yevgenyevich; Burdin, Sergey; Buszello, Claus Peter; Camacho-Perez, Enrique; Casey, Brendan Cameron Kieran; Castilla-Valdez, Heriberto; Caughron, Seth Aaron; Chakrabarti, Subhendu; Chan, Kwok Ming Leo; Chandra, Avdhesh; Chapon, Emilien; Chen, Guo; Cho, Sung-Woong; Choi, Suyong; Choudhary, Brajesh C; Cihangir, Selcuk; Claes, Daniel R; Clutter, Justace Randall; Cooke, Michael P; Cooper, William Edward; Corcoran, Marjorie D; Couderc, Fabrice; Cousinou, Marie-Claude; Cutts, David; Das, Amitabha; Davies, Gavin John; de Jong, Sijbrand Jan; De La Cruz-Burelo, Eduard; Deliot, Frederic; Demina, Regina; Denisov, Dmitri S; Denisov, Sergei P; Desai, Satish Vijay; Deterre, Cecile; DeVaughan, Kayle Otis; Diehl, HThomas; Diesburg, Michael; Ding, Pengfei; Dominguez, DAaron M; Dubey, Abhinav Kumar; Dudko, Lev V; Duperrin, Arnaud; Dutt, Suneel; Eads, Michael T; Edmunds, Daniel L; Ellison, John A; Elvira, VDaniel; Enari, Yuji; Evans, Harold G; Evdokimov, Valeri N; Faure, Alexandre; Feng, Lei; Ferbel, Thomas; Fiedler, Frank; Filthaut, Frank; Fisher, Wade Cameron; Fisk, HEugene; Fortner, Michael R; Fox, Harald; Fuess, Stuart C; Garbincius, Peter H; Garcia-Bellido, Aran; Garcia-Gonzalez, Jose Andres; Gavrilov, Vladimir B; Geng, Weigang; Gerber, Cecilia Elena; Gershtein, Yuri S; Ginther, George E; Gogota, Olga; Golovanov, Georgy Anatolievich; Grannis, Paul D; Greder, Sebastien; Greenlee, Herbert B; Grenier, Gerald Jean; Gris, Phillipe Luc; Grivaz, Jean-Francois; Grohsjean, Alexander; Gruenendahl, Stefan; Gruenewald, Martin Werner; Guillemin, Thibault; Gutierrez, Gaston R; Gutierrez, Phillip; Haley, Joseph Glenn Biddle; Han, Liang; Harder, Kristian; Harel, Amnon; Hauptman, John Michael; Hays, Jonathan M; Head, Tim; Hebbeker, Thomas; Hedin, David R; Hegab, Hatim; Heinson, Ann; Heintz, Ulrich; Hensel, Carsten; Heredia-De La Cruz, Ivan; Herner, Kenneth Richard; Hesketh, Gavin G; Hildreth, Michael D; Hirosky, Robert James; Hoang, Trang; Hobbs, John D; Hoeneisen, Bruce; Hogan, Julie; Hohlfeld, Mark; Holzbauer, Jenny Lyn; Howley, Ian James; Hubacek, Zdenek; Hynek, Vlastislav; Iashvili, Ia; Ilchenko, Yuriy; Illingworth, Robert A; Ito, Albert S; Jabeen, Shabnam; Jaffre, Michel J; Jayasinghe, Ayesh; Jeong, Min-Soo; Jesik, Richard L; Jiang, Peng; Johns, Kenneth Arthur; Johnson, Emily; Johnson, Marvin E; Jonckheere, Alan M; Jonsson, Per Martin; Joshi, Jyoti; Jung, Andreas Werner; Juste, Aurelio; Kajfasz, Eric; Karmanov, Dmitriy Y; Katsanos, Ioannis; Kaur, Manbir; Kehoe, Robert Leo Patrick; Kermiche, Smain; Khalatyan, Norayr; Khanov, Alexander; Kharchilava, Avto; Kharzheev, Yuri N; Kiselevich, Ivan Lvovich; Kohli, Jatinder M; Kozelov, Alexander V; Kraus, James Alexander; Kumar, Ashish; Kupco, Alexander; Kurca, Tibor; Kuzmin, Valentin Alexandrovich; Lammers, Sabine Wedam; Lebrun, Patrice; Lee, Hyeon-Seung; Lee, Seh-Wook; Lee, William M; Lei, Xiaowen; Lellouch, Jeremie; Li, Dikai; Li, Hengne; Li, Liang; Li, Qi-Zhong; Lim, Jeong Ku; Lincoln, Donald W; Linnemann, James Thomas; Lipaev, Vladimir V; Lipton, Ronald J; Liu, Huanzhao; Liu, Yanwen; Lobodenko, Alexandre; Lokajicek, Milos; Lopes de Sa, Rafael; Luna-Garcia, Rene; Lyon, Adam Leonard; Maciel, Arthur KA; Madar, Romain; Magana-Villalba, Ricardo; Malik, Sudhir; Malyshev, Vladimir L; Mansour, Jason; Martinez-Ortega, Jorge; McCarthy, Robert L; Mcgivern, Carrie Lynne; Meijer, Melvin M; Melnitchouk, Alexander S; Menezes, Diego D; Mercadante, Pedro Galli; Merkin, Mikhail M; Meyer, Arnd; Meyer, Jorg Manfred; Miconi, Florian; Mondal, Naba K; Mulhearn, Michael James; Nagy, Elemer; Narain, Meenakshi; Nayyar, Ruchika; Neal, Homer A; Negret, Juan Pablo; Neustroev, Petr V; Nguyen, Huong Thi; Nunnemann, Thomas P; Hernandez Orduna, Jose de Jesus; Osman, Nicolas Ahmed; Osta, Jyotsna; Pal, Arnab; Parashar, Neeti; Parihar, Vivek; Park, Sung Keun; Partridge, Richard A; Parua, Nirmalya; Patwa, Abid; Penning, Bjoern; Perfilov, Maxim Anatolyevich; Peters, Reinhild Yvonne Fatima; Petridis, Konstantinos; Petrillo, Gianluca; Petroff, Pierre; Pleier, Marc-Andre; Podstavkov, Vladimir M; Popov, Alexey V; Prewitt, Michelle; Price, Darren; Prokopenko, Nikolay N; Qian, Jianming; Quadt, Arnulf; Quinn, Gene Breese; Ratoff, Peter N; Razumov, Ivan A; Ripp-Baudot, Isabelle; Rizatdinova, Flera; Rominsky, Mandy Kathleen; Ross, Anthony; Royon, Christophe; Rubinov, Paul Michael; Ruchti, Randal C; Sajot, Gerard; Sanchez-Hernandez, Alberto; Sanders, Michiel P; Santos, Angelo Souza; Savage, David G; Savitskyi, Mykola; Sawyer, HLee; Scanlon, Timothy P; Schamberger, RDean; Scheglov, Yury A; Schellman, Heidi M; Schwanenberger, Christian; Schwienhorst, Reinhard H; Sekaric, Jadranka; Severini, Horst; Shabalina, Elizaveta K; Shary, Viacheslav V; Shaw, Savanna; Shchukin, Andrey A; Simak, Vladislav J; Skubic, Patrick Louis; Slattery, Paul F; Smirnov, Dmitri V; Snow, Gregory R; Snow, Joel Mark; Snyder, Scott Stuart; Soldner-Rembold, Stefan; Sonnenschein, Lars; Soustruznik, Karel; Stark, Jan; Stoyanova, Dina A; Strauss, Michael G; Suter, Louise; Svoisky, Peter V; Titov, Maxim; Tokmenin, Valeriy V; Tsai, Yun-Tse; Tsybychev, Dmitri; Tuchming, Boris; Tully, Christopher George T; Uvarov, Lev; Uvarov, Sergey L; Uzunyan, Sergey A; Van Kooten, Richard J; van Leeuwen, Willem M; Varelas, Nikos; Varnes, Erich W; Vasilyev, Igor A; Verkheev, Alexander Yurievich; Vertogradov, Leonid S; Verzocchi, Marco; Vesterinen, Mika; Vilanova, Didier; Vokac, Petr; Wahl, Horst D; Wang, Michael HLS; Warchol, Jadwiga; Watts, Gordon Thomas; Wayne, Mitchell R; Weichert, Jonas; Welty-Rieger, Leah Christine; Williams, Mark Richard James; Wilson, Graham Wallace; Wobisch, Markus; Wood, Darien Robert; Wyatt, Terence R; Xie, Yunhe; Yamada, Ryuji; Yang, Siqi; Yasuda, Takahiro; Yatsunenko, Yuriy A; Ye, Wanyu; Ye, Zhenyu; Yin, Hang; Yip, Kin; Youn, Sungwoo; Yu, Jiaming; Zennamo, Joseph; Zhao, Tianqi Gilbert; Zhou, Bing; Zhu, Junjie; Zielinski, Marek; Zieminska, Daria; Zivkovic, Lidija

    2015-04-09

    We present a measurement of the cross sections for the associated production of a $W$ boson with at least one heavy quark jet, $b$ or $c$, in proton-antiproton collisions. Data corresponding to an integrated luminosity of 8.7 fb$^{-1}$ recorded with the D0 detector at the Fermilab Tevatron \\ppbar Collider at $\\sqrt{s}=1.96$ TeV are used to measure the cross sections differentially as a function of the jet transverse momenta in the range 20 to 150 GeV. These results are compared to calculations of perturbative QCD theory as well as predictions from Monte Carlo generators.

  2. 17 CFR 240.15c1-8 - Sales at the market.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales at the market. 240.15c1... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-8 Sales at the market... securities exchange that such security is being offered to such customer “at the market” or at a price...

  3. miR-17-5p targets the p300/CBP-associated factor and modulates androgen receptor transcriptional activity in cultured prostate cancer cells

    International Nuclear Information System (INIS)

    Gong, Ai-Yu; Eischeid, Alex N; Xiao, Jing; Zhao, Jian; Chen, Dongqing; Wang, Zhao-Yi; Young, Charles YF; Chen, Xian-Ming

    2012-01-01

    Androgen receptor (AR) signalling is critical to the initiation and progression of prostate cancer (PCa). Transcriptional activity of AR involves chromatin recruitment of co-activators, including the p300/CBP-associated factor (PCAF). Distinct miRNA expression profiles have been identified in PCa cells during the development and progression of the disease. Whether miRNAs regulate PCAF expression in PCa cells to regulate AR transcriptional activity is still unclear. Expression of PCAF was investigated in several PCa cell lines by qRT-PCR, Western blot, and immunocytochemistry. The effects of PCAF expression on AR-regulated transcriptional activity and cell growth in PCa cells were determined by chromatin immunoprecipitation, reporter gene construct analysis, and MTS assay. Targeting of PCAF by miR-17-5p was evaluated using the luciferase reporter assay. PCAF was upregulated in several PCa cell lines. Upregulation of PCAF promoted AR transcriptional activation and cell growth in cultured PCa cells. Expression of PCAF in PCa cells was associated with the downregulation of miR-17-5p. Targeting of the 3’-untranslated region of PCAF mRNA by miR-17-5p caused translational suppression and RNA degradation, and, consequently, modulation of AR transcriptional activity in PCa cells. PCAF is upregulated in cultured PCa cells, and upregulation of PCAF is associated with the downregulation of miR-17-5p. Targeting of PCAF by miR-17-5p modulates AR transcriptional activity and cell growth in cultured PCa cells

  4. 17 CFR 240.10A-2 - Auditor independence.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Auditor independence. 240.10A... Exchange Act of 1934 Reports Under Section 10a § 240.10A-2 Auditor independence. It shall be unlawful for an auditor not to be independent under § 210.2-01(c)(2)(iii)(B), (c)(4), (c)(6), (c)(7), and § 210.2...

  5. π+-, K+-, pp, and p-barp elastic scattering from 50 to 175 GeV/c

    International Nuclear Information System (INIS)

    Ayres, D.S.; Diebold, R.; Maclay, G.J.; Cutts, D.; Lanou, R.E. Jr.; Levinson, L.J.; Massimo, J.T.; Litt, J.; Meunier, R.; Sogard, M.; Gittelman, B.; Loh, E.C.; Brenner, A.E.; Elias, J.E.; Mikenberg, G.; Guerriero, L.; Lavopa, P.; Maggi, G.; DeMarzo, C.; Posa, F.; Selvaggi, G.; Spinelli, P.; Waldner, F.; Barton, D.S.; Butler, J.; Fines, J.; Friedman, J.I.; Kendall, H.W.; Nelson, B.; Rosenson, L.; Verdier, R.; Gottschalk, B.; Anderson, R.L.; Gustavson, D.; Rich, K.; Ritson, D.M.; Weitsch, G.A.

    1977-01-01

    The differential cross sections for the elastic scattering of π + , π - , K + , K - , p, and p-bar on protons have been measured in the t interval -0.04 to -0.75 GeV 2 at five momenta: 50, 70, 100, 140, and 175 GeV/c. The t distributions have been parametrized by the quadratic exponential form dsigma/dt = A exp( B abs. value(t) + C abs. value(t) 2 and the energy dependence has been described in terms of a single-pole Regge model. The pp and K + p diffraction peaks are found to shrink with α' approx. 0.20 and approx. 0.15 GeV -2 , respectively. The p-barp diffraction peak is antishrinking while π + - and K - p are relatively energy-independent. Total elastic cross sections are calculated by integrating the differential cross sections. The rapid decline in sigma/sub el/ observed at low energies has stopped and all six reactions approach relatively constant values of sigma/sub el/. The ratio of sigma/sub el//sigma/sub tot/ approaches a constant value for all six reactions by 100 GeV, consistent with the predictions of the geometric-scaling hypothesis. This ratio is approx. 0.18 for pp and p-barp, and approx. 0.12--0.14 for π + - and K + -. A crossover is observed between K + p and K - p scattering at abs. value t approx =0.19 GeV 2 , and between pp and p-barp at abs. value t approx=0.11 GeV 2 . Inversion of the cross sections into impact-parameter space shows that protons are quite transparent to mesons even in head-on collisions. The probability for a meson to pass through a proton head-on without interaction inelastically is approx. 20%, while it is only approx. 6% for an incident proton or antiproton. Finally, the results are compared with various quark-model predictions

  6. 17 CFR 240.24c-1 - Access to nonpublic information.

    Science.gov (United States)

    2010-04-01

    ... Act; (4) The Securities Investor Protection Corporation or any trustee or counsel for a trustee appointed pursuant to Section 5(b) of the Securities Investor Protection Act of 1970; (5) A trustee in... representative of any of the above persons. (c) Nothing contained in this section shall affect: (1) The...

  7. Structure in K--nucleon total cross sections below 1.1 GeV/c

    International Nuclear Information System (INIS)

    Carroll, A.S.; Chiang, I.; Kycia, T.F.; Li, K.K.; Mazur, P.O.; Michael, D.N.; Mockett, P.M.; Rahm, D.C.; Rubinstein, R.

    1976-01-01

    Total cross sections of K - p and K - d have been measured between 410 and 1070 MeV/c with high statistical precision. In addition to the well known Λ (1520), Λ (1820), and Σ (1769), we confirmed the presence of the Λ (1692) and the Σ (1670). We have also observed several structures which could be Y* resonances: Λ (1646), Λ (1735), Σ (1583), Σ (1608), Σ (1633), and Σ (1715)

  8. The duplication 17p13.3 phenotype

    DEFF Research Database (Denmark)

    Curry, Cynthia J; Rosenfeld, Jill A; Grant, Erica

    2013-01-01

    . Older patients were often overweight. Three variant phenotypes included cleft lip/palate (CLP), split hand/foot with long bone deficiency (SHFLD), and a connective tissue phenotype resembling Marfan syndrome. The duplications in patients with clefts appear to disrupt ABR, while the SHFLD phenotype......Chromosome 17p13.3 is a gene rich region that when deleted is associated with the well-known Miller-Dieker syndrome. A recently described duplication syndrome involving this region has been associated with intellectual impairment, autism and occasional brain MRI abnormalities. We report 34...... was associated with duplication of BHLHA9 as noted in two recent reports. The connective tissue phenotype did not have a convincing critical region. Our experience with this large cohort expands knowledge of this diverse duplication syndrome....

  9. 19 CFR 162.23 - Seizure under section 596(c), Tariff Act of 1930, as amended (19 U.S.C. 1595a(c)).

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Seizure under section 596(c), Tariff Act of 1930... SEIZURE Seizures § 162.23 Seizure under section 596(c), Tariff Act of 1930, as amended (19 U.S.C. 1595a(c)). (a) Mandatory seizures. The following, if introduced or attempted to be introduced into the United...

  10. 17 CFR 240.8c-1 - Hypothecation of customers' securities.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Hypothecation of customers... Securities Exchange Act of 1934 Hypothecation of Customers' Securities § 240.8c-1 Hypothecation of customers... any customer under circumstances: (1) That will permit the commingling of securities carried for the...

  11. Interleukin-17A and Toll-Like Receptor 3 Ligand Poly(I:C Synergistically Induced Neutrophil Chemoattractant Production by Bronchial Epithelial Cells.

    Directory of Open Access Journals (Sweden)

    Hirotaka Matsuzaki

    Full Text Available Chronic inflammatory airway diseases, such as bronchial asthma and chronic obstructive pulmonary disease, are common respiratory disorders worldwide. Exacerbations of these diseases are frequent and worsen patients' respiratory condition and overall health. However, the mechanisms of exacerbation have not been fully elucidated. Recently, it was reported that interleukin (IL-17A might play an important role in neutrophilic inflammation, which is characteristic of such exacerbations, through increased production of neutrophil chemoattractants. Therefore, we hypothesized that IL-17A was involved in the pathogenesis of acute exacerbation, due to viral infection in chronic inflammatory airway diseases. In this study, we assessed chemokine production by bronchial epithelial cells and investigated the underlying mechanisms. Comprehensive chemokine analysis showed that, compared with poly(I:C alone, co-stimulation of BEAS-2B cells with IL-17A and poly(I:C strongly induced production of such neutrophil chemoattractants as CXC chemokine ligand (CXCL8, growth-related oncogene (GRO, and CXCL1. Co-stimulation synergistically induced CXCL8 and CXCL1 mRNA and protein production by BEAS-2B cells and normal human bronchial epithelial cells. Poly(I:C induced chemokine expression by BEAS-2B cells mainly via Toll-like receptor 3/TIR-domain-containing adapter-inducing interferon-β-mediated signals. The co-stimulation with IL-17A and poly(I:C markedly activated the p38 and extracellular-signal-regulated kinase 1/2 pathway, compared with poly(I:C, although there was little change in nuclear factor-κB translocation into the nucleus or the transcriptional activities of nuclear factor-κB and activator protein 1. IL-17A promoted stabilization of CXCL8 mRNA in BEAS-2B cells treated with poly(I:C. In conclusion, IL-17A appears to be involved in the pathogenesis of chronic inflammatory airway disease exacerbation, due to viral infection by promoting release of neutrophil

  12. 17 CFR 240.17a-11 - Notification provisions for brokers and dealers.

    Science.gov (United States)

    2010-04-01

    ... brokers and dealers. 240.17a-11 Section 240.17a-11 Commodity and Securities Exchanges SECURITIES AND... Stabilizing Activities § 240.17a-11 Notification provisions for brokers and dealers. (a) This section shall apply to every broker or dealer registered with the Commission pursuant to section 15 of the Act. (b)(1...

  13. Polarization measurements in π-p charge exchange scattering from 617 meV/c to 2267 meV/c

    International Nuclear Information System (INIS)

    Brown, R.M.; Clark, A.G.; Davies, J.K.

    1978-05-01

    Results are presented of polarization parameter measurements for the reaction π - p → π 0 n at 22 momenta between 617 and 2267 MeV/c. These results are generally in agreement with those of previous measurements and in qualitative agreement with predictions of phase shift analyses. Together with the recently published differential cross section measurements, they provide a comprehensive set of data for this reaction in the resonance region. (author)

  14. 29 CFR 2560.502c-5 - Civil penalties under section 502(c)(5).

    Science.gov (United States)

    2010-07-01

    ... Act) that is not a group health plan, and that provides benefits consisting of medical care (within... section 502(c)(5) of the Act for each failure or refusal to file a completed report required to be filed...). (2) For purposes of this section, a failure or refusal to file the report required to be filed under...

  15. The K-p charge exchange and elastic scattering reactions at 4.2 GeV/c

    International Nuclear Information System (INIS)

    Marzano, F.; Toet, D.Z.; Gavillet, Ph.; Gay, J.B.; Hemingway, R.J.; Marechal, B.; Blokzijl, R.; Jongejans, B.; Kluyver, J.C.; Wolters, G.F.; Grossmann, P.; Wells, J.

    1977-01-01

    In this letter results are presented on the reactions K - p→anti K 0 n and K - p→K - p from a high statistics CERN 2 m etre hydrogen bubble chamber exposure a t 4.15 GeV/c. The behaviour of the differential cross section as a function of four-momentum transfer shows remarkable similarities between the two reactions studied. From a comparison of the data with K + p elastic scattering at 4.27 GeV/c some conclusions are drawn concerning the magnitude of the contributing amplitudes. (Auth.)

  16. Spectroscopy of 17C via one-neutron knockout reaction

    Directory of Open Access Journals (Sweden)

    Kim Sunji

    2016-01-01

    Full Text Available A spectroscopic study of 17C was performed via the one-neutron knockout reaction of 18C on a carbon target at RIKEN-RIBF. Three unbound states at excitation energies of 2.66(2, 3.16(5, and 3.97(3 MeV (preliminary were observed. The energies are compared with shell-model calculations and existing measurements to deduce their spin-parities. From the comparison, the states at 2.66(2 and 3.97(3 MeV are suggested to be 1/2− and 3/2−, respectively. From its decay property, the state at 3.16(5 MeV is indicated to be 9/2+.

  17. Development of C-band Accelerating Section for SuperKEKB

    CERN Document Server

    Kamitani, T; Ikeda, M; Kakihara, K; Ohsawa, S; Oogoe, T; Sugimura, T; Takatomi, T; Yamaguchi, S; Yokoyama, K

    2004-01-01

    For the luminosity upgrade of the present KEK B-factory to SuperKEKB, the injector linac has to increase the positron acceleration energy from 3.5 to 8.0 GeV. In order to double the acceleration field gradient from 21 to 42 MV/m, design studies on C-band accelerator module has started in 2002. First prototype 1-m long accelerating section has been fabricated based upon a design which is half scale of the present S-band section. High power test of the C-band section has been performed at a test stand and later at an accelerator module in the KEKB injector linac. In a beam acceleration test, a field gradient of 41 MV/m is achieved with 43 MW RF power from a klystron. This paper report on the recent status of the high-power test and also the development of a second prototype section.

  18. Resonant states in 13C and 16,17O at high excitation energy

    Science.gov (United States)

    Rodrigues, M. R. D.; Borello-Lewin, T.; Miyake, H.; Duarte, J. L. M.; Rodrigues, C. L.; Horodynski-Matsushigue, L. B.; Ukita, G. M.; Cappuzzello, F.; Cavallaro, M.; Foti, A.; Agodi, C.; Cunsolo, A.; Carbone, D.; Bondi, M.; De Napoli, M.; Roeder, B. T.; Linares, R.; Lombardo, I.

    2014-12-01

    The 9Be(6Li,d)13C and 12,13C(6Li,d)16,17O reactions were measured at the São Paulo Pelletron-Enge-Spectrograph facility at 25.5 MeV incident energy. The nuclear emulsion detection technique was applied. Several narrow resonances were populated up to approximately 17 MeV of excitation energy. An excellent energy resolution was obtained: 40 keV for 13C and 15-30 keV for 16O. The upper limit for the resonance widths were determined. Recently, d-a angular correlations were measured at θd = 0° with incident energy of 25 MeV using the LNS Tandem-MAGNEX Spectrometer facility.

  19. Resonant states in 13C and 16,17O at high excitation energy

    International Nuclear Information System (INIS)

    Rodrigues, M R D; Borello-Lewin, T; Miyake, H; Duarte, J L M; Rodrigues, C L; Horodynski-Matsushigue, L B; Ukita, G M; Cappuzzello, F; Foti, A; Cavallaro, M; Agodi, C; Cunsolo, A; Carbone, D; Bondi, M; Napoli, M De; Roeder, B T; Linares, R; Lombardo, I

    2014-01-01

    The 9 Be( 6 Li,d) 13 C and 12,13 C( 6 Li,d) 16,17 O reactions were measured at the São Paulo Pelletron-Enge-Spectrograph facility at 25.5 MeV incident energy. The nuclear emulsion detection technique was applied. Several narrow resonances were populated up to approximately 17 MeV of excitation energy. An excellent energy resolution was obtained: 40 keV for 13 C and 15-30 keV for 16 O. The upper limit for the resonance widths were determined. Recently, d-a angular correlations were measured at θ d = 0° with incident energy of 25 MeV using the LNS Tandem-MAGNEX Spectrometer facility

  20. Determination of the S18 astrophysical factor for 8B(p,γ)9C from the breakup of 9C at intermediate energies

    International Nuclear Information System (INIS)

    Trache, L.; Mukhamedzhanov, A.M.; Tribble, R.E.; Carstoiu, F.

    2002-06-01

    We have used existing data on the one-proton-removal cross section of 9 C at 285 MeV/u and Glauber model calculations to extract the asymptotic normalization coefficient for the wave function of the last proton in the ground state of 9 C. The calculations are done first using folded potentials starting from two different effective nucleon-nucleon interactions and second in the optical limit using three nucleon-nucleon interactions, and the results are found to be consistent, with no new parameters adjusted. We find C 2 (p 3/2 ) + C 2 (p 1/2 ) = 1.22±0.13 fm -1 . From this result we obtain the astrophysical factor for the proton radiative capture reaction 8 B(p,γ) 9 C as S 18 (0) = 46 ± 6 eV.b. The calculated energy dependence of the astrophysical S-factor for the energy region E cm = 0 - 0.8 MeV and the reaction rates for T 9 = 0 - 1 are included. (authors)

  1. Hydrogenation of the Exocyclic Olefinic Bond at C-16/C-17 Position of ent-Kaurane Diterpene Glycosides of Stevia rebaudiana Using Various Catalysts

    Science.gov (United States)

    Chaturvedula, Venkata Sai Prakash; Prakash, Indra

    2013-01-01

    Catalytic hydrogenation of the exocyclic double bond present between C16 and C17 carbons of the four ent-kaurane diterpene glycosides namely rebaudioside A, rebaudioside B, rebaudioside C, and rebaudioside D isolated from Stevia rebaudiana has been carried out using Pt/C, Pd(OH)2, Rh/C, Raney Ni, PtO2, and 5% Pd/BaCO3 to their corresponding dihydro derivatives with 17α and 17β methyl group isomers. Reactions were performed using the above-mentioned catalysts with the solvents methanol, water, and ethanol/water (8:2) under various conditions. Synthesis of reduced steviol glycosides was performed using straightforward chemistry and their structures were characterized on the basis of 1D and 2D NMR spectral data, including a comparison with reported spectral data. PMID:23896597

  2. Hydrogenation of the Exocyclic Olefinic Bond at C-16/C-17 Position of ent-Kaurane Diterpene Glycosides of Stevia rebaudiana Using Various Catalysts

    Directory of Open Access Journals (Sweden)

    Indra Prakash

    2013-07-01

    Full Text Available Catalytic hydrogenation of the exocyclic double bond present between C16 and C17 carbons of the four ent-kaurane diterpene glycosides namely rebaudioside A, rebaudioside B, rebaudioside C, and rebaudioside D isolated from Stevia rebaudiana has been carried out using Pt/C, Pd(OH2, Rh/C, Raney Ni, PtO2, and 5% Pd/BaCO3 to their corresponding dihydro derivatives with 17α and 17β methyl group isomers. Reactions were performed using the above-mentioned catalysts with the solvents methanol, water, and ethanol/water (8:2 under various conditions. Synthesis of reduced steviol glycosides was performed using straightforward chemistry and their structures were characterized on the basis of 1D and 2D NMR spectral data, including a comparison with reported spectral data.

  3. A 0.7-V 17.4- μ W 3-lead wireless ECG SoC.

    Science.gov (United States)

    Khayatzadeh, Mahmood; Zhang, Xiaoyang; Tan, Jun; Liew, Wen-Sin; Lian, Yong

    2013-10-01

    This paper presents a fully integrated sub-1 V 3-lead wireless ECG System-on-Chip (SoC) for wireless body sensor network applications. The SoC includes a two-channel ECG front-end with a driven-right-leg circuit, an 8-bit SAR ADC, a custom-designed 16-bit microcontroller, two banks of 16 kb SRAM, and a MICS band transceiver. The microcontroller and SRAM blocks are able to operate at sub-/near-threshold regime for the best energy consumption. The proposed SoC has been implemented in a standard 0.13- μ m CMOS process. Measurement results show the microcontroller consumes only 2.62 pJ per instruction at 0.35 V . Both microcontroller and memory blocks are functional down to 0.25 V. The entire SoC is capable of working at single 0.7-V supply. At the best case, it consumes 17.4 μ W in heart rate detection mode and 74.8 μW in raw data acquisition mode under sampling rate of 500 Hz. This makes it one of the best ECG SoCs among state-of-the-art biomedical chips.

  4. A cross-sectional study to assess any possible linkage of C/T polymorphism in CYP17A1 gene with insulin resistance in non-obese women with polycystic ovarian syndrome

    Directory of Open Access Journals (Sweden)

    Ushasi Banerjee

    2016-01-01

    Full Text Available Background & objectives: Insulin resistance (IR is a major confounding factor in polycystic ovarian syndrome (PCOS irrespective of obesity. Its exact mechanism remains elusive till now. C/T polymorphism in the -34 promoter region of the CYP17 gene is inconsistently attributed to elucidate the mechanism of IR and its link to hyperandrogenemia in obese PCOS patients. In the present study we aimed to evaluate any association of this polymorphism with IR in non-obese women with PCOS. Methods: Polymorphism study was performed by restriction fragment length polymorphism (RFLP analysis of the Msp A1 digest of the PCR product of the target gene in 75 PCOS cases against 73 age and BMI matched control women. Serum testosterone, BMI and HOMA-IR (homeostatic model of assessment-insulin resistance were analyzed by standard techniques. A realistic cut-off value for the HOMA-IR was obtained through receiver operating characteristic (ROC curve for exploring any possible link between IR and T/C polymorphism in the case group. Results: Significant increases in serum testosterone and HOMA-IR values were observed among the case group (P<0.001 without any significant elevation in BMI and FBG compared to controls. Cut-off value for IR in the PCOS patients was 1.40 against a maximum sensitivity of 0.83 and a minimum false positivity of 0.13. The analysis revealed an inconclusive link between the C/T polymorphic distribution and insulin resistant case subjects. Interpretation & conclusions: The results showed that CYP17A1 gene was not conclusively linked to either IR or its associated increased androgen secretion in non-obese women with PCOS. We propose that an increased sensitivity of insulin on the ovarian cells may be the predominant reason for the clinical effects and symptoms of androgen excess observed in non-obese PCOS patients in our region.

  5. Cross sections for electron-impact excitation of krypton from the levels of 4p6, 4p55s, and 4p55p configurations

    International Nuclear Information System (INIS)

    Zeng Jiaolong; Yuan Jianmin; Wu Jianhua; Jin Fengtao; Zhao Gang

    2005-01-01

    The electron-impact excitation cross sections at low electron energies have been calculated using a fully relativistic R-matrix method for transitions between levels of 4p 6 , 4p 5 5s, and 4p 5 5p configurations. To ensure the convergence of results, we have paid special attention to the factors that may affect the convergence of cross sections. For examples, we have included extensive configuration interactions in the wave-function expansion of the target states. A large enough R-matrix boundary has been taken to ensure the convergence of atomic wave functions. Contributions to cross sections from a large number of partial waves (up to J=39.5) have been explicitly calculated. The final results are in good agreement with recent experimental data by Jung et al. [Phys. Rev. Lett. 94, 163202 (2005)] after shifting the position of electron energy. The relative difference is about 10% for four transitions out of the metastable levels. The results eliminated the significant discrepancies between theory and experimental work on excitation cross sections out of the metastable levels reported in the literature

  6. Production of muon pairs with masses greater than 4 GeV/c2 in anti p N and π-N interactions at 125 GeV/c

    International Nuclear Information System (INIS)

    Anassontzis, E.; Katsanevas, S.; Kostarakis, P.

    1982-07-01

    We have measured the high mass (M > 4 GeV/c 2 ) dimuons produced in anti-proton-nucleon and pi minus-nucleon interactions. Preliminary differential cross sections are presented as a function of pair mass, x/suf F/, p/sub T/, and √ tau. Comparisons of these cross sections with the predictions of the Drell-Yan model are discussed and preliminary values for the K factor for the anti p and π - induced reactions are reported

  7. Effects of IGFBP-2 on proliferation and differentiation in neural stem cell line C17.2

    Directory of Open Access Journals (Sweden)

    Deng Y

    2017-07-01

    Full Text Available Yujia Deng,1 Lei Wang,1,2 Lite Ge,1,3 Da Duan,1 Yi Zhuo,1 Ting Yuan,1 Weiping Yan,1 Peiqi Huang,1 Xiaohua Teng,1 Ming Lu1,3 1Department of Neurosurgery, The Second Affiliated Hospital of Hunan Normal University (163 Hospital of the People’s Liberation Army, Changsha, 2Department of Neurosurgery, Affiliated Haikou Hospital, Xiangya School of Central South University, Haikou, 3Key Laboratory of Protein Chemistry and Developmental Biology of Ministry of Education, College of Life Sciences, Hunan Normal University, Changsha, People’s Republic of China Objective: Insulin-like growth factor binding protein-2 (IGFBP-2, a member of a highly conserved family of six insulin-like growth factor binding proteins (IGFBPs, can regulate several cellular processes through IGF-dependent or IGF-independent pathway. Recent studies have provided solid evidence for the importance to delineate that olfactory ensheathing cells (OEC-conditioned medium (OCM can not only facilitate the differentiation of neural stem cell line (C17.2 into neurons, but also promote the survival and proliferation. We have previously reported that IGFBP-2 was detected in OCM. This study is designed to investigate the roles of IGFBP-2 for the regulation of C17.2 differentiation and proliferation.Methods and results: IGFBP-2 was identified and upregulated in OCM to compare with astrocytes-conditioned medium by shotgun proteomics and semiquantitative proteomic analysis. In order to investigate whether exogenous IGFBP-2 could stimulate proliferation in C17.2 cells and differentiate it into glia or neuron, we used various concentrations of IGFBP-2 to induce C17.2 cells which were cultured in DMEM/F12. The results showed that exogenous IGFBP-2 can promote proliferation in C17.2 cells, but had little effect on differentiation. Interestingly, we also found that IGFBP-2 could induce C17.2 cells to differentiate into astrocytes, while inhibiting their differentiation into neurons in a dose

  8. Assessment of tenascin-C levels in ventricular noncompaction/hypertrabeculation patients: a cross-sectional study.

    Science.gov (United States)

    Erer, Hatice Betul; Guvenc, Tolga Sinan; Kemik, Ahu Sarbay; Yilmaz, Hale; Kul, Seref; Altay, Servet; Oz, Dilaver; Zeren, Gonul; Ekmekci, Ahmet; Zencirci, Aycan Esen; Sayar, Nurten; Eren, Mehmet

    2014-02-01

    Ventricular noncompaction/hypertrabeculation (NC/HT) is a rare form of congenital cardiomyopathy. We aimed to investigate the presence of serum tenascin-C (TN-C) in adult patients with NC/HT and evaluate its value. Serum TN-C levels were measured by ELISA in 50 NC/HT patients both with/without systolic dysfunction and in 23 normal controls. Systolic dysfunction was defined as ejection fraction (EF) ≤ 40. Mann-Whitney U-test and ROC curve analysis were done. Of 49 NC/HT patients, 24 (49%) patients had systolic dysfunction (mean age 36 ± 15) and 25 patients (51%) had normal systolic function (mean age 36 ± 17). The ages between groups were not different. The mean levels of serum TN-C in patients with or without systolic dysfunction were 26 ± 10 ng/mL and 26 ± 8 ng/mL respectively, compared to normal controls, 7 ± 2 ng/mL (P < 0.001). No significance was observed between 2 groups of NC/HT patients regarding TN-C levels (P = 0.8). The ROC curve analysis revealed that a TN-C value of 11.7 ng/mL identified patients with NC/HT with 100% sensitivity and specifity. High serum TN-C levels are present in adult NC/HT cardiomyopathy even when left ventricular systolic function remains normal. Also, serum TN-C levels could be regarded as a candidate biomarker in the diagnosis of NC/HT which needs to be tested in larger prospective studies. © 2013, Wiley Periodicals, Inc.

  9. Measurement of negatively charged pion spectra in inelastic p+p interactions at $p_{lab}$ = 20, 31, 40, 80 and 158 GeV/c

    CERN Document Server

    Abgrall, N; Ali, Y; Anticic, T; Antoniou, N; Baatar, B; Bay, F; Blondel, A; Blumer, J; Bogomilov, M; Bravar, A; Brzychczyk, J; Bunyatov, S A; Busygina, O; Christakoglou, P; Czopowicz, T; Davis, N; Debieux, S; Dembinski, H; Diakonos, F; Di Luise, S; Dominik, W; Drozhzhova, T; Dumarchez, J; Dynowski, K; Engel, R; Ereditato, A; Feofilov, G A; Fodor, Z; Fulop, A; Gazdzicki, M; Golubeva, M; Grebieszkow, K; Grzeszczuk, A; Guber, F; Haesler, A; Hasegawa, T; Hierholzer, M; Idczak, R; Igolkin, S; Ivashkin, A; Jokovic, D; Kadija, K; Kapoyannis, A; Katrynska, N; Kaptur, E; Kielczewska, D; Kirejczyk, M; Kisiel, J; Kiss, T; Kleinfelder, S; Kobayashi, T; Kolesnikov, V I; Kolev, D; Kondratiev, V P; Korzenev, A; Kovesarki, P; Kowalski, S; Krasnoperov, A; Kurepin, A; Larsen, D; Laszlo, A; Lyubushkin, V V; Mackowiak-Pawlowska, M; Majka, Z; Maksiak, B; Malakhov, A I; Manic, D; Marcinek, A; Marin, V; Marton, K; Mathes, H J; Matulewicz, T; Matveev, V; Melkumov, G.L; Mrowczynski, St; Murphy, S; Nakadaira, T; Nirkko, M; Nishikawa, K; Palczewski, T; Palla, G; Panagiotou, A D; Paul, T; Pistillo, C; Peryt, W; Petukhov, O; Planeta, R; Pluta, J; Popov, B A; Posiadala, M; Pulawski, S; Puzovic, J; Rauch, W; Ravonel, M; Redij, A; Renfordt, R; Robert, A; Rohrich, D; Rondio, E; Roth, M; Rubbia, A; Rustamov, A; Rybczynski, M; Sadovsky, A; Sakashita, K; Savic, M; Schmidt, K; Sekiguchi, T; Seyboth, P; Sgalaberna, D; Shibata, M; Sipos, R; Skrzypczak, E; Slodkowski, M; Staszel, P; Stefanek, G; Stepaniak, J; Strobele, H; Susa, T; Szuba, M; Tada, M; Tereshchenko, V; Tolyhi, T; Tsenov, R; Turko, L; Ulrich, R; Unger, M; Vassiliou, M; Veberic, D; Vechernin, V V; Vesztergombi, G; Vinogradov, L; Wilczek, A; Wlodarczyk, Z; Wojtaszek-Szwarc, A; Wyszynski, O; Zambelli, L; Zipper, W

    2014-01-01

    We present experimental results on inclusive spectra and mean multiplicities of negatively charged pions produced in inelastic p+p interactions at incident projectile momenta of 20, 31, 40, 80 and 158GeV/c ($\\sqrt{s}$ = 6.3, 7.7, 8.8, 12.3 and 17.3GeV, respectively). The measurements were performed using the large acceptance NA61/SHINE hadron spectrometer at the CERN super proton synchrotron. Two-dimensional spectra are determined in terms of rapidity and transverse momentum. Their properties such as the width of rapidity distributions and the inverse slope parameter of transverse mass spectra are extracted and their collision energy dependences are presented. The results on inelastic p+p interactions are compared with the corresponding data on central Pb+Pb collisions measured by the NA49 experiment at the CERN SPS. The results presented in this paper are part of the NA61/SHINE ion program devoted to the study of the properties of the onset of deconfinement and search for the critical point of strongly inter...

  10. A global reference for caesarean section rates (C-Model): a multicountry cross-sectional study.

    Science.gov (United States)

    Souza, J P; Betran, A P; Dumont, A; de Mucio, B; Gibbs Pickens, C M; Deneux-Tharaux, C; Ortiz-Panozo, E; Sullivan, E; Ota, E; Togoobaatar, G; Carroli, G; Knight, H; Zhang, J; Cecatti, J G; Vogel, J P; Jayaratne, K; Leal, M C; Gissler, M; Morisaki, N; Lack, N; Oladapo, O T; Tunçalp, Ö; Lumbiganon, P; Mori, R; Quintana, S; Costa Passos, A D; Marcolin, A C; Zongo, A; Blondel, B; Hernández, B; Hogue, C J; Prunet, C; Landman, C; Ochir, C; Cuesta, C; Pileggi-Castro, C; Walker, D; Alves, D; Abalos, E; Moises, Ecd; Vieira, E M; Duarte, G; Perdona, G; Gurol-Urganci, I; Takahiko, K; Moscovici, L; Campodonico, L; Oliveira-Ciabati, L; Laopaiboon, M; Danansuriya, M; Nakamura-Pereira, M; Costa, M L; Torloni, M R; Kramer, M R; Borges, P; Olkhanud, P B; Pérez-Cuevas, R; Agampodi, S B; Mittal, S; Serruya, S; Bataglia, V; Li, Z; Temmerman, M; Gülmezoglu, A M

    2016-02-01

    To generate a global reference for caesarean section (CS) rates at health facilities. Cross-sectional study. Health facilities from 43 countries. Thirty eight thousand three hundred and twenty-four women giving birth from 22 countries for model building and 10,045,875 women giving birth from 43 countries for model testing. We hypothesised that mathematical models could determine the relationship between clinical-obstetric characteristics and CS. These models generated probabilities of CS that could be compared with the observed CS rates. We devised a three-step approach to generate the global benchmark of CS rates at health facilities: creation of a multi-country reference population, building mathematical models, and testing these models. Area under the ROC curves, diagnostic odds ratio, expected CS rate, observed CS rate. According to the different versions of the model, areas under the ROC curves suggested a good discriminatory capacity of C-Model, with summary estimates ranging from 0.832 to 0.844. The C-Model was able to generate expected CS rates adjusted for the case-mix of the obstetric population. We have also prepared an e-calculator to facilitate use of C-Model (www.who.int/reproductivehealth/publications/maternal_perinatal_health/c-model/en/). This article describes the development of a global reference for CS rates. Based on maternal characteristics, this tool was able to generate an individualised expected CS rate for health facilities or groups of health facilities. With C-Model, obstetric teams, health system managers, health facilities, health insurance companies, and governments can produce a customised reference CS rate for assessing use (and overuse) of CS. The C-Model provides a customized benchmark for caesarean section rates in health facilities and systems. © 2015 World Health Organization; licensed by John Wiley & Sons Ltd on behalf of Royal College of Obstetricians and Gynaecologists.

  11. Quality Assurance of the Cross-sections Measured on p+Li/C Source

    Czech Academy of Sciences Publication Activity Database

    Majerle, Mitja; Bém, Pavel; Novák, Jan; Šimečková, Eva; Štefánik, Milan; Simakov, S.; Fischer, U.

    2014-01-01

    Roč. 119, MAY (2014), s. 425-428 ISSN 0090-3752 Institutional support: RVO:61389005 Keywords : cross section * neutron beam * irradiation Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders Impact factor: 4.571, year: 2014

  12. Magnetism and local environment model in (Ni/sub 1-c/Co/sub c/)078P014B008 amorphous alloys

    International Nuclear Information System (INIS)

    Amamou, A.

    1976-06-01

    The magnetic properties of amorphous alloys (Ni/sub 1-c/Co/sub c/) 0 . 78 P 0 . 14 B 0 . 08 were investigated. The samples were prepared by the splat-cooling method. The Curie temperatures were determined and the magnetization measurements, performed for 1.7 0 K less than or equal to T less than or equal to 270 0 K and fields up to kOe. Ni 0 . 78 P 0 . 14 B 0 . 08 is paramagnetic, whereas Co 0 . 78 P 0 . 14 B 0 . 08 is ferromagnetic until the crystallization temperature (678 0 K). The average moment per cobalt atom is 1.15 μ/sub B/. In (Ni/sub 1-c/Co/sub c/) 0 . 78 P 0 . 14 B 0 . 08 the critical concentration for the paramagnetic-ferromagnetic transition is c approximately equal to 0.15; this transition occurs in an inhomogeneous way. The saturation magnetization in the whole concentration range can be interpreted (as for some crystallized alloys and compounds) by a local environment model, when a reasonable short-range order is assumed. In such a model the magnetic moment per cobalt atom is related merely to the number of its Co first neighbors n/sub Co/. For n/sub Co/ = 0 and 1 the cobalt atom is not magnetic, for n/sub Co/ = 2 and 3 it carries a small moment μ 1 = 0.50μ/sub B/ and for n/sub Co/ greater than 3 it is magnetic with μ 2 = 1.15μ/sub B/ as in Co 0 . 78 P 0 . 14 B 0 . 08 ; the nickel atoms do not carry a substantial moment in the entire concentration range. These features are comparable to those obtained in some crystalline alloys. 3 figures

  13. The effect of pregnancy and estradiol-17 beta treatment on the biliary transport maximum of dibromosulfophthalein, and the glucuronide conjugates of 5-phenyl-5-p-hydroxyphenyl[14C]hydantoin and [14C]morphine in the isolated perfused rat liver

    International Nuclear Information System (INIS)

    Auansakul, A.C.; Vore, M.

    1982-01-01

    The biliary transport maximum (Tm) of three organic axions was determined in the isolated perfused livers of untreated female (control), estradiol-17 beta (E2)-treated female (1 mg/kg/day, s.c. for 14 days), and pregnant (19-21 days of gestation) rats. Dibromosulfophthalein (DBSP), 5-phenyl-5-p-hydroxyphenyl[ 14 C]hydantoin (HPPH) and [ 14 C]morphine were infused continuously into the perfusate for a total dose of 41.2, 18, or 40.5 mumol, respectively. The concentration of [ 14 C]HPPH and [ 14 C]morphine declined in the perfusate, whereas the concentrations of [ 14 C]HPPH glucuronide and [ 14 C]morphine glucuronide increased during the 90-min experiment, indicating that the rate of formation of the glucuronide exceeded its rate of excretion in bile. E2 treatment decreased the Tm (nmol/min/g liver) for [ 14 C]HPPH glucuronide and [ 14 C]morphine glucuronide but not for DBSP, whereas pregnancy decreased the Tm for all three organic anions. Pregnancy, and to a lesser extent E2 treatment, increased liver weight. When expressed per whole liver, the Tm was not altered by pregnancy for any of three organic anions. E2 treatment increased the Tm for DBSP, had no effect on the Tm for HPPH glucuronide and decreased the Tm for [ 14 C]morphine glucuronide. These data suggest the presence of multiple carriers for organic anions which are differentially affected by estrogen treatment and pregnancy

  14. Asymmetry measurements in p--p scattering with polarized beams and targets up to 12 GeV/c

    International Nuclear Information System (INIS)

    Auer, I.P.; Colton, E.; Halpern, H.; Hill, D.; Spinka, H.; Tamura, N.; Theodosiou, G.; Underwood, D.; Wanger, R.; Watanabe, Y.; Yokosawa, A.

    1978-01-01

    The processes of proton--proton scattering for various spin directions was investigated in the beam momentum range of 1 to 12 GeV/c. A striking energy dependence was observed at p/sub lab/ = 1 to 4 GeV/c, especially in Δ sigma/sub L/, the total cross section difference in the longitudinal spin states. The rapid energy dependence has been interpreted as evidence for the formation of diproton resonances. Various pp scattering parameters were measured at 6 GeV/c, including 3-spin parameters, which are sufficient to determine pp elastic scattering amplitudes in a model independent way at 0.2 2 . Measurements of spin--spin correlation parameters were extended to higher t and higher energies, revealing the importance of the spin dependent interaction. These measurements may shed light on the nature of the constituents and their interactions. 24 references

  15. FIRST DETECTION OF [C I] {sup 3}P{sub 1}–{sup 3}P{sub 0} EMISSION FROM A PROTOPLANETARY DISK

    Energy Technology Data Exchange (ETDEWEB)

    Tsukagoshi, Takashi; Momose, Munetake [College of Science, Ibaraki University, Bunkyo 2-1-1, Mito 310-8512 (Japan); Saito, Masao [Nobeyama Radio Observatory, Minamimaki, Minamisaku, Nagano 384-1305 (Japan); Kitamura, Yoshimi [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, Yoshinodai 3-1-1, Sagamihara, Kanagawa 229-8510 (Japan); Shimajiri, Yoshito [Laboratoire AIM, CEA/DSM-CNRS-Université Paris, Diderot, IRFU/Service d’Astrophysique, CEA, Saclay, F-91191 Gif-sur-Yvette Cedex (France); Kawabe, Ryohei, E-mail: ttsuka@mx.ibaraki.ac.jp [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan)

    2015-03-20

    We performed single point [C i] {sup 3}P{sub 1}–{sup 3}P{sub 0} and CO J = 4–3 observations toward three T Tauri stars (TTSs), DM Tau, LkCa 15, and TW Hya, using the Atacama Large Millimeter/submillimeter Array Band 8 qualification model receiver installed on the Atacama Submillimeter Telescope Experiment. Two protostars (PSs) in the Taurus L1551 region, L1551 IRS 5 and HL Tau, were also observed. We successfully detected [C i] emission from the protoplanetary disk around DM Tau as well as the protostellar targets. The spectral profile of the [C i] emission from the protoplanetary disk is marginally single-peaked, suggesting that atomic carbon (C) extends toward the outermost disk. The detected [C i] emission is optically thin and the column densities of C are estimated to be ≲10{sup 16} and ∼10{sup 17} cm{sup −2} for the TTS targets and the PSs, respectively. We found a clear difference in the total mass ratio of C to dust, M(C)/M(dust), between the TTSs and protostellar targets; the M(C)/M(dust) ratio of the TTSs is one order of magnitude smaller than that of the PSs. The decrease of the estimated M(C)/M(dust) ratios for the disk sources is consistent with a theoretical prediction that the atomic C can survive only in the near surface layer of the disk and C{sup +}/C/CO transition occurs deeper into the disk midplane.

  16. Search for $C\\!P$ violation in $\\Lambda_b\\to pK^-\\mu^+\\mu^-$ decays

    CERN Document Server

    AUTHOR|(CDS)2091898; Neri, Nicola

    In this thesis the first search for $C\\!P$-violation on rare heavy beauty baryon $\\Lambda_b\\to pK^-\\mu^+\\mu^-$ decays is described. This analysis is carried out on the whole dataset recorded by the LHCb experiment during 2011 and 2012. The $C\\!P$ symmetry violation study is one of the most promising method for searching physics beyond the standard model, as the measured amount of $C\\!P$-violation in high-energy physics experiments, even though compatible with standard model expectations, is not sufficient for explaining the observed matter-antimatter asymmetry of our universe. The $\\Lambda_b\\to pK^-\\mu^+\\mu^-$ decays occur via electroweak loop diagrams which allow possible new physics fields to give this process a sensible contribution. For the $\\Lambda_b\\to pK^-\\mu^+\\mu^-$ decay a limited quantity of $C\\!P$-violation is expected in the standard model, making this transition suited to look for beyond standard model physics. In this thesis, $C\\!P$-violation is searched exploiting direct $C\\!P$ asymmetries and ...

  17. Change of I-V characteristics of SiC diodes upon reactor irradiation; Modification des caracteristiques I-V de jonctions p-n au SiC du fait d'une irradiation dans un reacteur; Izmeneniya kharakteristik I-V vyrashchennogo v SiC perekhoda tipa p-n posle oblucheniya ego v reaktore; Modificaciones que sufren por irradiacion en un reactor las caracteristicas I-V de uniones p-n en SiC

    Energy Technology Data Exchange (ETDEWEB)

    Heerschap, M; De Coninck, R [Solid State Physics Dept., SCK-CEN, Mol (Belgium)

    1962-04-15

    In search for semiconductors, which can be used in high-flux reactors in order to measure flux distributions, we irradiated SiC p-n junctions in the Belgium BR-1 reactor. Two types of SiC-diodes of different origin have been irradiated. These junctions are grown in the Lely-furnace. The change in forward and reverse characteristics have been measured during and after irradiation up to temperatures of 150{sup o}C, while measurements up to a temperature of 500{sup o}C are in progress. It has been found that one type resists BR-1 neutrons up to an integrated flux of 10{sup 15} n/cm{sup 2}, while the other resists irradiation up to a flux of 10{sup 17} n/cm{sup 2}. The changes in characteristics are given as well as the result of some annealing experiments. (author) [French] En recherchant des semi-conducteurs pouvant servir a mesurer les distributions de flux dans les reacteurs a haut flux de neutrons, les auteurs ont irradie des jonctions p-n au SiC dans le reacteur belge BR-1. Deux types de diodes a SiC d'origines differentes ont ete ainsi irradies. Les jonctions en question sont preparees par etirage dans le four Lely. Les auteurs ont mesure les modifications subies par les caracteristiques I-V apres et pendant l'irradiation a des temperatures allant jusqu'a 150{sup o}C; ils poursuivent leurs mesures dans la gamme des temperatures allant de 150{sup o}C a 500{sup o}C. Us ont constate que l'un des types de diode a SiC resiste aux neutrons du reacteur BR-1 jusqu'a 10{sup 15} n/cm{sup 2}, tandis que l'autre type resiste a l'irradiation jusqu'a 10{sup 17} n/cm{sup 2}. Les auteurs indiquent les modifications subies par les caracteristiques, ainsi que le resultat de certaines experiences de recuit. (author) [Spanish] Los autores estan tratando de encontrar semiconductores con los que sea posible medir distribuciones de flujo en reactores de flujo elevado, y con este fin irradiaron uniones p-n del SiC en el reactor BR-1 de Belgica. Irradiaron dos tipos de diodos de SiC de

  18. A mechanistic study of Toxoplasma gondii ROP18 inhibiting differentiation of C17.2 neural stem cells

    Directory of Open Access Journals (Sweden)

    Xian Zhang

    2017-11-01

    Full Text Available Abstract Background Congenital infection of Toxoplasma gondii is an important factor causing birth defects. The neural stem cells (NSCs are found to be one of the target cells for the parasite during development of the brain. As a key virulence factor of the parasite that hijacks host cellular functions, ROP18 has been demonstrated to mediate the inhibition of host innate and adaptive immune responses through specific binding different host immunity related molecules. However, its pathogenic actions in NSCs remain elusive. Results In the present study, ROP18 recombinant adenovirus (Ad-ROP18 was constructed and used to infect C17.2 NSCs. After 3d- or 5d–culture in differentiation medium, the differentiation of C17.2 NSCs and the activity of the Wnt/β-catenin signaling pathway were detected. The results showed that the protein level of βIII-tubulin, a marker of neurons, in the Ad-ROP18-transfected C17.2 NSCs was significantly decreased, indicating that the differentiation of C17.2 NSCs was inhibited by the ROP18. The β-catenin level in the Ad-ROP18-transfected C17.2 NSCs was found to be lower than that in the Ad group. Also, neurogenin1 (Ngn1 and neurogenin2 (Ngn2 were downregulated significantly (P < 0.05 in the Ad-ROP18-transfected C17.2 NSCs compared to the Ad group. Accordingly, the TOP flash/FOP flash dual-luciferase report system showed that the transfection of Ad-ROP18 decreased the Wnt/β-catenin pathway activity in the C17.2 NSCs. Conclusions The inhibition effect of the ROP18 from T. gondii (TgROP18 on the neuronal differentiation of C17.2 NSCs was at least partly mediated through inhibiting the activity of the Wnt/β-catenin signaling pathway, eventually resulting in the downregulation of Ngn1 and Ngn2. The findings help to better understand potential mechanisms of brain pathology induced by TgROP18.

  19. Spin dependence in high $p^{2}_{T}$ elastic pp and np scattering

    CERN Document Server

    Crabb, D G; Hansen, P.H.; Hauser, J.; Krisch, A.D.; Sandler, B.; Shima, T.; Terwilliger, K.M.; Crosbie, E.A.; Ratner, L.G.; Schultz, P.F.; Thomas, G.H.; O'Fallon, J.R.; Lin, A.D.; Salthouse, A.J.; Linn, S.L.; Perlmutter, A.; Karmakar, N.L.; Kyberd, P.

    1979-01-01

    Using the polarized proton capability of the Argonne ZGS the authors recently made 90 degrees /sub cm/ measurements of elastic pp scattering from 6 to 11.75 GeV/c, determining the parallel and anti- parallel pure initial spin state cross sections and the associated spin-spin parameter A/sub nn/ with the spins normal to the scattering plane. They find that the parallel to anti-parallel cross section ratio rises dramatically from 1.2+or-.06 at p/sub t//sup 2/=3.3 (GeV /c)/sup 2/ to 3.2+or-.4 at 4.8 (GeV/c)/sup 2/, similar to the p/sub T //sup 2/ dependence previously observed at the fixed laboratory momentum of 11.75 GeV/c. They have also extended the measurements at 6 GeV/c and find that A/sub nn/ has a small but sharp rise at 90 degrees /sub cm/. In addition a month of 12 GeV/c polarized deuteron acceleration in the ZGS enabled them to measure two A/sub nn/ at two points at 6 GeV/c for np elastic scattering: A/sub nn/=-.17+or-.04 at p/sub T//sup 2/=.8, A/sub nn/=-.19+or-.05 at P/sub T//sup 2/=1.0. These value...

  20. Experimental studies of collisions of excited Li(4p) atoms with C2H4, C2H6, C3H8 and theoretical interpretation of the Li-C2H4 system

    International Nuclear Information System (INIS)

    Semmineh, Natenael; Bililign, Solomon; Hagebaum-Reignier, Denis; Jeung, Gwang-Hi

    2009-01-01

    Collisions of excited Li(4p) states with C 2 H 4 , C 2 H 6 and C 3 H 8 are studied experimentally using far-wing scattering state spectroscopy techniques. High-level ab initio quantum mechanical studies of the Li-C 2 H 4 system are conducted to explain the results of the experiment for this system. The recent and present works indicate that knowledge of the internal structure of the perturber (C 2 H 4 , C 2 H 6 and C 3 H 8 ) is essential to fully understand the interaction between the metal and the hydrocarbon molecules. The ab initio calculation shows that the Li(4d) (with little probability under the experimental conditions) and the Li(4p) can be formed directly through the laser pumping. It also shows that the Li(4s) and Li(3d) states can be formed through an electronic diabatic coupling involving a radiationless process. However, the Li(3p), Li(3s) and Li(2p) states can only be formed through a secondary diabatic coupling which is a much less probable process than the primary one. The calculation limited to two C 2v sections of the potential energy surfaces (PESs) shows peculiar multi-state crossings that we have never seen in other lithium complexes we studied

  1. Cross section and panti p invariant mass distribution of the reaction γp → panti pp at 4.74-6.55 GeV, an experimental investigation

    International Nuclear Information System (INIS)

    Bodenkamp, J.

    1981-08-01

    This paper gives a report of a photoproduction experiment of proton-antiproton pairs on hydrogen in the elastic reaction γp → panti pp which was performed at the Deutsches Elektronensynchrotron in Hamburg. The results of our measurements do not show substantial energy dependence in the energy range in our experiment. We obtain an integrated cross section of 79.6 +- 6 nbarn for the investigated reaction. Data accumulations could be observed in the invariant mass distribution of the proton antiproton pairs at 1940 MeV/c 2 and 2020 MeV/c 2 . The signal at 2020 MeV/c 2 has a statistical significance of 3.5 standard deviations and is in agreement with a resonance of the panti p-system reported in earlier experiments, a Breit-Wigner fit to the data yielded for mass msub(o) and width GAMMAsub(o) of this signal m 0 = 2.023 +- .005 GeV/c 2 GAMMA 0 = 27 +- 12 MeV/c 2 . (orig./HSI) [de

  2. Photodetachment cross sections for He-(4P0)

    International Nuclear Information System (INIS)

    Compton, R.N.; Alton, G.D.; Pegg, D.J.

    1980-01-01

    The first measurements are reported of photodetachment cross sections for He - (formed through charge exchange of He + with Ca vapor) over the photon energy range from 1.77 to 2.75 eV. The energies of autodetached electrons from the metastable He - beam have also been determined for the first time. The autodetached electron energy agrees within experimental error (+-0.25 eV) with the known 1s2s2p) 4 P 0 He - energy level. This taken with measurements for the lifetime of He - infers that charge exchange of He + with Ca vapor produces 4 P 0 He -

  3. Measurement of the Inclusive Jet Cross Section using the k(T) algorithm in p anti-p collisions at s**(1/2) = 1.96-TeV with the CDF II Detector

    Energy Technology Data Exchange (ETDEWEB)

    Abulencia, A.; /Illinois U., Urbana; Adelman, J.; /Chicago U., EFI; Affolder, Anthony Allen; /UC, Santa Barbara; Akimoto, T.; /Tsukuba U.; Albrow, Michael G.; /Fermilab; Ambrose, D.; /Fermilab; Amerio, S.; /Padua U.; Amidei, Dante E.; /Michigan U.; Anastassov, A.; /Rutgers U., Piscataway; Anikeev, Konstantin; /Fermilab; Annovi, A.; /Frascati /Comenius U.

    2007-01-01

    The authors report on measurements of the inclusive jet production cross section as a function of the jet transverse momentum in p{bar p} collisions at {radical}s = 1.96 TeV, using the k{sub T} algorithm and a data sample corresponding to 1.0 fb{sup -1} collected with the Collider Detector at Fermilab in Run II. The measurements are carried out in five different jet rapidity regions with |y{sup jet}| < 2.1 and transverse momentum in the range 54 < p{sub T}{sup jet} < 700 GeV/c. Next-to-leading order perturbative QCD predictions are in good agreement with the measured cross sections.

  4. 78 FR 69155 - Altegris Advisors, L.L.C., et al.; Notice of Application

    Science.gov (United States)

    2013-11-18

    ... Advisors, L.L.C., et al.; Notice of Application November 12, 2013. AGENCY: Securities and Exchange..., under sections 6(c) and 17(b) of the Act for an exemption from sections 17(a)(1) and (2) of the Act, and under section 6(c) of the Act for an exemption from rule 12d1- 2(a) under the Act. Summary of...

  5. Promising Tools in Prostate Cancer Research: Selective Non-Steroidal Cytochrome P450 17A1 Inhibitors

    Science.gov (United States)

    Bonomo, Silvia; Hansen, Cecilie H.; Petrunak, Elyse M.; Scott, Emily E.; Styrishave, Bjarne; Jørgensen, Flemming Steen; Olsen, Lars

    2016-07-01

    Cytochrome P450 17A1 (CYP17A1) is an important target in the treatment of prostate cancer because it produces androgens required for tumour growth. The FDA has approved only one CYP17A1 inhibitor, abiraterone, which contains a steroidal scaffold similar to the endogenous CYP17A1 substrates. Abiraterone is structurally similar to the substrates of other cytochrome P450 enzymes involved in steroidogenesis, and interference can pose a liability in terms of side effects. Using non-steroidal scaffolds is expected to enable the design of compounds that interact more selectively with CYP17A1. Therefore, we combined a structure-based virtual screening approach with density functional theory (DFT) calculations to suggest non-steroidal compounds selective for CYP17A1. In vitro assays demonstrated that two such compounds selectively inhibited CYP17A1 17α-hydroxylase and 17,20-lyase activities with IC50 values in the nanomolar range, without affinity for the major drug-metabolizing CYP2D6 and CYP3A4 enzymes and CYP21A2, with the latter result confirmed in human H295R cells.

  6. The Cr–Fe–Nb ternary system: Experimental isothermal sections at 700 °C, 1050 °C and 1350 °C

    Energy Technology Data Exchange (ETDEWEB)

    Jacob, Aurélie, E-mail: a.jacob@fz-juelich.de [Forschungszentrum Juelich, IEK-2, 52425 Juelich (Germany); Schmetterer, Clemens [Forschungszentrum Juelich, IEK-2, 52425 Juelich (Germany); Fraunhofer-UMSICHT, 92237 Sulzbach-Rosenberg (Germany); Grüner, Daniel; Wessel, Egbert [Forschungszentrum Juelich, IEK-2, 52425 Juelich (Germany); Hallstedt, Bengt [Institute for Materials Applications in Mechanical Engineering, RWTH Aachen University, Augustinerbach 4, 52062 Aachen (Germany); Singheiser, Lorenz [Forschungszentrum Juelich, IEK-2, 52425 Juelich (Germany)

    2015-11-05

    The Cr–Fe–Nb system is an important constituent system in the development of Laves-phase reinforced steels. It contains two Laves-phase polytypes, i.e. C14–Fe{sub 2}Nb and C15–Cr{sub 2}Nb. While the first forms a substantial ternary solid solution with Cr, the latter only shows a limited solubility for Fe. The phase equilibria in the Cr–Fe–Nb system are shown in three isothermal sections at 700, 1050 and 1350 °C. Scanning electron microscopy coupled with energy dispersive X-ray analysis (SEM/EDX), X-ray diffraction (XRD) and electron back scatter diffraction (EBSD) were used to determine the phase equilibria from which the isothermal sections were constructed. - Highlights: • Determination of Phase Equilibria in the Cr–Fe–Nb system at 700, 1050 and 1350 °C. • Isothermal sections at 700, 1050 and 1350 °C were established. • Homogeneity range of Laves phases were determined. • Solubility of Fe and Cr and lattice parameter evolution in the ternary phases were determined.

  7. Inclusive and semi-inclusive rho0 production in π-p interactions at 147 GeV/c

    International Nuclear Information System (INIS)

    Fong, D.; Heller, M.; Shapiro, A.M.; Widgoff, M.; Bruyant, F.; Bogert, D.; Johnson, M.; Burnstein, R.; Fu, C.; Petersen, D.; Robertson, M.; Rubin, H.; Sard, R.; Snyder, A.; Tortora, J.; Alyea, D.; Chien, C.-Y.; Lucas, P.; Pevsner, A.; Zdanis, R.; Brau, J.; Grunhaus, J.; Hafen, E.S.; Hulsizer, R.I.; Karshon, U.; Kistiakowsky, V.; Levy, A.; Napier, A.; Pless, I.A.; Trepagnier, P.C.; Wolfson, J.; Yamamoto, R.K.; Cohn, H.; Ou, T.C.; Plano, R.; Watts, T.; Brucker, E.; Koller, E.; Stamer, P.; Taylor, S.; Bugg, W.; Condo, G.; Handler, T.; Hart, E.; Kraybill, H.; Ljung, D.; Ludlam, T.; Taft, H.D.

    1975-01-01

    Data on inclusive and semi-inclusive rho 0 production in 147 GeV/c π - p interactions are presented. A total cross section of 7.3+-1.3 mb is found. Most of this cross section is found in the lower topology events ( 2 dependence of rho 0 production, sub(rho 0 ) per event, and the rho 0 /π + ratios are also discussed. (Auth.)

  8. A measurement of t$\\bar{t}$ production cross section in p$\\bar{p}$ collisions at √s = 1.8 TeV using neural networks

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Harpreet [Univ. of California, Riverside, CA (United States)

    1999-12-01

    The authors present the results of a new measurement of the t$\\bar{t}$ production cross section using eμ channel in p$\\bar{p}$ collisions at √s = 1.8 TeV. This study corresponds to an integrated luminosity of 108.3 ± 5.7 pb-1 acquired by the D0 detector during the Fermilab Tevatron Collider Run 1 (1992--1996). By using neural network techniques instead of the conventional analysis methods, the authors show that the signal acceptance can be increased by 10% (for mt = 172 GeV/c2) while the background remains constant. Four eμ events are observed in data with an estimated background of 0.22 ± 0.14 corresponding to a t$\\bar{t}$ production cross section of 9.75 ± 5.53 pb.

  9. Hadron production from $\\mu-Deuteron$ scattering at $\\sqrt{s}=17 GeV$ at COMPASS

    CERN Document Server

    Morreale, Astrid

    2011-01-01

    Hadrons proceeding from quasi-real photo-production are one of the many probes accesible at the Common Muon Proton Apparatus for Structure and Spectroscopy (COMPASS) at CERN. These hadrons provide information on the scattering between photon and partons through $\\gamma$-gluon($g$) direct channels as well as $q-g$ resolved processes. Comparisons of unpolarized differential cross section measurements to next-to-leading order (NLO) pQCD calculations are essential to develop our understanding of proton-proton and lepton-nucleon scattering at varying center of mass energies. These measurements are important to asses the applicability of NLO pQCD in interpreting polarized processes. In this talk we will present the unidentified charged separated hadron cross-sections measured by the COMPASS experiment at center of mass energy of $\\sqrt{s}$ = 17 $GeV$, low $Q^{2}$ (Q$^{2}$ 1.0 $GeV/c$.)

  10. Metabolism of 7-ethoxycoumarin, flavanone and steroids by cytochrome P450 2C9 variants.

    Science.gov (United States)

    Uno, Tomohide; Nakano, Ryosuke; Kanamaru, Kengo; Takenaka, Shinji; Uno, Yuichi; Imaishi, Hiromasa

    2017-11-01

    CYP2C9 is a human microsomal cytochrome P450c (CYP). Much of the variation in CYP2C9 levels and activity can be attributed to polymorphisms of this gene. Wild-type CYP2C9 and mutants were coexpressed with NADPH-cytochrome P450 reductase in Escherichia coli. The hydroxylase activities toward 7-ethoxycoumarin, flavanone and steroids were examined. Six CYP2C9 variants showed Soret peaks (450 nm) typical of P450 in reduced CO-difference spectra. CYP2C9.38 had the highest 7-ethoxycoumarin de-ethylase activity. All the CYP2C9 variants showed lower flavanone 6-hydroxylation activities than CYP2C9.1 (the wild-type). CYP2C9.38 showed higher activities in testosterone 6β-hydroxylation, progesterone 6β-/16α-hydroxylation, estrone 11α-hydroxylation and estradiol 6α-hydroxylation than CYP2C9.1. CYP2C9.40 showed higher testosterone 17-oxidase activity than CYP2C9.1; CYP2C9.8 showed higher estrone 16α-hydroxylase activity and CYP2C9.12 showed higher estrone 11α-hydroxylase activity. CYP2C9.9 and CYP2C9.10 showed similar activities to CYP2C9.1. These results indicate that the substrate specificity of CYP2C9.9 and CYP2C9.10 was not changed, but CYP2C9.8, CYP2C9.12 and CYP2C9.40 showed different substrate specificity toward steroids compared with CYP2C9.1; and especially CYP2C9.38 displayed diverse substrate specificities towards 7-ethoxycoumarin and steroids. Copyright © 2017 John Wiley & Sons, Ltd.

  11. Measurements of the total cross sections of Sigma /sup -/ and Xi /sup -/ on protons and deuterons between 74 and 137 GeV/c

    CERN Document Server

    Biagi, S F; Britten, A J; Brown, R M; Burckhart, H J; Carter, A A; Carter, J R; Dore, C; Extermann, P; Gailloud, M; Gee, C N P; Gibson, W M; Gordon, J C; Gray, R J; Igo-Kemenes, P; Louis, W C; Modis, T; Mühlemann, P; Perrier, J; Rosselet, P; Saunders, B J; Schirato, P; Siebert, H W; Smith, V J; Stickland, D P; Streit, K P; Thresher, J J; Weill, R

    1981-01-01

    The Sigma /sup -/ p and Xi /sup -/d total cross sections have been measured to a statistical accuracy of +or-1% and +or-0.5%, respectively, at five momenta from 7.45 to 136.9 GeV/c, using the hyperon beam at the CERN SPS. The Xi /sup -/p and Xi /sup -/d total cross sections have also been measured to the same statistical accuracy at 101.5 and 133.8 GeV/c. The systematic uncertainty at each momentum is estimated to be of the order of +or-0.5%. The hyperon- nucleon cross sections are shown to be rising with energy, and the data are compared with various phenomenological models. (18 refs).

  12. Novel tetra-peptide insertion in Gag-p6 ALIX-binding motif in HIV-1 subtype C associated with protease inhibitor failure

    Science.gov (United States)

    Neogi, Ujjwal; RAO, Shwetha D; BONTELL, Irene; VERHEYEN, Jens; RAO, Vasudev R; GORE, Sagar C; SONI, Neelesh; SHET, Anita; SCHÜLTER, Eugen; EKSTRAND, Maria L.; WONDWOSSEN, Amogne; KAISER, Rolf; MADHUSUDHAN, Mallur S.; PRASAD, Vinayaka R; SONNERBORG, Anders

    2014-01-01

    A novel tetra-peptide insertion was identified in Gag-p6 ALIX-binding region which is appears in protease inhibitor (PI) failure Indian HIV-1C sequences (Odds Ratio 17.1, p<0.001) but naturally present in half of untreated Ethiopian sequences. The insertion will probably restore the ALIX mediated virus release pathway, which is lacking in HIV-1C. The clinical importance of such insertion need to be evaluated in HIV-1C dominating regions were PI-drugs are being scaled up as second line treatment options. PMID:25102091

  13. Spin effects in the inclusive reactions $\\pi^{\\pm} + p (\\uparrow) \\rightarrow \\pi^{\\pm}$ + anything at 8 GeV/c

    CERN Document Server

    Dick, Louis; Caverzasio, C; Gonidec, A; Green, K; Gsponer, A; Kuroda, K; Michalowicz, A; Phizacklea, P M; Poulet, M; Salmon, G L; Werlen, M

    1975-01-01

    The asymmetry in inclusive reactions of the type a+p(spin up) to a +anything at 8 GeV/c (a= pi /sup +/, pi /sup -/, or p) have been measured at the CERN Proton Synchrotron using a polarized proton target. In the pi p reactions and over a limited range of p/sub T /(0.170.7 which is mirror symmetric for the pi /sup +/ and pi /sup -/ reactions; ii) an asymmetry compatible with zero for 0.317 refs).

  14. Measurement of Elastic Scattering and of Total Cross-Section at the CERN $\\bar{p}p$ Collider

    CERN Multimedia

    2002-01-01

    The aim of the experiment is to measure elastic scattering and the total cross-section at the $\\bar{p}p$ collider. \\\\ \\\\ Up to 1983 the experimental apparatus was composed of two parts : \\item 1) Telescopes of high accuracy drift and proportional chambers and counters inserted into vertically moveable sections of the vacuum chamber ('Roman pots'), detect elastic scattering in the angular region from .5 mrad up to about 3 mrad. \\item 2) The total inelastic rate is measured with a forward/backward system of drift chambers and counter hodoscopes and the UA2 central detector covering together @= 4@p solid angle. \\end{enumerate}\\\\ \\\\ With these two set-ups, the measured value of the total cross-section confirms extrapolation with (ln s)|2 behaviour. Elastic scattering and diffraction dissociation were measured in the range .03~$<$~-t~$<$~1.6~GeV|2. \\\\ \\\\ From 1984 on, six horizontally moveable ``Roman Pots'' have been installed farther away from the intersection region (up to 100~m). Using an especially desi...

  15. Identification of putative substrates for cynomolgus monkey cytochrome P450 2C8 by substrate depletion assays with 22 human P450 substrates and inhibitors.

    Science.gov (United States)

    Hosaka, Shinya; Murayama, Norie; Satsukawa, Masahiro; Uehara, Shotaro; Shimizu, Makiko; Iwasaki, Kazuhide; Iwano, Shunsuke; Uno, Yasuhiro; Yamazaki, Hiroshi

    2016-07-01

    Cynomolgus monkeys are widely used in drug developmental stages as non-human primate models. Previous studies used 89 compounds to investigate species differences associated with cytochrome P450 (P450 or CYP) function that reported monkey specific CYP2C76 cleared 19 chemicals, and homologous CYP2C9 and CYP2C19 metabolized 17 and 30 human CYP2C9 and/or CYP2C19 substrates/inhibitors, respectively. In the present study, 22 compounds selected from viewpoints of global drug interaction guidances and guidelines were further evaluated to seek potential substrates for monkey CYP2C8, which is highly homologous to human CYP2C8 (92%). Amodiaquine, montelukast, quercetin and rosiglitazone, known as substrates or competitive inhibitors of human CYP2C8, were metabolically depleted by recombinant monkey CYP2C8 at relatively high rates. Taken together with our reported findings of the slow eliminations of amodiaquine and montelukast by monkey CYP2C9, CYP2C19 and CYP2C76, the present results suggest that these at least four chemicals may be good marker substrates for monkey CYP2C8. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.

  16. Annealing study of main electron irradiation-induced defects (H4 and H5) in P-In P using DLTS technique

    International Nuclear Information System (INIS)

    Massarani, B.; Awad, F.; Kaaka, M.

    1992-12-01

    Thermal annealing of the two hole traps H 4 and H 5 in room-temperature electron-irradiated In P Schottky diodes was investigated. Electron-irradiation energy ranging between 0.15 and 1.5 MeV with doses ranging between 5 x 10 14 and 10 16 e/cm 2 . DLTS technique with double-phase detector was used in this study. Contrary to what is generally admitted, we found that H 5 anneals out at about 150 C o with an activation energy of 1 eV. We have shown that H 4 is a complex defect having two components that we could resolve. While the first one, having lower emission cross section and higher capture cross section with ΔE = 0.37 eV anneals out at about 110 C o . The other component, with ΔE = 0.50 eV is thermally stable even above 170 C o . (author). 13 refs., 17 figs., 2 tabs

  17. Inclusive gamma production in π-p interactions at 5 GeV/C

    International Nuclear Information System (INIS)

    Amaglobeli, N.S.; Salukvadze, R.G.; Chiladze, B.G.; Shoshiashvili, Sh.S.; Subinsky, J.; Rumyantsev, V.S.; Budagov, Yu.A.; Vinogradov, V.B.; Volodko, A.G.; Dzhelepov, V.P.; Lomakin, Yu.F.

    1975-01-01

    The results of the experimental study of the inclusive reaction π - p→ γ + ... at 5 GeV/c are reported. The behaviour of the invariant inclusive cross section for γ-guanta in the central and the fragmentation regions has been investigated. The conclusion can be made from the comparison of results with data obtained at higher energies that gamma production in π - p interactions shows the scaling properties already at 5 GeV

  18. The reactions K-p → π-+Σ+-(1385) at 4.2 GeV/c

    International Nuclear Information System (INIS)

    Holmgren, S.O.; Aguilar-Benitez, M.; Barreiro, F.; Hemingway, R.J.; Losty, M.J.; Worden, R.P.; Zatz, J.; Kluyver, J.C.; Massaro, G.G.G.; Kittel, E.W.; Walle, R.T. van de

    1977-01-01

    The reactions K - p → π - Σ + (1385) and K - p → π + Σ - (1385) are studied at 4.2 GeV/c incident momentum using data from a high statistics bubble chamber experiment corresponding to approximately 80 events/μb. The total and differential cross sections are presented. Amplitude analyses are performed and the complete Σ +- (1385) helicity spin density matrices are extracted. The results are compared with the predictions of the additive quark model and exchange degeneracy. A substantial cross section is observed for the reaction K - p → π + Σ - (1385) in the forward direction, which implies exotic meson quantum numbers in the t-channel. One possible interpretation of this process provides an explanation for the small but significant violations of the additive quark model predictions observed in the reaction K - p → π - Σ + (1385) at low four-momentum transfer. In the backward direction unnatural parity exchange is shown to give a larger contribution to K - p → Σ - (1385)π + than natural parity exchange. (Auth.)

  19. Metabolic syndrome, C-reactive protein and cardiovascular risk in psoriasis patients: a cross-sectional study*

    Science.gov (United States)

    Paschoal, Renato Soriani; Silva, Daniela Antoniali; Cardili, Renata Nahas; Souza, Cacilda da Silva

    2018-01-01

    Background Psoriasis has been associated with co-morbidities and elevated cardiovascular risk. Objectives To analyze the relationships among metabolic syndrome, cardiovascular risk, C-reactive protein, gender, and Psoriasis severity. Methods In this cross-sectional study, plaque Psoriasis patients (n=90), distributed equally in gender, were analyzed according to: Psoriasis Area and Severity Index, cardiovascular risk determined by the Framingham risk score and global risk assessment, C-reactive protein and metabolic syndrome criteria (NCEPT-ATP III). Results Metabolic syndrome frequency was 43.3% overall, without significance between genders (P=0.14); but women had higher risk for obesity (OR 2.56, 95%CI 1.02-6.41; P=0.04) and systemic arterial hypertension (OR 3.29, 95%CI 1.39-7.81; P=0.006). The increase in the Psoriasis Area and Severity Index also increased the risk for metabolic syndrome (OR 1.060, 95%CI 1.006-1.117; P=0.03). Absolute 10-year cardiovascular risk was higher in males (P=0.002), but after global risk assessment, 51.1% patients, 52.2% women, were re-classified as high-intermediate cardiovascular risk; without significance between genders (P=0.83). C-reactive protein level was elevated nearly six-fold overall, higher in metabolic syndrome (P=0.05), systemic arterial hypertension (P=0.004), and high-intermediate 10-year cardiovascular risk patients (Preactive protein patients (t=1.98; P=0.05). Study limitations Restricted sample, hospital-based and representative of a single center and no specification of psoriatic arthritis. Conclusions Psoriasis, metabolic syndrome, systemic arterial hypertension and age share the increase in C-reactive protein, which could implicate in additional burden for increasing the cardiovascular risk and be an alert for effective interventions. PMID:29723366

  20. 7 CFR 29.3120 - Rule 17.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Rule 17. 29.3120 Section 29.3120 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... by the color symbol “V” in the C group and the combination color symbols “VF” or “VR” in the B and T...

  1. Inclusive dielectron cross sections in p+p and p+d interactions at beam energies from 1.04 to 4.88 GeV

    International Nuclear Information System (INIS)

    Wilson, W.K.; Beedoe, S.; Carroll, J.; Igo, G.; Seidl, P.; Toy, M.; Bossingham, R.; Gong, W.G.; Heilbronn, L.; Huang, H.Z.; Krebs, G.; Letessier-Selvon, A.; Magestro, D.; Matis, H.S.; Miller, J.; Naudet, C.; Porter, R.J.; Roche, G.; Schroeder, L.S.; Yegneswaran, A.; Bougteb, M.; Manso, F.; Prunet, M.; Roche, G.; Hallman, T.; Madansky, L.; Welsh, R.C.; Kirk, P.; Wang, Z.F.

    1998-01-01

    Measurements of dielectron production in p+p and p+d collisions with beam kinetic energies from 1.04 to 4.88 GeV are presented. The differential cross section is presented as a function of invariant pair mass, transverse momentum, and rapidity. The shapes of the mass spectra and their evolution with beam energy provide information about the relative importance of the various dielectron production mechanisms in this energy regime. The p+d to p+p ratio of the dielectron yield is also presented as a function of invariant pair mass, transverse momentum, and rapidity. The shapes of the transverse momentum and rapidity spectra from the p+d and p+p systems are found to be similar to one another for each of the beam energies studied. The beam energy dependence of the integrated cross sections is also presented. copyright 1998 The American Physical Society

  2. Cross sections, average multiplicities and energy fractions of neutral π- and k-mesons in p anti p-annihilations at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Batyunya, B.V.; Boguslavsky, I.V.; Gramenitsky, I.M.

    1982-01-01

    To determine cross sections, average multiplicities and inelasticity coefficients π 0 and Ksub(n), formed in anti pp annihilation interaction at 22.4 GeV/c, data on the differences in the respective characteristics anti pp- and pp-interactions have been used. The average multiplicity of π 0 in anti pp annihilation interactions is equal to 3.2+-0.3 and exceeds analogous data for inelastic pp- and anti pp interactions. The inelasticity coefficient π + , π 0 and Ksub(n)/Ksup(0) or anti K 0 /of mesons formed in annihilation interactions: etasub(π)sup(+)=0.33+-0.22, etasub(πsup(0)=0.36+-0.05, etasub(Ksubn))=0.044+-0.008 is determined. The total multiplicity of charged and neutral particles formed in anti pp annihilation at 22.4 GeV/c equals 10.2+-0.4 and exceeds the corresponding values for inelastic anti pp and pp interactions

  3. Ibrutinib for patients with relapsed or refractory chronic lymphocytic leukaemia with 17p deletion (RESONATE-17): a phase 2, open-label, multicentre study.

    Science.gov (United States)

    O'Brien, Susan; Jones, Jeffrey A; Coutre, Steven E; Mato, Anthony R; Hillmen, Peter; Tam, Constantine; Österborg, Anders; Siddiqi, Tanya; Thirman, Michael J; Furman, Richard R; Ilhan, Osman; Keating, Michael J; Call, Timothy G; Brown, Jennifer R; Stevens-Brogan, Michelle; Li, Yunfeng; Clow, Fong; James, Danelle F; Chu, Alvina D; Hallek, Michael; Stilgenbauer, Stephan

    2016-10-01

    The TP53 gene, encoding tumour suppressor protein p53, is located on the short arm of chromosome 17 (17p). Patients with 17p deletion (del17p) chronic lymphocytic leukaemia have poor responses and survival after chemoimmunotherapy. We assessed the activity and safety of ibrutinib, an oral covalent inhibitor of Bruton's tyrosine kinase, in relapsed or refractory patients with del17p chronic lymphocytic leukaemia or small lymphocytic lymphoma. We did a multicentre, international, open-label, single-arm study at 40 sites in the USA, Canada, Europe, Australia, and New Zealand. Patients (age ≥18 years) with previously treated del17p chronic lymphocytic leukaemia or small lymphocytic lymphoma received oral ibrutinib 420 mg once daily until progressive disease or unacceptable toxicity. The primary endpoint was overall response in the all-treated population per International Workshop on Chronic Lymphocytic Leukaemia 2008 response criteria modified for treatment-related lymphocytosis. Preplanned exploratory analyses were progression-free survival, overall survival, sustained haematological improvement, and immunological improvement. Patient enrolment is complete, but follow-up is ongoing. Treatment discontinuation owing to adverse events, unacceptable toxicity, or death were collected as a single combined category. This study is registered with ClinicalTrials.gov, number NCT01744691. Between Jan 29, 2013, and June 19, 2013, 145 patients were enrolled. The all-treated population consisted of 144 patients with del17p chronic lymphocytic leukaemia or small lymphocytic lymphoma who received at least one dose of study drug, with a median age of 64 years (IQR 57-72) and a median of two previous treatments (IQR 1-3). At the prespecified primary analysis after a median follow-up of 11·5 months (IQR 11·1-13·8), 92 (64%, 95% CI 56-71) of 144 patients had an overall response according to independent review committee assessment; 119 patients (83%, 95% CI 76-88) had an overall

  4. Effects of 17-allylamino-17-demethoxygeldanamycin (17-AAG) in transgenic mouse models of frontotemporal lobar degeneration and Alzheimer's disease.

    Science.gov (United States)

    Ho, Shuk Wai; Tsui, Yuk Tung Chanel; Wong, Ting Ting; Cheung, Stanley Kwok-Kuen; Goggins, William B; Yi, Lau Ming; Cheng, Kwok Kin; Baum, Larry

    2013-12-17

    Alzheimer's disease (AD), the most common dementia, is characterized by potentially neurotoxic aggregation of Aβ peptide and tau protein, and their deposition as amyloid plaques and neurofibrillary tangles (NFTs). Tau aggregation also occurs in other common neurodegenerative diseases. Frontotemporal dementia (FTD) can be caused by tau mutations that increase the susceptibility of tau to hyperphosphorylation and aggregation, which may cause neuronal dysfunction and deposition of NFTs. 17-allylamino-17-demethoxygeldanamycin (17-AAG) is a potent inhibitor of heat shock protein 90 (Hsp90), a cytosolic chaperone implicated in the proper folding and functions of a repertoire of client proteins. 17-AAG binds to Hsp90 and enhances degradation of Hsp90 client protein. We sought to determine whether 17-AAG can reduce Aβ and tau pathology in the brains of AD and FTD model mice expressing Aβ or P301L mutant tau, respectively. Mice were randomized to receive 25, 5, or 0 mg/kg 17-AAG thrice weekly from age eight to 11 months. Analysis was performed by rotarod test on motor function, on the area occupied by plaques in hippocampus or NFTs in medulla tissue sections, and on mortality. A high dose of 17-AAG tended to decrease NFTs in male mice (p = 0.08). Further studies are required to confirm the effect of 17-AAG in diseases of tau aggregation.

  5. Measurements of total production cross sections for pi+ + C, pi+ + Al, K+ + C, and K+ + Al at 60 GeV/c and pi+ + C and pi+ + Al at 31 GeV/c

    CERN Document Server

    Aduszkiewicz, A.; The NA61 collaboration; Antićić, T.; Antoniou, N.; Baatar, B.; Baszczyk, M.; Bhosale, S.; Blondel, A.; Bogomilov, M.; Brandin, A.; Bravar, A.; Bryliński, W.; Brzychczyk, J.; Bunyatov, S.A.; Busygina, O.; Bzdak, A.; Cao, S.; Cherif, H.; Christakoglou, P.; Ćirković, M.; Czopowicz, T.; Damyanova, A.; Datta, A.; Davis, N.; Deveaux, M.; Diakonos, F.; von Doetinchem, P.; Dominik, W.; Dorosz, P.; Dumarchez, J.; Engel, R.; Feofilov, G.A.; Fields, L.; Fodor, Z.; Friend, M.; Garibov, A.; Gaździcki, M.; Golosov, O.; Golubeva, M.; Grebieszkow, K.; Guber, F.; Haesler, A.; Hasegawa, T.; Hervé, A.E.; Igolkin, S.; Ilieva, S.; Ivashkin, A.; Johnson, S.R.; Kadija, K.; Kapoyannis, A.; Kaptur, E.; Kargin, N.; Kashirin, E.; Kiełbowicz, M.; Kireyeu, V.A.; Klochkov, V.; Kobayashi, T.; Kolesnikov, V.I.; Kolev, D.; Korzenev, A.; Kovalenko, V.N.; Kowalik, K.; Kowalski, S.; Koziel, M.; Krasnoperov, A.; Kucewicz, W.; Kuich, M.; Kurepin, A.; Larsen, D.; László, A.; Lazareva, T.V.; Lewicki, M.; Łojek, K.; Łysakowski, B.; Lyubushkin, V.V.; Maćkowiak-Pawłowska, M.; Majka, Z.; Maksiak, B.; Malakhov, A.I.; Manić, D.; Marchionni, A.; Marcinek, A.; Marino, A.D.; Marton, K.; Mathes, H.-J.; Matulewicz, T.; Matveev, V.; Melkumov, G.L.; Messerly, B.; Mik, L.; Mills, G.B.; Morozov, S.; Mrówczyński, S.; Nagai, Y.; Nakadaira, T.; Naskręt, M.; Ozvenchuk, V.; Panagiotou, A.D.; Paolone, V.; Pavin, M.; Petukhov, O.; Płaneta, R.; Podlaski, P.; Popov, B.A.; Posiadała, M.; Puławski, S.; Puzović, J.; Rauch, W.; Ravonel, M.; Renfordt, R.; Richter-Wąs, E.; Röhrich, D.; Rondio, E.; Roth, M.; Rumberger, B.T.; Rustamov, A.; Rybczynski, M.; Rybicki, A.; Sadovsky, A.; Sakashita, K.; Schmidt, K.; Sekiguchi, T.; Selyuzhenkov, I.; Seryakov, A.Yu.; Seyboth, P.; Shukla, A.; Słodkowski, M.; Snoch, A.; Staszel, P.; Stefanek, G.; Stepaniak, J.; Strikhanov, M.; Ströbele, H.; Šuša, T.; Tada, M.; Taranenko, A.; Tefelska, A.; Tefelski, D.; Tereshchenko, V.; Toia, A.; Tsenov, R.; Turko, L.; Ulrich, R.; Unger, M.; Valiev, F.F.; Vassiliou, M.; Veberič, D.; Vechernin, V.V.; Walewski, M.; Wickremasinghe, A.; Włodarczyk, Z.; Wojtaszek-Szwarc, A.; Wyszyński, O.; Yarritu, K.; Zambelli, L.; Zimmerman, E.D.; Zwaska, R.

    2018-01-01

    This paper presents several measurements of total production cross sections and total inelastic cross sections for the following reactions: pi+ + C, pi+ + Al, K+ + C, K+ + Al at 60 GeV/c, pi+ + C and pi+ + Al at 31 GeV/c. The measurements were made using the NA61/SHINE spectrometer at the CERN SPS. Comparisons with previous measurements are given and good agreement is seen. These interaction cross sections measurements are a key ingredient for neutrino flux prediction from the reinteractions of secondary hadrons in current and future accelerator-based long-baseline neutrino experiments.

  6. Measurement of π-p→ηn from threshold to pπ-=747 MeV/c

    International Nuclear Information System (INIS)

    Prakhov, S.; Nefkens, B.M.K.; Clajus, M.; Marusic, A.; McDonald, S.; Phaisangittisakul, N.; Price, J.W.; Starostin, A.; Tippens, W.B.; Allgower, C.E.; Spinka, H.; Arndt, R.A.; Briscoe, W.J.; Shafi, A.; Strakovsky, I.I.; Workman, R.L.; Bekrenev, V.; Koulbardis, A.; Kozlenko, N.; Kruglov, S.

    2005-01-01

    The differential cross section for η production in reaction π - p→ηn has been measured over the full angular range at seven incident π - beam momenta from threshold to p π - =747 MeV/c using the Crystal Ball multiphoton spectrometer. The angular distributions are S wave dominated. At 10 MeV/c above threshold, a small D-wave contribution appears that interferes with the main S wave. The total η production cross section σ tot is obtained by integration of dσ/dΩ. Starting at threshold, σ tot rises rapidly, as expected for S-wave-dominated production. The features of the π - p→ηn cross section are strikingly similar to those of the SU(3) flavor-related process K - p→ηΛ. Comparison of the π - p→ηn reaction is made with η photoproduction

  7. Partial-wave analysis of K/sup +/p elastic scattering. [Cross sections, polarization, dispersion relations, analytic smoothing threshold structure, 0. 78 to 2. 53 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Cutkosky, R E; Hicks, H R; Sandusky, J; Shih, C C [Carnegie-Mellon Univ., Pittsburgh, Pa. (USA); Kelly, R L [California Univ., Livermore (USA). Lawrence Livermore Lab.; Miller, R C; Yokosawa, A [Argonne National Lab., Ill. (USA)

    1976-01-05

    K/sup +/p cross-section and polarization data have been analyzed in the momentum range 0.78-2.53 GeV/c. Single energy fits were made using an ACE parametrization which had no cutoff in J, was analytic and has Regge-asymptotic behaviour in the cut cos theta plane, and contained explicit contributions from P, rho, A2, ..lambda.., ..sigma.., and low-mass di-pion exchange. Direct channel analyticity constraints were imposed by a partial wave dispersion relation interpolation procedure, fitting expansions in regulated-norm optimal bases to each partial wave which entered as a search parameter in the single energy fits. Output from these two programs was then used for a simultaneous fit by a linearized least squares program which provided input for another iterative fitting cycle. No strong evidence for the existence of exotic resonances was found. The method of analytic smoothing, in comparison with 'shortest path' methods, is found to allow more significant threshold structure to appear in the amplitudes.

  8. Precision Measurement of the e+e-→Λc+Λ¯c - Cross Section Near Threshold

    Science.gov (United States)

    Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Alekseev, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bai, Y.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Begzsuren, K.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, P. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Cossio, F.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garillon, B.; Garzia, I.; Gilman, A.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guo, A. Q.; Guo, R. P.; Guo, Y. P.; Guskov, A.; Haddadi, Z.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jin, Y.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Khoukaz, A.; Kiese, P.; Kliemt, R.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, J. W.; Li, Jin; Li, K. J.; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Libby, J.; Lin, C. X.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. L.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, X. L.; Lusso, S.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Meng, Z. X.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Muchnoi, N. Yu.; Muramatsu, H.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peng, Z. Y.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Pitka, A.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qi, T. Y.; Qian, S.; Qiao, C. F.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rolo, M.; Rong, G.; Rosner, Ch.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shan, X. Y.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shi, X.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, L.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tan, Y. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, Meng; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Wei, J. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, F.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Yang, Yifan; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Q.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, A. N.; Zhu, J.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Besiii Collaboration

    2018-03-01

    The cross section of the e+e-→Λc+Λ¯c - process is measured with unprecedented precision using data collected with the BESIII detector at √{s }=4574.5 , 4580.0, 4590.0 and 4599.5 MeV. The nonzero cross section near the Λc+Λ¯c- production threshold is cleared. At center-of-mass energies √{s }=4574.5 and 4599.5 MeV, the higher statistics data enable us to measure the Λc polar angle distributions. From these, the Λc electric over magnetic form-factor ratios (|GE/GM|) are measured for the first time. They are found to be 1.14 ±0.14 ±0.07 and 1.23 ±0.05 ±0.03 , respectively, where the first uncertainties are statistical and the second are systematic.

  9. Continuous Ecosystem Stoichiometry (C:N:P) in a Large Spring-fed River Reveals Decoupled N and P Assimilatory Dynamics

    Science.gov (United States)

    Cohen, M. J.; Douglass, R. L.; Martin, J. B.; Thomas, R. G.; Heffernan, J. B.; Foster, C. R.

    2010-12-01

    Diel variation in solutes offers insight into lotic ecosystem processes. Diel variation in dissolved oxygen (DO) is the standard method to estimate aquatic primary production (C fixation). Recently, diel variation in nitrate concentration was used to infer rates and pathways of N processing. From coupled C and N measurements, stoichiometric ratios of nutrient assimilation can be obtained, and variation therein linked back to environmental drivers and ecological changes. Here we present data obtained using an in situ phosphate sensor (Cycle-P, WetLabs, Philomath OR) that permits coupled high frequency C, N and P measurements. We collected hourly samples over 3 two-week deployments in the Ichetucknee River, a large (Q ~ 10 m3 s-1), productive (GPP ~ 6 g C m-2 d-1), entirely spring-fed river in north Florida. We observed average soluble reactive P (SRP) concentrations of 44, 41 and 45 µg/L for Dec-09, Feb-10 and Apr-10, respectively, and marked diel variation that averaged 6.7±0.9 µg/L. Observed river concentrations were consistently at or below the flow-weighted average input concentration of the 6 main springs that feed the river (49 µg/L) suggesting net SRP removal over the 5 km reach. Removal from co-precipitation with calcite or Fe-oxides is unlikely since variation in Fe and Ca is smaller than, and out of phase with, P variation. Since internal stores are presumed to be at steady-state given conditions of constant discharge, the balance of P export likely occurs as organic matter. Based on discharge during each deployment, diel variation of P concentrations indicate system-wide assimilation of 1505 ± 423 g P d-1, or 8.0 ± 2.3 mg P m-2 d-1 over the 17 ha of benthic surface area. Contemporaneous measurements of DO and nitrate implied average ecosystem stoichiometry (C:N:P) of 267:14:1, consistent with production dominated by submerged aquatic macrophytes rather than algae and other microflora. Of particular interest is the observation that diel variation in

  10. Determination of the total $c\\overline{c}$ production cross section in 340 GeV/c $\\Sigma^{-}$ - nucleus interactions

    CERN Document Server

    Adamovich, M.I.; Barberis, D.; Beck, M.; Berat, C.; Beusch, W.; Boss, M.; Brons, S.; Bruckner, W.; Buenerd, M.; Busch, C.; Buscher, C.; Charignon, F.; Chauvin, J.; Chudakov, E.A.; Dersch, U.; Dropmann, F.; Engelfried, J.; Faller, F.; Fournier, A.; Gerassimov, S.G.; Godbersen, M.; Grafstrom, P.; Haller, T.; Heidrich, M.; Hubbard, E.; Hurst, R.B.; Konigsmann, Kay; Konorov, I.; Keller, N.; Martens, K.; Martin, P.; Masciocchi, S.; Michaels, R.; Muller, U.; Neeb, H.; Newbold, D.; Newsom, C.; Paul, S.; Pochodzalla, J.; Potashnikova, I.; Povh, B.; Ransome, R.; Ren, Z.; Rey-Campagnolle, M.; Rosner, G.; Rossi, L.; Rudolph, H.; Scheel, C.; Schmitt, L.; Siebert, H.W.; Simon, A.; Smith, V.J.; Thilmann, O.; Trombini, A.; Vesin, E.; Volkemer, B.; Vorwalter, K.; Walcher, T.; Walder, G.; Werding, R.; Wittmann, E.; Zavertyaev, M.V.

    2000-01-01

    The production of charmed particles by Sigma- of 340 Gev/c momentum was studied in the hyperon beam experiment WA89 at the CERN-SPS, using the Omega-spectrometer. In two data-taking periods in 1993 and 1994 an integrated luminosity of 1600 microb^-1 on copper and carbon targets was recorded. From the reconstruction of 930 +- 90 charm particle decays in 10 decay channels production cross sections for D, antiD, Ds and Lambdac were determined in the region xF>0. Assuming an A^1 dependence of the cross section on the nucleon number, we calculate a total ccbar production cross section of sigma(x_F > 0) = 5.3+- 0.4(stat)+-1.0(syst)+1.0(Xi_c) microb per nucleon. The last term is an upper limit on the unknown contribution from charmed-strange baryon production.

  11. Capture cross-section and rate of the 14 C (n, γ) 15 C reaction from ...

    Indian Academy of Sciences (India)

    We calculate the Coulomb dissociation of 15C on a Pb target at 68 MeV/u incident beam energy within the fully quantum mechanical distorted wave Born approximation formalism of breakup reactions. The capture cross-section and the subsequent rate of the 14C(, )15C reaction are calculated from the ...

  12. OUTBURST OF COMET 17P/HOLMES OBSERVED WITH THE SOLAR MASS EJECTION IMAGER

    International Nuclear Information System (INIS)

    Li Jing; Jewitt, David; Clover, John M.; Jackson, Bernard V.

    2011-01-01

    We present time-resolved photometric observations of the Jupiter family comet 17P/Holmes during its dramatic 2007 outburst. The observations, from the orbiting Solar Mass Ejection Imager (SMEI), provide the most complete measure of the whole-coma brightness, free from the effects of instrumental saturation and with a time resolution well matched to the rapid brightening of the comet. The light curve is divided into two distinct parts. A rapid rise between the first SMEI observation on UT 2007 October 24 06h 37m (mid-integration) and UT 2007 October 25 is followed by a slow decline until the last SMEI observation on UT 2008 April 6 22h 16m (mid-integration). We find that the rate of change of the brightness is reasonably well described by a Gaussian function having a central time of UT 2007 October 24.54 ± 0.01 and a full width at half-maximum of 0.44 ± 0.02 days. The maximum rate of brightening occurs some 1.2 days after the onset of activity. At the peak, the scattering cross-section grows at 1070 ± 40 km 2 s -1 while the (model-dependent) mass loss rates inferred from the light curve reach a maximum at 3 x 10 5 kg s -1 . The integrated mass in the coma lies in the range (2-90) x 10 10 kg, corresponding to 0.2%-10% of the nucleus mass, while the kinetic energy of the ejecta is (0.7-30) megatonnes TNT. The particulate coma mass could be contained within a shell on the nucleus of thickness 1-60 m. This is also the approximate distance traveled by conducted heat in the century since the previous outburst of 17P/Holmes. This coincidence is consistent with, but does not prove, the idea that the outburst was triggered by the action of conducted heat, possibly through the crystallization of buried amorphous ice.

  13. Search for production of narrow p anti p states with a 5 GeV/c p beam

    International Nuclear Information System (INIS)

    Bensinger, J.; Kirsch, L.; Morris, W.

    1982-01-01

    A high-statistics search for the production of narrow p anti p states with a anti p beam at 5 GeV/c finds no evidence for such states from threshold up to 2.3 GeV. In particular, we set an upper limit (95% C.L.) of 9 nb for any state below 1.95 GeV with GAMMA less than or equal to 5 MeV in the reaction p anti → p anti p π 0

  14. Dicty_cDB: Contig-U14348-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 71_1( FJ787371 |pid:none) Nicotiana repanda protein kinase-c... 94 3e-18 AC124968_9( AC124968 |pid:none) Med... 5e-17 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda protein kinase-c... 90 5e-17 AE014298_1862( AE01429...08048_1( AY708048 |pid:none) Zea mays salt-inducible putative p... 90 5e-17 FJ787369_1( FJ787369 |pid:none) Nicotiana repanda

  15. 26 CFR 1.501(c)(17)-1 - Supplemental unemployment benefit trusts.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Supplemental unemployment benefit trusts. 1.501(c... Supplemental unemployment benefit trusts. (a) Requirements for qualification. (1) A supplemental unemployment... the purpose of providing supplemental unemployment compensation benefits (as defined in section 501(c...

  16. New results from the NA49 experiment on hadron production in p+p and p+C interactions and survey of backward hadrons in p+C collisions

    CERN Document Server

    Makariev, M

    2013-01-01

    Recent results on proton, anti-proton, neutron and charged kaon production in proton-proton and proton, anti-proton, neutron, deuteron and triton production in proton-carbon collisions at 158 GeV/c beam momentum are presented. Data samples of 4.8 million and 385 734 inelastic events in p+p and p+C, respectively, are obtained with the NA49 detector at the CERN SPS accelerator. The charged particles are identified by energy loss measurement in a system of four TPC chambers, while the neutrons are detected in a forward hadronic calorimeter. The data cover a major fraction of the phase space, ranging from 0 to 1.9 GeV in p_T and in Feynman x variable from -0.8 to 0.95 for protons, from -0.2 to 0.3 for anti-protons, from 0.1 to 0.95 for neutrons and from 0 to 0.5 for kaons. The comparison of the results on proton and neutron production in p+p interactions and deep inelastic e+p collisions at HERA reveals an independence of target fragmentation on the projectile type. Using the charged kaon data in p+p collisions a...

  17. Some general features of two body reactions in K{sup -}p interactions at 3 GeV/c; Quelques proprietes des reactions a deux corps dans les interactions K{sup -}p a 3 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Badier, J; Demoulin, M; Goldberg, J [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France); and others

    1966-06-01

    The differential and total cross sections of two-body reactions produced in 3 GeV/c K{sup -} proton collisions are presented. Their variation as a function of the baryonic number, strangeness, and isospin of the t and u cross channels is analyzed, as well as some implications of a baryon exchange mechanism. (authors) [French] Ce travail presente les sections efficaces differentielle et totale des reactions 'deux corps' produites par les interactions K{sup -}p a 3 GeV/c. Nous analysons leurs variations en fonction du nombre baryonique, de l'etrangete et de l'isospin des voies croisees t et u. Quelques consequences de l'hypothese de l'echange d'un baryon sont etudiees. (auteurs)

  18. Empirical P-L-C relations for delta Scuti stars

    International Nuclear Information System (INIS)

    Gupta, S.K.

    1978-01-01

    Separate P-L-C relations have been empirically derived by sampling the delta Scuti stars according to their pulsation modes. The results based on these relations have been compared with those estimated from the model based P-L-C relations and the other existing empirical P-L-C relations. It is found that a separate P-L-C relation for each pulsation mode provides a better correspondence with observations. (Auth.)

  19. Specific Destruction of HIV Proviral p17 Gene in T Lymphoid Cells Achieved by the Genome Editing Technology.

    Science.gov (United States)

    Kishida, Tsunao; Ejima, Akika; Mazda, Osam

    2016-01-01

    Recent development in genome editing technologies has enabled site-directed deprivation of a nucleotide sequence in the chromosome in mammalian cells. Human immunodeficiency (HIV) infection causes integration of proviral DNA into the chromosome, which potentially leads to re-emergence of the virus, but conventional treatment cannot delete the proviral DNA sequence from the cells infected with HIV. In the present study, the transcription activator-like effector nucleases (TALENs) specific for the HIV p17 gene were constructed, and their activities to destroy the target sequence were evaluated. SSA assay showed a high activity of a pair of p17-specific TALENs. A human T lymphoid cell line, Jurkat, was infected with a lentivirus vector followed by transfection with the TALEN-HIV by electroporation. The target sequence was destructed in approximately 10-95% of the p17 polymerase chain reaction clones, and the efficiencies depended on the Jurkat-HIV clones. Because p17 plays essential roles for assembly and budding of HIV, and this gene has relatively low nucleotide sequence diversity, genome editing procedures targeting p17 may provide a therapeutic benefit for HIV infection.

  20. n3 PUFAs reduce mouse CD4+ T-cell ex vivo polarization into Th17 cells.

    Science.gov (United States)

    Monk, Jennifer M; Hou, Tim Y; Turk, Harmony F; McMurray, David N; Chapkin, Robert S

    2013-09-01

    Little is known about the impact of n3 (ω3) PUFAs on polarization of CD4(+) T cells into effector subsets other than Th1 and Th2. We assessed the effects of dietary fat [corn oil (CO) vs. fish oil (FO)] and fermentable fiber [cellulose (C) vs. pectin (P)] (2 × 2 design) in male C57BL/6 mice fed CO-C, CO-P, FO-C, or FO-P diets for 3 wk on the ex vivo polarization of purified splenic CD4(+) T cells (using magnetic microbeads) into regulatory T cells [Tregs; forkhead box P3 (Foxp3(+)) cells] or Th17 cells [interleukin (IL)-17A(+) and retinoic acid receptor-related orphan receptor (ROR) γτ(+) cells] by flow cytometry. Treg polarization was unaffected by diet; however, FO independently reduced the percentage of both CD4(+) IL-17A(+) (P diets enriched in eicosapentaenoic acid (EPA), docosahexaenoic acid (DHA), or DHA + EPA similarly reduced Th17-cell polarization in comparison to CO by reducing expression of the Th17-cell signature cytokine (IL-17A; P = 0.0015) and transcription factor (RORγτ P = 0.02), whereas Treg polarization was unaffected. Collectively, these data show that n3 PUFAs exert a direct effect on the development of Th17 cells in healthy mice, implicating a novel n3 PUFA-dependent, anti-inflammatory mechanism of action via the suppression of the initial development of this inflammatory T-cell subset.

  1. Measurement of the Ratio of Inclusive Cross Sections σ (p anti-p → Z + b-jet) / σ (p anti-p → Z + jet) at √s = 1.96-TeV

    Energy Technology Data Exchange (ETDEWEB)

    Mutaf, Yildirim Dogan [Stony Brook Univ., NY (United States)

    2005-05-01

    Using the data collected with the D0 detector at √s = 1.96 TeV with integrated luminosities of about 180 pb-1, we have measured the ratio of inclusive cross sections for p$\\bar{p}$ → Z + b-jet to p$\\bar{p}$ → Z + jet production. The inclusive Z + b-jet reaction is an important background to searches for the Higgs boson in associated ZH production at the Fermilab Tevatron collider and is sensitive to the b quark content of the proton. This thesis describes our measurement which is performed using the dimuon decay channel of the Z boson, i.e. Z → μ+μ-. The ratio in the dimuon channel is measured to be 1.86 ± 0.44(stat)$+0.24\\atop{-0.28}$(syst)% for hadronic jets with transverse momenta pT > 20 GeV/c and pseudorapidities |η| < 2.5, consistent with next-to-leading order predictions of the standard model. This measurement is also combined with the result of the same ratio using the dielectron decay of the Z boson, and the combined measurement of the ratio of cross-sections yields 2.11 ± 0.41(stat)$+0.22\\atop{-0.25}$(syst)%. In addition to our measurement, we also study optimization procedures for the search of Z(μ $\\bar{μ}$)+b$\\bar{b}$ signal at D0. We demonstrate that substantial improvements in the signal sensitivity can be obtained by choosing more optimal selection cuts tailored for this signal and by combining the attributes of the similar objects in the events like muons and jets.

  2. Impact of cytochrome P450 2C19 polymorphisms on citalopram/escitalopram exposure: a systematic review and meta-analysis.

    Science.gov (United States)

    Chang, Ming; Tybring, Gunnel; Dahl, Marja-Liisa; Lindh, Jonatan D

    2014-09-01

    Citalopram and escitalopram, selective serotonin reuptake inhibitors, are primarily metabolized by cytochrome P450 (CYP) 2C19, which is a highly polymorphic enzyme known to cause inter-individual differences in pharmacokinetics. However, the impact of CYP2C19 polymorphisms on citalopram or escitalopram exposure has yet to be fully clarified, especially with regard to the quantitative impact of the CYP2C19*17 allele. The objective of this study was to quantify the effect of functional CYP2C19 allele variants on citalopram/escitalopram exposure. We performed a systematic review and meta-analysis with a structured search algorithm and eligibility criteria for including related studies, calculating the change of citalopram or escitalopram exposure associated with CYP2C19*2, *3, and *17 as compared with CYP2C19*1 using fixed-effect and random-effects models. Assessment of publication bias was performed by means of funnel plots and sensitivity analysis using meta-regressions. The pre-defined review protocol was registered at the PROSPERO international prospective register of systematic reviews, registration number CRD42013004106. Sixteen studies from 14 publications met the inclusion criteria. Eligible studies included 847 patients from psychiatric patient trials and 140 healthy subjects from pharmacokinetic studies. Compared to subjects with the EM/EM (CYP2C19*1/*1) genotype, the exposure to (es)citalopram increased by 95 % (95 % CI 40-149, p escitalopram. All functional CYP2C19 genotype groups demonstrated significant effects on (es)citalopram exposure. The findings based on our pooled analysis are likely to help in understanding the inter-individual variability in the exposure to citalopram and escitalopram in psychiatric patients and to facilitate dose selection, particularly for the homozygous carriers of CYP2C19*2 or *3 (loss of function) and CYP2C19*17 (gain of function) alleles. The results could improve individualization of citalopram or escitalopram therapy

  3. Absolute emission cross sections for electron-impact excitation of Zn+(4p 2P) and (5s 2S) terms

    International Nuclear Information System (INIS)

    Rogers, W.T.; Dunn, G.H.; Olsen, J.O.; Reading, M.; Stefani, G.

    1982-01-01

    Absolute emission cross sections for electron-impact excitation of the 3d 10 4p 2 P and 3d 10 5s 2 S terms of Zn + have been measured from below threshold to about 790 eV 2 P and 390 eV 2 S using the crossed-charged-beams technique. Both transitions have the abrupt onset at threshold characteristic of positive-ion excitation. The 2 P cross section shows considerable structure in the interval from threshold to near 20 eV, above which it falls off smoothly. Agreement with five-state close-coupling theory is excellent below 100 eV when cascading is included in the theory. Above 100 eV, the data lie above the theory. The peak value of the 2 P cross section is 9.4 x 10 -16 cm 2 essentially at threshold, while the peak value of the 2 S cross section is about 0.47 x 10 -16 cm 2 . The net linear polarization of the 3d 10 4p 2 P emission was measured (unresolved from the 3d 10 4d 2 D→3d 10 4p 2 P cascading transition), and these data were used to correct the cross-section data for anisotropy of the emitted light. The effective lifetime of the 3d 9 4s 2 2 D/sub 3/2/ level was measured by observing exponential decay of the 589.6-nm photons resulting from its decay

  4. The 2H(p,2p)n reaction at 508 MeV. Part I

    International Nuclear Information System (INIS)

    Punjabi, V.; Perdrisat, C.F.; Aniol, K.A.; Epstein, M.B.; Huber, J.P.; Margaziotis, D.J.; Bracco, A.; Davis, C.A.; Gubler, H.P.; Lee, W.P.; Poffenberger, P.R.; van Oers, W.T.H.; Postma, H.; Sebel, H.J.; Stetz, A.W.

    1988-09-01

    Differential cross sections for the reaction 2 H(p,2p)n at T p = 507 and 508 MeV are presented. The proton angle pairs chosen were 41.5 degrees with 41.4 and 50.0, 30.1 degrees with 44.0, 53,75, 61.0, and 68.0, 38.1 degrees -38.0 degrees, 44.1 degrees - 44.0 degrees, 47.1 degrees - 47.0 degrees and 50.0 degrees - 50.0 degrees. The data range over an energy window 100 MeV wide on one of the proton energies, the second energy being defined by the kinematic condition of a single neutron recoiling. The data are compared with the impulse approximation (IA) prediction and with the results of a nonrelativistic calculation of the six lowest-order Feynman diagrams describing the reaction. A previously known missing strength for the reaction in the small neutron recoil region is confirmed with much smaller experimental uncertainty; the missing strength persists up to 150 MeV/c neutron recoil. The onset of a systematic section excess relative to the IA near neutron recoil momentum 200 MeV is explored in detail. (Author) (37 refs., 17 figs.)

  5. Ξ-P Scattering and STOPPED-Ξ-12C Reaction

    Science.gov (United States)

    Ahn, J. K.; Aoki, S.; Chung, K. S.; Chung, M. S.; En'yo, H.; Fukuda, T.; Funahashi, H.; Goto, Y.; Higashi, A.; Ieiri, M.; Iijima, T.; Iinuma, M.; Imai, K.; Itow, Y.; Lee, J. M.; Makino, S.; Masaike, A.; Matsuda, Y.; Matsuyama, Y.; Mihara, S.; Nagoshi, C.; Nomura, I.; Park, I. S.; Saito, N.; Sekimoto, M.; Shin, Y. M.; Sim, K. S.; Susukita, R.; Takashima, R.; Takeutchi, F.; Tlustý, P.; Weibe, S.; Yokkaichi, S.; Yoshida, K.; Yoshida, M.; Yoshida, T.; Yamashita, S.

    2000-09-01

    We report upper limits on the cross sections for the Ξ-p elastic and conversion processes based on the observation of one Ξ-p elastic scattering events with an invisible Λ decay. The cross section for the Ξ-p elastic scattering is, for simplicity, assumming an isotropic angular distribution, found to be 40 mb at 90% confidence level, whereas that for the Ξ-p → ΛΛ reaction is 11 mb at 90% confidence level. While the results on the elastic cross section give no stringent constraint on theoretical estimates, the upper limit on the conversion process suggests that the estimate of the RGM-F model prediction could be ruled out. We also report some preliminary results on the obervation of the stopped-Ξ- hyperon-nucleus interaction with respect to hypernuclear production and existence of doubly-strange H-dibaryon.

  6. Invariant cross sections for the inclusive reactions antipp→π++X and antipp→p+X at 22.4 GeV/c

    International Nuclear Information System (INIS)

    Boss, E.G.; Ermilova, D.I.; Samojlov, V.V.

    1978-01-01

    The invariant inclusive cross sections for π + mesons and protons from antipp reactions at 22.4 GeV/c are presented. The average multiplicity for π + meson and proton production is 1.92+-0.02 and 0.41+-0.02, respectively. The annihilation spectra have been approximated using the difference between antipp and pp data. The resulting distributions have similar features as the total antipp data

  7. Measurement of low $p_{T}$ $D^{0}$ meson production cross section at CDF II

    Energy Technology Data Exchange (ETDEWEB)

    Mussini, Manuel [Univ. of Bologna (Italy)

    2011-05-01

    In this thesis we present a study of the production of D0 meson in the low transverse momentum region. In particular the inclusive differential production cross section of the D0 meson (in the two-body decay channel D0 → K-π+) is obtained extending the published CDF II measurement to pT as low as 1.5 GeV/c. This study is performed at the Tevatron Collider at Fermilab with the CDF II detector.

  8. CDKN1C/p57kip2 is a candidate tumor suppressor gene in human breast cancer

    International Nuclear Information System (INIS)

    Larson, Pamela S; Schlechter, Benjamin L; King, Chia-Lin; Yang, Qiong; Glass, Chelsea N; Mack, Charline; Pistey, Robert; Morenas, Antonio de las; Rosenberg, Carol L

    2008-01-01

    CDKN1C (also known as p57 KIP2 ) is a cyclin-dependent kinase inhibitor previously implicated in several types of human cancer. Its family members (CDKN1A/p21 CIP1 and B/p27 KIP1 ) have been implicated in breast cancer, but information about CDKN1C's role is limited. We hypothesized that decreased CDKN1C may be involved in human breast carcinogenesis in vivo. We determined rates of allele imbalance or loss of heterozygosity (AI/LOH) in CDKN1C, using an intronic polymorphism, and in the surrounding 11p15.5 region in 82 breast cancers. We examined the CDKN1C mRNA level in 10 cancers using quantitative real-time PCR (qPCR), and the CDKN1C protein level in 20 cancers using immunohistochemistry (IHC). All samples were obtained using laser microdissection. Data were analyzed using standard statistical tests. AI/LOH at 11p15.5 occurred in 28/73 (38%) informative cancers, but CDKN1C itself underwent AI/LOH in only 3/16 (19%) cancers (p = ns). In contrast, CDKN1C mRNA levels were reduced in 9/10 (90%) cancers (p < 0.0001), ranging from 2–60% of paired normal epithelium. Similarly, CDKN1C protein staining was seen in 19/20 (95%) cases' normal epithelium but in only 7/14 (50%) cases' CIS (p < 0.004) and 5/18 (28%) cases' IC (p < 0.00003). The reduction appears primarily due to loss of CDKN1C expression from myoepithelial layer cells, which stained intensely in 17/20 (85%) normal lobules, but in 0/14 (0%) CIS (p < 0.00001). In contrast, luminal cells displayed less intense, focal staining fairly consistently across histologies. Decreased CDKN1C was not clearly associated with tumor grade, histology, ER, PR or HER2 status. CDKN1C is expressed in normal epithelium of most breast cancer cases, mainly in the myothepithelial layer. This expression decreases, at both the mRNA and protein level, in the large majority of breast cancers, and does not appear to be mediated by AI/LOH at the gene. Thus, CDKN1C may be a breast cancer tumor suppressor

  9. Low cell pH depresses peak power in rat skeletal muscle fibres at both 30 degrees C and 15 degrees C: implications for muscle fatigue.

    Science.gov (United States)

    Knuth, S T; Dave, H; Peters, J R; Fitts, R H

    2006-09-15

    Historically, an increase in intracellular H(+) (decrease in cell pH) was thought to contribute to muscle fatigue by direct inhibition of the cross-bridge leading to a reduction in velocity and force. More recently, due to the observation that the effects were less at temperatures closer to those observed in vivo, the importance of H(+) as a fatigue agent has been questioned. The purpose of this work was to re-evaluate the role of H(+) in muscle fatigue by studying the effect of low pH (6.2) on force, velocity and peak power in rat fast- and slow-twitch muscle fibres at 15 degrees C and 30 degrees C. Skinned fast type IIa and slow type I fibres were prepared from the gastrocnemius and soleus, respectively, mounted between a force transducer and position motor, and studied at 15 degrees C and 30 degrees C and pH 7.0 and 6.2, and fibre force (P(0)), unloaded shortening velocity (V(0)), force-velocity, and force-power relationships determined. Consistent with previous observations, low pH depressed the P(0) of both fast and slow fibres, less at 30 degrees C (4-12%) than at 15 degrees C (30%). However, the low pH-induced depressions in slow type I fibre V(0) and peak power were both significantly greater at 30 degrees C (25% versus 9% for V(0) and 34% versus 17% for peak power). For the fast type IIa fibre type, the inhibitory effect of low pH on V(0) was unaltered by temperature, while for peak power the inhibition was reduced at 30 degrees C (37% versus 18%). The curvature of the force-velocity relationship was temperature sensitive, and showed a higher a/P(0) ratio (less curvature) at 30 degrees C. Importantly, at 30 degrees C low pH significantly depressed the ratio of the slow type I fibre, leading to less force and velocity at peak power. These data demonstrate that the direct effect of low pH on peak power in both slow- and fast-twitch fibres at near-in vivo temperatures (30 degrees C) is greater than would be predicted based on changes in P(0), and that the

  10. Differential effects of miR-34c-3p and miR-34c-5p on SiHa cells proliferation apoptosis, migration and invasion

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, Jesus Adrian [Laboratorio de Terapia Genica, Departamento de Genetica y Biologia Molecular, CINVESTAV, Av. IPN 2508, Mexico 07360 D.F. (Mexico); Alvarez-Salas, Luis Marat, E-mail: lalvarez@cinvestav.mx [Laboratorio de Terapia Genica, Departamento de Genetica y Biologia Molecular, CINVESTAV, Av. IPN 2508, Mexico 07360 D.F. (Mexico)

    2011-06-10

    Highlights: {yields} In this study we examine miR-34c-3p and miR-34c-5p functions in SiHa cells. {yields} We study miRNA effect on cell proliferation, anchorage independent growth, apoptosis, cell motility and invasion. {yields} We find that miR-34c-3p and miR-34c-5p inhibition of proliferation and anchorage independent growth are exclusive to SiHa cells. {yields} miR-34c-3p induces apoptosis and inhibits cell motility and invasion in SiHa cells. {yields} In this study we conclude that miR-34c-3p functions as a tumor suppressor differ from miR-34c-5p. -- Abstract: MicroRNAs (miRNA) regulate expression of several genes associated with human cancer. Here, we analyzed the function of miR-34c, an effector of p53, in cervical carcinoma cells. Expression of either miR-34c-3p or miR-34c-5p mimics caused inhibition of cell proliferation in the HPV-containing SiHa cells but not in other cervical cells irrespective of tumorigenicity and HPV content. These results suggest that SiHa cells may lack of regulatory mechanisms for miR-34c. Monolayer proliferation results showed that miR-34c-3p produced a more pronounced inhibitory effect although both miRNAs caused inhibition of anchorage independent growth at similar extent. However, ectopic expression of pre-miR-34c-3p, but not pre-miR-34c-5p, caused S-phase arrest in SiHa cells triggering a strong dose-dependent apoptosis. A significant inhibition was observed only for miR-34c-3p on SiHa cells migration and invasion, therefore implying alternative regulatory pathways and targets. These results suggest differential tumor suppressor roles for miR-34c-3p and miR-34c-5p and provide new insights in the understanding of miRNA biology.

  11. Differential effects of miR-34c-3p and miR-34c-5p on SiHa cells proliferation apoptosis, migration and invasion

    International Nuclear Information System (INIS)

    Lopez, Jesus Adrian; Alvarez-Salas, Luis Marat

    2011-01-01

    Highlights: → In this study we examine miR-34c-3p and miR-34c-5p functions in SiHa cells. → We study miRNA effect on cell proliferation, anchorage independent growth, apoptosis, cell motility and invasion. → We find that miR-34c-3p and miR-34c-5p inhibition of proliferation and anchorage independent growth are exclusive to SiHa cells. → miR-34c-3p induces apoptosis and inhibits cell motility and invasion in SiHa cells. → In this study we conclude that miR-34c-3p functions as a tumor suppressor differ from miR-34c-5p. -- Abstract: MicroRNAs (miRNA) regulate expression of several genes associated with human cancer. Here, we analyzed the function of miR-34c, an effector of p53, in cervical carcinoma cells. Expression of either miR-34c-3p or miR-34c-5p mimics caused inhibition of cell proliferation in the HPV-containing SiHa cells but not in other cervical cells irrespective of tumorigenicity and HPV content. These results suggest that SiHa cells may lack of regulatory mechanisms for miR-34c. Monolayer proliferation results showed that miR-34c-3p produced a more pronounced inhibitory effect although both miRNAs caused inhibition of anchorage independent growth at similar extent. However, ectopic expression of pre-miR-34c-3p, but not pre-miR-34c-5p, caused S-phase arrest in SiHa cells triggering a strong dose-dependent apoptosis. A significant inhibition was observed only for miR-34c-3p on SiHa cells migration and invasion, therefore implying alternative regulatory pathways and targets. These results suggest differential tumor suppressor roles for miR-34c-3p and miR-34c-5p and provide new insights in the understanding of miRNA biology.

  12. Effects of 17-allylamino-17-demethoxygeldanamycin (17-AAG) in transgenic mouse models of frontotemporal lobar degeneration and Alzheimer’s disease

    Science.gov (United States)

    2013-01-01

    Alzheimer’s disease (AD), the most common dementia, is characterized by potentially neurotoxic aggregation of Aβ peptide and tau protein, and their deposition as amyloid plaques and neurofibrillary tangles (NFTs). Tau aggregation also occurs in other common neurodegenerative diseases. Frontotemporal dementia (FTD) can be caused by tau mutations that increase the susceptibility of tau to hyperphosphorylation and aggregation, which may cause neuronal dysfunction and deposition of NFTs. 17-allylamino-17-demethoxygeldanamycin (17-AAG) is a potent inhibitor of heat shock protein 90 (Hsp90), a cytosolic chaperone implicated in the proper folding and functions of a repertoire of client proteins. 17-AAG binds to Hsp90 and enhances degradation of Hsp90 client protein. We sought to determine whether 17-AAG can reduce Aβ and tau pathology in the brains of AD and FTD model mice expressing Aβ or P301L mutant tau, respectively. Mice were randomized to receive 25, 5, or 0 mg/kg 17-AAG thrice weekly from age eight to 11 months. Analysis was performed by rotarod test on motor function, on the area occupied by plaques in hippocampus or NFTs in medulla tissue sections, and on mortality. A high dose of 17-AAG tended to decrease NFTs in male mice (p = 0.08). Further studies are required to confirm the effect of 17-AAG in diseases of tau aggregation. PMID:24344631

  13. Accurate quantification of sphingosine-1-phosphate in normal and Fabry disease plasma, cells and tissues by LC-MS/MS with (13)C-encoded natural S1P as internal standard

    NARCIS (Netherlands)

    Mirzaian, Mina; Wisse, Patrick; Ferraz, Maria J.; Marques, André R. A.; Gabriel, Tanit L.; van Roomen, Cindy P. A. A.; Ottenhoff, Roelof; van Eijk, Marco; Codée, Jeroen D. C.; van der Marel, Gijsbert A.; Overkleeft, Herman S.; Aerts, Johannes M.

    2016-01-01

    We developed a mass spectrometric procedure to quantify sphingosine-1-phosphate (S1P) in biological materials. The use of newly synthesized (13)C5 C18-S1P and commercial C17-S1P as internal standards rendered very similar results with respect to linearity, limit of detection and limit of

  14. Study on the mechanism of the 3He+p→p+p+d reaction at 3He momentum of 5 GeV/c

    International Nuclear Information System (INIS)

    Blinov, A.V.; Chuvilo, I.V.; Drobot, V.V.

    1985-01-01

    The mechanism of the reaction 3 He+pp+p+d is studied making use of the ITEP 80-cm liquid-hydrogen bubble chamber exposed to the beam of 5 GeV/c 3 He nuclei. The reaction cross sections is equal to 20.6+-0.3 mb. The phase space regions associated with quasi-free scattering (QFS) and final state interaction (FSI) are selected. Angular, mass and momentum distributions of the reaction products are obtained in the entire kinematically allowed range. The experimental data in the QFS region are compared with theoretical calculations based on the simplest pole diagram approximation. The 3 He and deuteron wave functions (WF) correspond to the realistic Reid potential. The D-wave components of these WF are taken into account. The absolute value of the cross section and shape of the distributions are described as a whole reasonably enough in the frame of the considered model in the kinematical region where FSI may be neglected

  15. Search for {theta}(1540){sup +} in the exclusive proton-induced reaction p+C(N){yields}{theta}{sup +} anti K{sup 0}+C(N) at the energy of 70 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Antipov, Yu.M.; Artamonov, A.V.; Batarin, V.A.; Eroshin, O.V. [Inst. for High Energy Physics, Protvino (Russian Federation); Kolgamov, V.Z. [Inst. of Theoretical and Experimental Physics, Moscow (RU)] [and others

    2004-09-01

    A search for narrow {theta}(1540){sup +}, a candidate for pentaquark baryon with positive strangeness, has been performed in an exclusive proton-induced reaction p+C(N){yields}{theta}{sup +} anti K{sup 0}+C(N) on carbon nuclei or quasifree nucleons at E{sub beam}=70 GeV ({radical}(s)=11.5 GeV) studying nK{sup +}, pK{sub S}{sup 0} and pK{sub L}{sup 0} decay channels of {theta}(1540){sup +} in four different final states of the {theta}{sup +} anti K{sup 0} system. In order to assess the quality of the identification of the final states with neutron or K {sup 0} {sub L}, we reconstructed {lambda}(1520){yields}nK{sup 0}{sub S} and {phi}{yields}K{sup 0}{sub L}K{sup 0}{sub S} decays in the calibration reactions p+C(N){yields}{lambda}(1520)K{sup +}+C(N) and p+C(N){yields}p{phi}+C(N). We found no evidence for narrow pentaquark peak in any of the studied final states and decay channels. Assuming that the production characteristics of the {theta}{sup +} anti K{sup 0} system are not drastically different from those of the {lambda}(1520)K{sup +} and p{phi} systems, we established upper limits on the cross-section ratios {sigma}({theta}{sup +} anti K{sup 0})/{sigma}({lambda}(1520)K{sup +})< 0.02 and {sigma}({theta}{sup +} anti K{sup 0})/{sigma}(p{phi})< 0.15 at 90% CL and a preliminary upper limit for the forward hemisphere cross-section {sigma}({theta}{sup +} anti K{sup 0})< 30 nb/nucleon. (orig.)

  16. EXTINCTION IN THE COMA OF COMET 17P/HOLMES

    International Nuclear Information System (INIS)

    Lacerda, Pedro; Jewitt, David

    2012-01-01

    On 2007 October 29, the outbursting comet 17P/Holmes passed within 0.''79 of a background star. We recorded the event using optical, narrowband photometry and detect a 3%-4% dip in stellar brightness bracketing the time of closest approach to the comet nucleus. The detected dimming implies an optical depth τ ≈ 0.04 at 1.''5 from the nucleus and an optical depth toward the nucleus center τ n d = 0.006 ± 0.002 at α = 16° phase angle. Our measurements place the most stringent constraints on the extinction optical depth of any cometary coma.

  17. EXTINCTION IN THE COMA OF COMET 17P/HOLMES

    Energy Technology Data Exchange (ETDEWEB)

    Lacerda, Pedro [Astrophysics Research Centre, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Jewitt, David, E-mail: lacerda.pedro@gmail.com [Department of Earth and Space Sciences, University of California Los Angeles (UCLA), 595 Charles Young Drive, Los Angeles, CA 90095-1567 (United States)

    2012-11-20

    On 2007 October 29, the outbursting comet 17P/Holmes passed within 0.''79 of a background star. We recorded the event using optical, narrowband photometry and detect a 3%-4% dip in stellar brightness bracketing the time of closest approach to the comet nucleus. The detected dimming implies an optical depth {tau} Almost-Equal-To 0.04 at 1.''5 from the nucleus and an optical depth toward the nucleus center {tau}{sub n} < 13.3. At the time of our observations, the coma was optically thick only within {rho} {approx}< 0.''01 from the nucleus. By combining the measured extinction and the scattered light from the coma, we estimate a dust red albedo p{sub d} = 0.006 {+-} 0.002 at {alpha} = 16 Degree-Sign phase angle. Our measurements place the most stringent constraints on the extinction optical depth of any cometary coma.

  18. 17 CFR 240.17Ad-21T - Operational capability in a Year 2000 environment.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Operational capability in a Year 2000 environment. 240.17Ad-21T Section 240.17Ad-21T Commodity and Securities Exchanges SECURITIES... Company Rules § 240.17Ad-21T Operational capability in a Year 2000 environment. (a) This section applies...

  19. Better Higgs-C P tests through information geometry

    Science.gov (United States)

    Brehmer, Johann; Kling, Felix; Plehn, Tilman; Tait, Tim M. P.

    2018-05-01

    Measuring the C P symmetry in the Higgs sector is one of the key tasks of the LHC and a crucial ingredient for precision studies, for example in the language of effective Lagrangians. We systematically analyze which LHC signatures offer dedicated C P measurements in the Higgs-gauge sector and discuss the nature of the information they provide. Based on the Fisher information measure, we compare the maximal reach for C P -violating effects in weak boson fusion, associated Z H production, and Higgs decays into four leptons. We find a subtle balance between more theory-independent approaches and more powerful analysis channels, indicating that rigorous evidence for C P violation in the Higgs-gauge sector will likely require a multistep process.

  20. Inelastic cross sections and π- -meson production in relativistic nuclear collisions induced by p, d, 4He and 12C on 12C and 181Ta target-nuclei

    International Nuclear Information System (INIS)

    Chasnikov, I.Ya.; Izbasarov, M.I.; Vinitsky, A.Kh.; Abdinov, O.B.; Agakishiev, G.N.; Backovic, S.; Damianovich, V.; Drndarevic, S.; Krmpotic, D.; Krpic, D.

    1981-12-01

    Experimental data on inelastic cross sections and PI - -meson production in interactions initiated by protons with the incident momentum in the range (2-10) GeV/c and by deuterons, alphas and carbon nuclei with the incident momentum per nucleon in the range (2-5) GeV/c on carbon and tantalum target-nuclei are presented. The experimental data have been obtained using the 2 m propane bubble chamber. The analysis of the experimental data has been made in the framework of various theoretical models. (authors)

  1. Study on aging embrittlement of 17-4PH martensite stainless steel at 350 degree C

    International Nuclear Information System (INIS)

    Wang Jun; Shen Baoluo

    2005-01-01

    The transformation of microstructure and hardness with the extension of aging time on the 17-4PH Martensite stainless steel at 350 degree C is studied, and the change of dynamic fracture toughness and fractography of the stainless steel for various holding time at this temperature are also studied by instrumental impact test and scanning electron microscope. The results indicate that the crack initiation energy (E i ), crack propagation energy (E p ), absorbed-in-fracture energy (E t ) and dynamic fracture toughness (K 1d ) of this type of alloy Charpy v-notch sample is decreased with the continuation of time at 350 degree C. It means that the toughness of the alloy is degraded, and the hardness of the steel is ascended when aging time is expanded and reaches the maximum at 9000 h. The fractography of this steel changes from dimple fracture into cleavage fracture and inter-granular rapture. (authors)

  2. Karakterisasi ekstrak kasar fitase termofilik dari bakteri kawah Ijen Banyuwangi, isolat AP-17

    Directory of Open Access Journals (Sweden)

    Aline Puspita Kusumadjaja

    2010-12-01

    Full Text Available Crude thermophilic phytase was produced by isolate AP-17 that has been isolated from Ijen Crater Banyuwangi. Based on Gram test, isolate AP-17 was gram positive spore forming rod shape bacteria so that it was identified as Bacillus sp. AP-17. Crude thermophilic phytase isolated from Bacillus sp. AP-17 had the optimum temperature at 75 ° C with activity of 0.1413 U/ml, and its optimum pH was at pH 6 with activity of 0.0875 U/ml. The enzyme was stable when heated at 75 ° C for three hours and still had 90% activity when it was exposed at pH 5 €“8, optimum temperature, for one hour.

  3. DETECTION OF REMNANT DUST CLOUD ASSOCIATED WITH THE 2007 OUTBURST OF 17P/HOLMES

    International Nuclear Information System (INIS)

    Ishiguro, Masateru; Kim, Yoonyoung; Kwon, Yuna G.; Sarugaku, Yuki; Kuroda, Daisuke; Maehara, Hiroyuki; Hanayama, Hidekazu; Takahashi, Jun; Terai, Tsuyoshi; Usui, Fumihiko; Vaubaillon, Jeremie J.; Morokuma, Tomoki; Kobayashi, Naoto; Watanabe, Jun-ichi

    2016-01-01

    This article reports a new optical observation of 17P/Holmes one orbital period after the historical outburst event in 2007. We detected not only a common dust tail near the nucleus but also a long narrow structure that extended along the position angle 274.°6 ± 0.°1 beyond the field of view (FOV) of the Kiso Wide Field Camera, i.e., >0.°2 eastward and >2.°0 westward from the nuclear position. The width of the structure decreased westward with increasing distance from the nucleus. We obtained the total cross section of the long extended structure in the FOV, C FOV  = (2.3 ± 0.5) × 10 10 m 2 . From the position angle, morphology, and mass, we concluded that the long narrow structure consists of materials ejected during the 2007 outburst. On the basis of the dynamical behavior of dust grains in the solar radiation field, we estimated that the long narrow structure would be composed of 1 mm–1 cm grains having an ejection velocity of >50 m s −1 . The velocity was more than one order of magnitude faster than that of millimeter–centimeter grains from typical comets around a heliocentric distance r h of 2.5 AU. We considered that sudden sublimation of a large amount of water-ice (≈10 30 mol s −1 ) would be responsible for the high ejection velocity. We finally estimated a total mass of M TOT  = (4–8) × 10 11 kg and a total kinetic energy of E TOT  = (1–6) × 10 15 J for the 2007 outburst ejecta, which are consistent with those of previous studies that were conducted soon after the outburst

  4. Selection of mutants tolerant of oxidative stress from respiratory cultures of Lactobacillus plantarum C17.

    Science.gov (United States)

    Zotta, T; Ianniello, R G; Guidone, A; Parente, E; Ricciardi, A

    2014-03-01

    Lactobacillus plantarum is a lactic acid bacterium involved in the production of many fermented foods. Recently, several studies have demonstrated that aerobic or respiratory metabolism in this species leads to improved technological and stress response properties. We investigated respiratory growth, metabolite production and stress resistance of Lact. plantarum C17 during batch, fed-batch and chemostat cultivations under respiratory conditions. Sixty mutants were selected for their ability to tolerate oxidative stress using H2 O2 and menadione as selective agents and further screened for their capability to growth under anaerobic, respiratory and oxidative stress conditions. Dilution rate clearly affected the physiological state of cells and, generally, slow-growing cultures had improved survival to stresses, catalase production and oxygen uptake. Most mutants were more competitive in terms of biomass production and ROS degradation compared with wild-type strain (wt) C17 and two of these (C17-m19 and C17-m58) were selected for further experiments. This work confirms that, in Lact. plantarum, respiration and low growth rates confer physiological and metabolic advantages compared with anaerobic cultivation. Our strategy of natural selection successfully provides a rapid and inexpensive screening for a large number of strains and represents a food-grade approach of practical relevance in the production of starter and probiotic cultures. © 2013 The Society for Applied Microbiology.

  5. V2 and cP/CP

    DEFF Research Database (Denmark)

    Vikner, Sten; Christensen, Ken Ramshøj; Nyvad, Anne Mette

    2017-01-01

    As in Nyvad et al. (2017), we will explore a particular derivation of (embedded) V2, in terms of a cP/CP-distinction, which may be seen as a version of the CP-recursion analysis (de Haan & Weerman 1986; Vikner 1995 and many others). e idea is that because embedded V2 clauses do not allow extraction......, whereas other types of CP-recursion clauses do (Christensen et al. 2013a; 2013b; Christensen & Nyvad 2014), CP-recursion in embedded V2 is assumed to be fundamentally di erent from other kinds of CP-recursion, in that main clause V2 and embedded V2 involve a CP (“big CP”), whereas other clausal...... projections above IP are instances of cP (“little cP”)....

  6. Search for $C\\!P$ violation in $\\Lambda^0_b \\to p K^- \\mu^+ \\mu^-$ decays at LHCb

    CERN Multimedia

    Marangotto, Daniele

    2017-01-01

    A search for $C\\!P$ violation in the rare decay $\\Lambda^0_b \\to p K^- \\mu^+ \\mu^-$ is presented. This decay is mediated by flavour-changing neutral-current transitions in the Standard Model and is potentially sensitive to new sources of $C\\!P$ violation. The study is based on a data sample of proton-proton collisions recorded with the LHCb experiment, corresponding to an integrated luminosity of $3\\mathrm{fb}^{-1}$. Two observables that are sensitive to different manifestations of $C\\!P$ violation are measured, $\\Delta\\mathcal{A}_{C\\!P} \\equiv \\mathcal{A}_{C\\!P}(\\Lambda^0_b \\to p K^- \\mu^+ \\mu^-)-\\mathcal{A}_{C\\!P}(\\Lambda^0_b\\to pK^- J/\\psi)$ and $a_{C\\!P}^{\\widehat{T}_{\\mathrm{odd}}}$, where the latter is based on asymmetries in the angle between the $\\mu^+\\mu^-$ and $p K^-$ decay planes. No evidence for $C\\!P$ violation is found.

  7. Cross sections for the production of 11C in C targets by 3.65 AGeV projectiles

    International Nuclear Information System (INIS)

    Kozma, P.; Tolstov, K.D.; Yanovskij, V.V.

    1989-01-01

    The absolute cross sections for the production of 11 C in C targets by 3.65 AGeV protons, deuterons, 4 He- and 12 C-ions were measured. Annihialtion radiation from 11 C was counted using a large volume NaI(Tl) and BaF 2 detectors. The flux measurement technique based on registration of charged particles by means of a thin nuclear emulsion layer rotating in a beam as well as fission chamber was used. The results are compared with earlier measurements of the cross sections in carbon targets using high-energy projectiles and Glauber theoretical prediction, as well. 10 refs.; 3 figs.; 1 tab

  8. Calculation of astrophysical S-factor in reaction ^{13}C(p,γ )^{14}N for first resonance levels

    Science.gov (United States)

    Moghadasi, A.; Sadeghi, H.; Pourimani, R.

    2018-01-01

    The ^{13}C(p,γ )^{14}N reaction is one of the important reactions in the CNO cycle, which is a key process in nucleosynthesis. We first calculated wave functions for the bound state of ^{14}N with Faddeev's method. In this method, the considered reaction components are ^{12}C+n+p. Then, by using direct capture cross section and Breit-Wigner formulae, the non-resonant and resonant cross sections were calculated, respectively. In the next step, we calculated the total S-factor and compared it with experimental data, which showed good agreement between them. Next, we extrapolated the S-factor for the transition to the ground state at zero energy and obtained S(0)=5.8 ± 0.7 (keV b) and then calculate reaction rate. These ones are in agreement with previous reported results.

  9. Measurements of (n,xp), (n,xd) double differential cross sections of Al and C for neutrons at 75 and 65 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Nauchi, Yasushi; Baba, Mamoru; Iwasaki, Tomohiko [Tohoku Univ., Sendai (Japan). Faculty of Engineering] [and others

    1998-03-01

    The (n,xp) and (n,xd) double differential cross sections (DDXs) of Al and C were measured at 6 angles (12deg, 17deg, 25deg, 40deg, 55deg and 70deg) for neutrons En=65 and 75 MeV. These data are compared with theoretical calculations of ISOBAR and GNASH. A new wide range spectrometer under fabrication to down the detection threshold is also described. (author)

  10. Measurement of negatively charged pion spectra in inelastic p+p interactions at p{sub lab} = 20, 31, 40, 80 and 158 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Abgrall, N.; Blondel, A.; Bravar, A.; Debieux, S.; Haesler, A.; Korzenev, A.; Murphy, S.; Ravonel, M. [University of Geneva, Geneva (Switzerland); Aduszkiewicz, A.; Dominik, W.; Kielczewska, D.; Kirejczyk, M.; Matulewicz, T.; Posiadala, M.; Skrzypczak, E. [University of Warsaw, Faculty of Physics, Warsaw (Poland); Ali, Y.; Brzychczyk, J.; Majka, Z.; Marcinek, A.; Planeta, R.; Staszel, P.; Wyszynski, O. [Jagiellonian University, Cracow (Poland); Anticic, T.; Kadija, K.; Susa, T. [Rudjer Boskovic Institute, Zagreb (Croatia); Antoniou, N.; Christakoglou, P.; Davis, N.; Diakonos, F.; Kapoyannis, A.; Panagiotou, A.D.; Vassiliou, M. [University of Athens, Athens (Greece); Baatar, B.; Bunyatov, S.A.; Kolesnikov, V.I.; Krasnoperov, A.; Lyubushkin, V.V.; Malakhov, A.I.; Melkumov, G.L.; Tereshchenko, V. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Bay, F.; Luise, S.Di; Rubbia, A.; Sgalaberna, D. [ETH, Zurich (Switzerland); Blumer, J.; Dembinski, H.; Engel, R.; Mathes, H.J.; Roth, M.; Szuba, M.; Ulrich, R.; Unger, M. [Karlsruhe Institute of Technology, Karlsruhe (Germany); Bogomilov, M.; Kolev, D.; Tsenov, R. [University of Sofia, Faculty of Physics, Sofia (Bulgaria); Busygina, O.; Golubeva, M.; Guber, F.; Ivashkin, A.; Kurepin, A.; Marin, V.; Petukhov, O.; Sadovsky, A. [Institute for Nuclear Research, Moscow (Russian Federation); Czopowicz, T.; Dynowski, K.; Grebieszkow, K.; Maksiak, B.; Peryt, W.; Pluta, J.; Slodkowski, M. [Warsaw University of Technology, Warsaw (Poland); Drozhzhova, T.; Feofilov, G.A.; Igolkin, S.; Kondratiev, V.P.; Vechernin, V.V.; Vinogradov, L. [St. Petersburg State University, St. Petersburg (Russian Federation); Dumarchez, J.; Robert, A.; Zambelli, L. [LPNHE, University of Paris VI and VII, Paris (France); Ereditato, A.; Hierholzer, M.; Nirkko, M.; Pistillo, C.; Redij, A. [University of Bern, Bern (Switzerland); Fodor, Z.; Fulop, A.; Kiss, T.; Laszlo, A.; Marton, K.; Palla, G.; Sipos, R.; Tolyhi, T.; Vesztergombi, G. [KFKI Research Institute for Particle and Nuclear Physics, Budapest (Hungary); Gazdzicki, M. [Jan Kochanowski University in Kielce, Kielce (Poland); University of Frankfurt, Frankfurt (Germany); Grzeszczuk, A.; Kaptur, E.; Kisiel, J.; Kowalski, S.; Larsen, D.; Pulawski, S.; Schmidt, K.; Wilczek, A.; Zipper, W. [University of Silesia, Katowice (Poland); Hasegawa, T.; Kobayashi, T.; Nakadaira, T.; Nishikawa, K.; Sakashita, K.; Sekiguchi, T.; Shibata, M.; Tada, M. [High Energy Accelerator Research Organization (KEK), Tsukuba, Ibaraki (Japan); Idczak, R.; Kovesarki, P.; Turko, L. [University of Wroclaw, Wroclaw (Poland); Jokovic, D.; Manic, D.; Puzovic, J.; Savic, M. [University of Belgrade, Belgrade (Serbia); Kleinfelder, S. [University of California, Irvine (United States); Mackowiak-Pawlowska, M.; Renfordt, R.; Rustamov, A.; Stroebele, H. [University of Frankfurt, Frankfurt (Germany); Matveev, V. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Institute for Nuclear Research, Moscow (Russian Federation); Mrowczynski, S.; Rybczynski, M.; Seyboth, P.; Stefanek, G.; Wlodarczyk, Z.; Wojtaszek-Szwarc, A. [Jan Kochanowski University in Kielce, Kielce (Poland); Palczewski, T.; Rondio, E.; Stepaniak, J. [National Centre for Nuclear Research, Warsaw (Poland); Paul, T.; Veberic, D. [University Nova Gorica, Laboratory of Astroparticle Physics, Nova Gorica (Slovenia); Popov, B.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); LPNHE, University of Paris VI and VII, Paris (France); Rauch, W. [Fachhochschule Frankfurt, Frankfurt (Germany); Roehrich, D. [University of Bergen, Bergen (Norway); Collaboration: NA61/SHINE Collaboration

    2014-03-15

    We present experimental results on inclusive spectra and mean multiplicities of negatively charged pions produced in inelastic p+p interactions at incident projectile momenta of 20, 31, 40, 80 and 158 GeV/c (√(s) = 6.3, 7.7, 8.8, 12.3 and 17.3 GeV, respectively). The measurements were performed using the large acceptance NA61/SHINE hadron spectrometer at the CERN super proton synchrotron. Two-dimensional spectra are determined in terms of rapidity and transverse momentum. Their properties such as the width of rapidity distributions and the inverse slope parameter of transverse mass spectra are extracted and their collision energy dependences are presented. The results on inelastic p+p interactions are compared with the corresponding data on central Pb+Pb collisions measured by the NA49 experiment at the CERN SPS. The results presented in this paper are part of the NA61/SHINE ion program devoted to the study of the properties of the onset of deconfinement and search for the critical point of strongly interacting matter. They are required for interpretation of results on nucleus-nucleus and proton-nucleus collisions. (orig.)

  11. Integral measurement of the $^{12}$C(n,p)$^{12}$B reaction up to 10 GeV

    CERN Document Server

    Žugec, P; Bosnar, D; Ventura, A; Mengoni, A; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Brugger, M; Calviani, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Cortés, G; Cortés-Giraldo, M.A; Cosentino, L; Diakaki, M; Domingo-Pardo, C; Dressler, R; Duran, I; Eleftheriadis, C; Ferrari, A; Finocchiaro, P; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Guerrero, C; Gunsing, F; Gurusamy, P; Heinitz, S; Jenkins, D G; Jericha, E; Käppeler, F; Karadimos, D; Kivel, N; Kokkoris, M; Krtička, M; Kroll, J; Langer, C; Lederer, C; Leeb, H; Leong, L S; Meo, S Lo; Losito, R; Manousos, A; Marganiec, J; Martínez, T; Massimi, C; Mastinu, P; Mastromarco, M; Mendoza, E; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Musumarra, A; Paradela, C; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J; Rauscher, T; Reifarth, R; Riego, A; Roman, F; Rubbia, C; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T

    2016-01-01

    The integral measurement of the $^{12}$C(n,p)$^{12}$B reaction was performed at the neutron time of flight facility n_TOF at CERN. The total number of $^{12}$B nuclei produced per neutron pulse of the n_TOF beam was determined using the activation technique in combination with a time of flight technique. The cross section is integrated over the n_TOF neutron energy spectrum from reaction threshold at 13.6 MeV to 10 GeV. Having been measured up to 1 GeV on basis of the $^{235}$U(n,f) reaction, the neutron energy spectrum above 200 MeV has been reevaluated due to the recent extension of the cross section reference for this particular reaction, which is otherwise considered a standard up to 200 MeV. The results from the dedicated GEANT4 simulations have been used to evaluate the neutron flux from 1 GeV up to 10 GeV. The experimental results related to the $^{12}$C(n,p)$^{12}$B reaction are compared with the evaluated cross sections from major libraries and with the predictions of different GEANT4 models, which m...

  12. Measurement of the D{sup *{+-}} meson production cross section and F{sub 2}{sup c} {sup anti} {sup c} at high Q{sup 2} in ep scattering at HERA

    Energy Technology Data Exchange (ETDEWEB)

    Brinkmann, Martin

    2010-04-15

    The inclusive production cross section of D{sup *{+-}}(2010) mesons in deep-inelastic e{sup {+-}}p scattering is measured in the kinematic region of photon virtuality 100sections for inclusive D{sup *} meson production are measured in the visible range defined by vertical stroke {eta}(D{sup *}) vertical stroke <1.5 and p{sub T}(D{sup *})>1.5 GeV. The data were collected by the H1 experiment during the period from 2004 to 2007 and correspond to an integrated luminosity of 351 pb{sup -1}. The charm contribution, F{sub 2}{sup c} {sup anti} {sup c}, to the proton structure function F{sub 2} is determined. The measurements are compared with QCD predictions. (orig.)

  13. 17 CFR 403.2 - Hypothecation of customer securities.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Hypothecation of customer... UNDER SECTION 15C OF THE SECURITIES EXCHANGE ACT OF 1934 PROTECTION OF CUSTOMER SECURITIES AND BALANCES § 403.2 Hypothecation of customer securities. Every registered government securities broker or dealer...

  14. Measured energy dependence of L-shell photoelectric cross sections of lead in the energy region 17-50 keV

    Energy Technology Data Exchange (ETDEWEB)

    Arora, S K; Allawadhi, K L; Sood, B S [Punjabi Univ., Patiala (India). Nuclear Science Labs.

    1980-08-28

    The energy dependence of L-shell photoelectric cross sections for lead in the energy region 17-50 keV has been investigated. The method utilises external conversion x-rays as the source of photons and it yields relative rather than absolute cross sections, but is simpler and more accurate. The results show fairly good agreement with theory.

  15. An analysis of few-body cross sections in pp and πp interactions in terms of the two-component picture

    International Nuclear Information System (INIS)

    Karimaeki, V.

    1975-01-01

    The energy behaviour of total cross sections of exclusive channel with one, two or three produced pions has been studied in pp and πp interactions. Two components, interpreted as diffractive and non-diffractive, have been fitted to the cross section data assuming an asymptotic power law dependence in psub(lab) for both. Isotopic spin factors were used as constraints to fit different charge channels simultaneously as well as for determining diffractive cross sections for non-observable few-body channels. The diffractive component for fixed multiplicity is found to decrease as psub(lab)sup(-0.16+-0.04). Results are compared with the predictions of factorization and semilocal factorization hypotheses. Total diffractive cross sections derived by the analysis are 5.1+-0.6 mb in pp and 2.2+-0.3 mb in πp interactions at psub(lab)=10 GeV/c. (author)

  16. Observation of the Decays Λ_{b}^{0}→χ_{c1}pK^{-} and Λ_{b}^{0}→χ_{c2}pK^{-}.

    Science.gov (United States)

    Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Baszczyk, M; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bitadze, A; Bizzeti, A; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bonivento, W; Bordyuzhin, I; Borgheresi, A; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chobanova, V; Chrzaszcz, M; Chubykin, A; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Deckenhoff, M; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Dungs, K; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Déléage, N; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fay, R; Fazzini, D; Ferguson, D; Fernandez, G; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hatch, M; He, J; Head, T; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Huard, Z-C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kecke, M; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Komarov, I; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozachuk, A; Kozeiha, M; Kravchuk, L; Kreps, M; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kurek, K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Liu, X; Loh, D; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Maev, O; Maguire, K; Malde, S; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Manning, P; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Meadows, B; Meier, F; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Minard, M-N; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Morris, A P; Mountain, R; Muheim, F; Mulder, M; Mussini, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Pappenheimer, C; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Poikela, T; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Popovici, B; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, C; Qian, W; Quagliani, R; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rodriguez Perez, P; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Gonzalo, D; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubert, K; Schubiger, M; Schune, M-H; Schwemmer, R;