WorldWideScience

Sample records for wilmington harbor south

  1. The South Wilmington Area remedial cost estimating methodology (RCEM) -- A planning tool and reality check for brownfield development

    International Nuclear Information System (INIS)

    Yancheski, T.B.; Swanson, J.E.

    1996-01-01

    The South Wilmington Area (SWA), which is comprised of 200 acres of multi-use urban lowlands adjacent to the Christina River, is a brownfields area that has been targeted for redevelopment/restoration as part of a major waterfront revitalization project for the City of Wilmington, Delaware. The vision for this riverfront development, which is being promoted by a state-funded development corporation, includes plans for a new harbor, convention and entertainment facilities, upscale residences, an urban wildlife refuge, and the restoration of the Christina River. However, the environmental quality of the SWA has been seriously impacted by an assortment of historic and current heavy industrial land-uses since the late 1800's, and extensive environmental cleanup of this area will be required as part of any redevelopment plan. Given that the environmental cleanup cost will be a major factor in determining the overall economic feasibility of brownfield development in the SWA, a reliable means of estimating potential preliminary remedial costs, without the expense of costly investigative and engineering studies, was needed to assist with this redevelopment initiative. The primary chemicals-of-concern (COCs) area-wide are lead and petroleum compounds, however, there are hot-spot occurrences of polynuclear aromatic hydrocarbons (PAHs), PCBs, and other heavy metals such as arsenic and mercury

  2. 33 CFR 165.T14-204 - Safety Zone; fixed mooring balls, south of Barbers Pt Harbor Channel, Oahu, Hawaii.

    Science.gov (United States)

    2010-07-01

    ..., south of Barbers Pt Harbor Channel, Oahu, Hawaii. 165.T14-204 Section 165.T14-204 Navigation and... Pt Harbor Channel, Oahu, Hawaii. (a) Location. The following area is a safety zone: All waters... position is approximately 2,500 yards south of Barbers Point Harbor channel buoy #2, Oahu, Hawaii. This...

  3. 33 CFR 165.709 - Security Zone; Charleston Harbor, Cooper River, South Carolina.

    Science.gov (United States)

    2010-07-01

    ..., Cooper River, South Carolina. 165.709 Section 165.709 Navigation and Navigable Waters COAST GUARD... § 165.709 Security Zone; Charleston Harbor, Cooper River, South Carolina. (a) Regulated area. The Coast Guard is establishing a fixed security zone on all waters of the Cooper River, bank-to-bank and surface...

  4. 33 CFR 165.515 - Safety Zone: Cape Fear River, Wilmington, North Carolina.

    Science.gov (United States)

    2010-07-01

    ... Cape Fear River to the stern of the Battleship USS NORTH CAROLINA. (b) Definitions. The designated..., Wilmington, North Carolina. 165.515 Section 165.515 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.515 Safety Zone: Cape Fear River, Wilmington, North Carolina. (a) Location. The following area is...

  5. 33 CFR 334.840 - Waters of Lake Michigan south of Northerly Island at entrance to Burnham Park Yacht Harbor...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Waters of Lake Michigan south of Northerly Island at entrance to Burnham Park Yacht Harbor, Chicago, Ill.; danger zone adjacent to airport on... Michigan south of Northerly Island at entrance to Burnham Park Yacht Harbor, Chicago, Ill.; danger zone...

  6. 40 CFR 81.73 - South Bend-Elkhart (Indiana)-Benton Harbor (Michigan) Interstate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false South Bend-Elkhart (Indiana)-Benton Harbor (Michigan) Interstate Air Quality Control Region. 81.73 Section 81.73 Protection of Environment... PLANNING PURPOSES Designation of Air Quality Control Regions § 81.73 South Bend-Elkhart (Indiana)-Benton...

  7. Building Information Security Awareness at Wilmington University

    Science.gov (United States)

    Hufe, Mark J.

    2014-01-01

    This executive position paper proposes recommendations for reducing the risk of a data breach at Wilmington University. A data breach could result in identity theft of students, faculty and staff, which is costly to the individual affected and costly to the University. The University has a legal and ethical obligation to provide safeguards against…

  8. Road Salt Transport at Two Municipal Wellfields in Wilmington, Massachusetts

    Science.gov (United States)

    Beginning in 2010, the USEPA and the Town of Wilmington collected monthly samples of wellfield raw water and surface water for inorganic analyses. Dataloggers recording temperature and specific conductivity every 15 minutes at key locations in streams and in the raw water taps o...

  9. Road Salt Transport at Two Municipal Wellfields in Wilmington, MA

    Science.gov (United States)

    Chloride concentrations in raw water at the Browns Crossing and Barrows Wellfields in Wilmington, Massachusetts have increased from an average of 6 mg/l in 1961 to 242 mg/l today. Average sodium concentrations since 2009 are six to seven times the state’s drinking water guideline...

  10. 75 FR 38019 - Safety Zone; Fixed Mooring Balls, South of Barbers Pt. Harbor Channel, Oahu, HI

    Science.gov (United States)

    2010-07-01

    ... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 165 [Docket No. USCG-2010-0457] RIN 1625-AA00 Safety Zone; Fixed Mooring Balls, South of Barbers Pt. Harbor Channel, Oahu, HI AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: Due to the placement of six fixed mooring balls in an...

  11. 78 FR 5156 - Drawbridge Operation Regulation; Christina River, Wilmington, DE

    Science.gov (United States)

    2013-01-24

    ... both of the bridges to open on signal, and that the Market Street drawbridge at mile 3.0, open on... Drawbridge Operation Regulation; Christina River, Wilmington, DE AGENCY: Coast Guard, DHS. ACTION: Notice of... Third Street Bridge at mile 2.3, the Walnut Street Bridge at mile 2.8, and the Market Street Bridge at...

  12. 78 FR 21565 - Television Broadcasting Services; Jackson, Wyoming to Wilmington, DE

    Science.gov (United States)

    2013-04-11

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [MB Docket No. 13-73; RM-11695; DA 13-450] Television Broadcasting Services; Jackson, Wyoming to Wilmington, DE AGENCY: Federal Communications... review Act, see 5 U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Television. Federal...

  13. Increasing Heavy Oil Reserves in the Wilmington Oil Field Through Advanced Reservoir Characterization and Thermal Production Technologies, Class III

    Energy Technology Data Exchange (ETDEWEB)

    City of Long Beach; Tidelands Oil Production Company; University of Southern California; David K. Davies and Associates

    2002-09-30

    The objective of this project was to increase the recoverable heavy oil reserves within sections of the Wilmington Oil Field, near Long Beach, California through the testing and application of advanced reservoir characterization and thermal production technologies. It was hoped that the successful application of these technologies would result in their implementation throughout the Wilmington Field and, through technology transfer, will be extended to increase the recoverable oil reserves in other slope and basin clastic (SBC) reservoirs.

  14. An investigation of the feasibility of building a harbor on the West coast of South America using explosive power of nuclear weapons, a preliminary report

    Energy Technology Data Exchange (ETDEWEB)

    Zodtner, H. H.

    1971-12-31

    There is an interest in discovering the various peace time uses of nuclear explosives. One of the proposals is the building of harbors. There are several ports along the west coast of South America where lighterage is necessary. This implies a need for expanded harbor facilities. The problem is to find a good location for creating a harbor, and the feasibility of accomplishing this with the use of nuclear force. Feasibility includes blast effects, radiation hazards, the number of weapons needed, and economic considerations. Economic considerations include the cost of treating a harbor of sufficient depth and area, the building of harbor facilities, and the estimated savings and advantages of the new harbor. Several meetings were held with naval personnel of the Military Liaison group at UCRL to discuss the general problems of harbors. Thirty-three different ports were given a preliminary investigation.

  15. Increasing Heavy Oil in the Wilmington Oil Field Through Advanced Reservoir Characterization and Thermal Production Technologies. Annual Report, March 30, 1995--March 31, 1996

    International Nuclear Information System (INIS)

    Allison, Edith

    1996-12-01

    The objective of this project is to increase heavy oil reserves in a portion of the Wilmington Oil Field, near Long Beach, California, by implementing advanced reservoir characterization and thermal production technologies. Based on the knowledge and experience gained with this project, these technologies are intended to be extended to other sections of the Wilmington Oil Field, and, through technology transfer, will be available to increase heavy oil reserves in other slope and basin clastic (SBC) reservoirs

  16. 77 FR 26358 - Petition for Waiver of Compliance

    Science.gov (United States)

    2012-05-03

    ... Aberdeen Subdivision (between Raleigh and Hamlet, NC) from Southern Junction (Milepost (MP) South 156.8) to Marston (MP South 241.6), and on the Wilmington Subdivision (between Hamlet and Wilmington, NC) from NE...

  17. Environment-Dependent Distribution of the Sediment nifH-Harboring Microbiota in the Northern South China Sea

    Science.gov (United States)

    Yang, Jinying; Li, Jing; Luan, Xiwu; Zhang, Yunbo; Gu, Guizhou; Xue, Rongrong; Zong, Mingyue; Klotz, Martin G.

    2013-01-01

    The South China Sea (SCS), the largest marginal sea in the Western Pacific Ocean, is a huge oligotrophic water body with very limited influx of nitrogenous nutrients. This suggests that sediment microbial N2 fixation plays an important role in the production of bioavailable nitrogen. To test the molecular underpinning of this hypothesis, the diversity, abundance, biogeographical distribution, and community structure of the sediment diazotrophic microbiota were investigated at 12 sampling sites, including estuarine, coastal, offshore, deep-sea, and methane hydrate reservoirs or their prospective areas by targeting nifH and some other functional biomarker genes. Diverse and novel nifH sequences were obtained, significantly extending the evolutionary complexity of extant nifH genes. Statistical analyses indicate that sediment in situ temperature is the most significant environmental factor influencing the abundance, community structure, and spatial distribution of the sediment nifH-harboring microbial assemblages in the northern SCS (nSCS). The significantly positive correlation of the sediment pore water NH4+ concentration with the nifH gene abundance suggests that the nSCS sediment nifH-harboring microbiota is active in N2 fixation and NH4+ production. Several other environmental factors, including sediment pore water PO43− concentration, sediment organic carbon, nitrogen and phosphorus levels, etc., are also important in influencing the community structure, spatial distribution, or abundance of the nifH-harboring microbial assemblages. We also confirmed that the nifH genes encoded by archaeal diazotrophs in the ANME-2c subgroup occur exclusively in the deep-sea methane seep areas, providing for the possibility to develop ANME-2c nifH genes as a diagnostic tool for deep-sea methane hydrate reservoir discovery. PMID:23064334

  18. INCREASING HEAVY OIL RESERVES IN THE WILMINGTON OIL FIELD THROUGH ADVANCED RESERVOIR CHARACTERIZATION AND THERMAL PRODUCTION TECHNOLOGIES

    Energy Technology Data Exchange (ETDEWEB)

    Unknown

    2001-08-08

    The objective of this project is to increase the recoverable heavy oil reserves within sections of the Wilmington Oil Field, near Long Beach, California, through the testing and application of advanced reservoir characterization and thermal production technologies. The hope is that successful application of these technologies will result in their implementation throughout the Wilmington Field and, through technology transfer, will be extended to increase the recoverable oil reserves in other slope and basin clastic (SBC) reservoirs. The existing steamflood in the Tar zone of Fault Block II-A (Tar II-A) has been relatively inefficient because of several producibility problems which are common in SBC reservoirs: inadequate characterization of the heterogeneous turbidite sands, high permeability thief zones, low gravity oil and non-uniform distribution of the remaining oil. This has resulted in poor sweep efficiency, high steam-oil ratios, and early steam breakthrough. Operational problems related to steam breakthrough, high reservoir pressure, and unconsolidated sands have caused premature well and downhole equipment failures. In aggregate, these reservoir and operational constraints have resulted in increased operating costs and decreased recoverable reserves. A suite of advanced reservoir characterization and thermal production technologies are being applied during the project to improve oil recovery and reduce operating costs, including: (1) Development of three-dimensional (3-D) deterministic and stochastic reservoir simulation models--thermal or otherwise--to aid in reservoir management of the steamflood and post-steamflood phases and subsequent development work. (2) Development of computerized 3-D visualizations of the geologic and reservoir simulation models to aid reservoir surveillance and operations. (3) Perform detailed studies of the geochemical interactions between the steam and the formation rock and fluids. (4) Testing and proposed application of a

  19. Solar energy system demonstration project at Wilmington Swim School, New Castle, Delaware

    Science.gov (United States)

    1980-07-01

    A solar energy system located at the Wilmington Swim School, New Castle, Delaware is described. The system was designed for a 40 percent heating and a 30 percent hot water solar contribution serving the heat loads in the following order: space heat - new addition, domestic water - entire facility, and pool heating - entire facility. On a cost basis for 2920 hours of operation, the heat reclaimed would cost $969.66 annually if provided by gas at 3.79 per million Btu's. At 5.5 centers per kwh, heat recovery costs of $481.80 percent a net savings of $487.86 annually.

  20. 77 FR 15087 - Intent To Prepare a Draft Environmental Impact Statement (DEIS) for the Installation of a...

    Science.gov (United States)

    2012-03-14

    ... to Section 404 of the Clean Water Act and Section 10 of the Rivers and Harbor Act, from the Village... Channel (a federally-maintained navigation channel of the Cape Fear River) at the ``Point'' of Bald Head... operations associated with the Wilmington Harbor Sand Management Plan. DATES: A public scoping meeting for...

  1. Characterization of Pliocene and Miocene Formations in the Wilmington Graben, Offshore Los Angeles, for Large-Scale Geologic Storage of CO₂

    Energy Technology Data Exchange (ETDEWEB)

    Bruno, Michael [Geomechanics Technologies, Incorporated, Monrovia, CA (United States)

    2014-12-08

    Geomechanics Technologies has completed a detailed characterization study of the Wilmington Graben offshore Southern California area for large-scale CO₂ storage. This effort has included: an evaluation of existing wells in both State and Federal waters, field acquisition of about 175 km (109 mi) of new seismic data, new well drilling, development of integrated 3D geologic, geomechanics, and fluid flow models for the area. The geologic analysis indicates that more than 796 MMt of storage capacity is available within the Pliocene and Miocene formations in the Graben for midrange geologic estimates (P50). Geomechanical analyses indicate that injection can be conducted without significant risk for surface deformation, induced stresses or fault activation. Numerical analysis of fluid migration indicates that injection into the Pliocene Formation at depths of 1525 m (5000 ft) would lead to undesirable vertical migration of the CO₂ plume. Recent well drilling however, indicates that deeper sand is present at depths exceeding 2135 m (7000 ft), which could be viable for large volume storage. For vertical containment, injection would need to be limited to about 250,000 metric tons per year per well, would need to be placed at depths greater than 7000ft, and would need to be placed in new wells located at least 1 mile from any existing offset wells. As a practical matter, this would likely limit storage operations in the Wilmington Graben to about 1 million tons per year or less. A quantitative risk analysis for the Wilmington Graben indicate that such large scale CO₂ storage in the area would represent higher risk than other similar size projects in the US and overseas.

  2. Wilmington Area Planning Council, New Castle County, Delaware and Cecil County, Maryland : a performance-based approach to integrating congestion management into the metropolitan planning process

    Science.gov (United States)

    2009-04-01

    The Wilmington Area Planning Council takes an objectives-driven, performance-based approach to its metropolitan transportation planning, including paying special attention to integrating its Congestion Management Process into its planning efforts. Th...

  3. Immersion in the Field: The Elementary Block Network in the Watson College of Education at the University of North Carolina Wilmington

    Science.gov (United States)

    Roseboro, Donyell; Lewis, Somer; Buchanan, Lisa; Higgins, Heidi; Schlichting, Katie; Brinkley, Brian

    2014-01-01

    In 1989, the Watson College of Education at the University of North Carolina Wilmington started the Model Clinical Teaching Project and the Consortium for the Advancement of Public Education's School Reform Initiative (CAPE). Since that time, the partnership system has grown to include 146 schools across twelve traditional school districts and…

  4. 77 FR 68736 - South Atlantic Fishery Management Council; Public Meetings

    Science.gov (United States)

    2012-11-16

    ... Wilmington Riverside Hotel, 301 North Water Street, Wilmington, NC 28401; telephone: (1-888) 324-8170 or (910... receive a legal briefing on litigation. (closed session) From 8:45 a.m. until 9 a.m., the Council will...

  5. Class III Mid-Term Project, "Increasing Heavy Oil Reserves in the Wilmington Oil Field Through Advanced Reservoir Characterization and Thermal Production Technologies"

    Energy Technology Data Exchange (ETDEWEB)

    Scott Hara

    2007-03-31

    The overall objective of this project was to increase heavy oil reserves in slope and basin clastic (SBC) reservoirs through the application of advanced reservoir characterization and thermal production technologies. The project involved improving thermal recovery techniques in the Tar Zone of Fault Blocks II-A and V (Tar II-A and Tar V) of the Wilmington Field in Los Angeles County, near Long Beach, California. A primary objective has been to transfer technology that can be applied in other heavy oil formations of the Wilmington Field and other SBC reservoirs, including those under waterflood. The first budget period addressed several producibility problems in the Tar II-A and Tar V thermal recovery operations that are common in SBC reservoirs. A few of the advanced technologies developed include a three-dimensional (3-D) deterministic geologic model, a 3-D deterministic thermal reservoir simulation model to aid in reservoir management and subsequent post-steamflood development work, and a detailed study on the geochemical interactions between the steam and the formation rocks and fluids. State of the art operational work included drilling and performing a pilot steam injection and production project via four new horizontal wells (2 producers and 2 injectors), implementing a hot water alternating steam (WAS) drive pilot in the existing steamflood area to improve thermal efficiency, installing a 2400-foot insulated, subsurface harbor channel crossing to supply steam to an island location, testing a novel alkaline steam completion technique to control well sanding problems, and starting on an advanced reservoir management system through computer-aided access to production and geologic data to integrate reservoir characterization, engineering, monitoring, and evaluation. The second budget period phase (BP2) continued to implement state-of-the-art operational work to optimize thermal recovery processes, improve well drilling and completion practices, and evaluate the

  6. 77 FR 19967 - Safety Zone, Port of Dutch Harbor; Dutch Harbor, AK

    Science.gov (United States)

    2012-04-03

    ...-AA00 Safety Zone, Port of Dutch Harbor; Dutch Harbor, AK AGENCY: Coast Guard, DHS. ACTION: Notice of proposed rulemaking. SUMMARY: The Coast Guard proposes temporary safety zones in the Port of Dutch Harbor... Dutch Harbor, Alaska, and the adjacent territorial sea due to additional vessel traffic associated with...

  7. INCREASING WATERFLOOD RESERVES IN THE WILMINGTON OIL FIELD THROUGH IMPROVED RESERVOIR CHARACTERIZATION AND RESERVOIR MANAGEMENT

    Energy Technology Data Exchange (ETDEWEB)

    Scott Walker; Chris Phillips; Roy Koerner; Don Clarke; Dan Moos; Kwasi Tagbor

    2002-02-28

    This project increased recoverable waterflood reserves in slope and basin reservoirs through improved reservoir characterization and reservoir management. The particular application of this project is in portions of Fault Blocks IV and V of the Wilmington Oil Field, in Long Beach, California, but the approach is widely applicable in slope and basin reservoirs. Transferring technology so that it can be applied in other sections of the Wilmington Field and by operators in other slope and basin reservoirs is a primary component of the project. This project used advanced reservoir characterization tools, including the pulsed acoustic cased-hole logging tool, geologic three-dimensional (3-D) modeling software, and commercially available reservoir management software to identify sands with remaining high oil saturation following waterflood. Production from the identified high oil saturated sands was stimulated by recompleting existing production and injection wells in these sands using conventional means as well as a short radius redrill candidate. Although these reservoirs have been waterflooded over 40 years, researchers have found areas of remaining oil saturation. Areas such as the top sand in the Upper Terminal Zone Fault Block V, the western fault slivers of Upper Terminal Zone Fault Block V, the bottom sands of the Tar Zone Fault Block V, and the eastern edge of Fault Block IV in both the Upper Terminal and Lower Terminal Zones all show significant remaining oil saturation. Each area of interest was uncovered emphasizing a different type of reservoir characterization technique or practice. This was not the original strategy but was necessitated by the different levels of progress in each of the project activities.

  8. 75 FR 54598 - Schedules for Atlantic Shark Identification Workshops and Protected Species Safe Handling...

    Science.gov (United States)

    2010-09-08

    ... workshop for September 9, 2010, to be held at the same time and location, 9 a.m. to 5 p.m., Comfort Inn (UNC Wilmington), 151 South College Road, Wilmington, NC 28403. DATES: The Atlantic Shark... CONTACT: Richard A. Pearson of the Highly Migratory Species Management Division at (727) 824-5399...

  9. Description and proposed life cycle of Maritrema novaezealandensis n. sp. (Microphallidae) parasitic in red-billed gulls, Larus novaehollandiae scopulinus, from Otago Harbor, South Island, New Zealand

    DEFF Research Database (Denmark)

    Martorelli, Sergio R; Fredensborg, Brian Lund; Mouritsen, Kim Nørgaard

    2004-01-01

    Maritrema novaezealandensis n. sp. is described from Otago Harbor, South Island, New Zealand, on the basis of adult specimens collected from the Red-billed gull, Larus novaehollandiae scopulinus, and excysted metacercariae obtained from crabs. It belongs to the "eroliae group" and differs from...... snail, Zeacumantus subcarinatus, in which the cercarial stage is produced in sporocysts located within the gonad of the snail. At least 3 crab species (Hemigrapsus crenulatus, Macrophtalmus hirtipes, and Halicarcinus whitei) and several species of amphipods act as second intermediate hosts...

  10. Interim Feasibility Report and Draft Environmental Impact Statement, Grays Harbor, Chehalis and Hoquiam Rivers, Washington, Channel Improvements for Navigation.

    Science.gov (United States)

    1982-06-01

    community depends on the continued descent of organic materials from the overlying waters for nourishment. The Dungeness crab ( Cancer magister) is an...immediately north and south of Grays Harbor. EIS-34 o Crabs. Dungeness crabs ( Cancer magister) are abundant in Grays Harbor, though most are smaller...Cooper Cultural Resources Mama Seattle District, Evaluation Corps of Engineers Endangered Species Brunner Seattle District, Evaluation Corps of Engineers

  11. 33 CFR 100.109 - Winter Harbor Lobster Boat Race, Winter Harbor, ME.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Winter Harbor Lobster Boat Race, Winter Harbor, ME. 100.109 Section 100.109 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY REGATTAS AND MARINE PARADES SAFETY OF LIFE ON NAVIGABLE WATERS § 100.109 Winter Harbor...

  12. 33 CFR 165.150 - New Haven Harbor, Quinnipiac River, Mill River.

    Science.gov (United States)

    2010-07-01

    ... River, Mill River. 165.150 Section 165.150 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... New Haven Harbor, Quinnipiac River, Mill River. (a) The following is a regulated navigation area: The... 303°T to point D at the west bank of the mouth of the Mill River 41°18′05″ N, 72°54′23″ W thence south...

  13. 33 CFR 125.15 - Access to waterfront facilities, and port and harbor areas, including vessels and harbor craft...

    Science.gov (United States)

    2010-07-01

    ..., and port and harbor areas, including vessels and harbor craft therein. 125.15 Section 125.15....15 Access to waterfront facilities, and port and harbor areas, including vessels and harbor craft....09 to those waterfront facilities, and port and harbor areas, including vessels and harbor craft...

  14. The planktonic communities of the Jamaican south-east coast; a comparison of harbor, shelf and oceanic areas

    Directory of Open Access Journals (Sweden)

    Hugh Small

    2014-09-01

    Full Text Available Few studies have compared water quality and plankton along the eutrophication gradient from Kingston Harbour to oceanic waters around Jamaica. To compare the planktonic community along the expected nutrient gradient, we sampled every two weeks at four stations, from eutrophic Kingston Harbour to oceanic California Bank. Phytoplankton was assessed from whole water Niskin bottle casts and zooplankton by vertical hauls with plankton nets of three different mesh sizes: 64µm, 200µm, and 600µm. Total phytoplankton biomass declined sharply away from the harbour (1.0 μg L-1 at the Harbour Shoal Beacon to 0.2 μg L-1 at California Bank. Characteristic estuarine phytoplankton genera -such as Ceratium, Gonyaulax, Gyrodinium and Rhizosolenia- dominated harbour samples while genera characteristic of offshore locations -such as Asterionelliopsis, Navicula, Nitzschia, Rhizosolenia and Thalassionema- dominated California Bank. Highest phytoplankton densities (mean values of 34 174 cells L-1 were found at the harbor mouth. Mean zooplankton abundances ranged from maximum (5 858.5m-3 at Beacon to minimum (2 124.2 m-3 at California; 171 species of zooplankton were identified and copepods dominated with 76 species. Overall, 75 species of zooplankton were identified from Beacon, 107 from Port Royal Cays- South East Cay, 110 from the exposed shelf edge- Windward Edge, and 95 from the oceanic California Bank. Larval forms dominated; copepod nauplii, fish eggs and echinoderm larvae occurred at all sites. Lucifer faxoni and Penilia avirostris were indicative of harbor waters and Microsetella sp. and Farranula carinata of offshore waters. Some zooplankton taxa, like L. faxoni, Paracalanus parvus and copepod nauplii, despite showing gradual decline with distance from Beacon to the Edge, increased in abundance at the furthest station, California. California Bank clearly experiences enrichment which at times can be as high as near-shore areas, but the planktonic

  15. Coastal Harbors Modeling Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Coastal Harbors Modeling Facility is used to aid in the planning of harbor development and in the design and layout of breakwaters, absorbers, etc.. The goal is...

  16. 77 FR 38587 - Takes of Marine Mammals Incidental to Specified Activities; Harbor Activities Related to the...

    Science.gov (United States)

    2012-06-28

    ... Northern elephant seals by Level B harassment only. To date, we have issued nine, one-year, Incidental... as far north as Alaska and as far south as Mexico. Northern elephant seals spend much of the year... numbers of marine mammals, incidental to conducting Delta Mariner harbor operations for one year. We...

  17. Deciphering igneous and metamorphic events in high-grade rocks of the Wilmington complex, Delaware: Morphology, cathodoluminescence and backscattered electron zoning, and SHRIMP U-Pb geochronology of zircon and monazite

    Science.gov (United States)

    Aleinikoff, J.N.; Schenck, W.S.; Plank, M.O.; Srogi, L.A.; Fanning, C.M.; Kamo, S.L.; Bosbyshell, H.

    2006-01-01

    High-grade rocks of the Wilmington Complex, northern Delaware and adjacent Maryland and Pennsylvania, contain morphologically complex zircons that formed through both igneous and metamorphic processes during the development of an island-arc complex and suturing of the arc to Laurentia. The arc complex has been divided into several members, the protoliths of which include both intrusive and extrusive rocks. Metasedimentary rocks are interlayered with the complex and are believed to be the infrastructure upon which the arc was built. In the Wilmingto n Complex rocks, both igneous and metamorphic zircons occur as elongate and equant forms. Chemical zoning, shown by cathodoluminescence (CL), includes both concentric, oscillatory patterns, indicative of igneous origin, and patchwork and sector patterns, suggestive of metamorphic growth. Metamorphic monazites are chemically homogeneous, or show oscillatory or spotted chemical zoning in backscattered electron images. U-Pb geochronology by sensitive high resolution ion microprobe (SHRIMP) was used to date complexly zoned zircon and monazite. All but one member of the Wilmington Complex crystallized in the Ordovician between ca. 475 and 485 Ma; these rocks were intruded by a suite of gabbro-to-granite plutonic rocks at 434 ?? Ma. Detrital zircons in metavolcanic and metasedimentary units were derived predominantly from 0.9 to 1.4 Ga (Grenvillian) basement, presumably of Laurentian origin. Amphibolite to granulite facies metamorphism of the Wilmington Complex, recorded by ages of metamorphic zircon (428 ?? 4 and 432 ?? 6 Ma) and monazite (429 ?? 2 and 426 ?? 3 Ma), occurred contemporaneously with emplacement of the younger plutonic rocks. On the basis of varying CL zoning patterns and external morphologies, metamorphic zircons formed by different processes (presumably controlled by rock chemistry) at slightly different times and temperatures during prograde metamorphism. In addition, at least three other thermal episodes are

  18. Faunal and vegetation monitoring in response to harbor dredging in the Port of Miami

    Science.gov (United States)

    Daniels, Andre; Stevenson, Rachael; Smith, Erin; Robblee, Michael

    2018-04-11

    Seagrasses are highly productive ecosystems. A before-after-control-impact (BACI) design was used to examine effects of dredging on seagrasses and the animals that inhabit them. The control site North Biscayne Bay and the affected site Port of Miami had seagrass densities decrease during both the before, Fish and Invertebrate Assessment Network 2006-2011, and after, Faunal Monitoring in Response to Harbor Dredging 2014-2016, studies. Turbidity levels increased at North Biscayne Bay and Port of Miami basins during the Faunal Monitoring in Response to Harbor Dredging study, especially in 2016. Animal populations decreased significantly in North Biscayne Bay and Port of Miami in the Faunal Monitoring in Response to Harbor Dredging study compared to the Fish and Invertebrate Assessment Network study. Predictive modeling shows that numbers of animal populations will likely continue to decrease if the negative trends in seagrass densities continue unabated. There could be effects on several fisheries vital to the south Florida economy. Additional research could determine if animal populations and seagrass densities have rebounded or continued to decrease.

  19. Nonindigenous Marine Species Introductions in the harbors of the South and West Shores of Oahu, Hawaii 1997-1998 (NODC Accession 0000324)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Despite the potential importance of Honolulu Harbor or other commercial harbors on Oahu as potential gateways for nonindigenous marine species to enter the Hawaiian...

  20. Description and proposed life cycle of Maritrema novaezealandensis n. sp. (Microphallidae) parasitic in red-billed gulls, Larus novaehollandiae scopulinus, from Otago Harbor, South Island, New Zealand.

    Science.gov (United States)

    Martorelli, Sergio R; Fredensborg, Brian L; Mouritsen, Kim N; Poulin, Robert

    2004-04-01

    Maritrema novaezealandensis n. sp. is described from Otago Harbor, South Island, New Zealand, on the basis of adult specimens collected from the Red-billed gull, Larus novaehollandiae scopulinus, and excysted metacercariae obtained from crabs. It belongs to the "eroliae group" and differs from other related species mainly in the shape, size, and patterns of distributions of the spines on the cirrus, the shape of the metraterm, the presence of an unlobed ovary, and the complete ring of the vitelline follicles. Based on morphometric features of metacercariae and adult specimens, the trophic relationships among invertebrate and vertebrate hosts, experimental infections, and previous reports of species of Maritrema with similar transmission patterns, the life cycle of M. novaezealandensis n. sp. is described. A 3-host life cycle is proposed for this parasite. The first intermediate host is the mud snail, Zeacumantus subcarinatus, in which the cercarial stage is produced in sporocysts located within the gonad of the snail. At least 3 crab species (Hemigrapsus crenulatus, Macrophtalmus hirtipes, and Halicarcinus whitei) and several species of amphipods act as second intermediate hosts, with metacercariae encysted in the body cavity of the crustacean host. Finally, the definitive host, the gull, L. n. scopulinus, harbors the adult worms in its intestine.

  1. 76 FR 8653 - Drawbridge Operation Regulation; Gulf Intracoastal Waterway, New Orleans Harbor, Inner Harbor...

    Science.gov (United States)

    2011-02-15

    ... Operation Regulation; Gulf Intracoastal Waterway, New Orleans Harbor, Inner Harbor Navigation Canal, New Orleans, Orleans Parish, LA AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from... Lock), at New Orleans, Orleans Parish, Louisiana. This deviation is necessary to replace all of the...

  2. 75 FR 78601 - Drawbridge Operation Regulation; Gulf Intracoastal Waterway, New Orleans Harbor, Inner Harbor...

    Science.gov (United States)

    2010-12-16

    ... Operation Regulation; Gulf Intracoastal Waterway, New Orleans Harbor, Inner Harbor Navigation Canal, New Orleans, Orleans Parish, LA AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from... Harvey Lock), at New Orleans, Orleans Parish, Louisiana. This deviation is necessary to adjust the...

  3. Increasing heavy oil reserves in the Wilmington Oil Field through advanced reservoir characterization and thermal production technologies. Annual report, March 30, 1995--March 31, 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-09-01

    The objective of this project is to increase heavy oil reserves in a portion of the Wilmington Oil Field, near Long Beach, California, by implementing advanced reservoir characterization and thermal production technologies. Based on the knowledge and experience gained with this project, these technologies are intended to be extended to other sections of the Wilmington Oil Field, and, through technology transfer, will be available to increase heavy oil reserves in other slope and basin clastic (SBC) reservoirs. The project involves implementing thermal recovery in the southern half of the Fault Block II-A Tar zone. The existing steamflood in Fault Block II-A has been relatively inefficient due to several producibility problems which are common in SBC reservoirs. Inadequate characterization of the heterogeneous turbidite sands, high permeability thief zones, low gravity oil, and nonuniform distribution of remaining oil have all contributed to poor sweep efficiency, high steam-oil ratios, and early steam breakthrough. Operational problems related to steam breakthrough, high reservoir pressure, and unconsolidated formation sands have caused premature well and downhole equipment failures. In aggregate, these reservoir and operational constraints have resulted in increased operating costs and decreased recoverable reserves. A suite of advanced reservoir characterization and thermal production technologies are being applied during the project to improve oil recovery efficiency and reduce operating costs.

  4. Ecological evaluation of proposed dredged material from Winyah Bay, South Carolina

    International Nuclear Information System (INIS)

    Ward, J.A.; Gardiner, W.W.; Pinza, M.R.; Word, J.Q.

    1993-10-01

    The navigational channels of Winyah Bay, Georgetown Harbor, South Carolina require dredging to enable normal shipping traffic to use these areas. Before dredging, environmental assessments must be conducted to determine the suitability of this dredged sediment for unconfined, open-water disposal. The Charleston, South Carolina District Office of the US Army Corps of Engineers (USACE) requested that the Battelle/Marine Science Laboratory (MSL) collect sediment samples and conduct the required physical/chemical, toxicological, and bioaccumulation evaluations as required in the 1991 Implementation Manual. This report is intended to provide information required to address potential ecological effects of the Entrance Channel and Inner Harbor sediments proposed disposal in the ocean

  5. 33 CFR 207.610 - St. Lawrence River, Cape Vincent Harbor, N.Y.; use, administration, and navigation of the harbor...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false St. Lawrence River, Cape Vincent Harbor, N.Y.; use, administration, and navigation of the harbor and U.S. breakwater. 207.610 Section 207... NAVIGATION REGULATIONS § 207.610 St. Lawrence River, Cape Vincent Harbor, N.Y.; use, administration, and...

  6. Geoscience rediscovers Phoenicia's buried harbors

    Science.gov (United States)

    Marriner, Nick; Morhange, Christophe; Doumet-Serhal, Claude; Carbonel, Pierre

    2006-01-01

    After centuries of archaeological debate, the harbors of Phoenicia's two most important city states, Tyre and Sidon, have been rediscovered, and including new geoarcheological results reveal how, where, and when they evolved after their Bronze Age foundations. The early ports lie beneath their present urban centers, and we have indentified four harbor phases. (1) During the Bronze Age, Tyre and Sidon were characterized by semi-open marine coves that served as protoharbors. (2) Biostratigraphic and lithostratigraphic data indicate the presence of early artificial basins after the first millennium B.C. (3) The harbors reached their apogees during the Greco-Roman and Byzantine periods. (4) Silting up and coastal progradation led to burial of the medieval basins, lost until now.

  7. 33 CFR 165.904 - Lake Michigan at Chicago Harbor & Burnham Park Harbor-Safety and Security Zone.

    Science.gov (United States)

    2010-07-01

    ... & Burnham Park Harbor-Safety and Security Zone. 165.904 Section 165.904 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION... Guard District § 165.904 Lake Michigan at Chicago Harbor & Burnham Park Harbor—Safety and Security Zone...

  8. 77 FR 59551 - Safety Zone, Changes to Original Rule; Boston Harbor's Rock Removal Project, Boston Inner Harbor...

    Science.gov (United States)

    2012-09-28

    ... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 165 [Docket No. USCG-2012-0767] RIN 1625-AA00 Safety Zone, Changes to Original Rule; Boston Harbor's Rock Removal Project, Boston Inner Harbor... original provisions of that temporary final rule, but adds two additional safety zones necessary for the...

  9. Teaching about Pearl Harbor. Curriculum Enhancement Series #1.

    Science.gov (United States)

    Shields, Anna Marshall

    These materials consist of sample lesson plans for teaching about the Japanese attack on Pearl Harbor on December 7, 1941, in both U.S. and world history classes. The lesson plans challenge students to examine how current attitudes toward the Japanese may be rooted in World War II and Pearl Harbor. Selected bibliographies on Pearl Harbor, World…

  10. Tales of some ancient harbors in the Aegean back-arc region: Earthquakes, coastal changes, historical impacts

    Science.gov (United States)

    Stiros, Stathis; Saltogianni, Vasso

    2017-04-01

    this ancient town since approximately AD200 as a result of loss of the only significant harbor along the southern coast of the Gulf of Corinth. Farther west, in the south part of the Greek mainland, rising of the level of the dock shortly after its construction may imply response to seismic land subsidence, while at the nearby harbor of Palairos, remains of a submerged breakwater, offset by several meters, testify to strike slip faulting with seismic offset amplified by liquefaction.

  11. [Pearl Harbor.

    Science.gov (United States)

    Johnson, Jennifer, Ed.

    1992-01-01

    This issue of "Loblolly Magazine" was written in observance of the 50th anniversary of the U.S. entrance into World War II. The publication features interviews conducted by East Texas high school students with Clarence Otterman, one of the few survivors of the crew of the USS Arizona, which was bombed during the attack on Pearl Harbor,…

  12. Modeling of Tsunami Currents in Harbors

    Science.gov (United States)

    Lynett, P. J.

    2010-12-01

    Extreme events, such as large wind waves and tsunamis, are well recognized as a damaging hazard to port and harbor facilities. Wind wave events, particularly those with long period spectral components or infragravity wave generation, can excite resonance inside harbors leading to both large vertical motions and strong currents. Tsunamis can cause great damage as well. The geometric amplification of these very long waves can create large vertical motions in the interior of a harbor. Additionally, if the tsunami is composed of a train of long waves, which it often is, resonance can be easily excited. These long wave motions create strong currents near the node locations of resonant motions, and when interacting with harbor structures such as breakwaters, can create intense turbulent rotational structures, typical in the form of large eddies or gyres. These gyres have tremendous transport potential, and have been observed to break mooring lines, and even cause ships to be trapped inside the rotation, moving helplessly with the flow until collision, grounding, or dissipation of the eddy (e.g. Okal et al., 2006). This presentation will introduce the traditional theory used to predict wave impacts on harbors, discussing both how these models are practically useful and in what types of situations require a more accurate tool. State-of-the-art numerical models will be introduced, with a focus on recent developments in Boussinesq-type modeling. The Boussinesq equations model can account the dispersive, turbulent and rotational flow properties frequently observed in nature. Also they have the ability to coupling currents and waves and can predict nonlinear wave propagation over uneven bottom from deep (or intermediate) water area to shallow water area. However, during the derivation of a 2D-horizontal equation set, some 3D flow features, such those driven by as the dispersive stresses and the effects of the unresolved small scale 3D turbulence, are excluded. Consequently

  13. Vibration-based structural health monitoring of harbor caisson structure

    Science.gov (United States)

    Lee, So-Young; Lee, So-Ra; Kim, Jeong-Tae

    2011-04-01

    This study presents vibration-based structural health monitoring method in foundation-structure interface of harbor caisson structure. In order to achieve the objective, the following approaches are implemented. Firstly, vibration-based response analysis method is selected and structural health monitoring (SHM) technique is designed for harbor caisson structure. Secondly, the performance of designed SHM technique for harbor structure is examined by FE analysis. Finally, the applicability of designed SHM technique for harbor structure is evaluated by dynamic tests on a lab-scaled caisson structure.

  14. 32 CFR 765.6 - Regulations for Pearl Harbor, Hawaii.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Regulations for Pearl Harbor, Hawaii. 765.6... RULES RULES APPLICABLE TO THE PUBLIC § 765.6 Regulations for Pearl Harbor, Hawaii. The Commander, U.S. Naval Base, Pearl Harbor, Hawaii, is responsible for prescribing and enforcing such rules and...

  15. 33 CFR 110.238 - Apra Harbor, Guam.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. 110.238 Section 110.238 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.238 Apra Harbor, Guam. (a) The anchorage grounds (Datum: WGS...

  16. Journal of Rehabilitation Research and Development Progress Reports 1994, Volume 32, June 1995

    Science.gov (United States)

    1995-06-01

    May 1993. La misura degli intervalli di attivazione muscolare durante il movimento: un metodo di detezione statistica, Bonato P, D’alessio T...Philadelphia, PA 19107; Division of Medical Sciences. Alfred I. dti Pont Institute, Wilmington, DP. 19803; Olsen Biochemistry Laboratories, South Dakota

  17. 78 FR 44933 - Intent To Prepare a Draft Supplement to the July 2011 Environmental Impact Statement for the...

    Science.gov (United States)

    2013-07-25

    ... and local units of government. The other partnering agencies include: U.S. Environmental Protection... Resources; and the Wilmington Metropolitan Planning Organization. The Merger process provides a forum for... travel lanes between a previously proposed interchange south of the Topsail High School and the...

  18. Navigation Improvement Design Memorandum Number 1, General Design for San Diego Harbor, San Diego County, California. Appendixes.

    Science.gov (United States)

    1975-02-01

    are currently in opposition to spoiling in dredge dispo’sal site "B". To our knowledge , uses planned of this fill would not be water-related...utilized by water- skiers , thereby presenting conflicts with scheduled amphibious training. In addition to conflicts of "joint use", there is a...to time %ater harbor to create a r.ew re- miles south of the base. skiers have interfered with creational beach c.n av- Thcre had b,.a numerous Navy

  19. First case of New Delhi metallo-β-lactamase in Klebsiella pneumoniae from Ecuador: An update for South America

    Directory of Open Access Journals (Sweden)

    Daniel Romero-Alvarez

    2017-12-01

    Full Text Available Objectives: To describe a clinical case of Klebsiella pneumoniae harboring a New Delhi metallo-β-lactamase (NDM plasmid in Ecuador and to present a map of reports of NDM isolates in South America. Methods: The modified Hodge test, carbapenem inactivation method, imipenem–EDTA disk method (synergy, and Rapidec Carba NP test were used to identify antibiotic resistance mechanisms. The presence of resistance genes was explored with a conjugation assay, and molecular confirmation of NDM was performed by PCR and DNA sequencing. Plasmid characterization was conducted by PCR-based replicon typing. A literature review was performed in Google Scholar and PubMed to identify reports from South America. Results: An HIV-infected patient, who had never traveled abroad, developed a bloodstream infection caused by K. pneumoniae ST147 harboring the NDM-1 resistance gene in a plasmid from the IncA/C group. Local circulation of NDM has also been described in other South American countries, in particular in Colombia and Brazil, although published scientific records were not found for other countries. Conclusions: This report presents the first evidence of autochthonous circulation of the NDM-1 resistance gene harbored by an IncA/C plasmid isolated from a K. pneumoniae ST147 in Ecuador. Efforts should be implemented to monitor and characterize the spatial and temporal distribution of NDM in Ecuador and other countries of South America. Keywords: NDM, South America, Klebsiella pneumoniae, Antibiotic resistance, Plasmid

  20. The Suez Canal and the petroleum harbors

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    The Suez Canal is the second longest channel in the world and allows to save 60% of the travel time between the petroleum harbors of the Arabic peninsula and Europe. This short paper gives a summary of the main petroleum harbors activity along the channel from the Red sea to the Mediterranean sea. (J.S.)

  1. Polycyclic aromatic hydrocarbons and trace elements bounded to airborne PM10 in the harbor of Volos, Greece: Implications for the impact of harbor activities

    Science.gov (United States)

    Manoli, E.; Chelioti-Chatzidimitriou, A.; Karageorgou, K.; Kouras, A.; Voutsa, D.; Samara, C.; Kampanos, I.

    2017-10-01

    Harbors are often characterized by high levels of air pollutants that are emitted from ship traffic and other harbor activities. In the present study, the concentrations of Polycyclic Aromatic Hydrocarbons (PAHs) and trace elements (As, Cd, Ni, Pb, Cr, Mn, Zn, and Fe) bounded to the inhalable particulate matter PM10 were studied in the harbor of Volos, central Greece, during a 2-year period (2014-2015). Seasonal and daily variations were investigated. Moreover, total carcinogenic and mutagenic activities of PAHs were calculated. The effect of major wind sectors (sea, city, industrial, harbor) was estimated to assess the potential contribution of ship traffic and harbor activities, such as scrap metal handling operations. Results showed that the harbor sector (calm winds ≤ 0.5 m s-1) was associated with the highest concentrations of PM10. The harbor sector was also associated with relatively increased levels of trace elements (As, Fe, Cr, Mn, Ni), however the effect of this sector was lower than the corresponding effect of the industrial wind sector. The sea sector showed only a slight increase in B[a]Py and Σ12PAHs, whereas the highest increasing effect for PAHs and traffic-related elements, such as Pb and Zn, was evidenced for the city sector.

  2. Wave Climate and Wave Response, 2025 Plan, Kahului Harbor, Maui, Hawaii

    National Research Council Canada - National Science Library

    Thompson, Edward

    2002-01-01

    ... (wind waves and swell) and long waves (harbor oscillations), was used to evaluate the technical feasibility of three alternative modifications to the harbor, including the Kahului Commercial Harbor 2025 Master Plan...

  3. 33 CFR 162.165 - Buffalo and Rochester Harbors, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Buffalo and Rochester Harbors, New York. 162.165 Section 162.165 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... and Rochester Harbors, New York. In Buffalo and Rochester Harbors, no vessel may exceed 6 miles per...

  4. Satellite Monitoring of Boston Harbor Water Quality: Initial Investigations

    Science.gov (United States)

    Sheldon, P.; Chen, R. F.; Schaaf, C.; Pahlevan, N.; Lee, Z.

    2016-02-01

    The transformation of Boston Harbor from the "dirtiest in America" to a National Park Area is one of the most remarkable estuarine recoveries in the world. A long-term water quality dataset from 1991 to present exists in Boston Harbor due to a $3. 8 billion lawsuit requiring the harbor clean-up. This project uses discrete water sampling and underway transects with a towed vehicle coordinated with Landsat 7 and Landsat 8 to create surface maps of chlorophyll a (Chl a), dissolved organic matter (CDOM and DOC), total suspended solids (TSS), diffuse attenuation coefficient (Kd_490), and photic depth in Boston Harbor. In addition, 3 buoys have been designed, constructed, and deployed in Boston Harbor that measure Chl a and CDOM fluorescence, optical backscatter, salinity, temperature, and meteorological parameters. We are initially using summer and fall of 2015 to develop atmospheric corrections for conditions in Boston Harbor and develop algorithms for Landsat 8 data to estimate in water photic depth, TSS, Chl a, Kd_490, and CDOM. We will report on initial buoy and cruise data and show 2015 Landsat-derived distributions of water quality parameters. It is our hope that once algorithms for present Landsat imagery can be developed, historical maps of water quality can be constructed using in water data back to 1991.

  5. Old Harbor Scammon Bay Hydro Feasibility

    Energy Technology Data Exchange (ETDEWEB)

    Brent Petrie

    2007-06-27

    The grantee, Alaska Village Electric Cooperative (AVEC), is a non-profit member owned rural electric generation and distribution cooperative. The proposed Project is located near the community of Old Harbor, Alaska. Old Harbor is on the southeastern coast of Kodiak Island, approximately 70 miles southwest of the City of Kodiak and 320 miles southwest of Anchorage. In 1998 sufficient information had been developed to apply for a license to construct the project and the cost was estimated to be $2,445,000 for a 500 KW project on Lagoon Creek. Major features of the project included an eight-foot high diversion dam on Mountain Creek, a desander box, a 9,800-foot long penstock to the powerhouse on Lagoon Creek, and a 5,500-foot long access road. It was also anticipated that the project could provide an additional source of water to Old Harbor. The report details the history and lessons learned in designing and permiting the proposed hydroelectric facility.

  6. 33 CFR 80.1450 - Nawiliwili Harbor, Kauai, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nawiliwili Harbor, Kauai, HI. 80.1450 Section 80.1450 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Pacific Islands § 80.1450 Nawiliwili Harbor, Kauai, HI...

  7. 33 CFR 80.1470 - Kawaihae Harbor, Hawaii, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Kawaihae Harbor, Hawaii, HI. 80.1470 Section 80.1470 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Pacific Islands § 80.1470 Kawaihae Harbor, Hawaii, HI...

  8. First case of New Delhi metallo-β-lactamase in Klebsiella pneumoniae from Ecuador: An update for South America.

    Science.gov (United States)

    Romero-Alvarez, Daniel; Reyes, Jorge; Quezada, Viviana; Satán, Carolina; Cevallos, Nelson; Barrera, Sofía; Trueba, Gabriel; Escobar, Luis E; Villacís, José E

    2017-12-01

    To describe a clinical case of Klebsiella pneumoniae harboring a New Delhi metallo-β-lactamase (NDM) plasmid in Ecuador and to present a map of reports of NDM isolates in South America. The modified Hodge test, carbapenem inactivation method, imipenem-EDTA disk method (synergy), and Rapidec Carba NP test were used to identify antibiotic resistance mechanisms. The presence of resistance genes was explored with a conjugation assay, and molecular confirmation of NDM was performed by PCR and DNA sequencing. Plasmid characterization was conducted by PCR-based replicon typing. A literature review was performed in Google Scholar and PubMed to identify reports from South America. An HIV-infected patient, who had never traveled abroad, developed a bloodstream infection caused by K. pneumoniae ST147 harboring the NDM-1 resistance gene in a plasmid from the IncA/C group. Local circulation of NDM has also been described in other South American countries, in particular in Colombia and Brazil, although published scientific records were not found for other countries. This report presents the first evidence of autochthonous circulation of the NDM-1 resistance gene harbored by an IncA/C plasmid isolated from a K. pneumoniae ST147 in Ecuador. Efforts should be implemented to monitor and characterize the spatial and temporal distribution of NDM in Ecuador and other countries of South America. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  9. Rapid Emergence and Clonal Dissemination of CTX-M-15-Producing Salmonella enterica Serotype Virchow, South Korea.

    Science.gov (United States)

    Kim, Jin Seok; Yun, Young-Sun; Kim, Soo Jin; Jeon, Se-Eun; Lee, Deog-Yong; Chung, Gyung Tae; Yoo, Cheon-Kwon; Kim, Junyoung

    2016-01-01

    The prevalence of cefotaxime-resistant Salmonella enterica serotype Virchow has dramatically increased in South Korea since the first isolation in 2011. Of 68 isolates collected over 10 years, 28 cefotaxime-resistant isolates harbored the bla(CTX-M-15) extended-spectrum β-lactamase gene and were closely related genetically, demonstrating the clonal dissemination of CTX-M-15-producing Salmonella Virchow in South Korea.

  10. APRILab: Regulation Dilemma in South Harbor & Aalborg East, Denmark

    DEFF Research Database (Denmark)

    Hansen, Jesper Rohr

    Copenhagen [in English, ‘South Harbour’] demonstrates an urban periphery development that in terms of strategy formation, project development and implementation has been running since the late 1990s. Accordingly, most of the city district of Sydhavn Copenhagen has been planned for. However, despite...... is the financial crisis that paralyzed the development in the area in the years 2007-2011; however, as this report shows, the deployment of new regulative tools as well as an expansionist municipal growth strategy have also contributed to this slow progress, generating problems of cooperation between landowners...... and diverting the attention and resources of the municipal system (administratively, politically). The suburban case, Aalborg Øst [in English, ‘Aalborg East’], in the City of Aalborg, is another type of case completely. This case is immature in the sense that only the first building blocks for a strategy...

  11. 33 CFR 110.208 - Buffalo Harbor, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y. 110.208 Section 110.208 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.208 Buffalo Harbor, N.Y. (a) The anchorage grounds—(1...

  12. Tech Talk for Social Studies Teachers Lest We Forget: Remembering Pearl Harbor.

    Science.gov (United States)

    Green, Tim

    2001-01-01

    Presents an annotated bibliography that provides Web sites about Pearl Harbor (Hawaii). Includes Web sites that cover Pearl Harbor history, a live view of Pearl Harbor, stories from people who remember where they were during the attack, information on the naval station at Pearl Harbor, and a virtual tour of the USS Arizona. (CMK)

  13. 33 CFR 80.1460 - Kahului Harbor, Maui, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Kahului Harbor, Maui, HI. 80.1460 Section 80.1460 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Pacific Islands § 80.1460 Kahului Harbor, Maui, HI. A line drawn...

  14. 33 CFR 80.1480 - Hilo Harbor, Hawaii, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hilo Harbor, Hawaii, HI. 80.1480 Section 80.1480 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Pacific Islands § 80.1480 Hilo Harbor, Hawaii, HI. A line drawn...

  15. Madaket Harbor, Nantucket, Massachusetts. Water Resources Improvement.

    Science.gov (United States)

    1977-07-01

    will continue to be, important increases in the recreational use of land and water. The harbor area is an important arena for commercial shellfishing...an important arena for commercial shell fishing. The past few years have seen a rather rapid increase in residential land use. Construction has...beamc. Tnis material will be re-deposited,, viaj troio it 1-apfro1inr ox prior location. j, MADAKET HARBOR NANTUCKET, MASSACHUSETTS FEASIBILITY

  16. 77 FR 45239 - Amendment of Class E Airspace; Bar Harbor, ME

    Science.gov (United States)

    2012-07-31

    ...-1366; Airspace Docket No. 11-ANE-13] Amendment of Class E Airspace; Bar Harbor, ME AGENCY: Federal... area at Bar Harbor, ME, as the Surry Non-Directional Radio Beacon (NDB) has been decommissioned and new Standard Instrument Approach Procedures have been developed at Hancock County-Bar Harbor Airport. This...

  17. Underwater noise from three types of offshore wind turbines: estimation of impact zones for harbor porpoises and harbor seals.

    Science.gov (United States)

    Tougaard, Jakob; Henriksen, Oluf Damsgaard; Miller, Lee A

    2009-06-01

    Underwater noise was recorded from three different types of wind turbines in Denmark and Sweden (Middelgrunden, Vindeby, and Bockstigen-Valar) during normal operation. Wind turbine noise was only measurable above ambient noise at frequencies below 500 Hz. Total sound pressure level was in the range 109-127 dB re 1 microPa rms, measured at distances between 14 and 20 m from the foundations. The 1/3-octave noise levels were compared with audiograms of harbor seals and harbor porpoises. Maximum 1/3-octave levels were in the range 106-126 dB re 1 microPa rms. Maximum range of audibility was estimated under two extreme assumptions on transmission loss (3 and 9 dB per doubling of distance, respectively). Audibility was low for harbor porpoises extending 20-70 m from the foundation, whereas audibility for harbor seals ranged from less than 100 m to several kilometers. Behavioral reactions of porpoises to the noise appear unlikely except if they are very close to the foundations. However, behavioral reactions from seals cannot be excluded up to distances of a few hundred meters. It is unlikely that the noise reaches dangerous levels at any distance from the turbines and the noise is considered incapable of masking acoustic communication by seals and porpoises.

  18. New Harbor in Kangerlussuaq, Western Greenland

    DEFF Research Database (Denmark)

    Stenstad, Jaran Gjerlandj; Eppeland, Kjetil Grødal; Ingeman-Nielsen, Thomas

    2015-01-01

    transported by rivers from the inland ice to the inner parts of the fjord. These sediment layers reduce the water depth and prevent container- and cruiseships to dock, imposing large additional maintenance costs, and inefficient operability. Through engineering geological field and lab investigations......, a possible new harbor location around 10 km further out the fjord near Hancock Pynt, has been investigated. The onshore area was found to be highly suitable for a harbor support area, where a sub-base thickness of 1.8 m with gravel cover-layer was found adequate for the calculated design loads. Existing...

  19. The biological assessment of flora and fauna as standards for changes in the near-shore ocean environment: a study of Barbers Point Harbor.

    Science.gov (United States)

    Hokama, Y; Wachi, K M; Shiraki, A; Goo, C; Ebesu, J S

    2001-02-01

    The biological assessments of the flora and fauna in the near-shore ocean environment, specifically Barbers Point Harbor (BPH), demonstrate the usefulness of these biological analyses for evaluation of the changes occurring following man-made excavation for expansion of the harbor. The study included identification and enumeration of macroalgae and dinoflagellates and analyses of herbivores and carnivores in four areas within the perimeter of the harbor and the north and south entrances into the harbor. Numbers of macroalgae varied between 1994 and 1999 surveys, with significant decrease in numbers in stations C, D and E. Stations A and B were similar between 1994 and 1999 with a slight increase in 1999. The significant differences were shown with the appearance of Gambierdiscus toxicus (G toxicus) in 1999 among the algae in stations A and B. Assessment of herbivores and carnivores with the immunological membrane immunobead assay using monoclonal antibody to ciguatoxin and related polyethers demonstrated an increase in fish toxicity among the herbivore from 1994-1999 (22% increase) with a decrease (22%) in non-toxic fish. This was also demonstrated in the carnivores, but to a lesser degree. It is suggested that the biological analyses of the flora and the fauna of the near-shore ocean environment are appropriate to assess the changes that occur from natural and man-made alterations.

  20. 33 CFR 165.1402 - Apra Outer Harbor, Guam-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Apra Outer Harbor, Guam-regulated....1402 Apra Outer Harbor, Guam—regulated navigation area. (a) The following is a regulated navigation area—The waters of the Pacific Ocean and Apra Outer Harbor enclosed by a line beginning at latitude 13...

  1. Comparison of trace metals in South Carolina floodplain and marsh sediments

    International Nuclear Information System (INIS)

    Gardner, L.R.; Chen, H.S.; Settlemyre, J.L.

    1978-01-01

    A comparative study of trace metals (copper, zinc, lead, and molybdenum) in sediment cores from a pristine marsh near North Inlet, S.C., a polluted marsh near Charleston Harbor, S.C., and South Carolina river floodplains indicates that the Charleston Harbor marsh samples have significantly higher concentrations of copper, zinc, and lead than either North Inlet samples or river floodplain samples. It is not clear, however, whether this result can be attributed to industrial contamination because the peak concentrations of copper and zinc in cores from the Charleston Harbor marsh occur at depths between 10 and 60 cm rather than at or near the sediment surface, as is the case for well-documented occurrences of contaminated marine sediments. Also, both marsh areas show similar linear relationships for copper vs. zinc, which suggest that both areas received the same relative inputs of copper and zinc from similar or identical sources and that the differences in concentrations between the two areas are due to differences in the rates of accumulation. Natural mechanisms are suggested to explain the higher content of copper and zinc in Charleston Harbor vs. North Inlet marsh sediments and the variable depth of peak copper and zinc concentrations

  2. Ground-water status report, Pearl Harbor area, Hawaii, 1978

    Science.gov (United States)

    Soroos, Ronald L.; Ewart, Charles J.

    1979-01-01

    Increasing demand for freshwater in Hawaii has placed heavy stress on many of the State 's basal aquifer systems. The most heavily stressed of these systems is the Pearl Harbor on Oahu. The Pearl Harbor basal aquifer supplies as much as 277 million gallons per day. Since early in this century, spring discharge has been declining while pumpage has been increasing. Total ground-water discharge has remained steady despite short-term fluctuations. Some wells show general increases in chloride concentration while others remain steady. Chloride concentrations throughout the area show no apparent increase since 1970. Basal water head maps of the Pearl Harbor area clearly reflect the natural discharge points, which are the springs located along the shore near the center of Pearl Harbor. Basal-water hydrographs show a general decline of about 0.09 foot per year. This implies depletion of storage at a rate of about 25 million gallons per day. (USGS).

  3. Alaska Harbor Seal Glacial Surveys

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Floating glacial ice serves as a haul-out substrate for a significant number (10-15%) of Alaskan harbor seals, and thus surveying tidewater glacial fjords is an...

  4. 32 CFR 705.31 - USS Arizona Memorial, Pearl Harbor.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false USS Arizona Memorial, Pearl Harbor. 705.31... NAVY REGULATIONS AND OFFICIAL RECORDS PUBLIC AFFAIRS REGULATIONS § 705.31 USS Arizona Memorial, Pearl Harbor. (a) Limited space and the desirability of keeping the Memorial simple and dignified require the...

  5. Stratigraphic controls on saltwater intrusion in the Dominguez Gap area of coastal Los Angeles

    Science.gov (United States)

    Edwards, B.D.; Ehman, K.D.; Ponti, D.J.; Reichard, E.G.; Tinsley, J.C.; Rosenbauer, R.J.; Land, M.

    2009-01-01

    The Los Angeles Basin is a densely populated coastal area that significantly depends on groundwater. A part of this groundwater supply is at risk from saltwater intrusion-the impetus for this study. High-resolution seismic-reflection data collected from the Los Angeles-Long Beach Harbor Complex have been combined with borehole geophysical and descriptive geological data from four nearby ??400-m-deep continuously cored wells and with borehole geophysical data from adjacent water and oil wells to characterize the Pliocene to Holocene stratigraphy of the Dominguez Gap coastal aquifer system. The new data are shown as a north-south, two- dimensional, sequence-stratigraphic model that is compared to existing lithostratigraphic models of the Los Angeles Basin in an attempt to better understand pathways of saltwater intrusion into coastal aquifers. Intrusion of saltwater into the coastal aquifer system generally is attributed to over-pumping that caused the hydraulic gradient to reverse during the mid-1920s. Local water managers have used the existing lithostratigraphic model to site closely spaced injection wells of freshwater (barrier projects) attempting to hydraulically control the saltwater intrusion. Improved understanding of the stratigraphic relationships can guide modifications to barrier design that will allow more efficient operation. Allostratigraphic nomenclature is used to define a new sequence-stratigraphic model for the area because the existing lithostratigraphic correlations that have been used to define aquifer systems are shown not to be time-correlative. The youngest sequence, the Holocene Dominguez sequence, contains the Gaspur aquifer at its base. The Gaspur aquifer is intruded with saltwater and consists of essentially flat-lying gravelly sands deposited by the ancestral Los Angeles River as broad channels that occupied a paleovalley incised into the coastal plain during the last glacio-eustatic highstand. The underlying sequences are deformed into

  6. 76 FR 32071 - Safety Zone; Conneaut Festival Fireworks, Conneaut Harbor, Conneaut, OH

    Science.gov (United States)

    2011-06-03

    ...-AA00 Safety Zone; Conneaut Festival Fireworks, Conneaut Harbor, Conneaut, OH AGENCY: Coast Guard, DHS... Conneaut Harbor, Conneaut, OH for the Conneaut Festival Fireworks. This zone is intended to restrict vessels from a portion of Conneaut Harbor, Conneaut, OH during the Conneaut Festival Fireworks on July 3...

  7. Remembering Pearl Harbor at 75 Years.

    Science.gov (United States)

    Liehr, Patricia; Sopcheck, Janet; Milbrath, Gwyneth

    2016-12-01

    : On December 7, 1941, the Sunday-morning quiet of the U.S. naval base in Pearl Harbor, Hawaii, was shattered by dive-bombing Japanese fighter planes. The planes came in two waves-and when it was all over, more than 2,400 were killed and more than 1,100 were injured.Nurses were stationed at U.S. Naval Hospital Pearl Harbor, Tripler General Hospital (now Tripler Army Medical Center), Hickam Field Hospital, Schofield Barracks Station Hospital, and aboard the USS Solace, and witnessed the devastation. But they also did what nurses do in emergencies-they responded and provided care to those in need. Here are the stories of a few of those nurses.

  8. 77 FR 27666 - Proposed Amendment of Class E Airspace; Bar Harbor, ME

    Science.gov (United States)

    2012-05-11

    ...-1366; Airspace Docket No. 11-ANE-13] Proposed Amendment of Class E Airspace; Bar Harbor, ME AGENCY... action proposes to amend Class E Airspace at Bar Harbor, ME, as the Surry Non-Directional Radio Beacon... Hancock County-Bar Harbor Airport. This action would enhance the safety and airspace management of...

  9. CRSMP Potential Harbor Borrow Sites 2012

    Data.gov (United States)

    California Natural Resource Agency — Harbor locations as identified originally in the California Shoreline Database compiled by Noble Consultants (Jon Moore) for California Department of Boating and...

  10. Integrated approach to assess ecosystem health in harbor areas.

    Science.gov (United States)

    Bebianno, M J; Pereira, C G; Rey, F; Cravo, A; Duarte, D; D'Errico, G; Regoli, F

    2015-05-01

    Harbors are critical environments with strategic economic importance but with potential environmental impact: health assessment criteria are a key issue. An ecosystem health status approach was carried out in Portimão harbor as a case-study. Priority and specific chemical levels in sediments along with their bioavailability in mussels, bioassays and a wide array of biomarkers were integrated in a biomarker index (IBR index) and the overall data in a weight of evidence (WOE) model. Metals, PAHs, PCBs and HCB were not particularly high compared with sediment guidelines and standards for dredging. Bioavailability was evident for Cd, Cu and Zn. Biomarkers proved more sensitive namely changes of antioxidant responses, metallothioneins and vittellogenin-like proteins. IBR index indicated that site 4 was the most impacted area. Assessment of the health status by WOE approach highlighted the importance of integrating sediment chemistry, bioaccumulation, biomarkers and bioassays and revealed that despite some disturbance in the harbor area, there was also an impact of urban effluents from upstream. Environmental quality assessment in harbors. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. 33 CFR 334.1430 - Apra Inner Harbor, Island of Guam; restricted area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Apra Inner Harbor, Island of Guam... THE ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.1430 Apra Inner Harbor, Island of Guam; restricted area. (a) The restricted area. The waters within Apra Inner Harbor and...

  12. Harbor seal vibrissa morphology suppresses vortex-induced vibrations

    OpenAIRE

    Hanke, Wolf; Witte, Mathias; Miersch, Lars; Brede, Martin; Oeffner, Johannes; Michael, Mark; Hanke, Frederike; Leder, Alfred; Dehnhardt, Guido

    2010-01-01

    Harbor seals (Phoca vitulina) often live in dark and turbid waters, where their mystacial vibrissae, or whiskers, play an important role in orientation. Besides detecting and discriminating objects by direct touch, harbor seals use their whiskers to analyze water movements, for example those generated by prey fish or by conspecifics. Even the weak water movements left behind by objects that have passed by earlier can be sensed and followed accurately (hydrodynamic trail following). While scan...

  13. 33 CFR 110.87 - Henderson Harbor, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Henderson Harbor, N.Y. 110.87... ANCHORAGE REGULATIONS Special Anchorage Areas § 110.87 Henderson Harbor, N.Y. (a) Area A. The area in the... latitude 43°51′08.8″ N, longitude 76°12′08.9″ W, thence to latitude 43°51′09.0″ N, longitude 76°12′19.0″ W...

  14. Influenza A(H10N7) Virus in Dead Harbor Seals, Denmark

    DEFF Research Database (Denmark)

    Krog, Jesper Schak; Hansen, Mette Sif; Holm, Elisabeth

    2015-01-01

    Since April 2014, an outbreak of influenza in harbor seals has been ongoing in northern Europe. In Denmark during June-August, 152 harbor seals on the island of Anholt were found dead from severe pneumonia. We detected influenza A(H10N7) virus in 2 of 4 seals examined.......Since April 2014, an outbreak of influenza in harbor seals has been ongoing in northern Europe. In Denmark during June-August, 152 harbor seals on the island of Anholt were found dead from severe pneumonia. We detected influenza A(H10N7) virus in 2 of 4 seals examined....

  15. Harbor seal vibrissa morphology suppresses vortex-induced vibrations.

    Science.gov (United States)

    Hanke, Wolf; Witte, Matthias; Miersch, Lars; Brede, Martin; Oeffner, Johannes; Michael, Mark; Hanke, Frederike; Leder, Alfred; Dehnhardt, Guido

    2010-08-01

    Harbor seals (Phoca vitulina) often live in dark and turbid waters, where their mystacial vibrissae, or whiskers, play an important role in orientation. Besides detecting and discriminating objects by direct touch, harbor seals use their whiskers to analyze water movements, for example those generated by prey fish or by conspecifics. Even the weak water movements left behind by objects that have passed by earlier can be sensed and followed accurately (hydrodynamic trail following). While scanning the water for these hydrodynamic signals at a swimming speed in the order of meters per second, the seal keeps its long and flexible whiskers in an abducted position, largely perpendicular to the swimming direction. Remarkably, the whiskers of harbor seals possess a specialized undulated surface structure, the function of which was, up to now, unknown. Here, we show that this structure effectively changes the vortex street behind the whiskers and reduces the vibrations that would otherwise be induced by the shedding of vortices from the whiskers (vortex-induced vibrations). Using force measurements, flow measurements and numerical simulations, we find that the dynamic forces on harbor seal whiskers are, by at least an order of magnitude, lower than those on sea lion (Zalophus californianus) whiskers, which do not share the undulated structure. The results are discussed in the light of pinniped sensory biology and potential biomimetic applications.

  16. Frequency Domain Response at Pacific Coast Harbors to Major Tsunamis of 2005-2011

    Science.gov (United States)

    Xing, Xiuying; Kou, Zhiqing; Huang, Ziyi; Lee, Jiin-Jen

    2013-06-01

    Tsunamis waves caused by submarine earthquake or landslide might contain large wave energy, which could cause significant human loss and property damage locally as well as in distant region. The response of three harbors located at the Pacific coast (i.e. Crescent City Harbor, Los Angeles/Long Beach Port, and San Diego Harbor) to six well-known tsunamis events generated (both near-field and far-field) between 2005 and 2011 are examined and simulated using a hybrid finite element numerical model in frequency domain. The model incorporated the effects of wave refraction, wave diffraction, partial wave reflection from boundaries, entrance and bottom energy dissipation. It can be applied to harbor regions with arbitrary shapes and variable water depth. The computed resonant periods or modes of oscillation for three harbors are in good agreement with the energy spectral analysis of the time series of water surface elevations recorded at tide gauge stations inside three harbors during the six tsunamis events. The computed wave induced currents based on the present model are also in qualitative agreement with some of the reported eye-witness accounts absence of reliable current data. The simulated results show that each harbor responded differently and significantly amplified certain wave period(s) of incident wave trains according to the shape, topography, characteristic dimensions and water depth of the harbor basins.

  17. Aerial Survey Counts of Harbor Seals in Coastal Alaska (1998-2002)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset supports efforts to estimate the abundance and trends in population size of Alaska harbor seals. Annual surveys of harbor seal populations are...

  18. Aerial Survey Counts of Harbor Seals in Coastal Alaska (2003-2011)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset supports efforts to estimate the abundance and trends in population size of Alaska harbor seals. Annual surveys of harbor seal populations are...

  19. 78 FR 18479 - Drawbridge Operation Regulations; Inner Harbor Navigation Canal, New Orleans, LA

    Science.gov (United States)

    2013-03-27

    ... Operation Regulations; Inner Harbor Navigation Canal, New Orleans, LA AGENCY: Coast Guard, DHS. ACTION... across the Inner Harbor Navigation Canal, mile 4.6, at New Orleans, Louisiana. This deviation is... Seabrook Highway crossing the Inner Harbor Navigation Canal, mile 4.6, in New Orleans, Louisiana. The...

  20. Hydraulic modeling of stream channels and structures in Harbor and Crow Hollow Brooks, Meriden, Connecticut

    Science.gov (United States)

    Weiss, Lawrence A.; Sears, Michael P.; Cervione, Michael A.

    1994-01-01

    Effects of urbanization have increased the frequency and size of floods along certain reaches of Harbor Brook and Crow Hollow Brook in Meriden, Conn. A floodprofile-modeling study was conducted to model the effects of selected channel and structural modifications on flood elevations and inundated areas. The study covered the reach of Harbor Brook downstream from Interstate 691 and the reach of Crow Hollow Brook downstream from Johnson Avenue. Proposed modifications, which include changes to bank heights, channel geometry, structural geometry, and streambed armoring on Harbor Brook and changes to bank heights on Crow Hollow Brook, significantly lower flood elevations. Results of the modeling indicate a significant reduction of flood elevations for the 10-year, 25-year, 35-year, 50-year, and 100-year flood frequencies using proposed modifications to (1 ) bank heights between Harbor Brook Towers and Interstate 691 on Harbor Brook, and between Centennial Avenue and Johnson Avenue on Crow Hollow Brook; (2) channel geometry between Coe Avenue and Interstate 69 1 on Harbor Brook; (3) bridge and culvert opening geometry between Harbor Brook Towers and Interstate 691 on Harbor Brook; and (4) channel streambed armoring between Harbor Brook Towers and Interstate 691 on Harbor Brook. The proposed modifications were developed without consideration of cost-benefit ratios.

  1. 76 FR 50489 - Agency Information Collection Activities: Harbor Maintenance Fee

    Science.gov (United States)

    2011-08-15

    ... Activities: Harbor Maintenance Fee AGENCY: U.S. Customs and Border Protection, Department of Homeland... Fee (CBP Forms 349 and 350). This is a proposed extension of an information collection that was... Fee. OMB Number: 1651-0055. Form Number: CBP Forms 349 and 350. Abstract: The Harbor Maintenance Fee...

  2. Pearl Harbor: lessons for the dam safety community

    Energy Technology Data Exchange (ETDEWEB)

    Martin, T.E. [AMEC Earth and Environmental Ltd., Burnaby, BC (Canada)

    2001-10-01

    Every good dam safety program must be based on surveillance and emergency response planning. The same principles apply to the gathering of information for military intelligence and the planning of defence tactics. Lessons learned from failure have spurred the advancement of dam engineering. Dam safety experts can benefit from the inadequacies encountered by the military community, with the most famous occurring on December 7, 1941 in Pearl Harbor. Both intelligence gathering and contingency response planning failed miserably. The data was not properly disseminated, interpreted, analysed. The proper response to the situation was not initiated. Human error and failure to communicate are the two main reasons that explain the debacle. The inquiries into the tragedy at Pearl Harbor provided valuable lessons, related to individual and organizational failures, which the authors shared in this presentation. The relevance to dam safety was made. All Federal Bureau of Investigation (FBI) agents must read the lessons drawn from Pearl Harbor, as they have responsibility for dam safety. 4 refs.

  3. 33 CFR 110.27 - Lynn Harbor in Broad Sound, Mass.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lynn Harbor in Broad Sound, Mass. 110.27 Section 110.27 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.27 Lynn Harbor in Broad Sound, Mass. North of...

  4. 33 CFR 117.458 - Inner Harbor Navigation Canal, New Orleans.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Inner Harbor Navigation Canal, New Orleans. 117.458 Section 117.458 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Harbor Navigation Canal, New Orleans. (a) The draws of the SR 46 (St. Claude Avenue) bridge, mile 0.5...

  5. Extrachromosomal deoxyribonucleic acid in R factor-harboring Enterobacteriaceae

    DEFF Research Database (Denmark)

    Møller, JK; Bak, AL; Christiansen, C

    1976-01-01

    Extrachromosomal deoxyribonucleic acid (DNA) from 24 different R factor-harboring Enterobacteriaceae was isolated and characterized by analytical ultracentrifugation and electron microscopy. The R factors represented 15 different patterns of transferable drug resistance found in enterobacteria from...... from 1.700 to 1.720 g/cm3. The majority of the bacteria contained extrachromosomal DNAs of various densities. Three-fourths of the R factors were classified as fi+. The investigation illustrates the extensive variability in the physical characteristics of plasmid DNA from R factor-harboring strains....

  6. Genetics Home Reference: Floating-Harbor syndrome

    Science.gov (United States)

    ... Patton MA, Hurst J, Donnai D, McKeown CM, Cole T, Goodship J. Floating-Harbor syndrome. J Med ... medicine? What is newborn screening? New Pages Lyme disease Fibromyalgia White-Sutton syndrome All New & Updated Pages ...

  7. 76 FR 38153 - California State Nonroad Engine Pollution Control Standards; Commercial Harbor Craft Regulations...

    Science.gov (United States)

    2011-06-29

    ... Standards; Commercial Harbor Craft Regulations; Opportunity for Public Hearing and Comment AGENCY... engines on commercial harbor craft. CARB has requested that EPA issue a new authorization under [email protected] . SUPPLEMENTARY INFORMATION: I. California's Commercial Harbor Craft Regulations In a...

  8. 33 CFR 117.753 - Ship Channel, Great Egg Harbor Bay.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ship Channel, Great Egg Harbor Bay. 117.753 Section 117.753 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.753 Ship Channel, Great Egg Harbor Bay. The draw of the S52 (Ship...

  9. Congress Investigates: Pearl Harbor and 9/11 Congressional Hearing Exhibits

    Science.gov (United States)

    Blackerby, Christine

    2011-01-01

    On the morning of December 7, 1941, Japanese bombers staged a surprise attack on U.S. military forces at Pearl Harbor in Hawaii. Sixty years after the attack on Pearl Harbor, the United States was attacked again. On the morning of September 11, 2001, four commercial airplanes hijacked by 19 terrorists killed nearly 3,000 people when they crashed…

  10. Genetic characterization of blaNDM-harboring plasmids in carbapenem-resistant Escherichia coli from Myanmar.

    Directory of Open Access Journals (Sweden)

    Yo Sugawara

    Full Text Available The bacterial enzyme New Delhi metallo-β-lactamase hydrolyzes almost all β-lactam antibiotics, including carbapenems, which are drugs of last resort for severe bacterial infections. The spread of carbapenem-resistant Enterobacteriaceae that carry the New Delhi metallo-β-lactamase gene, blaNDM, poses a serious threat to public health. In this study, we genetically characterized eight carbapenem-resistant Escherichia coli isolates from a tertiary care hospital in Yangon, Myanmar. The eight isolates belonged to five multilocus-sequence types and harbored multiple antimicrobial-resistance genes, resulting in resistance against nearly all of the antimicrobial agents tested, except colistin and fosfomycin. Nine plasmids harboring blaNDM genes were identified from these isolates. Multiple blaNDM genes were found in the distinct Inc-replicon types of the following plasmids: an IncA/C2 plasmid harboring blaNDM-1 (n = 1, IncX3 plasmids harboring blaNDM-4 (n = 2 or blaNDM-7 (n = 1, IncFII plasmids harboring blaNDM-4 (n = 1 or blaNDM-5 (n = 3, and a multireplicon F plasmid harboring blaNDM-5 (n = 1. Comparative analysis highlighted the diversity of the blaNDM-harboring plasmids and their distinct characteristics, which depended on plasmid replicon types. The results indicate circulation of phylogenetically distinct strains of carbapenem-resistant E. coli with various plasmids harboring blaNDM genes in the hospital.

  11. Sedimentation and chronology of heavy metal pollution in Oslo harbor, Norway

    International Nuclear Information System (INIS)

    Lepland, Aivo; Andersen, Thorbjorn J.; Lepland, Aave; Arp, Hans Peter H.; Alve, Elisabeth; Breedveld, Gijs D.; Rindby, Anders

    2010-01-01

    Stratigraphic profiles of Cu, Cd and Hg in ten sediment cores from the Oslo harbor, Norway, combined with results of radiometric dating demonstrate that pollution by these metals peaked between 1940 and 1970. Dating results indicate that Hg discharges peaked between 1940 and 1950, Cd reached maximum ca. 1955-1960, and Cu has the highest concentration in sediment interval corresponding to ca. 1970. Geochemical profiles and maxima of Cu, Cd and Hg concentrations can be used as chronostratigraphic markers for sediment cores from the Oslo harbor. Acoustic backscatter and sediment core data indicate that propeller wash affects the seabed in the Oslo harbor. The propeller-induced turbulence causes erosion, and in places exposes and remobilizes contaminated sediments that accumulated in the harbor during previous decades. Such re-exposure of contaminated sediments could be detrimental to local ecosystems and offset remediation efforts, warranting further impact studies and potential mitigation strategies to prevent redistribution.

  12. 77 FR 50916 - Safety Zone; Boston Harbor's Rock Removal Project, Boston Inner Harbor, Boston, MA

    Science.gov (United States)

    2012-08-23

    ... operation on the navigable waters of Boston Inner Harbor, in the main ship channel near Castle Island. This... operations in support of the U.S. Army Corps of Engineers rock removal project. Entering into, transiting... before the start date of the project. The U.S. Army Corps of Engineers also discussed the rock removal...

  13. CHIRP survey of the submerged harbors of King Herod's Caesarea, offshore Israel - looking for evidence of ancient disasters

    Science.gov (United States)

    Austin, J. A.; Goodman-Tchernov, B.

    2012-12-01

    Caesarea Maritima, located on the Israel coast south of Haifa, is an ancient city/harbor site built ~2,000 years ago that continues to produce important insights into both the maritime livelihoods of antiquity and natural/anthropogenic influences on coastal structures/processes. The grandiose, three-basin harbor complex was built by Herod the Great. Today, the inner harbor basin is terrestrial, while the majority of the intermediate/outer harbors lies 1-7 m beneath the sea surface. Explanations for the harbor's destruction have included earthquakes, liquefaction, deterioration from erosion, storm undercutting and tsunami damage. Recently, evidence for tsunami events has been discovered offshore during excavation and coring expeditions, specifically trench exposures and pneumatic hammer cores. Stratigraphic horizons containing tsunamite signatures suggest the occurrence of at least three tsunamis in the past ~3,500 yrs. One may correspond with the catastrophic eruption of Santorini ~1500 BC; another appears to have done significant damage to Caesarea ~115 AD, and a third occurred within the period 5th-7th centuries AD. Extant combined bathymetric/magnetic surveys offshore also show unusual, anomalous features. Excavations in 2003 suggest that these features may be part of an ancient designated anchoring station, and support the existence of underlying man-made terrestrial structures from an earlier period when sea-level was lower. The primary goal of the current survey was to correlate recognized/potential tsunamigenic sediment layers throughout the proximal shelf offshore Caesarea, using extremely high-resolution geophysical images. Such surficial sub-bottom profiling will allow archaeologists to proceed with investigations of recognized anthropogenically-influenced submerged coastal features. The field survey was conducted in August 2011. Seismic data were collected using UTIG's portable Knudsen 320BP CHIRP (2.5-5.5 kHz) profiler, affixed to a metal pole mounted

  14. 33 CFR 80.1490 - Apra Harbor, U.S. Territory of Guam.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, U.S. Territory of Guam. 80.1490 Section 80.1490 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Pacific Islands § 80.1490 Apra Harbor, U...

  15. 33 CFR 110.214 - Los Angeles and Long Beach harbors, California.

    Science.gov (United States)

    2010-07-01

    ... Angeles Harbor). A circular area with a radius of 400 yards (approximately 366 meters), centered in... 400 Transportation Corridor. (C) Outer Harbor: The western boundary of Commercial Anchorage B. (2... Thence along a line described as an arc, radius of 460 meters (approximately 1509 feet) centered on 33...

  16. 33 CFR 110.250 - St. Thomas Harbor, Charlotte Amalie, V.I.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false St. Thomas Harbor, Charlotte... SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.250 St. Thomas Harbor, Charlotte Amalie.... Thomas, V.I. of the United States and approaches thereto, including all waters under its jurisdiction, as...

  17. Littoral cells and harbor dredging along the California coast

    Science.gov (United States)

    Griggs, Gary B.

    1987-02-01

    Beach compartments or littoral cells form the framework for our understanding of the sources, transport, and sinks of sand in the nearshore zone. In general, along the California coast, beach sand is derived from rivers or clifferosion, moves alongshore under the influence of the prevailing waver conditions, and ultimately is lost either to a submarine canyon or a dune field. Marinas or harbors built either between or at the upcoast ends of beach compartments have been relatively maintenance-free, because of a lack of significant littoral drift at these locations. On the other hand, those harbors built in the middle reaches or at the downcoast ends of littoral cells have had expensive annual dredging problems, because of the interruption of large volumes of littoral drift. Although engineers have labored for years on various breakwater, jetty, or entrance channel configurations, the actual design utilized is of secondary importance. The critical factors are harbor location within a littoral cell and annual litoral drift volume.

  18. [Attitudes towards psychotherapy in South Korea and Germany : A cross-cultural comparative study].

    Science.gov (United States)

    Schulz, W; Shin, M A; Schmid-Ott, G

    2018-01-01

    Due to the relatively recent introduction of psychotherapy in South Korea and against the background of collectivist and Confucian values, it has been suggested that South Koreans harbor more negative attitudes towards psychotherapy compared to Germans and that the social acceptance of psychotherapy is lower. We compared the attitudes of 99 women from South Korea with 98 German women using the questionnaire on attitudes towards psychotherapeutic treatment (FEP). For the study of the South Korean women we translated the questionnaire into the Korean language. The results of the psychometric analysis suggest that the Korean version of the FEP is of acceptable quality. South Korean women reported a significantly more negative attitude towards psychotherapy compared to German women. Furthermore, South Korean women anticipated a more skeptical social attitude towards psychotherapy compared to Germans. The presented results suggest the relevance of cultural imprinting in psychotherapy. They are discussed with respect to culture-specific self-concepts, concepts of disease and healing expectations and the increase of individualistic values in the Korean society.

  19. 33 CFR 110.129a - Apra Harbor, Guam. (Datum: WGS 84)

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. (Datum: WGS 84) 110.129a Section 110.129a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.129a Apra Harbor, Guam. (Datum: WGS 84) (a...

  20. Pearl Harbor Biological Survey

    Science.gov (United States)

    1974-08-30

    Pearl Harbor also receives Irrigation tailgate waters from the Oahu Sug- ar Company, Industrial waste waters from the Prlmo Brewery , and heated waters...34Observations of the Cell Structure of Salt Fingers", J. Fluid Mech. 41:4, pp 707-719. ~) 3.3-79 ,’:•.-. ^ IV s’V- EFFECTS OF SHIP ACTIVITY Paul L...anticyclonic) death assemblage - in this report, an assemblage (q.v.) of remains (such as shells or bones ) from a naturally occurring association of living

  1. Stabilization and in situ management of radioactive contaminated sediments of Port Hope harbor

    International Nuclear Information System (INIS)

    Dolinar, G.M.; Killey, R.W.D.; Philipase, K.E.

    1991-01-01

    This paper presents the findings of laboratory and field studies undertaken to assess the feasibility of in situ management of contaminated sediments in Port Hope harbor. The contaminated sediments stem from historic releases from an adjacent radium and uranium refinery, and uranium, arsenic, and radium are the most abundant contaminants. With improved emission controls, currently accumulating sediments have much lower levels of contamination, and the harbor waters currently meet water quality limits for the contaminants of concern. Within a few years, however, the continuing sedimentation will render the harbor unusable. Field tests have confirmed the dredging will result in incomplete removal of the contaminated sediments and that sediment suspension and the release of pores waters during dredging will produce harbor water contaminant concentrations that would require the treatment of large volumes of water. In addition, no remedial work can start until a site for the dredged material can be found. The local community inquired whether in situ burial of the sediments and abandonment of the harbor would provide safe disposal

  2. Reducing Vulnerability of Ports and Harbors to Earthquake and Tsunami Hazards

    Science.gov (United States)

    Wood, Nathan J.; Good, James W.; Goodwin, Robert F.

    2002-01-01

    Recent scientific research suggests the Pacific Northwest could experience catastrophic earthquakes in the near future, both from distant and local sources, posing a significant threat to coastal communities. Damage could result from numerous earthquake-related hazards, such as severe ground shaking, soil liquefaction, landslides, land subsidence/uplift, and tsunami inundation. Because of their geographic location, ports and harbors are especially vulnerable to these hazards. Ports and harbors, however, are important components of many coastal communities, supporting numerous activities critical to the local and regional economy and possibly serving as vital post-event, response-recovery transportation links. A collaborative, multi-year initiative is underway to increase the resiliency of Pacific Northwest ports and harbors to earthquake and tsunami hazards, involving Oregon Sea Grant (OSG), Washington Sea Grant (WSG), the National Oceanic and Atmospheric Administration Coastal Services Center (CSC), and the U.S. Geological Survey Center for Science Policy (CSP). Specific products of this research, planning, and outreach initiative include a regional stakeholder issues and needs assessment, a community-based mitigation planning process, a Geographic Information System (GIS) — based vulnerability assessment methodology, an educational web-site and a regional data archive. This paper summarizes these efforts, including results of two pilot port-harbor community projects, one in Yaquina Bay, Oregon and the other in Sinclair Inlet, Washington. Finally, plans are outlined for outreach to other port and harbor communities in the Pacific Northwest and beyond, using "getting started" workshops and a web-based tutorial.

  3. Pearl Harbor, Hawaii 1 arc-second DEM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 1/3-second Pearl Harbor Hawaii Elevation Grid provides bathymetric data in ASCII raster format of 1/3-second resolution in geographic coordinates. This grid is...

  4. 76 FR 34865 - Safety Zone; Rochester Harbor Festival, Genesee River, Rochester, NY

    Science.gov (United States)

    2011-06-15

    ...-AA00 Safety Zone; Rochester Harbor Festival, Genesee River, Rochester, NY AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on the Genesee River, Rochester, NY for the Rochester Harbor Festival fireworks. This zone is intended to...

  5. 76 FR 81904 - Solicitation of New Safe Harbors and Special Fraud Alerts

    Science.gov (United States)

    2011-12-29

    ... Medicaid Patient and Program Protection Act of 1987, Public Law 100-93 Sec. 14, the Act, Sec. 1128B(b), 42...-called ``safe harbor'' provisions, specifying various payment and business practices that, although... basis for administrative sanctions. OIG safe harbor provisions have been developed ``to limit the reach...

  6. Observations and modeling of tsunami-induced currents in ports and harbors

    Science.gov (United States)

    Lynett, Patrick J.; Borrero, Jose C.; Weiss, Robert; Son, Sangyoung; Greer, Dougal; Renteria, Willington

    2012-04-01

    Tsunamis, or "harbor waves" in Japanese, are so-named due to common observations of enhanced wave heights, currents and damage in harbors and ports. However, dynamic currents induced by these waves, while regularly observed and known to cause significant damage, are poorly understood. Observations and modeling of the currents induced by the 2011 Tohoku and 2004 Indian Ocean tsunamis allows us to show that the strongest flows in harbor basins are governed by horizontally sheared and rotational shallow features, such as jets and large eddies. When examining currents in harbors, this conclusion will generally require a simulation approach that both includes the relevant physical processes in the governing equations and uses a numerical scheme that does not artificially damp these features. Without proper representation of the physics associated with these phenomena, predictive models may provide drag force estimates that are an order of magnitude or more in error. The immediate implementation of this type of analysis into tsunami hazard studies can mean the difference between an unaffected port and one in which 300 m long container vessels are detached from their moorings and drift chaotically.

  7. Harbor Seal (Phoca vitulina) Reproductive Advertisement Behavior and the Effects of Vessel Noise

    Science.gov (United States)

    Matthews, Leanna P.

    Harbor seals (Phoca vitulina) are a widely distributed pinniped species that mate underwater. Similar to other aquatically mating pinnipeds, male harbor seals produce vocalizations during the breeding season that function in male-male interactions and possibly as an attractant for females. I investigated multiple aspects of these reproductive advertisement displays in a population of harbor seals in Glacier Bay National Park and Preserve, Alaska. First, I looked at vocal production as a function of environmental variables, including season, daylight, and tidal state. Vocalizations were highly seasonal and detection of these vocalizations peaked in June and July, which correspond with the estimated time of breeding. Vocalizations also varied with light, with the lowest probability of detection during the day and the highest probability of detection at night. The high probability of detection corresponded to when females are known to forage. These results are similar to the vocal behavior of previously studied populations. However, unlike previously studied populations, the detection of harbor seal breeding vocalizations did not vary with tidal state. This is likely due to the location of the hydrophone, as it was not near the haul out and depth was therefore not significantly influenced by changes in tidal height. I also investigated the source levels and call parameters of vocalizations, as well as call rate and territoriality. The average source level of harbor seal breeding vocalizations was 144 dB re 1 ?Pa at 1 m and measurements ranged from 129 to 149 dB re 1 ?Pa. Analysis of call parameters indicated that vocalizations of harbor seals in Glacier Bay were similar in duration to other populations, but were much lower in frequency. During the breeding season, there were two discrete calling areas that likely represent two individual males; the average call rate in these display areas was approximately 1 call per minute. The harbor seal breeding season also

  8. 33 CFR 110.31 - Hull Bay and Allerton Harbor at Hull, Mass.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hull Bay and Allerton Harbor at Hull, Mass. 110.31 Section 110.31 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.31 Hull Bay and Allerton Harbor at...

  9. 75 FR 81556 - Solicitation of New Safe Harbors and Special Fraud Alerts

    Science.gov (United States)

    2010-12-28

    ... statute (section 1128B(b) of the Social Security Act), as well as developing new OIG Special Fraud Alerts... of New Safe Harbors and Special Fraud Alerts AGENCY: Office of Inspector General (OIG), HHS. ACTION... the public on recommendations for developing new or revised safe harbors and Special Fraud Alerts...

  10. 33 CFR 207.580 - Buffalo Harbor, N.Y.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y.; use, administration, and navigation. 207.580 Section 207.580 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.580 Buffalo Harbor, N.Y.; use...

  11. Telemetry data from satellite tags deployed on harbor seals in Cook Inlet, Alaska

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Between 2004 and 2006 we conducted four harbor seal tagging trips in Cook Inlet during the months of October and May. In total, we captured and released 93 harbor...

  12. 77 FR 76434 - Solicitation of New Safe Harbors and Special Fraud Alerts

    Science.gov (United States)

    2012-12-28

    ... statute (section 1128B(b) of the Social Security Act), as well as developing new OIG Special Fraud Alerts... of New Safe Harbors and Special Fraud Alerts AGENCY: Office of Inspector General (OIG), HHS. ACTION... revised safe harbors and Special Fraud Alerts. Please assist us by referencing the file code OIG-121-N...

  13. 78 FR 78807 - Solicitation of New Safe Harbors and Special Fraud Alerts

    Science.gov (United States)

    2013-12-27

    ... statute (section 1128B(b) of the Social Security Act), as well as developing new OIG Special Fraud Alerts... of New Safe Harbors and Special Fraud Alerts AGENCY: Office of Inspector General (OIG), HHS. ACTION... revised safe harbors and Special Fraud Alerts. Please assist us by referencing the file code OIG-122-N...

  14. 33 CFR 165.754 - Safety Zone: San Juan Harbor, San Juan, PR.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: San Juan Harbor, San Juan, PR. 165.754 Section 165.754 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Zone: San Juan Harbor, San Juan, PR. (a) Regulated area. A moving safety zone is established in the...

  15. Respiratory properties of blood in the harbor porpoise, Phocoena phocoena

    DEFF Research Database (Denmark)

    Soegaard, Lisette B; Hansen, Marie N; van Elk, Cornelis

    2012-01-01

    Harbor porpoises are active divers that exchange O(2) and CO(2) with the environment during a fast single breath upon surfacing. We investigated blood O(2)-transporting properties, buffer characteristics, Cl(-) transport via the erythrocyte anion exchanger (AE1), circulating nitric oxide metaboli......Harbor porpoises are active divers that exchange O(2) and CO(2) with the environment during a fast single breath upon surfacing. We investigated blood O(2)-transporting properties, buffer characteristics, Cl(-) transport via the erythrocyte anion exchanger (AE1), circulating nitric oxide....... The true plasma non-bicarbonate buffer value was moderately higher than in terrestrial mammals and increased upon deoxygenation. Plasma bicarbonate was also relatively high, contributing to increase the overall buffer capacity. The apparent Cl(-) permeability of harbor porpoise erythrocytes was similar......, plasma nitrate and hemoglobin-mediated nitrite reduction were elevated compared with mammalian standards, suggesting that increased nitric oxide bioavailability and nitrite-derived nitric oxide could play important roles in diving physiology....

  16. Civilian Reuse of Former Military Bases. Summary of Completed Military Base Economic Adjustment Projects

    Science.gov (United States)

    1990-06-01

    Theodore Army Terminal 1965 (-) Unde, deal Basic Industries, Chamber of Commerce . P.O. Box 2187 Mobile Paint Mfg Co, Hula, Taylor- Mobile. AL 36652 Wharton...585 650 Sidney Warehousing Activities, 300(C) Anita Pennel, Chamber of Commerce . Sioux Army Depot 1967 (2) Western Nebraska Community College, Sidney...Inc. Laurel Oaks Vo-Tech, 600(S) Wilmington Area Chamber of Commerce Industrial Park, Hydro-Lift Trucks, 69 North South Street Southern State Community

  17. Evaluation of Sediment Contamination in Pearl Harbor

    Science.gov (United States)

    1992-06-01

    ancient Hawaiians, was a large natural inland lagoon. Numerous walled fishponds located inside the harbor were used to cultivate various species of fishes... Ecotoxicology , Commission on Natural Resources, National Academy Press, Washington, D.C., 103 pp. National Research Council, 1989. Contaminated Marine

  18. Pearl Harbor bombing attack: a contamination legacy revealed in the sedimentary record

    International Nuclear Information System (INIS)

    Ashwood, T.L.; Olsen, C.R.

    1988-01-01

    Sediment cores collected from Middle Loch and West Loch of Pearl Harbor were dated using fallout 137 Cs and excess 210 Pb and analysed for several major elements and trace metals. Results indicate that sediment deposited immediately following the 7 December, 1941, bombing attack on Pearl Harbor contained elevated levels of several trace metals. (author)

  19. Environmental space management in the harbor of Amsterdam, Netherlands; Milieuruimtemanagement haven Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Klok, L.; Hulskotte, J. [TNO Built Environment and Geosciences, Den Haag (Netherlands); Van Breemen, T. [Haven Amsterdam, Amsterdam (Netherlands)

    2012-02-15

    A new calculation tool will quickly offer the Harbor of Amsterdam insight in the effect of activities in the harbor on the air quality and hence the available environmental space. [Dutch] Een nieuw rekeninstrument geeft Haven Amsterdam snel inzicht in het effect van alle activiteiten in de haven op de luchtkwaliteit en daarmee in de beschikbare milieuruimte.

  20. Pearl Harbor bombing attack: a contamination legacy revealed in the sedimentary record

    Energy Technology Data Exchange (ETDEWEB)

    Ashwood, T.L.; Olsen, C.R.

    1988-02-01

    Sediment cores collected from Middle Loch and West Loch of Pearl Harbor were dated using fallout /sup 137/Cs and excess /sup 210/Pb and analysed for several major elements and trace metals. Results indicate that sediment deposited immediately following the 7 December, 1941, bombing attack on Pearl Harbor contained elevated levels of several trace metals.

  1. Army Engineers at Pearl Harbor

    Science.gov (United States)

    2011-01-01

    siblings, he was the grandson of David Belden Lyman—a Christian missionary from New England who settled in the Hilo , Hawaii area—and the descendent of...of Hawaii appeared over Oahu. Some headed for Ameri- can warships at Pearl Harbor and the planes on the ground at nearby Hickam Field; oth- ers...hit Schofield Barracks, Wheeler Field, and Bellows Field. USACE in Hawaii con- sisted of Soldier-engineers in the Army’s Hawaiian Depart- ment and

  2. Multivariate analysis of heavy metal contaminations in seawater and sediments from a heavily industrialized harbor in Southern Taiwan

    International Nuclear Information System (INIS)

    Lin, Yung-Chang; Chang-Chien, Guo-Ping; Chiang, Pen-Chi; Chen, Wei-Hsiang; Lin, Yuan-Chung

    2013-01-01

    Highlights: • Kaohsiung Harbor is the largest international commercial port in Taiwan. • The metal distributions in the seawater and sediments were investigated. • Many metals exhibited higher levels of enrichment inside the harbor. • Multivariate statistical analysis was used to characterize the metal pollutions. • Two complex arrays of contamination behaviors exist inside and outside the harbor. -- Abstract: Heavy metal pollution, including chromium, zinc, arsenic, cadmium, mercury, copper, lead, and aluminum, in the largest industrial harbor in southern Taiwan was investigated. Increasing metal contamination was observed by monitoring heavy metal concentrations in seawater and sediments and estimating the enrichment factors, particularly those inside the harbor. Compared to other metal-polluted harbors worldwide, the presence of chromium in the sediments was relatively high. Excluding the background contribution, the harbor area was polluted by outflows from river mouths, wastewater discharging pipes, and point sources near industrial activities within the harbor. It is shown by principal component and cluster analyses that metal contamination was affected by a wide range of different and complex contamination mechanisms inside and outside the harbor, suggesting managing the pollution using straightforward strategies, i.e., solutions that only consider a single source or single pathway of metal emissions, is problematic

  3. The hearing threshold of a harbor porpoise (Phocoena phocoena) for impulsive sounds (L)

    NARCIS (Netherlands)

    Kastelein, R.A.; Gransier, R.; Hoek, L.; Jong, C.A.F. de

    2012-01-01

    The distance at which harbor porpoises can hear underwater detonation sounds is unknown, but depends, among other factors, on the hearing threshold of the species for impulsive sounds. Therefore, the underwater hearing threshold of a young harbor porpoise for an impulsive sound, designed to mimic a

  4. Effects of Harbor Modification on Crescent City, California's Tsunami Vulnerability

    Science.gov (United States)

    Dengler, Lori; Uslu, Burak

    2011-06-01

    More damaging tsunamis have impacted Crescent City, California in historic times than any other location on the West Coast of the USA. Crescent City's harbor has undergone significant modification since the early 20th century, including construction of several breakwaters, dredging, and a 200 × 300 m2 small boat basin. In 2006, a M w 8.3 earthquake in the Kuril Islands generated a moderate Pacific-wide tsunami. Crescent City recorded the highest amplitudes of any tide gauge in the Pacific and was the only location to experience structural damage. Strong currents damaged docks and boats within the small boat basin, causing more than US 20 million in damage and replacement costs. We examine how modifications to Crescent City's harbor may have affected its vulnerability to moderate tsunamis such as the 2006 event. A bathymetric grid of the basin was constructed based on US Army Corps of Engineers soundings in 1964 and 1965 before the construction of the small boat basin. The method of splitting tsunamis was used to estimate tsunami water heights and current velocities at several locations in the harbor using both the 1964-1965 grid and the 2006 bathymetric grid for the 2006 Kuril event and a similar-sized source along the Sanriku coast of Japan. Model velocity outputs are compared for the two different bathymetries at the tide gauge location and at six additional computational sites in the harbor. The largest difference between the two grids is at the small boat basin entrance, where the 2006 bathymetry produces currents over three times the strength of the currents produced by the 1965 bathymetry. Peak currents from a Sanriku event are comparable to those produced by the 2006 event, and within the boat basin may have been higher. The modifications of the harbor, and in particular the addition of the small boat basin, appear to have contributed to the high current velocities and resulting damage in 2006 and help to explain why the 1933 M w 8.4-8.7 Sanriku tsunami

  5. 75 FR 4693 - Drawbridge Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA

    Science.gov (United States)

    2010-01-29

    ... Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA AGENCY: Coast Guard, DHS. ACTION... C. Simon) Bascule Bridge across the Inner Harbor Navigational Canal, mile 4.6, at New Orleans, LA... Ochsner Ironman 70.3 New Orleans event. This deviation allows the bridge to remain closed during the event...

  6. Extrachromosomal deoxyribonucleic acid in R factor-harboring Enterobacteriaceae

    DEFF Research Database (Denmark)

    Møller, JK; Bak, AL; Christiansen, C

    1976-01-01

    Extrachromosomal deoxyribonucleic acid (DNA) from 24 different R factor-harboring Enterobacteriaceae was isolated and characterized by analytical ultracentrifugation and electron microscopy. The R factors represented 15 different patterns of transferable drug resistance found in enterobacteria from...

  7. 77 FR 46285 - Drawbridge Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA

    Science.gov (United States)

    2012-08-03

    ... Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA AGENCY: Coast Guard, DHS. ACTION... Navigational Canal, mile 3.1, at New Orleans, LA. The deviation is necessary to replace the wire rope lifting... of the US 90 (Danzinger) Bridge across the Inner Harbor Navigational Canal, mile 3.1, at New Orleans...

  8. 33 CFR 207.600 - Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation. 207.600 Section 207.600 Navigation and Navigable Waters CORPS OF... (Charlotte) Harbor, N.Y.; use, administration, and navigation. (a)-(b) [Reserved] (c) No vessel shall moor or...

  9. Native South American genetic structure and prehistory inferred from hierarchical modeling of mtDNA.

    Science.gov (United States)

    Lewis, Cecil M; Long, Jeffrey C

    2008-03-01

    Genetic diversity in Native South Americans forms a complex pattern at both the continental and local levels. In comparing the West to the East, there is more variation within groups and smaller genetic distances between groups. From this pattern, researchers have proposed that there is more variation in the West and that a larger, more genetically diverse, founding population entered the West than the East. Here, we question this characterization of South American genetic variation and its interpretation. Our concern arises because others have inferred regional variation from the mean variation within local populations without taking into account the variation among local populations within the same region. This failure produces a biased view of the actual variation in the East. In this study, we analyze the mitochondrial DNA sequence between positions 16040 and 16322 of the Cambridge reference sequence. Our sample represents a total of 886 people from 27 indigenous populations from South (22), Central (3), and North America (2). The basic unit of our analyses is nucleotide identity by descent, which is easily modeled and proportional to nucleotide diversity. We use a forward modeling strategy to fit a series of nested models to identity by descent within and between all pairs of local populations. This method provides estimates of identity by descent at different levels of population hierarchy without assuming homogeneity within populations, regions, or continents. Our main discovery is that Eastern South America harbors more genetic variation than has been recognized. We find no evidence that there is increased identity by descent in the East relative to the total for South America. By contrast, we discovered that populations in the Western region, as a group, harbor more identity by descent than has been previously recognized, despite the fact that average identity by descent within groups is lower. In this light, there is no need to postulate separate founding

  10. Ice Harbor Spillway Dissolved Gas Field Studies: Before and After Spillway Deflectors

    Science.gov (United States)

    2016-07-01

    Steven C. Wilhelms Coastal And Hydraulics Laboratory U.S. Army Engineer Research and Development Center 3909 Halls Ferry Road Vicksburg, Mississippi...Harbor as a measure to reduce the total dissolved gas (TDG) production during spill operations. Three field studies were conducted at the Ice Harbor...significantly reduced for nearly all spill operations with deflectors in place. TDG near the stilling basin was reduced from approximately 150% to

  11. Grays Harbor Paper

    Energy Technology Data Exchange (ETDEWEB)

    Quigg, B. [Grays Harbor Paper, Hoquiam, WA (United States)

    2009-07-01

    Wood waste biomass boilers are used at Grays Harbor Paper in Hoquiam, Washington. This presentation showed that large volumes of biomass are left after a traditional clearcut. The opportunities and challenges of collecting branches, tops and stumps from this wet coastal climate were outlined. The paper described some of the low-tech methods for picking up branches, stumps and woody debris. It included several photographs of custom logging machines for timber harvest, including a brush grapple slasher, a shearer shovel, chippers, grinders, slicesaws, trucks, trailers and caterpillar log loaders for handling slash. The slash recovery program relies on innovative harvesting machines that convert scattered logging slash into bundles that can be easily collected, transported, and stored for use in existing facilities that utilize wood fiber for fuel. figs.

  12. Towards an ethics safe harbor for global biomedical research

    Science.gov (United States)

    Dove, Edward S.; Knoppers, Bartha M.; Zawati, Ma'n H.

    2014-01-01

    Although increasingly global, data-driven genomics and other ‘omics’-focused research hold great promise for health discoveries, current research ethics review systems around the world challenge potential improvements in human health from such research. To overcome this challenge, we propose a ‘Safe Harbor Framework for International Ethics Equivalency’ that facilitates the harmonization of ethics review of specific types of data-driven international research projects while respecting globally transposable research ethics norms and principles. The Safe Harbor would consist in part of an agency supporting an International Federation for Ethics Review (IFER), formed by a voluntary compact among countries, granting agencies, philanthropies, institutions, and healthcare, patient advocacy, and research organizations. IFER would be both a central ethics review body, and also a forum for review and follow-up of policies concerning ethics norms for international research projects. It would be built on five principle elements: (1) registration, (2) compliance review, (3) recognition, (4) monitoring and enforcement, and (5) public participation. The Safe Harbor would create many benefits for researchers, countries, and the general public, and may eventually have application beyond (gen)omics to other areas of biomedical research that increasingly engage in secondary use of data and present only negligible risks. PMID:27774154

  13. Bioaccumulation of polychlorinated biphenyls and organochlorine pesticides in young-of-the-year bluefish (Pomatomus saltatrix) in the vicinity of a Superfund Site in New Bedford Harbor, Massachusetts, and in the adjacent waters.

    Science.gov (United States)

    Deshpande, Ashok D; Dockum, Bruce W; Cleary, Thomas; Farrington, Cameron; Wieczorek, Daniel

    2013-07-15

    Spatial gradients of polychlorinated biphenyls (PCBs) and organochlorine pesticides were examined in the young-of-the-year (YOY) bluefish (Pomatomus saltatrix) in the vicinity of a PCB Superfund Site in New Bedford Harbor, Massachusetts, and in the adjacent waters. PCB concentrations in bluefish varied between different locations, and also among fish from a given location. A generally decreasing gradient in PCB concentrations was evident as the bluefish were collected away from the Superfund Site. The average sum of PCB concentrations were highest for bluefish collected in the Upper Harbor between Interstate-195 Bridge and Coggeshall Street Bridge (Upper Harbor), followed by bluefish in Lower Harbor from north of Popes Island Bridge (Lower Harbor), and bluefish from Outer Harbor south of Hurricane Barrier (Outer Harbor). The levels of PCBs in bluefish from Clarks Cove and PCBs in bluefish from Buzzards Bay were similar and lowest among all bluefish specimens analyzed in the present study. Pesticide concentrations were about one order of magnitude or lower than the PCB concentrations, and the gradient of pesticide concentrations generally followed the gradient of PCB concentrations. Some of the commonly detected pesticides in the order of decreasing concentrations included DDTs and metabolites, heptachlor epoxide, endosulfan sulfate, and α-chlordane. Distribution of PCBs and organochlorine pesticides were examined in the tissues of YOY bluefish from Clarks Cove. PCBs and lipids in the brain samples of YOY bluefish were generally numerically greater than PCBs in the liver samples, but these differences were not statistically significant. PCBs and lipids in hypaxial muscle samples were numerically greater than PCBs in epaxial muscle samples, although these two groups of tissues were not statistically different. Despite the higher susceptibility of lighter PCB homologs to geophysical and biogeochemical weathering processes, the relative dominance of lighter homologs

  14. 77 FR 67563 - Regulated Navigation Area-New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT; Pearl...

    Science.gov (United States)

    2012-11-13

    ... 1625-AA11 Regulated Navigation Area--New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT... Haven Harbor, Quinnipiac River and Mill River. The current RNA pertains only to the operation of tugs...) entitled Regulated Navigation Area--New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT; Pearl...

  15. A smart ROV solution for ship hull and harbor inspection

    Science.gov (United States)

    Reed, Scott; Wood, Jon; Vazquez, Jose; Mignotte, Pierre-Yves; Privat, Benjamin

    2010-04-01

    Hull and harbor infrastructure inspections are frequently performed manually and involve quite a bit of risk and human and monetary resources. In any kind of threat and resource constrained environment, this involves unacceptable levels of risk and cost. Modern Remotely Operated Vehicles are highly refined machines that provide features and capabilities previously unavailable. Operations once carried out by divers can now be carried out more quickly, efficiently and safely by smart enabled ROVs. ROVs are rapidly deployable and capable of continuous, reliable operations in adverse conditions. They also provide a stable platform on which multiple sensors may be mounted and utilized to meet the harbor inspection problem. Automated Control software provides ROV's and their pilots with the capability to inspect complex, constrained environments such as those found in a harbor region. This application and the user interface allow the ROV to automatically conduct complex maneuvers relative to the area being inspected and relieves the training requirements and work load for the pilot, allowing he or she to focus on the primary task of survey, inspection and looking for possible threats (such as IEDs, Limpet Mines, signs of sabotage, etc). Real-time sensor processing tools can be integrated into the smart ROV solution to assist the operator. Automatic Target Recognition (ATR) algorithms are used to search through the sensor data collected by the ROV in real time. These algorithms provide immediate feedback on possible threats and notify the operator of regions that may require manual verification. Sensor data (sonar or video) is also mosaiced, providing the operator with real-time situational awareness and a coverage map of the hull or seafloor. Detected objects may also be placed in the context of the large scale characteristics of the hull (or bottom or pilings) and localized. Within the complex areas such as the harbor pier pilings and the running gear of the ship, real

  16. Summary of oceanographic and water–quality measurements in West Falmouth Harbor and Buzzards Bay, Massachusetts, 2009–2010

    Science.gov (United States)

    Ganju, Neil K.; Dickhudt, Patrick J.; Thomas, Jennifer A.; Borden, Jonathan; Sherwood, Christopher R.; Montgomery, Ellyn T.; Twomey, Erin R.; Martini, Marinna A.

    2011-01-01

    This data report presents oceanographic and water-quality observations made at six locations in West Falmouth Harbor and Buzzards Bay, Massachusetts, from August 2009 to September 2010. Both Buzzards Bay and West Falmouth Harbor are estuarine embayments; the input of freshwater on the eastern margin of Buzzards Bay adjacent to Cape Cod and West Falmouth Harbor is largely due to groundwater. In West Falmouth Harbor, the groundwater that seeps into the harbor is characterized by relatively high levels of nitrate. This high nitrate load has modified the ecology of the harbor (Howes and others, 2006) and may be a significant source of nitrate to Buzzards Bay during seasons with low biological nitrate uptake. The U.S. Geological Survey undertook these measurements to improve understanding of circulation, residence time, and water quality in the harbor and bay. We set up and monitored multiple sites in both Buzzards Bay and West Falmouth Harbor, measuring depth, water velocity,salinity, pH, dissolved oxygen, chlorophyll-a, and nitrate concentration. In this report we present the processed time-series data at these locations and provide access to the data and metadata. The results will be used to understand circulation mechanisms and verify numerical models of hydrodynamics and biogeochemistry.

  17. 75 FR 76613 - National Pearl Harbor Remembrance Day, 2010

    Science.gov (United States)

    2010-12-09

    .... The deadly attack on Pearl Harbor did not accomplish its mission of breaking the American spirit..., aiding the war effort by working in manufacturing plants, participating in rationing programs, or...

  18. Specific and Efficient Regression of Cancers Harboring KRAS Mutation by Targeted RNA Replacement.

    Science.gov (United States)

    Kim, Sung Jin; Kim, Ju Hyun; Yang, Bitna; Jeong, Jin-Sook; Lee, Seong-Wook

    2017-02-01

    Mutations in the KRAS gene, which persistently activate RAS function, are most frequently found in many types of human cancers. Here, we proposed and verified a new approach against cancers harboring the KRAS mutation with high cancer selectivity and efficient anti-cancer effects based on targeted RNA replacement. To this end, trans-splicing ribozymes from Tetrahymena group I intron were developed, which can specifically target and reprogram the mutant KRAS G12V transcript to induce therapeutic gene activity in cells. Adenoviral vectors containing the specific ribozymes with downstream suicide gene were constructed and then infection with the adenoviruses specifically downregulated KRAS G12V expression and killed KRAS G12V-harboring cancer cells additively upon pro-drug treatment, but it did not affect the growth of wild-type KRAS-expressing cells. Minimal liver toxicity was noted when the adenoviruses were administered systemically in vivo. Importantly, intratumoral injection of the adenoviruses with pro-drug treatment specifically and significantly impeded the growth of xenografted tumors harboring KRAS G12V through a trans-splicing reaction with the target RNA. In contrast, xenografted tumors harboring wild-type KRAS were not affected by the adenoviruses. Therefore, RNA replacement with a mutant KRAS-targeting trans-splicing ribozyme is a potentially useful therapeutic strategy to combat tumors harboring KRAS mutation. Copyright © 2017 The American Society of Gene and Cell Therapy. Published by Elsevier Inc. All rights reserved.

  19. 78 FR 13479 - Drawbridge Operation Regulation; New Haven Harbor, Quinnipiac and Mill Rivers, CT

    Science.gov (United States)

    2013-02-28

    ...-AA09 Drawbridge Operation Regulation; New Haven Harbor, Quinnipiac and Mill Rivers, CT AGENCY: Coast... regulations that govern the operation of three bridges across the Quinnipiac and Mill Rivers at New Haven...) entitled ``Drawbridge Operation Regulations New Haven Harbor, Quinnipiac and Mill Rivers,'' in the Federal...

  20. A solitary hyperfunctioning thyroid nodule harboring thyroid carcinoma: review of the literature

    OpenAIRE

    Mirfakhraee, Sasan; Mathews, Dana; Peng, Lan; Woodruff, Stacey; Zigman, Jeffrey M

    2013-01-01

    Hyperfunctioning nodules of the thyroid are thought to only rarely harbor thyroid cancer, and thus are infrequently biopsied. Here, we present the case of a patient with a hyperfunctioning thyroid nodule harboring thyroid carcinoma and, using MEDLINE literature searches, set out to determine the prevalence of and characteristics of malignant ?hot? nodules as a group. Historical, biochemical and radiologic characteristics of the case subjects and their nodules were compared to those in cases o...

  1. Caffeine in Boston Harbor past and present, assessing its utility as a tracer of wastewater contamination in an urban estuary

    Science.gov (United States)

    Sites throughout Boston Harbor were analyzed for caffeine to assess its utility as a tracer in identifying sources of sanitary wastewater. Caffeine ranged from 15 ng/L in the outer harbor to a high of 185 ng/L in the inner harbor. Inner harbor concentrations were a result of comb...

  2. Pearl Harbor, Hawaii Tsunami Forecast Grids for MOST Model

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Pearl Harbor, Hawaii Forecast Model Grids provides bathymetric data strictly for tsunami inundation modeling with the Method of Splitting Tsunami (MOST) model....

  3. 76 FR 37005 - Safety Zone; Fan Pier Yacht Club Fireworks, Boston Harbor, Boston, MA

    Science.gov (United States)

    2011-06-24

    ...-AA00 Safety Zone; Fan Pier Yacht Club Fireworks, Boston Harbor, Boston, MA AGENCY: Coast Guard, DHS... Sector Boston Captain of the Port (COTP) Zone for the Fan Pier Yacht Club Fireworks display. This safety... Safety Zone; Fan Pier Yacht Club Fireworks, Boston Harbor, Boston, Massachusetts. (a) General. A...

  4. 33 CFR 110.235 - Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83). 110.235 Section 110.235 Navigation and Navigable Waters COAST... Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83). (a) The anchorage grounds—(1...

  5. 33 CFR 165.708 - Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC.

    Science.gov (United States)

    2010-07-01

    ... Harbor and Cooper River, Charleston, SC. 165.708 Section 165.708 Navigation and Navigable Waters COAST... Guard District § 165.708 Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC. (a... Cooper River. All coordinates referenced use datum: NAD 1983. (2) All waters within 100 yards of the...

  6. 77 FR 42076 - Notice of Opportunity for Public Comment on Surplus Property Release at Hancock County-Bar Harbor...

    Science.gov (United States)

    2012-07-17

    ... Comment on Surplus Property Release at Hancock County-Bar Harbor Airport, Trenton, ME AGENCY: Federal... located at Hancock County-Bar Harbor Airport, Trenton, Maine. DATES: Comments must be received on or... INFORMATION: The Federal Aviation Administration is reviewing a request by Hancock County-Bar Harbor Airport...

  7. Hydrocarbon pollutants shape bacterial community assembly of harbor sediments

    KAUST Repository

    Barbato, Marta; Mapelli, Francesca; Magagnini, Mirko; Chouaia, Bessem; Armeni, Monica; Marasco, Ramona; Crotti, Elena; Daffonchio, Daniele; Borin, Sara

    2016-01-01

    Petroleum pollution results in co-contamination by different classes of molecules, entailing the occurrence of marine sediments difficult to remediate, as in the case of the Ancona harbor (Mediterranean Sea, Italy). Autochthonous bioaugmentation

  8. Bar Harbor, ME Tsunami Forecast Grids for MOST Model

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Bar Harbor, Maine Forecast Model Grids provides bathymetric data strictly for tsunami inundation modeling with the Method of Splitting Tsunami (MOST) model. MOST...

  9. Submarine Biofouling Control- Chlorination DATS Study at Pearl Harbor

    National Research Council Canada - National Science Library

    Wegand, John

    2001-01-01

    The intent of this document is to sumarize the chlorination studies performed at Naval Station, Pearl Harbor in support of biofouling control initiatives for the submarine community, as requested by NAVSEA 92T...

  10. Apra Harbor, Guam Tsunami Forecast Grids for MOST Model

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Apra Harbor, Guam Forecast Model Grids provides bathymetric data strictly for tsunami inundation modeling with the Method of Splitting Tsunami (MOST) model. MOST...

  11. 77 FR 38490 - Safety Zone; Mentor Harbor Yachting Club Fireworks, Lake Erie, Mentor, OH

    Science.gov (United States)

    2012-06-28

    ...-AA00 Safety Zone; Mentor Harbor Yachting Club Fireworks, Lake Erie, Mentor, OH AGENCY: Coast Guard, DHS... Erie, Mentor, OH. This safety zone is intended to restrict vessels from a portion of Lake Erie during the Mentor Harbor Yachting Club fireworks display. This temporary safety zone is necessary to protect...

  12. A Comprehensive Copper Compliance Strategy: Implementing Regulatory Guidance at Pearl Harbor Naval Shipyard & Intermediate Maintenance Facility

    National Research Council Canada - National Science Library

    Earley, P. J; Rosen, G; Rivera-Duarte, I; Gauthier, R. D; Arias-Thode, Y; Thompson, J; Swope, B

    2007-01-01

    Studies were performed to develop a new National Pollution Discharge Elimination Systems Permit for the discharge of effluents from the Pearl Harbor Naval Shipyard and Intermediate Maintenance Facility into Pearl Harbor...

  13. 76 FR 38302 - Safety Zone; Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA

    Science.gov (United States)

    2011-06-30

    ... the Town of Cape Charles will sponsor a fireworks display on the shoreline of the navigable waters of...-AA00 Safety Zone; Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA AGENCY: Coast Guard... navigable waters of Cape Charles City Harbor in Cape Charles, VA in support of the Fourth of July Fireworks...

  14. 76 FR 71598 - Pearl Harbor National Wildlife Refuge, Honolulu County, HI; Final Comprehensive Conservation Plan...

    Science.gov (United States)

    2011-11-18

    ...] Pearl Harbor National Wildlife Refuge, Honolulu County, HI; Final Comprehensive Conservation Plan and.../docs/HI-PI/docsjcpearl.htm . Email: [email protected] . Include ``Pearl Harbor final CCP'' in...`iwa, HI 96712. FOR FURTHER INFORMATION CONTACT: David Ellis, Project Leader, (808) 637-6330...

  15. Analyzing Approaches to Internet Jurisdiction Based on Model of Harbors and the High Seas

    NARCIS (Netherlands)

    Jiménez, W.G.; Lodder, A.R.

    2015-01-01

    The inherent cross-border nature of the internet has challenged the legal system for over two decades. In this paper we introduce a model in which the internet is approached as if it were the high seas, the harbor of origin, the harbor of destination, or a combination of these. This model is used to

  16. Are federal sustained yield units equitable? A case study of the Grays Harbor unit.

    Science.gov (United States)

    Con H Schallau; Wilbur R. Maki

    1986-01-01

    The Grays Harbor Federal Sustained Yield Unit (U.S. Department of Agriculture, Forest Service) was established in 1949 to enhance the economic stability of the forest products industry and dependent communities in Grays Harbor County, Washington. Provisions of the unit's charter require that all logs harvested from the Quinault Ranger District of the Olympic...

  17. Impact of Geomorphological Changes to Harbor Resonance During Meteotsunamis: The Vela Luka Bay Test Case

    Science.gov (United States)

    Denamiel, Cléa; Šepić, Jadranka; Vilibić, Ivica

    2018-05-01

    In engineering studies, harbor resonance, including quality and amplification factors, is typically computed for swell and waves with periods shorter than 10 min. However, in various locations around the world, such as Vela Luka Bay in Croatia, meteotsunami waves of periods greater than 10 min can excite the bay or harbor natural modes and produce substantial structural damages. In this theoretical study, the impact of some geomorphological changes of Vela Luka Bay—i.e. deepening of the bay, dredging the harbor, adding a pier or a marina—to the amplification of the meteotsunami waves are presented for a set of 6401 idealized pressure wave field forcing used to derive robust statistics. The most substantial increase in maximum elevation is found when the Vela Luka harbor is dredged to a 5 m depth, which is in contradiction with the calculation of the quality factor showing a decrease of the harbor natural resonance. It has been shown that the forcing energy content at different frequency bands should also be taken into account when estimating the quality and amplification factors, as their typical definitions derived from the peak frequency of the sea level spectrum fail to represent the harbor response during meteotsunami events. New definitions of these factors are proposed in this study and are shown to be in good agreement with the results of the statistical analysis of the Vela Luka Bay maximum elevation results. In addition, the presented methodology can easily be applicable to any other location in the world where meteotsunamis occur.

  18. 77 FR 24381 - Security Zone; Passenger Vessel SAFARI EXPLORER Arrival/Departure, Kaunakakai Harbor, Molokai, HI

    Science.gov (United States)

    2012-04-24

    ...-AA87 Security Zone; Passenger Vessel SAFARI EXPLORER Arrival/ Departure, Kaunakakai Harbor, Molokai, HI... channel's entrance during the arrival and departure of the Passenger Vessel Safari Explorer in Kaunakakai... entrance during the arrival and departure of the Passenger Vessel Safari Explorer in Kaunakakai Harbor...

  19. A lifelong journey of moving beyond wartime trauma for survivors from Hiroshima and Pearl Harbor.

    Science.gov (United States)

    Liehr, Patricia; Nishimura, Chie; Ito, Mio; Wands, Lisa Marie; Takahashi, Ryutaro

    2011-01-01

    This study examines 51 stories of health, shared by people who survived the wartime trauma of Hiroshima and Pearl Harbor, seeking to identify turning points that moved participants along over their lifetime. The central turning point for Hiroshima survivors was "becoming Hibabusha (A-bomb survivor)" and for Pearl Harbor survivors was "honoring the memory and setting it aside." Wartime trauma was permanently integrated into survivors' histories, surfacing steadily over decades for Hiroshima survivors and intermittently over decades for Pearl Harbor survivors. Regardless of experience or nationality, participants moved through wartime trauma by connecting with others, pursuing personal and global peace.

  20. Temporal and spatial variation in harbor seal (Phoca vitulina L.) roar calls from southern Scandinavia

    DEFF Research Database (Denmark)

    Sabinsky, Puk Faxe; Larsen, Ole Næsbye; Wahlberg, Magnus

    2017-01-01

    Male harbor seals gather around breeding sites for competitive mating displays. Here, they produce underwater vocalizations possibly to attract females and/or scare off other males. These calls offer prospects for passive acoustic monitoring. Acoustic monitoring requires a good understanding...... of natural variation in calling behavior both temporally and among geographically separate sites. Such variation in call structure and calling patterns were studied in harbor seal vocalizations recorded at three locations in Danish and Swedish waters. There was a strong seasonality in the calls from end...... biological differences when comparing harbor seal roars among recording sites and between years....

  1. Emergence of colistin-resistant Escherichia coli clinical isolates harboring mcr-1 in Vietnam.

    Science.gov (United States)

    Tada, Tatsuya; Nhung, Pham Hong; Shimada, Kayo; Tsuchiya, Mitsuhiro; Phuong, Doan Mai; Anh, Nguyen Quoc; Ohmagari, Norio; Kirikae, Teruo

    2017-10-01

    The mcr-1 was first detected on a plasmid in colistin-resistant Escherichia coli from livestock and patients in China. We described here the emergence of colistin-resistant E. coli clinical isolates harboring mcr-1 on the chromosomes in Vietnam. To our knowledge, this is the first report of hospital-acquired E. coli isolates harboring mcr-1 in a medical setting in Vietnam. Copyright © 2017. Published by Elsevier Ltd.

  2. Numerical Modeling of Wave Overtopping of Buffalo Harbor Confined Disposal Facility (CDF4)

    Science.gov (United States)

    2017-10-01

    navigation channel , and harbor complex. Though there are anecdotal claims and debris indicating possible sediment movement, there has been no evidence of...littoral sediments inside the disposal area, into the channel and harbor, and other adjacent areas to the CDF4. 1.4 Study plan 1.4.1 Purpose There...locations. 2.4 Maintenance dredging data The need for maintenance dredging arises from sedimentation in the navigation channels , which impedes

  3. An Evaluation of the Acquisition Streamlining Methods at the Fleet and Industrial Supply Center Pearl Harbor Hawaii

    National Research Council Canada - National Science Library

    Henry, Mark

    1999-01-01

    ...) Pearl Harbor's implementation of acquisition streamlining initiatives and recommends viable methods of streamlining the acquisition process at FISC Pearl Harbor and other Naval Supply Systems Command...

  4. Quantitative Measures of Anthropogenic Noise on Harbor Porpoises

    DEFF Research Database (Denmark)

    Wisniewska, Danuta Maria; Teilmann, Jonas; Hermannsen, Line

    2016-01-01

    -animal recordings as proxies for actual exposure. Here, we quantify sound exposure levels recorded with a DTAG-3 tag on a captive harbor porpoise exposed to vessel noise in a controlled acoustic environment. Results show that fl ow noise is limiting onboard noise recordings, whereas no evidence of body shading has...

  5. 77 FR 2019 - Security Zone; Passenger Vessel SAFARI EXPLORER Arrival/Departure, Kaunakakai Harbor, Molokai, HI

    Science.gov (United States)

    2012-01-13

    ...-AA87 Security Zone; Passenger Vessel SAFARI EXPLORER Arrival/ Departure, Kaunakakai Harbor, Molokai, HI... vessel SAFARI EXPLORER to its intended berth in the harbor. Entry into the temporary security zone is... operation of the SAFARI EXPLORER into Molokai has been voluntarily suspended by the operating company...

  6. 78 FR 19632 - Special Local Regulations; St. Thomas Carnival Watersport Activities, Charlotte Amalie Harbor; St...

    Science.gov (United States)

    2013-04-02

    ...-AA08 Special Local Regulations; St. Thomas Carnival Watersport Activities, Charlotte Amalie Harbor; St... proposes to establish a special local regulation on the waters of Charlotte Amalie Harbor in St Thomas, USVI during the St. Thomas Carnival Watersport Activities, a high speed boat race. The event is...

  7. Nonindigenous Freshwater and Estuarine Species Introductions and their Potential to Affect Sportfishing in the Lower Stream and Estuarine Regions of the South and West Shores of Oahu, Hawaii: Data from 1998-1999 (NODC Accession 0001116)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Surveys of native and non-indigenous species along the south and west shores of Oahu (excluding Pearl Harbor) were funded by a grant from the David and Lucile...

  8. Analysis of Protection Measures for Naval Vessels Berthed at Harbor Against Terrorist Attacks

    Science.gov (United States)

    2016-06-01

    of discriminating neutral vessels from threats. A naval vessel berthed at harbor is more susceptible to attack than a vessel in open seas. The...discriminating neutral vessels from threats. A naval vessel berthed at harbor is more susceptible to attack than a vessel in open seas. The chances of...this thesis. He was a source of inspiration, encouragement, and reassurance. Captain Jeffery E. Kline, I am really thankful to you for your ideas

  9. Cladophora (Chlorophyta) spp. Harbor Human Bacterial Pathogens in Nearshore Water of Lake Michigan†

    OpenAIRE

    Ishii, Satoshi; Yan, Tao; Shively, Dawn A.; Byappanahalli, Muruleedhara N.; Whitman, Richard L.; Sadowsky, Michael J.

    2006-01-01

    Cladophora glomerata, a macrophytic green alga, is commonly found in the Great Lakes, and significant accumulations occur along shorelines during the summer months. Recently, Cladophora has been shown to harbor high densities of the fecal indicator bacteria Escherichia coli and enterococci. Cladophora may also harbor human pathogens; however, until now, no studies to address this question have been performed. In the present study, we determined whether attached Cladophora, obtained from the L...

  10. Case study of small harbor excitation under storm and tsunami conditions

    Science.gov (United States)

    Synolakis, Costas; Maravelakis, Nikos; Kalligeris, Nikos; Skanavis, Vassilios; Kanoglu, Utku; Yalciner, Ahmet; Lynett, Pat

    2016-04-01

    Simultaneous nearshore and interior-to-ports wave and current measurements for small ports are not common, and few, if any, benchmarking cases at sufficient resolution exist to help validate numerical model of intermediate waves, or even long waves. The wave conditions inside the old Venetian harbor of Chania, Greece and offshore were measured and studied from 2012 to 2015. The construction of this harbor began in the 14th century, and since then, its layout has been modified to adapt to different social and to economic conditions. It is divided into a western and an eastern basin. The eastern basin is used by recreational vessels and fishing boats throughout the year. The western basin has an exposed entrance to the north, and it is essentially functional half of the year, because of the severe overtopping and flooding that occur during the northern winter storms. Our work is motivated by the necessity to protect the monument from severe winter storm conditions and allow safe mooring and all other recreational activities that take place in the exposed western basin. Two earlier studies had proposed the construction of a low crested breakwater near the harbor entrance. The first design has been partially constructed, while the second never materialized. The main disadvantage of both studies was the lack of any wave field measurements. At the same time, second order or complimentary phenomena such as harbor resonance had not been considered. To address the lack of field data, the offshore wave climate has been monitored since October 2012 using an AWAC 600kHz instrument, deployed at 23m depth. The response of the western and eastern basins of the harbor was measured with a TWR-2050 (deployed at 5.5m depth) and an RBRDuet T.D./wave (deployed at 2m depth) pressure gauges respectively. Significant wave heights ranging up to 5.8 m with significant periods of up to 10 sec were measured. The harbor pressure gauges are now being re-deployed in other locations to collect

  11. Calculating background levels for ecological risk parameters in toxic harbor sediment

    Science.gov (United States)

    Leadon, C.J.; McDonnell, T.R.; Lear, J.; Barclift, D.

    2007-01-01

    Establishing background levels for biological parameters is necessary in assessing the ecological risks from harbor sediment contaminated with toxic chemicals. For chemicals in sediment, the term contaminated is defined as having concentrations above background and significant human health or ecological risk levels. For biological parameters, a site could be considered contaminated if levels of the parameter are either more or less than the background level, depending on the specific parameter. Biological parameters can include tissue chemical concentrations in ecological receptors, bioassay responses, bioaccumulation levels, and benthic community metrics. Chemical parameters can include sediment concentrations of a variety of potentially toxic chemicals. Indirectly, contaminated harbor sediment can impact shellfish, fish, birds, and marine mammals, and human populations. This paper summarizes the methods used to define background levels for chemical and biological parameters from a survey of ecological risk investigations of marine harbor sediment at California Navy bases. Background levels for regional biological indices used to quantify ecological risks for benthic communities are also described. Generally, background stations are positioned in relatively clean areas exhibiting the same physical and general chemical characteristics as nearby areas with contaminated harbor sediment. The number of background stations and the number of sample replicates per background station depend on the statistical design of the sediment ecological risk investigation, developed through the data quality objective (DQO) process. Biological data from the background stations can be compared to data from a contaminated site by using minimum or maximum background levels or comparative statistics. In Navy ecological risk assessments (ERA's), calculated background levels and appropriate ecological risk screening criteria are used to identify sampling stations and sites with contaminated

  12. 77 FR 67345 - Final Environmental Impact Statement/Environmental Impact Report (EIS/EIR) for the Clearwater...

    Science.gov (United States)

    2012-11-09

    ...The U.S. Army Corps of Engineers (Corps) in conjunction with the Sanitation Districts of Los Angeles County (Sanitation Districts) has completed a Final Environmental Impact Statement/Environmental Impact Report (EIS/EIR) for the Clearwater Program. The Clearwater Program is a comprehensive planning effort undertaken by the Sanitation Districts for the Joint Outfall System, a regional wastewater management system serving approximately 4.8 million people in 73 cities and unincorporated areas in Los Angeles County. A major component of the Clearwater Program is the evaluation of alternatives for construction of a new ocean outfall and rehabilitation of the existing ocean outfalls. Both activities would entail discharge of dredged and fill material in waters of the United States, work in navigable waters of the United States, and the transport of dredged material for ocean disposal. These activities would require authorization from the Corps pursuant to Section 404 of the Clean Water Act, Section 10 of the Rivers and Harbors Act, and Section 103 of the Marine Protection, Research, and Sanctuaries Act, respectively. The Draft EIS/EIR was circulated for a 57-day review period from February 13, 2012 through April 10, 2012. The Corps and the Sanitation Districts reviewed and provided responses to 19 agency comments and 33 public comments in preparing the Final EIS/EIR. The Final EIS/EIR, including a Draft 404(b)(1) alternatives analysis, is available for a 31-day review period from November 9, 2012 through December 10, 2012. The document is accessible via the World- Wide Web at www.ClearwaterProgram.org. Alternatively, printed copies are available at the following locations: Sanitation Districts of Los Angeles County, 1955 Workman Mill Road, Whittier, California; Carson Regional Library, 151 East Carson Street, Carson, California; Los Angeles Public Library, San Pedro Branch, 931 South Gaffey Street, San Pedro, California; and Los Angeles Public Library, Wilmington

  13. U.S. Department of Defense - Pearl Harbor Special

    Science.gov (United States)

    Hawaii saw that seminal moment in history, and those that were there vividly remember that Sunday morning this noise," he said in an oral history on the Pearl Harbor Survivors' Association Web site. " seeing was an attack. "It didn't mean anything to us until a large group of planes came near the

  14. The Plurality of Harbors at Caesarea: The Southern Anchorage in Late Antiquity

    Science.gov (United States)

    Ratzlaff, Alexandra; Galili, Ehud; Waiman-Barak, Paula; Yasur-Landau, Assaf

    2017-08-01

    The engineering marvel of Sebastos, or Portus Augusti as it was called in Late Antiquity (284-638 CE), dominated Caesarea's harbor center along modern Israel's central coast but it was only one part of a larger maritime complex. The Southern Anchorage provides a case study as one portion of the Caesarea complex, as well as a node within the regional network of anchorages and small harbors. Ceramics recovered from here show a high percentage of locally, and provincially, produced storage jars engaged in maritime trade. The ceramic evidence points towards an intensified regional trade or cabotage rather than favouring long distance trade from large port to port. Working out of these small harbors, opportunities arose for greater flexibility in specialization of commodities and materials passing through the network of subsidiary ports, contributing to a more diversified market economy. This analysis provides another example in the growing focus on how these simple and semi-modified anchorages in the Eastern Mediterranean were often the predominant economic networks connecting hinterland and coastal trade.

  15. Length-weight relationship of northern pike, Esox lucius, from East Harbor, Ohio

    Science.gov (United States)

    Brown, Edward H.; Clark, Clarence F.

    1965-01-01

    The northern pike is one of Ohio's largest game fish but is well known to comparatively few anglers. Large numbers of the big fish spawn in the Ohio marshes adjacent to Lake Erie. Movements related to spawning reach a peak in late March or early April. Later the spawning population disperses and is seldom represented in catches by experimental gear or by anglers. The short period of availability was used to obtain life history information in March of 1951 through 1953. No comprehensive length-weight data for this species have previously been published from this area. East Harbor is a sandspit pond separated from Lake Erie by a large sand bar. Waters and fish populations of the harbor and lake can mix freely through a permanent connecting channel. The larger part of the 850 surface acres of the harbor is normally less than 8 feet deep. The male northern pike averaged 20.5 inches in length and ranged from 13.5 to 28.5 inches. The conspicuously larger females averaged 26.0 inches and ranged from 15.5 to 37.5 inches.

  16. 77 FR 60109 - Takes of Marine Mammals Incidental to Specified Activities; Harbor Activities Related to the...

    Science.gov (United States)

    2012-10-02

    ...; and Northern elephant seals by Level B harassment only. To date, we have issued nine, 1-year... numbers of marine mammals, incidental to conducting Delta Mariner harbor operations for one year. We... California sea lions (Zalophus californianus), Pacific harbor seals (Phoca vitulina), and Northern elephant...

  17. Curbing stem cell tourism in South Africa.

    Science.gov (United States)

    Meissner-Roloff, Madelein; Pepper, Michael S

    2013-12-01

    Stem cells have received much attention globally due in part to the immense therapeutic potential they harbor. Unfortunately, malpractice and exploitation (financial and emotional) of vulnerable patients have also drawn attention to this field as a result of the detrimental consequences experienced by some individuals that have undergone unproven stem cell therapies. South Africa has had limited exposure to stem cells and their applications and, while any exploitation is detrimental to the field of stem cells, South Africa is particularly vulnerable in this regard. The current absence of adequate legislation and the inability to enforce existing legislation, coupled to the sea of misinformation available on the Internet could lead to an increase in illegitimate stem cell practices in South Africa. Circumstances are already precarious because of a lack of understanding of concepts involved in stem cell applications. What is more, credible and easily accessible information is not available to the public. This in turn cultivates fears born out of existing superstitions, cultural beliefs, rituals and practices. Certain cultural or religious concerns could potentially hinder the effective application of stem cell therapies in South Africa and novel ways of addressing these concerns are necessary. Understanding how scientific progress and its implementation will affect each individual and, consequently, the community, will be of cardinal importance to the success of the fields of stem cell therapy and regenerative medicine in South Africa. A failure to understand the ethical, cultural or moral ramifications when new scientific concepts are introduced could hinder the efficacy and speed of bringing discoveries to the patient. Neglecting proper procedure for establishing the field would lead to long delays in gaining public support in South Africa. Understanding the dangers of stem cell tourism - where vulnerable patients are subjected to unproven stem cell therapies that

  18. Sediment quality in Burlington Harbor, Lake Champlain, U.S.A.

    Science.gov (United States)

    Lacey, E.M.; King, J.W.; Quinn, J.G.; Mecray, E.L.; Appleby, P.G.; Hunt, A.S.

    2001-01-01

    Surface samples and cores were collected in 1993 from the Burlington Harbor region of Lake Champlain. Sediment samples were analyzed for trace metals (cadmium, copper, lead, nickel, silver and zinc), simultaneously extracted metal/acid volatile sulfide (SEM-AVS), grain size, nutrients (carbon and nitrogen) and organic contaminants (polycyclic aromatic hydrocarbons (PAHs) and polychlorinated biphenyls (PCBs)). The concentrations of cadmium, copper, silver and zinc from the partial sediment digestion of the surface samples correlated well with each other (r2 > 0.60) indicating that either a common process, or group of processes determined the sediment concentrations of these metals. In an analysis of the spatial distribution of the trace metals and PAHs, high surficial concentrations were present in the southern portion of the Harbor. The trace metal trend was strengthened when the concentrations were normalized by grain size. A sewage treatment plant outfall discharge was present in the southeastern portion of the Harbor at the time of this study and is the major source of trace metal and PAH contamination. Evaluation of sediment cores provides a proxy record of historical trace metal and organic inputs. The peak accumulation rate for copper, cadmium, lead, and zinc was in the late 1960s and the peak silver accumulation rate was later. The greatest accumulation of trace metals occurred in the late 1960s after discharges from the STP began. Subsequent declines in trace metal concentrations may be attributed to increased water and air regulations. The potential toxicity of trace metals and organic contaminants was predicted by comparing contaminant concentrations to benchmark concentrations and potential trace metal bioavailability was predicted with SEM-AVS results. Surface sample results indicate lead, silver, ???PAHs and ???PCBs are potentially toxic and/or bioavailable. These predictions were supported by studies of biota in the Burlington Harbor watershed. There

  19. 78 FR 28492 - Special Local Regulation; Low Country Splash, Wando River, Cooper River, and Charleston Harbor...

    Science.gov (United States)

    2013-05-15

    ...-AA08 Special Local Regulation; Low Country Splash, Wando River, Cooper River, and Charleston Harbor... establishing a special local regulation on the waters of the Wando River, Cooper River, and Charleston Harbor... rulemaking (NPRM) entitled, ``Special Local Regulation; Low Country Splash, Wando River, Cooper River, and...

  20. 78 FR 21597 - Marine Mammals: Alaska Harbor Seal Habitats

    Science.gov (United States)

    2013-04-11

    ... seek input as to whether management measures are needed, and if so, what types of measures should be... proposed rulemaking (ANPR) on potential management measures to protect glacially-associated harbor seal... need for regulations; (2) the geographic scope and time horizon of regulations; (3) management options...

  1. Hydrocarbon pollutants shape bacterial community assembly of harbor sediments

    KAUST Repository

    Barbato, Marta

    2016-02-02

    Petroleum pollution results in co-contamination by different classes of molecules, entailing the occurrence of marine sediments difficult to remediate, as in the case of the Ancona harbor (Mediterranean Sea, Italy). Autochthonous bioaugmentation (ABA), by exploiting the indigenous microbes of the environment to be treated, could represent a successful bioremediation strategy. In this perspective we aimed to i) identify the main drivers of the bacterial communities\\' richness in the sediments, ii) establish enrichment cultures with different hydrocarbon pollutants evaluating their effects on the bacterial communities\\' composition, and iii) obtain a collection of hydrocarbon degrading bacteria potentially exploitable in ABA. The correlation between the selection of different specialized bacterial populations and the type of pollutants was demonstrated by culture-independent analyses, and by establishing a collection of bacteria with different hydrocarbon degradation traits. Our observations indicate that pollution dictates the diversity of sediment bacterial communities and shapes the ABA potential in harbor sediments.

  2. Gridded multibeam bathymetry of Apra Harbor, Guam U.S. Territory

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry from Apra Harbor, Guam U.S. Territory. The netCDF and Arc ASCII grids include multibeam bathymetry from the Reson SeaBat 8125 multibeam sonar...

  3. Grays Harbor and Chehalis River Improvements to Navigation Environmental Studies. Wildlife Studies at Proposed Disposal Sites in Grays Harbor, Washington,

    Science.gov (United States)

    1982-01-01

    sltand. T 𔃼~P i’ W 210 three times VtwCerI November IOC’C -nd ~co l.Etls ~ ec!,!zervc-o betxwe H -gF 12 Th -ind hl rway u- 7Plie Sicuobh. E. Cumin -s 1... stress imposed by dredge dsosal ;ictivities on these species. It is difficult to rredict the effects of establishing a salt marsh in Grays Harbor on

  4. Composition and source of butyltins in sediments of Kaohsiung Harbor, Taiwan

    Science.gov (United States)

    Dong, Cheng-Di; Chen, Chih-Feng; Chen, Chiu-Wen

    2015-04-01

    Fifty-eight sediment samples were collected from the Kaohsiung Harbor (Taiwan) for analyses of monobutyltin (MBT), dibutyltin (DBT) and tributyltin (TBT), using gas chromatography/flame photometric detector (GC/FPD). The concentration of total butyltins (ΣBTs), sum of MBT, DBT, and TBT, varied from 3.9 to 158.5 ng Sn/g dw in sediment samples with TBT being the major component of the sediment samples, except for the vicinity of the Love River mouth where MBT was the most abundant BT compound (a proportion of over 57%). Based on the BTs concentration, distribution, composition and correlations, the sources of BTs found in harbor sediments are shipping activities, and TBT is the main pollutant; the estuary (i.e. Love River) has been the anthropogenic source of MBT from upstream inputs. Influences of TBT on aquatic organisms are evaluated using the toxicity guidelines proposed by the US EPA (US Environmental Protection Agency) and the ACCI (assessment class criterion for imposex) proposed by OSPAR (Oslo and Paris Commission). The evaluation shows that the TBT contained in the sediment at Kaohsiung Harbor is likely to have a negative influence at ACCI class C because gastropods present imposex and TBT levels are above ecotoxicological assessment criteria (EAC) limits.

  5. Assessment of a combination between hard structures and sand nourishment eastern of Damietta harbor using numerical modeling

    Directory of Open Access Journals (Sweden)

    A.M. Khalifa

    2017-12-01

    Full Text Available Damietta harbor was constructed in 1982 as an inland harbor with its 15 m depth navigation channel and two jetties acting like an obstacle to not allow sediment deposition in the harbor. On the other hand, they significantly affect the northern coast shoreline and hinder the sediment circulation in Damietta promontory. Satellite images show that new headlands are being implemented in the coastal shores of As-senaneyah. The proposed project consists of implementation of four headlands with length of 160 m, spacing of 400 m and using 150,000 m3 nourishment in those spacing between the hard structures only once during the construction time. Litpack 1D-model is used to predict shoreline responses to number of different five scenarios considered as combination between hard structures such as headlands and sand nourishment. A total number of 32 profiles were used to assess the shoreline changes along Gamasa, Damietta and Ras El-bar resort from 2010 to 2015. This study prevails a high erosion rate of the eastern and western shorelines of the proposed headlands. Nourishment of 200,000 m3/year is found to be a reasonable solution due to simplicity of being attained from Damietta harbor’s annual dredged materials which was reported to be average of 1 million m3/year. Keywords: Numerical modeling, Damietta harbor, Egyptian shoreline changes, Inland harbor

  6. 33 CFR 162.260 - Channel leading to San Juan Harbor, P.R.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Channel leading to San Juan Harbor, P.R.; use, administration, and navigation. 162.260 Section 162.260 Navigation and Navigable... WATERWAYS NAVIGATION REGULATIONS § 162.260 Channel leading to San Juan Harbor, P.R.; use, administration...

  7. DefenseLink Special: Attack on Pearl Harbor, 65th Anniversary

    Science.gov (United States)

    Japanese raid on Pearl Harbor has been called a defining moment in U.S. history. It caught the country by Hawaii-based combat planes, were heavily damaged. By crippling the U.S. Pacific Fleet, Japan hoped to

  8. Abstracts of papers presented at the LVIII Cold Spring Harbor Symposium on quantitative Biology: DNA and chromosomes

    Energy Technology Data Exchange (ETDEWEB)

    1993-12-31

    This volume contains the abstracts of oral and poster presentations made at the LVIII Cold Spring Harbor Symposium on Quantitative Biology entitles DNA & Chromosomes. The meeting was held June 2--June 9, 1993 at Cold Spring Harbor, New York.

  9. Side-scan imagery of Apra Harbor, Guam U.S. Territory

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gridded side-scan imagery collected in Apra Harbor, Guam U.S. Territory, USA. The GeoTIFF and Arc ASCII file includes data that were collected using a Klein 3000...

  10. New world bats harbor diverse influenza A viruses.

    Directory of Open Access Journals (Sweden)

    Suxiang Tong

    Full Text Available Aquatic birds harbor diverse influenza A viruses and are a major viral reservoir in nature. The recent discovery of influenza viruses of a new H17N10 subtype in Central American fruit bats suggests that other New World species may similarly carry divergent influenza viruses. Using consensus degenerate RT-PCR, we identified a novel influenza A virus, designated as H18N11, in a flat-faced fruit bat (Artibeus planirostris from Peru. Serologic studies with the recombinant H18 protein indicated that several Peruvian bat species were infected by this virus. Phylogenetic analyses demonstrate that, in some gene segments, New World bats harbor more influenza virus genetic diversity than all other mammalian and avian species combined, indicative of a long-standing host-virus association. Structural and functional analyses of the hemagglutinin and neuraminidase indicate that sialic acid is not a ligand for virus attachment nor a substrate for release, suggesting a unique mode of influenza A virus attachment and activation of membrane fusion for entry into host cells. Taken together, these findings indicate that bats constitute a potentially important and likely ancient reservoir for a diverse pool of influenza viruses.

  11. 33 CFR 117.181 - Oakland Inner Harbor Tidal Canal.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Oakland Inner Harbor Tidal Canal. 117.181 Section 117.181 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... Tidal Canal. The draws of the Alameda County highway drawbridges at Park Street, mile 5.2; Fruitvale...

  12. 33 CFR 165.776 - Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico 165.776 Section 165.776 Navigation and Navigable Waters COAST... Guard District § 165.776 Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico (a...

  13. Charleston Harbor, SC, Regional Sediment Management Study: Beneficial Use of Dredged Material through Nearshore Placement

    Science.gov (United States)

    2017-05-01

    Modeling System (CMS) that were developed and applied previously for the Charleston Harbor numerical modeling study (Kashlan 2013) were used in...Particle Tracking Model; Report 1: Model theory, implementation, and example applications. ERDC/CHL TR-6-20. Vicksburg, MS: U.S. Army Engineer Research ...ER D C/ CH L TR -1 7- 7 Regional Sediment Management (RSM) Program Charleston Harbor, SC, Regional Sediment Management Study

  14. Charleston Harbor, SC, Regional Sediment Management Study; Beneficial Use of Dredged Material through Nearshore Placement

    Science.gov (United States)

    2017-05-01

    Modeling System (CMS) that were developed and applied previously for the Charleston Harbor numerical modeling study (Kashlan 2013) were used in...Particle Tracking Model; Report 1: Model theory, implementation, and example applications. ERDC/CHL TR-6-20. Vicksburg, MS: U.S. Army Engineer Research ...ER D C/ CH L TR -1 7- 7 Regional Sediment Management (RSM) Program Charleston Harbor, SC, Regional Sediment Management Study

  15. A Comparison of Microbial Water Quality and Diversity for Ballast and Tropical Harbor Waters.

    Science.gov (United States)

    Ng, Charmaine; Le, Thai-Hoang; Goh, Shin Giek; Liang, Liang; Kim, Yiseul; Rose, Joan B; Yew-Hoong, Karina Gin

    2015-01-01

    Indicator organisms and antibiotic resistance were used as a proxy to measure microbial water quality of ballast tanks of ships, and surface waters in a tropical harbor. The survival of marine bacteria in ballast tanks appeared to diminish over longer water retention time, with a reduction of cell viability observed after a week based on heterotrophic plate counts. Pyrosequencing of 16S rRNA genes showed distinct differences in microbial composition of ballast and harbor waters. The harbor waters had a higher abundance of operational taxonomic units (OTUs) assigned to Cyanobacteria (Synechococcus spp.) and α-proteobacteria (SAR11 members), while marine hydrocarbon degraders such as γ-proteobacteria (Ocenspirillaes spp., Thiotrchales spp.) and Bacteroidetes (Flavobacteriales spp.) dominated the ballast water samples. Screening of indicator organisms found Escherichia coli (E. coli), Enterococcus and Pseudomonas aeruginosa (P. aeruginosa) in two or more of the ballast and harbor water samples tested. Vibrio spp. and Salmonella spp. were detected exclusively in harbor water samples. Using quantitative PCR (qPCR), we screened for 13 antibiotic resistant gene (ARG) targets and found higher abundances of sul1 (4.13-3.44 x 102 copies/mL), dfrA (0.77-1.80 x10 copies/mL) and cfr (2.00-5.21 copies/mL) genes compared to the other ARG targets selected for this survey. These genes encode for resistance to sulfonamides, trimethoprim and chloramphenicol-florfenicol antibiotics, which are also known to persist in sediments of aquaculture farms and coastal environments. Among the ARGs screened, we found significant correlations (Pwater quality survey, quantitatively assessing indicators of antibiotic resistance, potentially pathogenic organisms and a broad-brush description of difference in microbial composition and diversity between open oceans and tropical coastal environments through the use of next generation sequencing technology.

  16. Distribution and contamination status of chromium in surface sediments of northern Kaohsiung Harbor, Taiwan.

    Science.gov (United States)

    Dong, Cheng-Di; Chen, Chiu-Wen; Chen, Chih-Feng

    2013-07-01

    The distribution, enrichment, accumulation, and potential ecological risk of chromium (Cr) in the surface sediments of northern Kaohsiung Harbor, Taiwan, China were investigated. Sediment samples from ten locations located between the river mouths and harbor entrance of northern Kaohsiung Harbor were collected quarterly in 2011 and characterized for Cr, aluminum, water content, organic matter, total nitrogen, total phosphorous, total grease, and grain size. Results showed that the Cr concentrations varied from 27.0 to 361.9 mg/kg with an average of (113.5 +/- 87.0) mg/kg. High Cr concentration was observed near the Jen-Gen River mouth. The mean Cr concentration was high at 255.5 mg/kg, which was at least 2 to 7 times than that of other sites. This might imply significant Cr contribution from upstream receiving tanneries wastewater into the Jen-Gen River. The spatial distribution of Cr reveals relatively high in the river mouth region, especially in Jen-Gen River, and gradually diminishes toward the harbor entrance region. This indicates that the major sources of Cr pollution from upstream industrial and municipal wastewaters discharged along the river bank; and Cr may drift with sea current and be dispersed into open sea. Moreover, Cr concentrations correlated closely to the physical-chemical properties of the sediments, which suggested the influence of industrial and municipal wastewaters discharged from the neighboring industrial parks and river basins. Results from the enrichment factor and geo-accumulation index analyses imply that the Jen-Gen River sediments can be characterized as moderate enrichment and none to medium accumulation of Cr, respectively. However, results of potential ecological risk index indicate that the sediment has low ecological potential risk. The results can provide valuable information to developing future strategies for the management of river mouth and harbor.

  17. A Probabilistic and Observation Based Methodology to Estimate Small Craft Harbor Vulnerability to Tsunami Events

    Science.gov (United States)

    Keen, A. S.; Lynett, P. J.; Ayca, A.

    2016-12-01

    Because of the damage resulting from the 2010 Chile and 2011 Japanese tele-tsunamis, the tsunami risk to the small craft marinas in California has become an important concern. The talk will outline an assessment tool which can be used to assess the tsunami hazard to small craft harbors. The methodology is based on the demand and structural capacity of the floating dock system, composed of floating docks/fingers and moored vessels. The structural demand is determined using a Monte Carlo methodology. Monte Carlo methodology is a probabilistic computational tool where the governing might be well known, but the independent variables of the input (demand) as well as the resisting structural components (capacity) may not be completely known. The Monte Carlo approach uses a distribution of each variable, and then uses that random variable within the described parameters, to generate a single computation. The process then repeats hundreds or thousands of times. The numerical model "Method of Splitting Tsunamis" (MOST) has been used to determine the inputs for the small craft harbors within California. Hydrodynamic model results of current speed, direction and surface elevation were incorporated via the drag equations to provide the bases of the demand term. To determine the capacities, an inspection program was developed to identify common features of structural components. A total of six harbors have been inspected ranging from Crescent City in Northern California to Oceanside Harbor in Southern California. Results from the inspection program were used to develop component capacity tables which incorporated the basic specifications of each component (e.g. bolt size and configuration) and a reduction factor (which accounts for the component reduction in capacity with age) to estimate in situ capacities. Like the demand term, these capacities are added probabilistically into the model. To date the model has been applied to Santa Cruz Harbor as well as Noyo River. Once

  18. Cultural Resources Survey of Mobile Harbor, Alabama.

    Science.gov (United States)

    1983-01-01

    improvement from the point of view of supply and communication with other European settlements, since it cut the lightering distance to the capital in half...order to cut the costs of building (Bathe 1978:08.00-02; Millar 1978:15-29). 32 6e The sharing of ship builders, the borrowing of vessel lines and the... Eslava Street Mobile. Burned to water’s edge during overhaul. Notes: Served as HINGHAM in Boston Harbor; served as ORIENT in Long Island Sound. Operated

  19. Organochlorines in harbor seal (Phoca vitulina) tissues from the northern Gulf of Alaska

    International Nuclear Information System (INIS)

    Wang Dongli; Atkinson, Shannon; Hoover-Miller, Anne; Lee, Sung-Eun; Li, Qing X.

    2007-01-01

    Polychlorinated biphenyls (PCBs), dichlorodiphenyltrichloroethane (DDT) and its metabolites, heptachlor and hexachlorocyclohexanes (HCHs) were analyzed in the harbor seal (Phoca vitulina) tissues collected from the Gulf of Alaska during 2000-2001. ΣPCBs (16-728 ng/g lw) and ΣDDTs (14-368 ng/g lw) were the predominant pollutants followed by ΣHCHs (0.56-93 ng/g lw) and heptachlor (≤0.068-6.0 ng/g lw). Concentrations of the above organochlorines (OCs) in the liver, kidney and blubber tissues correlated with ages, sex, body weight and blubber thickness of the harbor seals. The OC concentrations were similar between the samples collected from two different regions - Prince William Sound, and Kodiak Island and Southern Alaska Peninsula. Mean levels of OCs in nursing female adults were much lower than those in male adults, which indicate that lactation transfer OCs from mother seals to newborns. - Σ28 PCB congeners, p,p'-DDE, p,p'-DDD and p,p'-DDT, α-, β-, γ-, and δ-HCH and heptachlor in harbor seal tissues from the northern Gulf of Alaska are reported

  20. 77 FR 60319 - Harbor Porpoise Take Reduction Plan; Coastal Gulf of Maine Closure Area Established With a...

    Science.gov (United States)

    2012-10-03

    ...-XC099 Harbor Porpoise Take Reduction Plan; Coastal Gulf of Maine Closure Area Established With a... Atmospheric Administration (NOAA), Commerce. ACTION: Establishment of the Coastal Gulf of Maine Closure Area... Service (NMFS) announces the establishment of the Coastal Gulf of Maine Closure Area under the Harbor...

  1. 77 FR 29929 - Safety Zone; Town of Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA

    Science.gov (United States)

    2012-05-21

    ... section of this notice. Basis and Purpose On July 4, 2012 the Town of Cape Charles will sponsor a...-AA00 Safety Zone; Town of Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA AGENCY: Coast... temporary safety zone on the waters of Cape Charles City Harbor in Cape Charles, VA in support of the Fourth...

  2. Defense Infrastructure: General and Flag Officer Quarters at Pearl Harbor, Hawaii

    National Research Council Canada - National Science Library

    2002-01-01

    .... We reviewed 17 GFOQs at Pearl Harbor, Hawaii, with budgeted maintenance and repair costs of $1,247,300, to determine whether the Navy had properly classified interior shutter costs as maintenance and repair...

  3. 75 FR 43823 - Safety Zone; He'eia Kea Small Boat Harbor, Kaneohe Bay, Oahu, HI

    Science.gov (United States)

    2010-07-27

    ...The Coast Guard is establishing a temporary safety zone in He'eia Kea Small Boat Harbor located in Kaneohe Bay, Oahu, Hawaii. The safety zone is necessary to protect watercraft and the general public from hazards associated with five vessels moored for approximately 3- weeks off the boat harbor's main pier. Vessels desiring to transit through the zone can request permission by contacting the Captain of the Port Honolulu.

  4. First case of New Delhi metallo-β-lactamase in Klebsiella pneumoniae from Ecuador: An update for South America

    OpenAIRE

    Daniel Romero-Alvarez; Jorge Reyes; Viviana Quezada; Carolina Satán; Nelson Cevallos; Sofía Barrera; Gabriel Trueba; Luis E. Escobar; José E. Villacís

    2017-01-01

    Objectives: To describe a clinical case of Klebsiella pneumoniae harboring a New Delhi metallo-β-lactamase (NDM) plasmid in Ecuador and to present a map of reports of NDM isolates in South America. Methods: The modified Hodge test, carbapenem inactivation method, imipenemâEDTA disk method (synergy), and Rapidec Carba NP test were used to identify antibiotic resistance mechanisms. The presence of resistance genes was explored with a conjugation assay, and molecular confirmation of NDM was per...

  5. Aerial Survey Effort for Harbor Seals in Coastal Alaska (2004-2015)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The most feasible approach to determining harbor seal distribution and abundance in Alaska coastal habitats is to use aircraft to count seals when they haul out of...

  6. Estimation of potential distribution of gas hydrate in the northern South China Sea

    Science.gov (United States)

    Wang, Chunjuan; Du, Dewen; Zhu, Zhiwei; Liu, Yonggang; Yan, Shijuan; Yang, Gang

    2010-05-01

    Gas hydrate research has significant importance for securing world energy resources, and has the potential to produce considerable economic benefits. Previous studies have shown that the South China Sea is an area that harbors gas hydrates. However, there is a lack of systematic investigations and understanding on the distribution of gas hydrate throughout the region. In this paper, we applied mineral resource quantitative assessment techniques to forecast and estimate the potential distribution of gas hydrate resources in the northern South China Sea. However, current hydrate samples from the South China Sea are too few to produce models of occurrences. Thus, according to similarity and contrast principles of mineral outputs, we can use a similar hydrate-mining environment with sufficient gas hydrate data as a testing ground for modeling northern South China Sea gas hydrate conditions. We selected the Gulf of Mexico, which has extensively studied gas hydrates, to develop predictive models of gas hydrate distributions, and to test errors in the model. Then, we compared the existing northern South China Sea hydrate-mining data with the Gulf of Mexico characteristics, and collated the relevant data into the model. Subsequently, we applied the model to the northern South China Sea to obtain the potential gas hydrate distribution of the area, and to identify significant exploration targets. Finally, we evaluated the reliability of the predicted results. The south seabed area of Taiwan Bank is recommended as a priority exploration target. The Zhujiang Mouth, Southeast Hainan, and Southwest Taiwan Basins, including the South Bijia Basin, also are recommended as exploration target areas. In addition, the method in this paper can provide a useful predictive approach for gas hydrate resource assessment, which gives a scientific basis for construction and implementation of long-term planning for gas hydrate exploration and general exploitation of the seabed of China.

  7. Selenium and mercury concentrations in harbor seals (Phoca vitulina) from central California: Health implications in an urbanized estuary

    Science.gov (United States)

    McHuron, Elizabeth A.; Harvey, James T.; Castellini, J. Margaret; Stricker, Craig A.; O'Hara, Todd M.

    2014-01-01

    We measured total selenium and total mercury concentrations ([TSe] and [THg]) in hair (n = 138) and blood (n = 73) of harbor seals (Phoca vitulina) from California to assess variation by geography and sex, and inferred feeding relationships based on carbon, nitrogen, and sulfur stable isotopes. Harbor seals from Hg-contaminated sites had significantly greater [THg], and lesser [TSe] and TSe:THg molar ratios than seals from a relatively uncontaminated site. Males had significantly greater [THg] than females at all locations. Sulfur stable isotope values explained approximately 25% of the variability in [THg], indicating increased Hg exposure for seals with a greater use of estuarine prey species. Decreased [TSe] in harbor seals from Hg-contaminated regions may indicate a relative Se deficiency to mitigate the toxic effects of Hg. Further investigation into the Se status and the potential negative impact of Hg on harbor seals from Hg-contaminated sites is warranted.

  8. Emergence of fatal avian influenza in New England harbor seals

    Science.gov (United States)

    Anthony, S.J.; St. Leger, J. A.; Pugliares, K.; Ip, Hon S.; Chan, J.M.; Carpenter, Z.W.; Navarrete-Macias, I.; Sanchez-Leon, M.; Saliki, J.T.; Pedersen, J.; Karesh, W.; Daszak, P.; Rabadan, R.; Rowles, T.; Lipkin, W.I.

    2012-01-01

    From September to December 2011, 162 New England harbor seals died in an outbreak of pneumonia. Sequence analysis of postmortem samples revealed the presence of an avian H3N8 influenza A virus, similar to a virus circulating in North American waterfowl since at least 2002 but with mutations that indicate recent adaption to mammalian hosts. These include a D701N mutation in the viral PB2 protein, previously reported in highly pathogenic H5N1 avian influenza viruses infecting people. Lectin staining and agglutination assays indicated the presence of the avian-preferred SAα-2,3 and mammalian SAα-2,6 receptors in seal respiratory tract, and the ability of the virus to agglutinate erythrocytes bearing either the SAα-2,3 or the SAα-2,6 receptor. The emergence of this A/harbor seal/Massachusetts/1/2011 virus may herald the appearance of an H3N8 influenza clade with potential for persistence and cross-species transmission.

  9. 77 FR 47331 - Regulated Navigation Area-New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT; Pearl...

    Science.gov (United States)

    2012-08-08

    ...-AA11 Regulated Navigation Area--New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT; Pearl... navigable waters of New Haven Harbor, Quinnipiac River and Mill River. The current RNA pertains only to the..., Quinnipiac River, and Mill River RNA. The proposed amendment would give the Captain of the Port Sector Long...

  10. 78 FR 7663 - SLR; 2013 International Rolex Regatta; St. Thomas Harbor; St. Thomas, U.S. Virgin Islands

    Science.gov (United States)

    2013-02-04

    ... 1625-AA08 SLR; 2013 International Rolex Regatta; St. Thomas Harbor; St. Thomas, U.S. Virgin Islands... special local regulations on the waters of St. Thomas Harbor in St. Thomas, U. S. Virgin Islands during... 5 p.m., Monday through Friday, except federal holidays. The telephone number is 202-366-9329. See...

  11. Surveillance for zoonotic and selected pathogens in harbor seals Phoca vitulina from central California

    Science.gov (United States)

    Greig, Denise J.; Ip, Hon S.; Gulland, Frances M. D.; Miller, Woutrina A.; Conrad, Patricia A.; Field, Cara L.; Fleetwood, Michelle; Harvey, James T.; Jang, Spencer; Packham, Andrea; Wheeler, Elizabeth; Hall, Ailsa J.

    2014-01-01

    The infection status of harbor seals Phoca vitulina in central California, USA, was evaluated through broad surveillance for pathogens in stranded and wild-caught animals from 2001 to 2008, with most samples collected in 2007 and 2008. Stranded animals from Mendocino County to San Luis Obispo County were sampled at a rehabilitation facility: The Marine Mammal Center (TMMC, n = 175); wild-caught animals were sampled at 2 locations: San Francisco Bay (SF, n = 78) and Tomales Bay (TB, n = 97), that differed in degree of urbanization. Low prevalences of Salmonella, Campylobacter, Giardia, and Cryptosporidium were detected in the feces of stranded and wild-caught seals. Clostridium perfringens and Escherichia coli were more prevalent in the feces of stranded (58% [78 out of 135] and 76% [102 out of 135]) than wild-caught (42% [45 out of 106] and 66% [68 out of 106]) seals, whereas Vibrio spp. were 16 times more likely to be cultured from the feces of seals from SF than TB or TMMC (p neurona, and type A influenza was only detected in the wild-caught harbor seals (post-weaning age classes), whereas antibody titers to Leptospira spp. were detected in stranded and wild-caught seals. No stranded (n = 109) or wild-caught (n = 217) harbor seals had antibodies to phocine distemper virus, although a single low titer to canine distemper virus was detected. These results highlight the role of harbor seals as sentinel species for zoonotic and terrestrial pathogens in the marine environment.

  12. Retail ready-to-eat food as a potential vehicle for Staphylococcus spp. harboring antibiotic resistance genes.

    Science.gov (United States)

    Chajęcka-Wierzchowska, Wioleta; Zadernowska, Anna; Nalepa, Beata; Sierpińska, Magda; Laniewska-Trokenheim, Lucja

    2014-06-01

    Ready-to-eat (RTE) food, which does not need thermal processing before consumption, could be a vehicle for the spread of antibiotic-resistant microorganisms. As part of general microbiological safety checks, staphylococci are routinely enumerated in these kinds of foods. However, the presence of antibiotic-resistant staphylococci in RTE food is not routinely investigated, and data are only available from a small number of studies. The present study evaluated the pheno- and genotypical antimicrobial resistance profile of Staphylococcus spp. isolated from 858 RTE foods (cheeses, cured meats, sausages, smoked fishes, salads). Of 113 strains isolated, S. aureus was the most prevalent species, followed by S. xylosus, S. saprophyticus, and S. epidermidis. More than half (54.9%) of the isolates were resistant to at least one class of tested antibiotic; of these, 35.4% of the strains were classified as multidrug resistant. Most of the isolates were resistant to cefoxitin (49.6%), followed by clindamycin (39.3%), tigecycline (27.4%), quinupristin-dalfopristin (22.2%), rifampin (20.5%), tetracycline (17.9%), and erythromycin (8.5%). All methicillin-resistant staphylococci harbored the mecA gene. Among the isolates resistant to at least one antibiotic, 38 harbored tetracycline resistance determinant tet (M), 24 harbored tet (L), and 9 harbored tet (K). Of the isolates positive for tet (M) genes, 34.2% were positive for the Tn916-Tn1545-like integrase family gene. Our results indicated that retail RTE food could be considered an important route for the transmission of antibiotic-resistant bacteria harboring multiple antibiotic resistance genes.

  13. Current and historic mercury deposition to New Haven Harbor (CT, USA): Implications for industrial coastal environments

    International Nuclear Information System (INIS)

    Clark, Heather F.; Benoit, Gaboury

    2009-01-01

    This study quantifies historic and current mercury contamination in New Haven Harbor (New Haven, Connecticut, USA) through the analysis of sediment cores. The mercury concentration measured in surface sediment ranged from 320 to 1640 μg kg -1 with an average of 530 μg kg -1 . The harbor is relatively small in area (6.6 km 2 ) but displays a large range in concentrations, illustrating the important methodological issue that a large number of samples may be necessary to capture the variability in even a small area. Depth profiles of mercury reflect sedimentation over a range of 20 to 200 years and indicate a complex history of contamination. Mercury depth profiles were compared with lead, copper, cadmium, and silver concentrations and the metals generally covary. This trend indicates that the sources of mercury and heavy metals are linked and that regionally specific sources dominate the historic input of metals rather than large-scale atmospheric deposition patterns. Results also show there are large differences in absolute concentrations of metals among sites in the harbor. Differences in the abundance of Fe-rich, fine-grained sediment likely control the level of metals in various parts of the harbor. Proximity to current sources and the long, diverse industrial history of the harbor also influence the distribution pattern. All of the cores can be modeled as mixing between pre-industrial sediments and either one or two pollution endmembers. This study demonstrates the importance of riverine sources in the mass balance of mercury delivered to coastal areas and of watershed management to preserve coastal ecosystems.

  14. 78 FR 63381 - Safety Zones; Hawaiian Island Commercial Harbors, HI

    Science.gov (United States)

    2013-10-24

    ...; Kaumalapau, Lanai; Kahului, Maui and Kawaihae and Hilo on the Island of Hawaii). The purpose of these safety... the piers faces. (9) All waters of Hilo Harbor, Hawaii immediately adjacent to commercial piers 1 and.... SUMMARY: The Coast Guard is establishing nine (9) permanent safety zones encompassing Hawaii's commercial...

  15. 33 CFR 110.197 - Galveston Harbor, Bolivar Roads Channel, Texas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Galveston Harbor, Bolivar Roads Channel, Texas. 110.197 Section 110.197 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Roads Channel, Texas. (a)(1) Anchorage area (A). The water bounded by a line connecting the following...

  16. Polycyclic aromatic hydrocarbons (PAHs) and organochlorine pesticides in water columns from the Pearl River and the Macao harbor in the Pearl River Delta in South China

    Energy Technology Data Exchange (ETDEWEB)

    Luo, X.J.; Mai, B.X.; Yang, Q.S.; Fu, J.M.; Sheng, G.Y.; Wang, Z.S. [Chinese Academy of Science, Guangzhou (China)

    2004-06-01

    Polycyclic aromatic hydrocarbons (PAHs) and organochlorine pesticides (OCPs) were measured in suspended particles and dissolved phase from the Baiertang water column and the Macao water column samples as collected from the Guangzhou channel of the Pearl River and the Macao harbor, where the sediments were heavily contaminated with organic pollutants. Total OCPs concentration varies from 23.4 to 61.7 ng/l in Baiertang water column and from 25.2 to 67.8 ng/l in Macao column, while total PAHs concentration varies from 987.1 to 2878.5 ng/l in the Baiertang water column and from 944.0 to 6654.6 ng/l in the Macao column. The vertical distribution profiles of pollutants and the partition of pollutants between particles and dissolved phases indicate that the sediments in Baiertang act as an important source of selected pollutants, and the pollutants in water of this region were mainly originated from the release and re-suspension of contaminants residing in the sediments. The sediments in Macao harbor act as a reservoir for organochlorine pesticides, such as DDTs mainly introduced by river inflow from Xijiang and PAHs input by brackish water from the Lingdingyang estuary. Combustion of fossil fuels and petroleum input are the main sources of PAHs in the Macao water column, while combustion of fossil fuels and coal is responsible for the PAHs in the Baiertang water column.

  17. A Comparison of Microbial Water Quality and Diversity for Ballast and Tropical Harbor Waters.

    Directory of Open Access Journals (Sweden)

    Charmaine Ng

    Full Text Available Indicator organisms and antibiotic resistance were used as a proxy to measure microbial water quality of ballast tanks of ships, and surface waters in a tropical harbor. The survival of marine bacteria in ballast tanks appeared to diminish over longer water retention time, with a reduction of cell viability observed after a week based on heterotrophic plate counts. Pyrosequencing of 16S rRNA genes showed distinct differences in microbial composition of ballast and harbor waters. The harbor waters had a higher abundance of operational taxonomic units (OTUs assigned to Cyanobacteria (Synechococcus spp. and α-proteobacteria (SAR11 members, while marine hydrocarbon degraders such as γ-proteobacteria (Ocenspirillaes spp., Thiotrchales spp. and Bacteroidetes (Flavobacteriales spp. dominated the ballast water samples. Screening of indicator organisms found Escherichia coli (E. coli, Enterococcus and Pseudomonas aeruginosa (P. aeruginosa in two or more of the ballast and harbor water samples tested. Vibrio spp. and Salmonella spp. were detected exclusively in harbor water samples. Using quantitative PCR (qPCR, we screened for 13 antibiotic resistant gene (ARG targets and found higher abundances of sul1 (4.13-3.44 x 102 copies/mL, dfrA (0.77-1.80 x10 copies/mL and cfr (2.00-5.21 copies/mL genes compared to the other ARG targets selected for this survey. These genes encode for resistance to sulfonamides, trimethoprim and chloramphenicol-florfenicol antibiotics, which are also known to persist in sediments of aquaculture farms and coastal environments. Among the ARGs screened, we found significant correlations (P<0.05 between ereA, ermG, cfr and tetO genes to one or more of the indicator organisms detected in this study, which may suggest that these members contribute to the environmental resistome. This study provides a baseline water quality survey, quantitatively assessing indicators of antibiotic resistance, potentially pathogenic organisms and a

  18. A neurological comparative study of the harp seal (Pagophilus groenlandicus) and harbor porpoise (Phocoena phocoena) brain

    DEFF Research Database (Denmark)

    Walløe, Solveig; Eriksen, Nina; Dabelsteen, Torben

    2010-01-01

    The cetacean brain is well studied. However, few comparisons have been done with other marine mammals. In this study, we compared the harp seal (Pagophilus groenlandicus) and the harbor porpoise brain (Phocoena phocoena). Stereological methods were applied to compare three areas of interest...... cells, whereas the harp seal have 6.1 × 10(9) neocortical neurons and 17.5 × 10(9) neocortical glial cells. The harbor porpoise have significantly more neurons and glial cells in the auditory cortex than in the visual cortex, whereas the pattern was opposite for the harp seal. These results...... are the first to provide estimates of the number of neurons and glial cells in the neocortex of the harp seal and harbor porpoise brain and offer new data to the comparative field of mammalian brain evolution....

  19. Rhizosphere of rice plants harbor bacteria with multiple plant growth ...

    African Journals Online (AJOL)

    Rhizosphere of rice plants harbor bacteria with multiple plant growth promoting features. ... 45 (39.46%) isolates were capable of producing siderophore, the range of production being 4.50 to 223.26 μg mg-1 protein. Analysis of molecular diversity was made by amplified ribosomal DNA restriction analysis (ARDRA) and ...

  20. 33 CFR 117.669 - St. Louis River (Duluth Superior Harbor).

    Science.gov (United States)

    2010-07-01

    ... SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Minnesota § 117.669 St. Louis River (Duluth Superior Harbor). (a) The draws of the Burlington Northern railroad bridge, mile 5.7, shall open... Missabe and Iron Range Railway bridge, mile 16.3, need not be opened for the passage of vessels. The owner...

  1. 33 CFR 117.1083 - Duluth-Superior Harbor (St. Louis River).

    Science.gov (United States)

    2010-07-01

    ... SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1083 Duluth-Superior Harbor (St. Louis River). (a) The draws of the Burlington Northern railroad bridge, mile 5.7 at... blasts. (c) The draw of the Duluth, Missabe and Iron Range Railway bridge, mile 16.3 at Duluth, need not...

  2. Re-alimentation in harbor seal pups: effects on the somatotropic axis and growth rate.

    Science.gov (United States)

    Richmond, Julie P; Norris, Tenaya; Zinn, Steven A

    2010-01-15

    The metabolic hormones, growth hormone (GH) and insulin-like growth factor (IGF)-I, together with IGF binding proteins (IGFBP), have been well studied in domestic species and are the primary components of the somatotropic axis. This hormone axis is responsive to nutrient intake, associated with growth rate, and accretion of protein and adipose. However, this relationship has not been evaluated in species that rely heavily on adipose stores for survival, such as pinnipeds. The primary objectives of this research were to investigate the response of the somatotropic axis to reduced nutrient intake and re-alimentation in rehabilitated harbor seal pups, and to assess if these hormones are related to nutritional status and growth rate in harbor seals. Stranded harbor seal pups (n=24) arrived at the rehabilitation facility very thin after fasting for several days (nutritional nadir). Throughout rehabilitation nutrient intake increased and pups gained mass and body condition. Concentrations of GH and IGFBP-2 decreased with re-alimentation, while IGF-I and IGFBP-3 concentrations increased. Overall, GH and IGFBP-2 were negatively associated and IGF-I and IGFBP-3 were positively associated with growth rate and increased body condition of harbor sea pups. Further, the magnitude of the growth response was related to the magnitude in response of the somatotropic axis to varied levels of intake. These data suggest that multiple components of the somatotropic axis may be used to assess the energy status of individuals and may also provide information on the level of feed intake that is predictive of growth rate.

  3. Japan's Monroe Doctrine?: Re-Framing the Story of Pearl Harbor

    Science.gov (United States)

    Murnane, John R.

    2007-01-01

    Ever since War Department propaganda films set the mold, historians have pretty much followed: the road to Pearl Harbor began in 1931 with Japanese aggression in Manchuria. Any "revision" regarding the War in the Pacific has its own set of problems--engendering controversy, often running up against patriotic sentiments and the tendency…

  4. Seroprevalence of Brucella antibodies in harbor seals in Alaska, USA, with age, regional, and reproductive comparisons.

    Science.gov (United States)

    Hoover-Miller, A; Dunn, J L; Field, C L; Blundell, G; Atkinson, S

    2017-09-20

    Populations of harbor seal Phoca vitulina in the Gulf of Alaska have dramatically declined during the past 4 decades. Numbers of seals in Glacier Bay, in southeast Alaska, USA, have also declined despite extensive protection. Causes of the declines and slow recovery are poorly understood. Brucellosis is a zoonotic disease that adversely affects reproduction in many domestic species. We measured the seroprevalence of Brucella antibodies in 554 harbor seals in 3 Alaska locations: Prince William Sound (PWS), Glacier Bay (GB), and Tracy Arm Fords Terror (TAFT) Wilderness Area. Objectives included testing for regional, sex, age, and female reproductive state differences in Brucella antibody seroprevalence, persistence in titers in recaptured seals, and differences in titers between mother seals and their pups. Overall, 52% of adults (AD), 53% of subadults (SA), 77% of yearlings (YRL), and 26% of Brucella. Results show higher seroprevalence (64%) for AD and SA seals in the depressed and declining populations in PWS and GB than in TAFT (29%). Lactating females were less likely to be seropositive than other AD females, including pregnant females. Further research is needed to seek evidence of Brucella infection in Alaskan harbor seals, identify effects on neonatal viability, and assess zoonotic implications for Alaska Natives who rely on harbor seals for food.

  5. Palm harvest impacts in north-western South America

    DEFF Research Database (Denmark)

    Balslev, Henrik

    2011-01-01

    Tropical forests harbor thousands of useful plants that are harvested and used in subsistence economies or traded in local, regional or international markets. The effect on the ecosystem is little known, and the forests resilience is badly understood. Palms are the most useful group of plants...... in tropical American forests. This paper introduces a cross-disciplinary study of the effects of harvesting palm products from the tropical forests in north-western South America. The size of the resource is estimated through palm community studies in the different forest formations that determines the number...... of species and individuals of all palm species. The genetic structure of useful palm species is studied to determine how much harvesting of the species contributes to genetic erosion of its populations, and whether extraction can be made without harm. Almost all palm species are used in rural communities...

  6. 78 FR 16211 - Safety Zone, Corp. Event Finale UHC, St. Thomas Harbor; St. Thomas, U.S. Virgin Islands

    Science.gov (United States)

    2013-03-14

    ... 1625-AA00 Safety Zone, Corp. Event Finale UHC, St. Thomas Harbor; St. Thomas, U.S. Virgin Islands... establish a temporary safety zone on the waters of St. Thomas Harbor in St. Thomas, U.S. Virgin Islands... through Friday, except federal holidays. The telephone number is 202-366-9329. See the ``Public...

  7. 78 FR 23489 - Safety Zone; V.I. Carnival Finale, St. Thomas Harbor; St. Thomas, U.S.V.I.

    Science.gov (United States)

    2013-04-19

    ... waters of St. Thomas Harbor in St. Thomas, U.S. Virgin Islands during the V.I. Carnival Finale, a... through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT: If you have questions on this... event. The event will be held on the waters of St. Thomas Harbor, St. Thomas, U. S. Virgin Islands...

  8. Influence of the Pearl River estuary and vertical mixing in Victoria Harbor on water quality in relation to eutrophication impacts in Hong Kong waters.

    Science.gov (United States)

    Yin, Kedong; Harrison, Paul J

    2007-06-01

    This study presents water quality parameters such as nutrients, phytoplankton biomass and dissolved oxygen based on 11 years of water quality data in Victoria Harbor and examined how the Pearl River estuary discharge in summer and year round sewage discharge influenced these parameters. Nutrients in Victoria Harbor were strongly influenced by both the Pearl River and sewage effluent, as indicated by the high NO(3) inputs from the Pearl River in summer and higher NH(4) and PO(4) in Victoria Harbor than both its sides. N:P ratios were low in the dry season, but increased to >16:1 in the wet season, suggesting that P is potentially the most limiting nutrient in this area during the critical period in the summer. Although there were generally high nutrients, the phytoplankton biomass was not as high as one would expect in Victoria Harbor. In fact, there were high concentrations of chl near the bottom well below the photic zone. Salinity near the bottom was lower in Victoria Harbor than at the two entrances to Victoria Harbor, suggesting strong vertical mixing within Victoria Harbor. Therefore, strong vertical mixing and horizontal advection appear to play an important role in significantly reducing eutrophication impacts in Victoria Harbor. Consequently, dissolved oxygen near the bottom was low in summer, but only occasionally dipped to 2 mgL(-1) despite the high organic loading from sewage effluent.

  9. 78 FR 19158 - Safety Zone; USA Triathlon, Milwaukee Harbor, Milwaukee, WI

    Science.gov (United States)

    2013-03-29

    ... have minimal impact on the economy, will not interfere with other agencies, will not adversely alter... Milwaukee Harbor due to the 2013 and 2014 Olympic and Sprint Distance National Championships. This proposed... the 2013 and 2014 Olympic and Sprint Distance National Championships. DATES: Comments and related...

  10. Sedimentation and chronology of heavy metal pollution in Oslo harbor, Norway

    DEFF Research Database (Denmark)

    Lepland, Aivo; Andersen, Thorbjørn Joest; Lepland, Aave

    2010-01-01

    Stratigraphic profiles of Cu, Cd and Hg in ten sediment cores from the Oslo harbor, Norway, combined with results of radiometric dating demonstrate that pollution by these metals peaked between 1940 and 1970. Dating results indicate that Hg discharges peaked between 1940 and 1950, Cd reached...

  11. Synergistic growth inhibition of cancer cells harboring the RET/PTC1 ...

    Indian Academy of Sciences (India)

    Synergistic growth inhibition of cancer cells harboring the RET/PTC1 oncogene by staurosporine and rotenone involves enhanced cell death. ANTÓNIO PEDRO GONÇALVES, ARNALDO VIDEIRA, VALDEMAR MÁXIMO and PAULA SOARES. J. Biosci. 36(4), September 2011, 639-648, © Indian Academy of Sciences.

  12. Factors Contributing to Corrosion of Steel Pilings in Duluth-Superior Harbor

    Science.gov (United States)

    2009-11-01

    1226 Office of Counsel,Code 1008.3 ADOR/Director NCST E. R. Franchi , 7000 Public Affairs (Unclassified/ Unlimited Only), Code 703o 4...Great Lakes. Accelerated corrosion of CS pilings in estua- rine and marine harbors is a global phenomenon.9 The term "accelerated low water corrosion

  13. 33 CFR 334.1420 - Pacific Ocean off Orote Point, Apra Harbor, Island of Guam, Marianas Islands; small arms firing...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Pacific Ocean off Orote Point, Apra Harbor, Island of Guam, Marianas Islands; small arms firing range. 334.1420 Section 334.1420... AND RESTRICTED AREA REGULATIONS § 334.1420 Pacific Ocean off Orote Point, Apra Harbor, Island of Guam...

  14. Assessment of the impact of oil spill on Mumbai harbor bay

    International Nuclear Information System (INIS)

    Pandit, G.G.; Saradhi, I.V.; Puranik, V.D.; Sharma, D.N.; Ghosh, A.K.

    2011-04-01

    On 7 th August, 2010 two cargo ships MSC Chitra and MV Khalijia collided off Mumbai coast causing an oil spill that spread quickly through Maharashtra's coastline. MSC Chitra ruptured its tank when it hit incoming MV Khalijia. MSC Chitra tilted to about 80 degrees soon after the collision, spilling an estimated 400 to 500 tonnes of oil. The ship was loaded with an estimated 2,600 tonnes of oil, 300 tonnes of diesel and 70 tonnes of lubricating oil at the time of the accident. The oil spill has spreaded over an area of 25 square kilometers. MSC Chitra was carrying 1219 containers out of which 31 had hazardous chemicals like organophosphate pesticides. After the collision about 400 containers fall off into to the sea from the deck of MSC Chitra. The oil spill has resulted in severe environmental damage along the Mumbai coastline as well as to the marine life. In order to assess the impact of oil spill on the marine environment daily monitoring of oil and grease levels has been carried out at CIRUS Jetty. Additionally three field surveys have been carried out along the coast line of Mumbai harbor bay from Vashi Jetty to Uran collecting sea water samples. The samples collected at CIRUS Jetty and Mumbai harbor bay are analyzed for various water quality parameters apart from oil and grease. The results indicate the oil and grease levels in sea water at CIRUS Jetty reduced to background levels within 15 days. The filed survey along Mumbai harbor bay also shows a decreasing trend in the oil and grease levels in seawater. (author)

  15. 78 FR 16208 - Safety Zone; V. I. Carnival Finale; St. Thomas Harbor; St. Thomas, U.S. Virgin Islands

    Science.gov (United States)

    2013-03-14

    ... 1625-AA00 Safety Zone; V. I. Carnival Finale; St. Thomas Harbor; St. Thomas, U.S. Virgin Islands AGENCY... establish a safety zone on the waters of St. Thomas Harbor in St. Thomas, U. S. Virgin Islands during the V... between 9 a.m. and 5 p.m., Monday through Friday, except federal holidays. The telephone number is 202-366...

  16. Army Engineer Divers: First In Port-Au-Prince Harbor

    Science.gov (United States)

    2010-12-01

    to the pile once the concrete was poured. This step was com- pleted in a few minutes for each pile. Last, a prefabricated wooden form was emplaced...September-December 201010 Engineer This prefabricated wooden form was emplaced around a rebar cage at the top of damaged piles to hold concrete until it...the mainland into the harbor. Waste from tugboats and sewage from the mainland compounded ecological hazards. The only alternative for the Army and

  17. Environmental Assessment for Boston Harbor Maintenance Dredging, Boston, Massachusetts.

    Science.gov (United States)

    1981-12-01

    Harbor was developed by Jerome et al (1966), Chesmore et al (1971) and Iwanowicz et al. (1973). The studies on the Lower Mystic River were concentrated in... Iwanowicz et al. (1973) and this data should be referred to for detailed information. Waters overlying the shellfish beds are contaminated by wastes...DMRP Technical Report DS-78-5, Environmental Laboratory, U.S. Army Engineer Waterways Experiment Station, Vicksburg, Mississippi. Iwanowicz , H. R., R D

  18. 33 CFR 334.85 - New York Harbor, adjacent to the Stapleton Naval Station, Staten Island, New York; restricted area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false New York Harbor, adjacent to the Stapleton Naval Station, Staten Island, New York; restricted area. 334.85 Section 334.85 Navigation and... RESTRICTED AREA REGULATIONS § 334.85 New York Harbor, adjacent to the Stapleton Naval Station, Staten Island...

  19. Prevalence of severe fever with thrombocytopenia syndrome virus in Haemaphysalis longicornis ticks in South Korea.

    Science.gov (United States)

    Park, Sun-Whan; Song, Bong Gu; Shin, E-Hyun; Yun, Seok-Min; Han, Myung-Guk; Park, Mi Yeoun; Park, Chan; Ryou, Jungsang

    2014-10-01

    Haemaphysalis longicornis a vector that harbors severe fever with thrombocytopenia syndrome virus (SFTSV) is a major species of tick in South Korea. To investigate the existence and prevalence of SFTSV in Korea, we collected ticks from nine provinces in South Korea for detecting SFTSV. In all, we collected 13,053 ticks, and H. longicornis (90.8%, 11,856/13,053) was the most abundant among them. The minimum infection rate (MIR) of SFTSV in H. longicornis was 0.46% (55 pools). SFTSV was detected in ticks during all the developmental stages, showing MIR in larvae (2/350, 0.57%), nymphs (38/10,436, 0.36%), males (2/221, 0.90%), and females (13/849, 1.53%), respectively. Viruses were detected in ticks collected between April and September. A higher MIR was detected in ticks from the southern part of the country. We amplified the M and S segment partial genes from a sample and analyzed the nucleotide sequence. The results showed a 93-98% homology to Chinese and Japanese strains registered in Genbank. In this study, we confirmed the existence of SFTSV for the first time in South Korea. The SFTSV prevalence data from the studies are essential for raising the awareness of SFTS in South Korea. Copyright © 2014 Elsevier GmbH. All rights reserved.

  20. 77 FR 29618 - The Release of the Draft Environmental Impact Statement and the Announcement of a Public Hearing...

    Science.gov (United States)

    2012-05-18

    ... Engineers (COE), Wilmington District, Wilmington Regulatory Field Office has received a request for... oceanfront beach and 1,800 linear feet of back barrier shoreline to protect residential homes and... proposed source of the material for the nourishment will be dredged from Nixon Channel, a back barrier...

  1. Polycyclic aromatic hydrocarbons (PAHs) and organochlorine pesticides in water columns from the Pearl River and the Macao harbor in the Pearl River Delta in South China.

    Science.gov (United States)

    Luo, Xiaojun; Mai, Bixian; Yang, Qingshu; Fu, Jiamo; Sheng, Guoying; Wang, Zhishi

    2004-06-01

    Polycyclic aromatic hydrocarbons (PAHs) and organochlorine pesticides (OCPs) were measured in suspended particles and dissolved phase from the Baiertang water column and the Macao water column samples as collected from the Guangzhou channel of the Pearl River and the Macao harbor, where the sediments were heavily contaminated with organic pollutants. Total OCPs concentration varies from 23.4 to 61.7 ng/l in Baiertang water column and from 25.2 to 67.8 ng/l in Macao column, while total PAHs concentration varies from 987.1 to 2878.5 ng/l in the Baiertang water column and from 944.0 to 6654.6 ng/l in the Macao column. The vertical distribution profiles of pollutants and the partition of pollutants between particles and dissolved phases indicate that the sediments in Baiertang act as an important source of selected pollutants, and the pollutants in water of this region were mainly originated from the release and re-suspension of contaminants residing in the sediments. The sediments in Macao harbor act as a reservoir for organochlorine pesticides, such as DDTs mainly introduced by river inflow from Xijiang and PAHs input by brackish water from the Lingdingyang estuary. Combustion of fossil fuels and petroleum input are the main sources of PAHs in the Macao water column, while combustion of fossil fuels and coal is responsible for the PAHs in the Baiertang water column. The ratios of DDT/(DDD+DDE) for the Macao water column samples demonstrate that such chemicals were input into this region in recent times.

  2. Wave Climate and Wave Response, Kawaihae Deep Draft Harbor, Island of Hawaii, Hawaii

    National Research Council Canada - National Science Library

    Thompson, Edward F; Demirbilek, Zeki; Briggs, Michael J

    2006-01-01

    Present and projected commercial activities in Kawaihae Deep Draft Harbor, Island of Hawaii, HI, indicate that a deeper basin and entrance channel and better protected berthing areas will be needed. The U.S...

  3. Space Threat Warning: Foundation for Space Superiority, Avoiding a Space Pearl Harbor

    National Research Council Canada - National Science Library

    Burke, Alan W

    2006-01-01

    ... have stated the US must avoid a space Pearl Harbor. This concern is due to the idea that a decrease in the perceived threat to space assets after the demise of the Soviet Union coupled with a competition for space resources has resulted...

  4. Geomorphic characterization of four shelf-sourced submarine canyons along the U.S. Mid-Atlantic continental margin

    Science.gov (United States)

    Obelcz, Jeffrey; Brothers, Daniel S.; Chaytor, Jason D.; ten Brink, Uri S.; Ross, Steve W.; Brooke, Sandra

    2013-01-01

    Shelf-sourced submarine canyons are common features of continental margins and are fundamental to deep-sea sedimentary systems. Despite their geomorphic and geologic significance, relatively few passive margin shelf-breaching canyons worldwide have been mapped using modern geophysical methods. Between 2007 and 2012 a series of geophysical surveys was conducted across four major canyons of the US Mid-Atlantic margin: Wilmington, Baltimore, Washington, and Norfolk canyons. More than 5700 km2 of high-resolution multibeam bathymetry and 890 line-km of sub-bottom CHIRP profiles were collected along the outer shelf and uppermost slope (depths of 80-1200 m). The data allowed us to compare and contrast the fine-scale morphology of each canyon system. The canyons have marked differences in the morphology and orientation of canyon heads, steepness and density of sidewall gullies, and the character of the continental shelf surrounding canyon rims. Down-canyon axial profiles for Washington, Baltimore and Wilmington canyons have linear shapes, and each canyon thalweg exhibits morphological evidence for recent, relatively small-scale sediment transport. For example, Washington Canyon displays extremely steep wall gradients and contains ~100 m wide, 5–10 m deep, v-shaped incisions down the canyon axis, suggesting modern or recent sediment transport. In contrast, the convex axial thalweg profile, the absence of thalweg incision, and evidence for sediment infilling at the canyon head, suggest that depositional processes strongly influence Norfolk Canyon during the current sea-level high-stand. The north walls of Wilmington, Washington and Norfolk canyons are steeper than the south walls due to differential erosion, though the underlying cause for this asymmetry is not clear. Furthermore, we speculate that most of the geomorphic features observed within the canyons (e.g., terraces, tributary canyons, gullies, and hanging valleys) were formed during the Pleistocene, and show only

  5. 33 CFR 117.213 - New Haven Harbor, Quinnipiac and Mill Rivers.

    Science.gov (United States)

    2010-07-01

    ... Mill Rivers. 117.213 Section 117.213 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Haven Harbor, Quinnipiac and Mill Rivers. The draws of the Tomlinson bridge, mile 0.0, the Ferry Street... bridge, mile 0.4 across Mill River, shall operate as follows: (a) The draws shall open on signal; except...

  6. 78 FR 18481 - Drawbridge Operation Regulations; Inner Harbor Navigation Canal, LA

    Science.gov (United States)

    2013-03-27

    ... regulation governing the operation of the US 90 (Danzinger) vertical lift span drawbridge across the Inner... Lift Span Bridge across the Inner Harbor Navigation Canal, mile 3.10 at New Orleans, Orleans Parish, Louisiana. The bridge has a vertical clearance of 50 feet above mean high water, elevation 5.0 feet Mean Sea...

  7. Digenetic trematodes in South American sea lions from southern Brazilian waters.

    Science.gov (United States)

    Pereira, E M; Müller, G; Secchi, E; Pereira, J; Valente, A L S

    2013-10-01

    The aim of this work was to perform a systematic study to detect and quantify the digenetic trematode infections in South American sea lions from the southern Brazilian coast. Twenty-four South American sea lions, Otaria flavescens (Carnivora: Otaridae), were found dead along the coast of Rio Grande do Sul State, Brazil, between June 2010 and September of 2011. Two trematode species were found in the intestines of O. flavescens, i.e., Stephanoprora uruguayense (Digenea: Echinostomatidae) and Ascocotyle (Phagicola) longa (Digenea: Heterophyidae). Ascocotyle (P.) longa reached a prevalence of 33.3% and mean intensity of 248,500, whereas S. uruguayense showed a prevalence of 4.2% and mean intensity of 202. The 2 trematode species infecting sea lions were likely transmitted by feeding on mullets, Mugil platanus, that commonly harbor heterophyid metacercariae. The present work is the first report of digenetic trematodes infecting O. flavescens in Brazil. The high prevalence and mean intensity values of the 2 trematode species infecting sea lions in the present study suggest caution in human consumption of mullets and other fish, which can be infected with the metacercariae of these trematodes known to have zoonotic potential.

  8. A solitary hyperfunctioning thyroid nodule harboring thyroid carcinoma: review of the literature.

    Science.gov (United States)

    Mirfakhraee, Sasan; Mathews, Dana; Peng, Lan; Woodruff, Stacey; Zigman, Jeffrey M

    2013-05-04

    Hyperfunctioning nodules of the thyroid are thought to only rarely harbor thyroid cancer, and thus are infrequently biopsied. Here, we present the case of a patient with a hyperfunctioning thyroid nodule harboring thyroid carcinoma and, using MEDLINE literature searches, set out to determine the prevalence of and characteristics of malignant "hot" nodules as a group. Historical, biochemical and radiologic characteristics of the case subjects and their nodules were compared to those in cases of benign hyperfunctioning nodules. A literature review of surgical patients with solitary hyperfunctioning thyroid nodules managed by thyroid resection revealed an estimated 3.1% prevalence of malignancy. A separate literature search uncovered 76 cases of reported malignant hot thyroid nodules, besides the present case. Of these, 78% were female and mean age at time of diagnosis was 47 years. Mean nodule size was 4.13 ± 1.68 cm. Laboratory assessment revealed T3 elevation in 76.5%, T4 elevation in 51.9%, and subclinical hyperthyroidism in 13% of patients. Histological diagnosis was papillary thyroid carcinoma (PTC) in 57.1%, follicular thyroid carcinoma (FTC) in 36.4%, and Hurthle cell carcinoma in 7.8% of patients. Thus, hot thyroid nodules harbor a low but non-trivial rate of malignancy. Compared to individuals with benign hyperfunctioning thyroid nodules, those with malignant hyperfunctioning nodules are younger and more predominantly female. Also, FTC and Hurthle cell carcinoma are found more frequently in hot nodules than in general. We were unable to find any specific characteristics that could be used to distinguish between malignant and benign hot nodules.

  9. Buffalo Harbor Study. Preliminary Feasibility Report. Volume I. Main Report.

    Science.gov (United States)

    1983-04-01

    to usually narrow strips of riparian vegetation, which is composed of various trees and shrubs of the Salix genus (willow), sumac, aspen, boxelder...reptiles were found. Species included, leopard frogs, snapping turtles, painted turtle, and garter snakes (SUNY Brockport: 1982). (7) Endangered Species...vessel traffic on the Buffalo River causes interrupted truck service. Firms have also cited snow removal as a problem. The harbor area road service

  10. A crisis in waste management, economic vitality, and a coastal marine environment: Boston Harbor and Massachusetts Bay

    Science.gov (United States)

    Manheim, F.T.; Butman, B.

    1994-01-01

    Discharge of sewage sludge and effluent from 43 communities in the greater Boston metropolitan area has helped make the harbor one of the most polluted in the nation. As part of a court-mandated plan to end pollution of the harbor, effluent will no longer be discharged into the harbor, but instead, by 1995 it will be discharged into Massachusetts Bay through a record-long 15.34 km tunnel. By the year 2000 all of the sewage is scheduled to recive full secondary treatment. The public is concerned about long-term effects of the new ocean outfall on the environment, including Cape Cod Bay and Stellwagen Bank, which is an important habitat for whales and a newly designated national marine sanctuary. The bay has been additionally stressed by dumping of low-level radioactive and other hazardous wastes during the 1950s and 1960s. -from Authors

  11. Cloning and Sequencing of Protein Kinase cDNA from Harbor Seal (Phoca vitulina Lymphocytes

    Directory of Open Access Journals (Sweden)

    Jennifer C. C. Neale

    2004-01-01

    Full Text Available Protein kinases (PKs play critical roles in signal transduction and activation of lymphocytes. The identification of PK genes provides a tool for understanding mechanisms of immunotoxic xenobiotics. As part of a larger study investigating persistent organic pollutants in the harbor seal and their possible immunomodulatory actions, we sequenced harbor seal cDNA fragments encoding PKs. The procedure, using degenerate primers based on conserved motifs of human protein tyrosine kinases (PTKs, successfully amplified nine phocid PK gene fragments with high homology to human and rodent orthologs. We identified eight PTKs and one dual (serine/threonine and tyrosine kinase. Among these were several PKs important in early signaling events through the B- and T-cell receptors (FYN, LYN, ITK and SYK and a MAP kinase involved in downstream signal transduction. V-FGR, RET and DDR2 were also expressed. Sequential activation of protein kinases ultimately induces gene transcription leading to the proliferation and differentiation of lymphocytes critical to adaptive immunity. PKs are potential targets of bioactive xenobiotics, including persistent organic pollutants of the marine environment; characterization of these molecules in the harbor seal provides a foundation for further research illuminating mechanisms of action of contaminants speculated to contribute to large-scale die-offs of marine mammals via immunosuppression.

  12. Checklist of helminths from lizards and amphisbaenians (Reptilia, Squamata of South America

    Directory of Open Access Journals (Sweden)

    RW Ávila

    2010-01-01

    Full Text Available A comprehensive and up to date summary of the literature on the helminth parasites of lizards and amphisbaenians from South America is herein presented. One-hundred eighteen lizard species from twelve countries were reported in the literature harboring a total of 155 helminth species, being none acanthocephalans, 15 cestodes, 20 trematodes and 111 nematodes. Of these, one record was from Chile and French Guiana, three from Colombia, three from Uruguay, eight from Bolivia, nine from Surinam, 13 from Paraguay, 12 from Venezuela, 27 from Ecuador, 17 from Argentina, 39 from Peru and 103 from Brazil. The present list provides host, geographical distribution (with the respective biome, when possible, site of infection and references from the parasites. A systematic parasite-host list is also provided.

  13. Quantification of total mercury in liver and heart tissue of Harbor Seals (Phoca vitulina) from Alaska USA

    International Nuclear Information System (INIS)

    Marino, Kady B.; Hoover-Miller, Anne; Conlon, Suzanne; Prewitt, Jill; O'Shea, Stephen K.

    2011-01-01

    This study quantified the Hg levels in the liver (n=98) and heart (n=43) tissues of Harbor Seals (Phoca vitulina) (n=102) harvested from Prince William Sound and Kodiak Island Alaska. Mercury tissue dry weight (dw) concentrations in the liver ranged from 1.7 to 393 ppm dw, and in the heart from 0.19 to 4.99 ppm dw. Results of this study indicate liver and heart tissues' Hg ppm dw concentrations significantly increase with age. Male Harbor Seals bioaccumulated Hg in both their liver and heart tissues at a significantly faster rate than females. The liver Hg bioaccumulation rates between the harvest locations Kodiak Island and Prince William Sound were not found to be significantly different. On adsorption Hg is transported throughout the Harbor Seal's body with the partition coefficient higher for the liver than the heart. No significant differences in the bio-distribution (liver:heart Hg ppm dw ratios (n=38)) values were found with respect to either age, sex or geographic harvest location. In this study the age at which Hg liver and heart bioaccumulation levels become significantly distinct in male and female Harbor Seals were identified through a Tukey's analysis. Of notably concern to human health was a male Harbor Seal's liver tissue harvested from Kodiak Island region. Mercury accumulation in this sample tissue was determined through a Q-test to be an outlier, having far higher Hg concentrarion (liver 392 Hg ppm dw) than the general population sampled. - Highlights: ► Mercury accumulation in the liver and heart of seals exceed food safety guidelines. ► Accumulation rate is greater in males than females with age. ► Liver mercury accumulation is greater than in the heart tissues. ► Mercury determination by USA EPA Method 7473 using thermal decomposition.

  14. Novel B19-like parvovirus in the brain of a harbor seal

    NARCIS (Netherlands)

    R. Bodewes (Rogier); A.R. García (Ana Rubio); L.C.M. Wiersma (Lidewij); S. Getu (Sarah); M. Beukers (Martijn); C.M.E. Schapendonk (Claudia); P.R.W.A. van Run (Peter); M.W.G. van de Bildt (Marco); M.J. Poen (Marjolein); N. Osinga (Nynke); G.J. Sánchez Contreras (Guillermo); T. Kuiken (Thijs); S.L. Smits (Saskia); A.D.M.E. Osterhaus (Albert)

    2013-01-01

    textabstractUsing random PCR in combination with next-generation sequencing, a novel parvovirus was detected in the brain of a young harbor seal (Phoca vitulina) with chronic non-suppurative meningo-encephalitis that was rehabilitated at the Seal Rehabilitation and Research Centre (SRRC) in the

  15. Onondaga Lake Inner Harbor Dredging Design Project, Syracuse, New York: Final Design Memorandum

    National Research Council Canada - National Science Library

    1997-01-01

    .... The sponsor is the New York State Canal Corporation. The design includes deepening the Inner Harbor channel and a portion of the terminal slip area to a depth of 10 feet below Low Water Datum (LWD...

  16. Inshore Survey Results: Approaches to New York Harbor, Fall 1955 (NODC Accession 7000294)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A current survey in the approaches to New York Harbor was initiated 06 September 1955 and continued through 04 November 1955. This survey was conducted in accordance...

  17. The historical significance of anaesthesia events at Pearl Harbor.

    Science.gov (United States)

    Crowhurst, Ja

    2014-07-01

    Up to the end of World War II, less than 10% of the general anaesthetics administered was with intravenous barbiturates. The remaining 90% of anaesthetics given in the USA were with diethyl ether. In the United Kingdom and elsewhere, chloroform was also popular. Diethyl ether administration was a relatively safe and simple procedure, often delegated to nurses or junior doctors with little or no specific training in anaesthesia. During the Japanese attack on the US bases at Pearl Harbor, with reduced stocks of diethyl ether available, intravenous Sodium Pentothal(®), a most 'sophisticated and complex' drug, was used with devastating effects in many of those hypovolaemic, anaemic and septic patients. The hazards of spinal anaesthesia too were realised very quickly. These effects were compounded by the dearth of trained anaesthetists. This paper presents the significance of the anaesthesia tragedies at Pearl Harbor, and the discovery in the next few years of many other superior drugs that caused medical and other health professionals to realise that anaesthesia needed to be a specialist medical discipline in its own right. Specialist recognition, aided by the foundation of the National Health Service in the UK, the establishment of Faculties of Anaesthesia and appropriate training in pharmacology, physiology and other sciences soon followed. Modern anaesthesiology, as we understand it today, was born and a century or more of ether anaesthesia finally ceased.

  18. 75 FR 53574 - Safety Zone; Fireworks Displays, Potomac River, National Harbor, MD

    Science.gov (United States)

    2010-09-01

    ...-AA00 Safety Zone; Fireworks Displays, Potomac River, National Harbor, MD AGENCY: Coast Guard, DHS... safety of life on navigable waters during five fireworks displays launched from a discharge barge located... necessary to protect persons and vessels against the hazards associated with a fireworks display on...

  19. South-South Migration and Remittances

    OpenAIRE

    Ratha, Dilip; Shaw, William

    2007-01-01

    South-South Migration and Remittances reports on preliminary results from an ongoing effort to improve data on bilateral migration stocks. It sets out some working hypotheses on the determinants and socioeconomic implications of South-South migration. Contrary to popular perception that migration is mostly a South-North phenomenon, South-South migration is large. Available data from nation...

  20. 75 FR 5907 - Safety Zone; Dive Platform, Pago Pago Harbor, American Samoa

    Science.gov (United States)

    2010-02-05

    ... platform vessel in Pago Pago Harbor, American Samoa, while diving operations are under way in and around the CHEHALIS wreck. The safety zone is necessary to protect other vessels and the general public from... Pago, American Samoa. Today, the CHEHALIS wreck remains a potential pollution threat to the environment...

  1. Environmental Assessment for Waterfront Facilities Maintenance and Improvements, Pearl Harbor Naval Complex, Oahu, Hawaii

    National Research Council Canada - National Science Library

    2005-01-01

    Commander, Navy Region Hawaii (CNRH) proposes to repair, maintain, and improve waterfront berthing and maintenance facilities for ships and submarines on an as-needed basis within the Pearl Harbor Naval Complex (PHNC...

  2. Female harbor seal (Phoca vitulina) behavioral response to playbacks of underwater male acoustic advertisement displays.

    Science.gov (United States)

    Matthews, Leanna P; Blades, Brittany; Parks, Susan E

    2018-01-01

    During the breeding season, male harbor seals ( Phoca vitulina ) make underwater acoustic displays using vocalizations known as roars. These roars have been shown to function in territory establishment in some breeding areas and have been hypothesized to be important for female choice, but the function of these sounds remains unresolved. This study consisted of a series of playback experiments in which captive female harbor seals were exposed to recordings of male roars to determine if females respond to recordings of male vocalizations and whether or not they respond differently to roars from categories with different acoustic characteristics. The categories included roars with characteristics of dominant males (longest duration, lowest frequency), subordinate males (shortest duration, highest frequency), combinations of call parameters from dominant and subordinate males (long duration, high frequency and short duration, low frequency), and control playbacks of water noise and water noise with tonal signals in the same frequency range as male signals. Results indicate that overall females have a significantly higher level of response to playbacks that imitate male vocalizations when compared to control playbacks of water noise. Specifically, there was a higher level of response to playbacks representing dominant male vocalization when compared to the control playbacks. For most individuals, there was a greater response to playbacks representing dominant male vocalizations compared to playbacks representing subordinate male vocalizations; however, there was no statistical difference between those two playback types. Additionally, there was no difference between the playbacks of call parameter combinations and the controls. Investigating female preference for male harbor seal vocalizations is a critical step in understanding the harbor seal mating system and further studies expanding on this captive study will help shed light on this important issue.

  3. Remembering Pearl Harbor: The USS Arizona Memorial. Teaching with Historic Places.

    Science.gov (United States)

    Vierra, John, Jr.

    This lesson describes and discusses the submerged remains of the battleship USS Arizona which rests on the silt of Pearl Harbor (Hawaii), just as it had settled on December 7, 1941, the day Japan attacked the U.S. fleet and began the Pacific battles of World War II. The lesson is based on the National Register of Historic Places registration file,…

  4. 78 FR 68002 - Safety Zone for Fireworks Display, Baltimore Harbor, Baltimore, MD

    Science.gov (United States)

    2013-11-13

    ... 1625-AA00 Safety Zone for Fireworks Display, Baltimore Harbor, Baltimore, MD AGENCY: Coast Guard, DHS... safety of life on navigable waters during a fireworks display launched from a barge located in Baltimore... rule involves a fireworks display associated with a New Year's Eve event that will take place in...

  5. Benthic foraminifera distribution in high polluted sediments from Niterói Harbor (Guanabara Bay), Rio de Janeiro, Brazil

    OpenAIRE

    Claudia G. Vilela; Daniele S. Batista; José A. Batista-Neto; Mirian Crapez; John J. Mcallister

    2004-01-01

    Dockyards and harbors are recognized as being important locations where sediment-associated pollutants can accumulate, which constitutes an environmental risk to aquatic life due to potential uptake and accumulation of heavy metals in the biota. The aim of this paper is to assess the concentrations and the effects of some heavy metals in the benthic foraminifera assemblage in Niterói Harbor. Low concentrations in the benthic foraminifera as well as the dominance of indicative species such as ...

  6. Red mangrove (Rhizophora mangle) reproduction and seedling colonization after Hurricane Charley: Comparisons of Charlotte Harbor and Tampa Bay

    Science.gov (United States)

    Proffitt, C.E.; Milbrandt, E.C.; Travis, S.E.

    2006-01-01

    Reproductive aspects of life history are known to be important in recovery following disturbance in many plant species although this has not been well studied in mangroves. Hurricane Charley devastated large areas of mangroves in Charlotte Harbor, Florida, in August 2004. We surveyed 6 forests in Charlotte Harbor (2002, 2003, and 2005) and 16 in Tampa Bay, Florida (2001, 2002, 2003, and 2005) for total numbers of reproducing trees and trees heterozygotic for albinism that produce both normal and albino propagules. Tree size (estimated height and diameter at breast height) was also recorded for sentinel heterozygotic trees. Total number of reproducing trees km-1 was used as an index of reproductive output of the population, and deviation from the 3:1 (normal:albino propagules) ratio on heterozygotic trees expected with 100% selfing was used to estimate outcrossing. Numbers of Rhizophora mangle reproducing trees km-1 of shoreline in Charlotte Harbor were reduced by an order of magnitude following Hurricane Charley, while numbers of reproducing trees in Tampa Bay were similar to those of previous years. Reduced reproduction in Charlotte Harbor was accompanied by fewer new recruits in plots on Sanibel and Captiva Islands. Numbers of new recruits after the storm also tended to be fewer in plots where canopy loss was greater. More new recruits occurred in sites that had higher densities of pre-storm Rhizophora seedlings and greater relative dominance by Rhizophora. Outcrossing of sentinel trees was 2.5 times greater in Charlotte Harbor (mean site-1 = 33.6 ?? 6.7%; with 17% of forest sites completely selfing) than in Tampa Bay (mean site-1 = 13.4 ?? 4.7%; with 40% of sites completely selfing), although the implications for seedling recruitment of this difference are not known. ?? 2006 Estuarine Research Federation.

  7. Bluff evolution along coastal drumlins: Boston Harbor Islands, Massachusetts

    Science.gov (United States)

    Himmelstoss, E.A.; FitzGerald, D.M.; Rosen, P.S.; Allen, J.R.

    2006-01-01

    A series of partially drowned drumlins forms the backbone of the inner islands within Boston Harbor. The shoreline of these rounded glacial deposits is composed of actively retreating bluffs formed by continual wave attack. Comparisons of bluffs reveal variability in their height and lateral extent, as well as in the dominant mechanism causing their retreat. Two processes are responsible for bluff erosion and yield distinct bluff morphologies: (1) wave attack undercuts the bluff and causes episodic slumping, yielding planar bluff slopes, and (2) subaerial processes such as rainfall create irregular slopes characterized by rills and gullies. We propose a model of drumlin bluff evolution that is based on processes of erosion and physical characteristics such as bluff height, slope morphology, and the orientation of the bluff with respect to the long axis of the drumlin and its topographic crest. The four phases of drumlin bluff evolution consist of (1) initial formation of bluff, with retreat dominated by wave notching and slumping processes; (2) rill and gully development as bluff heights exceed 10 m and slumped sediment at bluff base inhibits wave attack; (3) return of wave notching and slumping as bluff heights decrease; and (4) final development of boulder retreat lag as last remnants of drumlin are eroded by wave action. These phases capture the important physical processes of drumlin evolution in Boston Harbor and could apply to other eroding coastal drumlin deposits.

  8. Immunization with avian metapneumovirus harboring chicken Fc induces higher immune responses.

    Science.gov (United States)

    Paudel, Sarita; Easwaran, Maheswaran; Jang, Hyun; Jung, Ho-Kyoung; Kim, Joo-Hun; Shin, Hyun-Jin

    2016-07-15

    In this study, we evaluated the immune responses of avian metapneumovirus harboring chicken Fc molecule. Stable Vero cells expressing chicken Fc chimera on its surface (Vero-cFc) were established, and we confirmed that aMPV grown in Vero-cFc incorporated host derived chimera Fc into the aMPV virions. Immunization of chicken with aMPV-cFc induced higher level of antibodies and inflammatory cytokines; (Interferon (IFN)-γ and Interleukin (IL)-1β) compared to those of aMPV. The increased levels of antibodies and inflammatory cytokines in chicken immunized with aMPV-cFc were statistically significantly (p<0.05) to that of aMPV and control. The aMPV-cFc group also generated the highest neutralizing antibody response. After challenges, chickens immunized with aMPV-cFc showed much less pathological signs in nasal turbinates and trachea so that we could confirm aMPV-cFc induced higher protection than that of aMPV. The greater ability of aMPV harboring chicken Fc to that of aMPV presented it as a possible vaccine candidate. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Environmental Assessment for Building 88 Interior Demolition, Pearl Harbor Naval Complex, O'ahu, Hawaii

    National Research Council Canada - National Science Library

    2005-01-01

    ...) and ancillary equipment from the interior of Building 88, a former lubricating oil storage facility, and the related exposed piping underneath Mike wharves M3 and M4 at Merry Point, Pearl Harbor Naval Complex...

  10. Application of heterogeneous multiple camera system with panoramic capabilities in a harbor environment

    NARCIS (Netherlands)

    Schwering, P.B.W.; Lensen, H.A.; Broek, S.P. van den; Hollander, R.J.M. den; Mark, W. van der; Bouma, H.; Kemp, R.A.W.

    2009-01-01

    In a harbor environment threats like explosives-packed rubber boats, mine-carrying swimmers and divers must be detected in an early stage. This paper describes the integration and use of a heterogeneous multiple camera system with panoramic observation capabilities for detecting these small vessels

  11. 33 CFR 165.114 - Safety and Security Zones: Escorted Vessels-Boston Harbor, Massachusetts.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones... COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION... Guard District § 165.114 Safety and Security Zones: Escorted Vessels—Boston Harbor, Massachusetts. (a...

  12. 75 FR 18056 - Safety Zone; Fireworks Display, Patuxent River, Solomons Island Harbor, MD

    Science.gov (United States)

    2010-04-09

    ... the event, and enhancing public and maritime safety. Basis and Purpose Fireworks displays are... promote public and maritime safety during a fireworks display, and to protect mariners transiting the area...-AA00 Safety Zone; Fireworks Display, Patuxent River, Solomons Island Harbor, MD AGENCY: Coast Guard...

  13. 77 FR 11434 - Safety Zone; Patapsco River, Northwest and Inner Harbors, Baltimore, MD

    Science.gov (United States)

    2012-02-27

    ...-AA00 Safety Zone; Patapsco River, Northwest and Inner Harbors, Baltimore, MD AGENCY: Coast Guard, DHS... intended route immediately prior to, during, and following the scheduled towing evolution, vessel traffic... made to the maritime community via marine information broadcasts so mariners may adjust their plans...

  14. Aerial Survey Trend Counts of Harbor Seals in Coastal Alaska (1984-2006) - ADF&G

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Aerial surveys were conducted during 1983–2006 in the Ketchikan, Sitka, Kodiak, and Bristol Bay areas of Alaska to estimate trends in abundance of harbor seals.

  15. A non-invasive approach to study lifetime exposure and bioaccumulation of PCBs in protected marine mammals: PBPK modeling in harbor porpoises

    International Nuclear Information System (INIS)

    Weijs, Liesbeth; Covaci, Adrian; Yang, Raymond S.H.; Das, Krishna; Blust, Ronny

    2011-01-01

    In the last decade, physiologically based pharmacokinetic (PBPK) models have increasingly been developed to explain the kinetics of environmental pollutants in wildlife. For marine mammals specifically, these models provide a new, non-destructive tool that enables the integration of biomonitoring activities and in vitro studies. The goals of the present study were firstly to develop PBPK models for several environmental relevant PCB congeners in harbor porpoises (Phocoena phocoena), a species that is sensitive to pollution because of its limited metabolic capacity for pollutant transformation. These models were tested using tissue data of porpoises from the Black Sea. Secondly, the predictive power of the models was investigated for time trends in the PCB concentrations in North Sea harbor porpoises between 1990 and 2008. Thirdly, attempts were made to assess metabolic capacities of harbor porpoises for the investigated PCBs. In general, results show that parameter values from other species (rodents, humans) are not always suitable in marine mammal models, most probably due to differences in physiology and exposure. The PCB 149 levels decrease the fastest in male harbor porpoises from the North Sea in a time period of 18 years, whereas the PCB 101 levels decrease the slowest. According to the models, metabolic breakdown of PCB 118 is probably of lesser importance compared to other elimination pathways. For PCB 101 and 149 however, the presence of their metabolites can be attributed to bioaccumulation of metabolites from the prey and to metabolic breakdown of the parent compounds in the harbor porpoises. - Highlights: → PBPK modeling was used to study the kinetics of several PCBs in a marine mammal. → Harbor porpoises are sensitive to pollution and therefore ideal model organisms. → Black Sea data were used for parameterization. → North Sea data for assessing temporal trends (1990-2008). → PBPK modeling is a non-invasive and non-destructive tool.

  16. Safe Harbor Legislation for Juvenile Victims of Sex Trafficking: A Myopic View of Improvements in Practice

    Directory of Open Access Journals (Sweden)

    Kimberly Mehlman-Orozco

    2015-02-01

    Full Text Available Current social and political realties have focused attention on human trafficking in the United States. Although new mechanisms for criminalizing offenders and protecting victims are increasingly funded and implemented across the country, empirical exploration into the efficacy of these interventions is lacking. This article uses yearly count data on juvenile prostitution arrests aggregated at the state level to explore the criminalization of commercial sexually exploited children post safe harbor policy implementation. Preliminary data from four states suggests that the passage of safe harbor laws may not reduce the number of juveniles arrested for prostitution crimes. Implications for future research are discussed.

  17. Phaeobacter inhibens from the Roseobacter clade has an environmental niche as a surface colonizer in harbors

    DEFF Research Database (Denmark)

    Gram, Lone; Rasmussen, Bastian Barker; Wemheuer, Bernd

    2015-01-01

    in the environment is to date unknown. Here, we report on the repeated isolation of Phaeobacter inhibens strains from a marine environment (harbors) not related to aquaculture. Based on phenotype and 16S rRNA gene sequence similarity, a total of 64 P. inhibens strains were identified from 35 samples (eukaryotic...... and used for amplification of 16S rRNA. P. inhibens was detected in five of these samples, all of which were biofilm samples, by pyrotag-sequencing at a prevalence of 0.02–0.68% of the prokaryotic community. The results indicated that P. inhibens had a niche in biofilms of fouled surfaces in harbor areas...

  18. NifH- Harboring Bacterial Community Composition Across an Alaskan Permafrost Thaw Gradient

    Directory of Open Access Journals (Sweden)

    Christopher Ryan Penton

    2016-11-01

    Full Text Available Since nitrogen (N is often limiting in permafrost soils, we investigated the N2-fixing genetic potential and the inferred taxa harboring those genes by sequencing nifH gene fragments in samples taken along a permafrost thaw gradient in an Alaskan boreal soil. Samples from minimally, moderately and extensively thawed sites were taken to a depth of 79 cm to encompass zones above and below the depth of the water table. NifH reads were translated with frameshift correction and 112,476 sequences were clustered at 5% amino acid dissimilarity resulting in 1,631 OTUs. Sample depth in relation to water table depth was correlated to differences in the NifH sequence classes. NifH sequences most closely related to group I nifH-harboring Alpha- and Beta Proteobacteria were in higher abundance above water table depth while those related to group III nifH-harboring Delta and Gamma Proteobacteria were more abundant below. The most dominant below water table depth NifH sequences, comprising 1/3 of the total, were distantly related to Verrucomicrobia-Opitutaceae. Overall, these results suggest that permafrost thaw alters the class-level composition of N2-fixing communities in the thawed soil layers and that this distinction corresponds to the depth of the water table. These nifH data were also compared to nifH sequences obtained from a study at an Alaskan taiga site, and to those of other geographically distant, non-permafrost sites. The two Alaska sites were differentiated largely by changes in relative abundances of the same OTUs, whereas the non-Alaska sites were differentiated by the lack of many Alaskan OTUs, and the presence of unique halophilic, sulfate- and iron-reducing taxa in the Alaska sites.

  19. Ecological evaluation of proposed discharge of dredged material from Oakland Harbor into ocean waters (Phase 3 B of -42-foot project)

    Energy Technology Data Exchange (ETDEWEB)

    Kohn, N.P.; Ward, J.A.; Mayhew, H.L.; Word, J.Q.; Barrows, E.S.; Goodwin, S.M.; Lefkovitz, L.F. (Battelle/Marine Sciences Lab., Sequim, WA (United States))

    1992-06-01

    The Water Resources Development Act of 1986 (Public Law 99-662) authorized the US Army Corps of Engineers (USACE) San Francisco District, to deepen and widen the navigational channels of the Oakland Inner and Outer Harbors to accommodate deeper-draft vessels. The USACE is considering several disposal options for the dredged material removed during these channel improvements including open-water disposal. Dredged material proposed for open-water disposal must be evaluated to determine the potential impacts of the disposal activity on the water column and disposal site environments. The USACE requested that Battelle/Marine Sciences Laboratory (MSL) conduct studies to evaluate open-water disposal options for Oakland Harbor sediments. This request developed into the Oakland Harbor Phase III Program. This is Volume 2 of a two-volume report that presents information gathered to determine the suitability of ocean disposal of sediments dredged from Oakland Harbor. This volume contains the Appendixes (A through N), which provide details of the data analyses and full presentation of the data and results.

  20. 78 FR 63136 - Drawbridge Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA

    Science.gov (United States)

    2013-10-23

    ...-AA09 Drawbridge Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA AGENCY: Coast... 4.6, both at New Orleans, LA. This proposed change would allow for the safe navigation of vessels... Department of Transportation and Development (LDOTD) (representing the New Orleans Levee District which is...

  1. 33 CFR 165.116 - Safety and Security Zones; Salem and Boston Harbors, Massachusetts.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones; Salem..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED... § 165.116 Safety and Security Zones; Salem and Boston Harbors, Massachusetts. (a) Location. The...

  2. One surgeon's Army experience with "wound shock" from Pearl Harbor to the present.

    Science.gov (United States)

    Hardaway, Robert M

    2009-09-01

    The Army has had extensive experience in the study and treatment of shock, beginning with the American Civil War and continuing to the present. This is the story of one Army surgeon's experience, both in research and treatment of shock, from Pearl Harbor to the present.

  3. 76 FR 57087 - Stone Harbor Investment Partners LP, et al.; Notice of Application

    Science.gov (United States)

    2011-09-15

    ... SECURITIES AND EXCHANGE COMMISSION [Investment Company Act Release No. 29784; File No. 812-13931] Stone Harbor Investment Partners LP, et al.; Notice of Application September 7, 2011. AGENCY: Securities..., or cause more than 10% of the acquired company's voting stock to be owned by investment companies and...

  4. 78 FR 36662 - Safety Zone; Fairport Harbor Mardi Gras, Lake Erie, Fairport, OH

    Science.gov (United States)

    2013-06-19

    ... the Fairport Harbor Mardi Gras Fireworks display. This temporary safety zone is necessary to protect spectators and vessels from the hazards associated with a fireworks display. DATES: This rule is effective...: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on Lake Erie...

  5. Bacterial Communities in Polluted Seabed Sediments: A Molecular Biology Assay in Leghorn Harbor

    Directory of Open Access Journals (Sweden)

    Carolina Chiellini

    2013-01-01

    Full Text Available Seabed sediments of commercial ports are often characterized by high pollution levels. Differences in number and distribution of bacteria in such areas can be related to distribution of pollutants in the port and to sediment conditions. In this study, the bacterial communities of five sites from Leghorn Harbor seabed were characterized, and the main bacterial groups were identified. T-RFLP was used for all samples; two 16S rRNA libraries and in silico digestion of clones were used to identify fingerprint profiles. Library data, phylogenetic analysis, and T-RFLP coupled with in silico digestion of the obtained sequences evidenced the dominance of Proteobacteria and the high percentage of Bacteroidetes in all sites. The approach highlighted similar bacterial communities between samples coming from the five sites, suggesting a modest differentiation among bacterial communities of different harbor seabed sediments and hence the capacity of bacterial communities to adapt to different levels and types of pollution.

  6. Grace Under Fire: The Army Nurses of Pearl Harbor, 1941.

    Science.gov (United States)

    Milbrath, Gwyneth R

    2016-01-01

    Much has been written about the military events of December 7, 1941; however, little has been documented about the nurses' work and experience at Pearl Harbor, Hawaii. The aerial assault on Pearl Harbor was the first time in US history that Army nurses had been on the front line of battle. Nurses quickly triaged and stabilized those who could be saved, and provided compassion and comfort to those who were dying, in an environment where the nurses were unsure of their own survival. Traditional historical methods and a social history framework were used in this investigation. Primary sources included oral histories from the US Army Medical Department Center of History and Heritage and the State of Hawaii's website, Hawaii Aviation. Secondary sources included published books, newspaper articles, military websites, and history texts. Due to the limited bed capacity, Hickam Field Hospital converted to an evacuation hospital. Nurses, physicians, and medical corpsman triaged, stabilized, and transported those likely to survive, while staging the dead behind the building. The emergency room at Tripler Hospital was quickly flooded with patients from the battlefield, but the staff was able to sort patients appropriately to the wards, to the operating room, or provide comfort care as they died. At Schofield Hospital, collaboration between tireless doctors, nurses, and corpsmen was key to providing life-saving surgery and care.

  7. DEPOT MAINTENANCE: Key Financial Issues for Consolidations at Pearl Harbor and Elsewhere Are Still Unresolved

    National Research Council Canada - National Science Library

    2001-01-01

    .... In September 1999, we reported that the preliminary results of the ongoing Pearl Harbor pilot were mixed and recommended that the Departments of Defense and the Navy address unresolved issues related...

  8. 78 FR 27304 - Safety Zone; Melrose Pyrotechnics Fireworks Display; Chicago Harbor, Chicago, IL

    Science.gov (United States)

    2013-05-10

    ... environmental risk to health or risk to safety that may disproportionately affect children. 11. Indian Tribal... Pier in Chicago Harbor, Chicago, IL. The Captain of the Port, Lake Michigan, has determined that these fireworks displays will pose a significant risk to public safety and property. Such hazards include falling...

  9. Brain Meta-Transcriptomics from Harbor Seals to Infer the Role of the Microbiome and Virome in a Stranding Event.

    Science.gov (United States)

    Rosales, Stephanie M; Thurber, Rebecca Vega

    2015-01-01

    Marine diseases are becoming more frequent, and tools for identifying pathogens and disease reservoirs are needed to help prevent and mitigate epizootics. Meta-transcriptomics provides insights into disease etiology by cataloguing and comparing sequences from suspected pathogens. This method is a powerful approach to simultaneously evaluate both the viral and bacterial communities, but few studies have applied this technique in marine systems. In 2009 seven harbor seals, Phoca vitulina, stranded along the California coast from a similar brain disease of unknown cause of death (UCD). We evaluated the differences between the virome and microbiome of UCDs and harbor seals with known causes of death. Here we determined that UCD stranded animals had no viruses in their brain tissue. However, in the bacterial community, we identified Burkholderia and Coxiella burnetii as important pathogens associated with this stranding event. Burkholderia were 100% prevalent and ~2.8 log2 fold more abundant in the UCD animals. Further, while C. burnetii was found in only 35.7% of all samples, it was highly abundant (~94% of the total microbial community) in a single individual. In this harbor seal, C. burnetii showed high transcription rates of invading and translation genes, implicating it in the pathogenesis of this animal. Based on these data we propose that Burkholderia taxa and C. burnetii are potentially important opportunistic neurotropic pathogens in UCD stranded harbor seals.

  10. Brain Meta-Transcriptomics from Harbor Seals to Infer the Role of the Microbiome and Virome in a Stranding Event.

    Directory of Open Access Journals (Sweden)

    Stephanie M Rosales

    Full Text Available Marine diseases are becoming more frequent, and tools for identifying pathogens and disease reservoirs are needed to help prevent and mitigate epizootics. Meta-transcriptomics provides insights into disease etiology by cataloguing and comparing sequences from suspected pathogens. This method is a powerful approach to simultaneously evaluate both the viral and bacterial communities, but few studies have applied this technique in marine systems. In 2009 seven harbor seals, Phoca vitulina, stranded along the California coast from a similar brain disease of unknown cause of death (UCD. We evaluated the differences between the virome and microbiome of UCDs and harbor seals with known causes of death. Here we determined that UCD stranded animals had no viruses in their brain tissue. However, in the bacterial community, we identified Burkholderia and Coxiella burnetii as important pathogens associated with this stranding event. Burkholderia were 100% prevalent and ~2.8 log2 fold more abundant in the UCD animals. Further, while C. burnetii was found in only 35.7% of all samples, it was highly abundant (~94% of the total microbial community in a single individual. In this harbor seal, C. burnetii showed high transcription rates of invading and translation genes, implicating it in the pathogenesis of this animal. Based on these data we propose that Burkholderia taxa and C. burnetii are potentially important opportunistic neurotropic pathogens in UCD stranded harbor seals.

  11. 78 FR 62439 - Drawbridge Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA

    Science.gov (United States)

    2013-10-22

    ... Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA AGENCY: Coast Guard, DHS. ACTION..../Seabrook) bridge across the IHNC, mile 4.6, both at New Orleans, LA. This deviation will test changes to... Intra-Costal Waterway (GIWW). The US 90 (Danzinger) Bridge across the IHNC, mile 3.1, at New Orleans...

  12. 75 FR 8486 - Drawbridge Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA

    Science.gov (United States)

    2010-02-25

    ... Operation Regulation; Inner Harbor Navigational Canal, New Orleans, LA AGENCY: Coast Guard, DHS. ACTION... EHL), at New Orleans, LA. The deviation is necessary to replace the counterweight wire ropes on the... Building Ground Floor, Room W12-140, 1200 New Jersey Avenue, SE., Washington, DC 20590, between 9 a.m. and...

  13. Aerial Survey Counts of Harbor Seals in Lake Iliamna, Alaska, 1984-2013 (NODC Accession 0123188)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset provides counts of harbor seals from aerial surveys over Lake Iliamna, Alaska, USA. The data have been collated from three previously published sources...

  14. A Dataset of Aerial Survey Counts of Harbor Seals in Iliamna Lake, Alaska: 1984-2013

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset provides counts of harbor seals from aerial surveys over Iliamna Lake, Alaska, USA. The data have been collated from three previously published sources...

  15. Characteristics and management of Enterobacteriaceae harboring IMP-4 or IMP-8 carbapenemase in a tertiary hospital.

    Science.gov (United States)

    Pang, Feng; Jia, Xiu-Qin; Song, Zhen-Zhu; Li, Yan-Hua; Wang, Bin; Zhao, Qi-Gang; Wang, Chuan-Xin; Zhang, Yi; Wang, Le-Xin

    2016-03-01

    The emergence of Enterobacteriaceae harboring IMP-4 or IMP-8 carbapenemases is rare. We report an occurrence of Enterobacteriaceae harboring IMP-4 or IMP-8 carbapenemases in a Chinese tertiary care hospital from November 2010 to December 2012. The clinical characteristics of 30 patients were described. The genetic relationship of isolates was determined by pulsed-field gel electrophoresis (PFGE). Carbapenemases were detected by modified Hodge test (MHT) and polymerase chain reactions (PCRs). Amplicons were sequenced and blasted to determine the genotype. Most infected patients were from intensive care unit and had complex and serious underlying illnesses requiring mechanical ventilation. PFGE revealed that Klebsiella pneumoniae showed two major PFGE types. Two Klebsiella oxytoca had an indistinguishable PFGE pattern, while four Enterobacter cloacae were different strains. The sequencing studies showed Enterobacteriaceae harboring IMP-4 or IMP-8 carbapenemase in the 23 infected patients. The majority of patients had infections with the carbapenemase-producing Enterobacteriaceae (CPE) strain, most were successfully treated with a range of antibiotics and discharged. It is important to maintain a high index of suspicion to screen for carbapenemase-producing Enterobacteriaceae strains. Rapid identification of these strains and implementation of stringent procedures are the key to prevent major outbreaks in a hospital setting.

  16. Assay dependence of Brucella antibody prevalence in a declining Alaskan harbor seal (Phoca vitulina population

    Directory of Open Access Journals (Sweden)

    Hueffer Karsten

    2013-01-01

    Full Text Available Abstract Background Brucella is a group of bacteria that causes brucellosis, which can affect population health and reproductive success in many marine mammals. We investigated the serological prevalence of antibodies against Brucella bacteria in a declining harbor seal population in Glacier Bay National Park, Alaska. Results Prevalence ranged from 16 to 74 percent for those tests detecting antibodies, indicating that harbor seals in Glacier Bay have been exposed to Brucella bacteria. However, the actual level of serological prevalence could not be determined because results were strongly assay-dependent. Conclusions This study reinforces the need to carefully consider assay choice when comparing different studies on the prevalence of anti–Brucella antibodies in pinnipeds and further highlights the need for species- or taxon-specific assay validation for both pathogen and host species.

  17. 75 FR 18887 - Division of Longshore and Harbor Workers' Compensation; Proposed Collection; Comment Request

    Science.gov (United States)

    2010-04-13

    ... can be provided in the desired format, reporting burden (time and financial resources) is minimized... comment on proposed and/or continuing collections of information in accordance with the paperwork... concerning the proposed collection: Securing Financial Obligations under the Longshore and Harbor Workers...

  18. Detection of multidrug-resistant Pseudomonas aeruginosa harboring bla GES-1 and bla GES-11 in Recife, Brazil

    Directory of Open Access Journals (Sweden)

    Valdemir Vicente da Silva Júnior

    Full Text Available Abstract INTRODUCTION: Pseudomonas aeruginosa, an important pathogen globally, presents several resistance mechanisms. This study aimed to investigate the presence of bla GES in clinical isolates of Pseudomonas aeruginosa obtained from various clinical specimens from patients admitted to three different hospitals in Recife, Brazil. The Guiana extended spectrum beta-lactamase (GES enzymes are responsible for conferring broad spectrum resistance to beta-lactam drugs, including the carbapenems. METHODS: A total of 100 carbapenem-resistant P. aeruginosa isolates underwent polymerase chain reaction (PCR testing to identify bla GES, bla KPC, bla SPM-1, bla IMP, and bla VIM. Additionally, PCR products positive for bla GES were sequenced. The clonal profiles of these same isolates were then determined by means of enterobacterial repetitive intergenic consensus (ERIC-PCR analysis. RESULTS: PCR analysis revealed that four isolates harbored bla GES; DNA sequencing showed that two harbored bla GES-1 and two bla GES-11. Beta-lactamase genes bla SPM-1, bla IMP, bla VIM, and bla KPC were investigated; none of these genes was detected. Automated susceptibility testing methods (Vitek®2, bioMérieux showed that the bla GES-1-positive isolates were only susceptible to polymyxin B. The patterns obtained with ERIC-PCR methods showed clonal relationship between the two isolates that harbored bla GES-11, whereas different clonal profiles were found in the isolates harboring bla GES-1. CONCLUSIONS: We detected the presence of bacterial isolates positive for two different variants of the enzyme GES in three different hospitals from Recife, Brazil. These enzymes have a great capacity for dissemination among Gram-negative bacteria and confer broad-spectrum resistance to beta-lactam antibiotics and to the carbapenems.

  19. 33 CFR 334.470 - Cooper River and Charleston Harbor, S.C.; restricted areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Cooper River and Charleston....470 Cooper River and Charleston Harbor, S.C.; restricted areas. (a) The restricted areas. (1) Area No. 1 is that portion of the Cooper River beginning near the westerly shore north of Shipyard Creek at...

  20. Radiological survey of the Pearl Harbor Naval Shipyard and Environs, Honolulu, Hawaii. Final report

    International Nuclear Information System (INIS)

    Callis, R.S.

    1987-06-01

    This report presents results of the survey conducted by the Eastern Environmental Radiation Facility personnel to assess levels of environmental radioactivity resulting from maintenance and operation of nuclear-powered warships at the Pearl Harbor Naval Shipyard and Environs on the Hawaiian Island of Oahu

  1. Hydraulic experiment on flow and topography change in harbor due to tsunami and its numerical simulation

    International Nuclear Information System (INIS)

    Fujii, Naoki; Ikeno, Masaaki; Sakakiyama, Tsutomu; Matsuyama, Masafumi; Takao, Makoto; Mukohara, Takeshi

    2009-01-01

    Numerical model of topography change is important to examine collapse of the harbor facilities by sand transport due to tsunami. Problems for evaluation of sand transport due to tsunami with topography change model are in precision of the numerical model and topography change data. Therefore, we installed the harbor in large-scaled wave tank and carried out experiment about tsunami flow and topography change to get those detailed data. For results provided by experimental test, we applied the topography change model of Ikeno et al. (2009a) and evaluated it about the reproduction characteristics. As a result, it was confirmed that reproduction of an experiment improved by using new pickup rate formula proposed by Ikeno et al. (2009a). (author)

  2. 76 FR 82117 - Regulations Implementing the Longshore and Harbor Workers' Compensation Act: Recreational Vessels

    Science.gov (United States)

    2011-12-30

    ... activity, and whether it falls within the Coast Guard definition of a non- recreational vessel less than 20... recreational vessel work, the employee will be eligible for benefits based on the covered work. The last... Regulations Implementing the Longshore and Harbor Workers' Compensation Act: Recreational Vessels AGENCY...

  3. 78 FR 57319 - Children's Online Privacy Protection Rule Safe Harbor Proposed Self-Regulatory Guidelines...

    Science.gov (United States)

    2013-09-18

    ...-AB20 Children's Online Privacy Protection Rule Safe Harbor Proposed Self-Regulatory Guidelines; kidSAFE... proposed self-regulatory guidelines submitted by the kidSAFE Seal Program (``kidSAFE''), owned and operated... enabling industry groups or others to submit to the Commission for approval self-regulatory guidelines that...

  4. Feeding kinematics, suction, and hydraulic jetting performance of harbor seals (Phoca vitulina.

    Directory of Open Access Journals (Sweden)

    Christopher D Marshall

    Full Text Available The feeding kinematics, suction and hydraulic jetting capabilities of captive harbor seals (Phoca vitulina were characterized during controlled feeding trials. Feeding trials were conducted using a feeding apparatus that allowed a choice between biting and suction, but also presented food that could be ingested only by suction. Subambient pressure exerted during suction feeding behaviors was directly measured using pressure transducers. The mean feeding cycle duration for suction-feeding events was significantly shorter (0.15±0.09 s; P<0.01 than biting feeding events (0.18±0.08 s. Subjects feeding in-water used both a suction and a biting feeding mode. Suction was the favored feeding mode (84% of all feeding events compared to biting, but biting comprised 16% of feeding events. In addition, seals occasionally alternated suction with hydraulic jetting, or used hydraulic jetting independently, to remove fish from the apparatus. Suction and biting feeding modes were kinematically distinct regardless of feeding location (in-water vs. on-land. Suction was characterized by a significantly smaller gape (1.3±0.23 cm; P<0.001 and gape angle (12.9±2.02°, pursing of the rostral lips to form a circular aperture, and pursing of the lateral lips to occlude lateral gape. Biting was characterized by a large gape (3.63±0.21 cm and gape angle (28.8±1.80°; P<0.001 and lip curling to expose teeth. The maximum subambient pressure recorded was 48.8 kPa. In addition, harbor seals were able to jet water at food items using suprambient pressure, also known as hydraulic jetting. The maximum hydraulic jetting force recorded was 53.9 kPa. Suction and hydraulic jetting where employed 90.5% and 9.5%, respectively, during underwater feeding events. Harbor seals displayed a wide repertoire of behaviorally flexible feeding strategies to ingest fish from the feeding apparatus. Such flexibility of feeding strategies and biomechanics likely forms the basis of their

  5. Assessment for water quality by artificial neural network in Daya Bay, South China Sea.

    Science.gov (United States)

    Wu, Mei-Lin; Wang, You-Shao; Gu, Ji-Dong

    2015-10-01

    In this study, artificial neural network such as a self-organizing map (SOM) was used to assess for the effects caused by climate change and human activities on the water quality in Daya Bay, South China Sea. SOM has identified the anthropogenic effects and seasonal characters of water quality. SOM grouped the four seasons as four groups (winter, spring, summer and autumn). The Southeast Asian monsoons, northeasterly from October to the next April and southwesterly from May to September have also an important influence on the water quality in Daya Bay. Spatial pattern is mainly related to anthropogenic activities and hydrodynamics conditions. In spatial characteristics, the water quality in Daya Bay was divided into two groups by chemometrics. The monitoring stations (S3, S8, S10 and S11) were in these area (Dapeng Ao, Aotou Harbor) and northeast parts of Daya Bay, which are areas of human activity. The thermal pollution has been observed near water body in Daya Bay Nuclear Power Plant (S5). The rest of the monitoring sites were in the south, central and eastern parts of Daya Bay, which are areas that experience water exchanges from South China Sea. The results of this study may provide information on the spatial and temporal patterns in Daya Bay. Further research will be carry out more research concerning functional changes in the bay ecology with respect to changes in climatic factor, human activities and bay morphology in Daya Bay.

  6. Benthic grab data from October 1994 in the Lower Bay of New York/New Jersey Harbor

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Benthic grab samples were collected using a Shipek grab at pre-determined locations in the harbor. Taxonomic enumerations and biological community parameters were...

  7. Design and execution of double slits type straight caisson at exclusive harbors of Ooma nuclear power plant

    International Nuclear Information System (INIS)

    Tsukamoto, Kunihiro; Yamamoto, Morikuni; Naruoka, Masayoshi; Matsubara, Takayuki

    2004-01-01

    Ooma nuclear power plant is going to build the exclusive harbors, of which west breakwater is a double slits type straight caisson bank (double slits caisson). It contains double transmission walls and retarding rooms, which show large effect of breaker, because the reflected wave height of short-period component is decreased in the rear retarding room and one of long-period component decreased in both retarding rooms. Accordingly, it is seemed to be proved larger effect of breaker than one slit type caisson. Outline of harbors construction, adoption of double slits caisson, design of caisson, construction of caisson and installation are stated. The effect of breaker of double slits caisson is shown. (S.Y.)

  8. Processes influencing the transport and fate of contaminated sediments in the coastal ocean: Boston Harbor and Massachusetts Bay

    Science.gov (United States)

    Alexander, P. Soupy; Baldwin, Sandra M.; Blackwood, Dann S.; Borden, Jonathan; Casso, Michael A.; Crusius, John; Goudreau, Joanne; Kalnejais, Linda H.; Lamothe, Paul J.; Martin, William R.; Martini, Marinna A.; Rendigs, Richard R.; Sayles, Frederick L.; Signell, Richard P.; Valentine, Page C.; Warner, John C.; Bothner, Michael H.; Butman, Bradford

    2007-01-01

    Most of the major urban centers of the United States including Boston, New York, Washington, Chicago, New Orleans, Miami, Los Angeles, San Francisco, and Seattle—are on a coast (fig. 1.1). All of these cities discharge treated sewage effluent into adjacent waters. In 2000, 74 percent of the U.S. population lived within 200 kilometers (km) of the coast. Between 1980 and 2002, the population density in coastal communities increased approximately 4.5 times faster than in noncoastal areas of the U.S. (Perkins, 2004). More people generate larger volumes of wastes, increase the demands on wastewater treatment, expand the area of impervious land surfaces, and use more vehicles that contribute contaminants to street runoff. According to the National Coastal Condition Report II (U.S. Environmental Protection Agency, 2005a), on the basis of coastal habitat, water and sediment quality, benthic index, and fish tissue, the overall national coastal condition is only poor to fair and the overall coastal condition in the highly populated Northeast is poor. Scientific information helps managers to prioritize and regulate coastal-ocean uses that include recreation, commercial fishing, transportation, waste disposal, and critical habitat for marine organisms. These uses are often in conflict with each other and with environmental concerns. Developing a strategy for managing competing uses while maintaining sustainability of coastal resources requires scientific understanding of how the coastal ocean system behaves and how it responds to anthropogenic influences. This report provides a summary of a multidisciplinary research program designed to improve our understanding of the transport and fate of contaminants in Massachusetts coastal waters. Massachusetts Bay and Boston Harbor have been a focus of U.S. Geological Survey (USGS) research because they provide a diverse geographic setting for developing a scientific understanding of the geology, geochemistry, and oceanography of

  9. Marine biodiversity in South Africa: an evaluation of current states of knowledge.

    Directory of Open Access Journals (Sweden)

    Charles L Griffiths

    Full Text Available Continental South Africa has a coastline of some 3,650 km and an Exclusive Economic Zone (EEZ of just over 1 million km(2. Waters in the EEZ extend to a depth of 5,700 m, with more than 65% deeper than 2,000 m. Despite its status as a developing nation, South Africa has a relatively strong history of marine taxonomic research and maintains comprehensive and well-curated museum collections totaling over 291,000 records. Over 3 million locality records from more than 23,000 species have been lodged in the regional AfrOBIS (African Ocean Biogeographic Information System data center (which stores data from a wider African region. A large number of regional guides to the marine fauna and flora are also available and are listed. The currently recorded marine biota of South Africa numbers at least 12,914 species, although many taxa, particularly those of small body size, remain poorly documented. The coastal zone is relatively well sampled with some 2,500 samples of benthic invertebrate communities have been taken by grab, dredge, or trawl. Almost none of these samples, however, were collected after 1980, and over 99% of existing samples are from depths shallower than 1,000 m--indeed 83% are from less than 100 m. The abyssal zone thus remains almost completely unexplored. South Africa has a fairly large industrial fishing industry, of which the largest fisheries are the pelagic (pilchard and anchovy and demersal (hake sectors, both focused on the west and south coasts. The east coast has fewer, smaller commercial fisheries, but a high coastal population density, resulting in intense exploitation of inshore resources by recreational and subsistence fishers, and this has resulted in the overexploitation of many coastal fish and invertebrate stocks. South Africa has a small aquaculture industry rearing mussels, oysters, prawns, and abalone-the latter two in land-based facilities. Compared with many other developing countries, South Africa has a well

  10. 76 FR 4574 - Drawbridge Operation Regulations; Oakland Inner Harbor Tidal Canal, Oakland/Alameda, CA, Schedule...

    Science.gov (United States)

    2011-01-26

    ... Boating Federation, Hanson Aggregates, Power Engineering, Harbor Bay Maritime, Dutra Group, Oakland Yacht... Association, Aeolian Yacht Club, Briar Rose Yacht Charters, Baytech Marine Service, Heinold's First and Last... Outboard Motor Shop, Waterfront Hotel-Miss Pearl's Restaurant, Encinal Yacht Club, Marina Village Inn...

  11. 33 CFR 110.190 - Tortugas Harbor, in vicinity of Garden Key, Dry Tortugas, Fla.

    Science.gov (United States)

    2010-07-01

    ... Garden Key, Dry Tortugas, Fla. 110.190 Section 110.190 Navigation and Navigable Waters COAST GUARD..., in vicinity of Garden Key, Dry Tortugas, Fla. (a) The anchorage grounds. All of Bird Key Harbor, southwest of Garden Key, bounded by the surrounding reefs and shoals and, on the northeast, by a line...

  12. Clinical and CT characteristics of surgically resected lung adenocarcinomas harboring ALK rearrangements or EGFR mutations

    International Nuclear Information System (INIS)

    Wang, Hua; Schabath, Matthew B.; Liu, Ying; Han, Ying; Li, Qi; Gillies, Robert J.; Ye, Zhaoxiang

    2016-01-01

    Purpose: To determine if clinical and CT characteristics of surgically resected lung adenocarcinomas can distinguish those harboring ALK rearrangements from EGFR mutations. Materials and methods: Patients who had surgical resection and histologically confirmed lung adenocarcinoma were enrolled, including 41 patients with ALK rearrangements and 66 patients with EGFR mutations. Eighteen categorical and six quantitative CT characteristics were used to evaluate the tumors. Differences in clinical and CT characteristics between the two groups were investigated. Results: Age (P = 0.003), histological subtypes (P < 0.001), pathological stage (P = 0.007), and five CT characteristics, including size (P < 0.001), GGO (P = 0.001), bubble-like lucency (P = 0.048), lymphadenopathy (P = 0.001), and tumor shadow disappearance rate (P = 0.005) were significantly different between patients harboring ALK rearrangements compared to patients with EGFR mutations. When we compared histologic components, a solid pattern was more common (P = 0.009) in tumors with ALK rearrangements, and lepidic and acinar patterns were more common (P < 0.001 and P = 0.040, respectively) in those with EGFR mutations. Backward elimination analyses revealed that age (OR = 0.93; 95% CI 0.89–0.98), GGO (OR = 0.14; 95% CI 0.03–0.67), and lymphadenopathy (OR = 4.15; 95% CI 1.49–11.60) were significantly associated with ALK rearrangement status. Conclusion: Our analyses revealed that clinical and CT characteristics of lung adenocarcinomas harboring ALK rearrangements were significantly different, compared with those with EGFR mutations. These differences may be related to the molecular pathology of these diseases.

  13. Movements and foraging effort of Steller's Eiders and Harlequin Ducks wintering near Dutch Harbor, Alaska

    Science.gov (United States)

    Reed, J.A.; Flint, Paul L.

    2007-01-01

    We studied the movements and foraging effort of radio-marked Steller's Eiders (Polysticta stelleri) and Harlequin Ducks (Histrionicus histrionicus) to evaluate habitat quality in an area impacted by industrial activity near Dutch Harbor, Alaska. Foraging effort was relatively low, with Steller's Eiders foraging only 2.7 ± 0.6 (SE) hours per day and Harlequin Ducks 4.1 ± 0.5 hours per day. Low-foraging effort during periods of high-energetic demand generally suggests high food availability, and high food availability frequently corresponds with reductions in home range size. However, the winter ranges of Harlequin Ducks did not appear to be smaller than usual, with the mean range size in our study (5.5 ± 1.1 km2) similar to that reported by previous investigators. The mean size of the winter ranges of Steller's Eiders was similar (5.1 ± 1.3 km2), but no comparable estimates are available. Eutrophication of the waters near Dutch Harbor caused by seafood processing and municipal sewage effluent may have increased populations of the invertebrate prey of these sea ducks and contributed to their low-foraging effort. The threat of predation by Bald Eagles (Haliaeetus leucocephalus) that winter near Dutch Harbor may cause Steller's Eiders and Harlequin Ducks to move further offshore when not foraging, contributing to an increase in range sizes. Thus, the movement patterns and foraging behavior of these ducks likely represent a balance between the cost and benefits of wintering in a human-influenced environment.

  14. Clinical and CT characteristics of surgically resected lung adenocarcinomas harboring ALK rearrangements or EGFR mutations

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hua [Department of Radiology, Tianjin Medical University Cancer Institute and Hospital, National Clinical Research Center of Cancer, Key Laboratory of Cancer Prevention and Therapy, Tianjin (China); Schabath, Matthew B. [Department of Cancer Epidemiology, H. Lee Moffitt Cancer Center and Research Institute, Tampa, FL (United States); Liu, Ying [Department of Radiology, Tianjin Medical University Cancer Institute and Hospital, National Clinical Research Center of Cancer, Key Laboratory of Cancer Prevention and Therapy, Tianjin (China); Department of Cancer Imaging and Metabolism, H. Lee Moffitt Cancer Center and Research Institute, Tampa, FL (United States); Han, Ying [Department of Biotherapy, Tianjin Medical University Cancer Institute and Hospital, National Clinical Research Center of Cancer, Key Laboratory of Cancer Prevention and Therapy, Tianjin (China); Li, Qi [Department of Pathology, Tianjin Medical University Cancer Institute and Hospital, National Clinical Research Center of Cancer, Key Laboratory of Cancer Prevention and Therapy, Tianjin (China); Gillies, Robert J. [Department of Cancer Imaging and Metabolism, H. Lee Moffitt Cancer Center and Research Institute, Tampa, FL (United States); Department of Radiology, H. Lee Moffitt Cancer Center and Research Institute, Tampa, FL (United States); Ye, Zhaoxiang, E-mail: yezhaoxiang@163.com [Department of Radiology, Tianjin Medical University Cancer Institute and Hospital, National Clinical Research Center of Cancer, Key Laboratory of Cancer Prevention and Therapy, Tianjin (China)

    2016-11-15

    Purpose: To determine if clinical and CT characteristics of surgically resected lung adenocarcinomas can distinguish those harboring ALK rearrangements from EGFR mutations. Materials and methods: Patients who had surgical resection and histologically confirmed lung adenocarcinoma were enrolled, including 41 patients with ALK rearrangements and 66 patients with EGFR mutations. Eighteen categorical and six quantitative CT characteristics were used to evaluate the tumors. Differences in clinical and CT characteristics between the two groups were investigated. Results: Age (P = 0.003), histological subtypes (P < 0.001), pathological stage (P = 0.007), and five CT characteristics, including size (P < 0.001), GGO (P = 0.001), bubble-like lucency (P = 0.048), lymphadenopathy (P = 0.001), and tumor shadow disappearance rate (P = 0.005) were significantly different between patients harboring ALK rearrangements compared to patients with EGFR mutations. When we compared histologic components, a solid pattern was more common (P = 0.009) in tumors with ALK rearrangements, and lepidic and acinar patterns were more common (P < 0.001 and P = 0.040, respectively) in those with EGFR mutations. Backward elimination analyses revealed that age (OR = 0.93; 95% CI 0.89–0.98), GGO (OR = 0.14; 95% CI 0.03–0.67), and lymphadenopathy (OR = 4.15; 95% CI 1.49–11.60) were significantly associated with ALK rearrangement status. Conclusion: Our analyses revealed that clinical and CT characteristics of lung adenocarcinomas harboring ALK rearrangements were significantly different, compared with those with EGFR mutations. These differences may be related to the molecular pathology of these diseases.

  15. 76 FR 27970 - Safety Zone; Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA.

    Science.gov (United States)

    2011-05-13

    ... Charles will sponsor a fireworks display on the shoreline of the navigable waters of Cape Charles City...[deg]01'30'' W (NAD 1983). This safety zone will be established in the vicinity of Cape Charles, VA...-AA00 Safety Zone; Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA. AGENCY: Coast Guard...

  16. Revisiting "Pearl Harbor": Resistance to Reel and Real Events in an English Language Classroom

    Science.gov (United States)

    Mackie, Ardiss; Norton, Bonny

    2006-01-01

    In this article, we draw on disruptive scenes in a postsecondary classroom to examine a critical incident concerning conflicting readings of the film "Pearl Harbor" (2001). We raise crucial questions for pedagogical work with popular film: Who speaks for whom about the meaning of a given film? Under what conditions do students resist…

  17. 75 FR 1738 - Drawbridge Operation Regulation; New Haven Harbor, Quinnipiac and Mill Rivers, CT

    Science.gov (United States)

    2010-01-13

    ...-AA09 Drawbridge Operation Regulation; New Haven Harbor, Quinnipiac and Mill Rivers, CT AGENCY: Coast... regulation governing the operation of three bridges across the Quinnipiac and Mill Rivers at New Haven... and 15 feet at mean low water. The Chapel Street Bridge at mile 0.4, across the Mill River has a...

  18. 77 FR 75917 - Drawbridge Operation Regulation; New Haven Harbor, Quinnipiac and Mill Rivers, CT

    Science.gov (United States)

    2012-12-26

    ...-AA09 Drawbridge Operation Regulation; New Haven Harbor, Quinnipiac and Mill Rivers, CT AGENCY: Coast..., mile 1.3, across the Quinnipiac River, and the Chapel Street Bridge, mile 0.4, across the Mill River..., across the Quinnipiac River, and the Chapel Street Bridge, mile 0.4, across the Mill River, to reduce the...

  19. Ecological evaluation of proposed discharge of dredged material from Oakland Harbor into ocean waters (Phase 3 B of -42-foot project). Volume 2, Appendixes

    Energy Technology Data Exchange (ETDEWEB)

    Kohn, N.P.; Ward, J.A.; Mayhew, H.L.; Word, J.Q.; Barrows, E.S.; Goodwin, S.M.; Lefkovitz, L.F. [Battelle/Marine Sciences Lab., Sequim, WA (United States)

    1992-06-01

    The Water Resources Development Act of 1986 (Public Law 99-662) authorized the US Army Corps of Engineers (USACE) San Francisco District, to deepen and widen the navigational channels of the Oakland Inner and Outer Harbors to accommodate deeper-draft vessels. The USACE is considering several disposal options for the dredged material removed during these channel improvements including open-water disposal. Dredged material proposed for open-water disposal must be evaluated to determine the potential impacts of the disposal activity on the water column and disposal site environments. The USACE requested that Battelle/Marine Sciences Laboratory (MSL) conduct studies to evaluate open-water disposal options for Oakland Harbor sediments. This request developed into the Oakland Harbor Phase III Program. This is Volume 2 of a two-volume report that presents information gathered to determine the suitability of ocean disposal of sediments dredged from Oakland Harbor. This volume contains the Appendixes (A through N), which provide details of the data analyses and full presentation of the data and results.

  20. MODELING HOW A HURRICANE BARRIER IN NEW BEDFORD HARBOR, MASSACHUSETTS, AFFECTS THE HYDRODYNAMICS AND RESIDENCE TIMES

    Science.gov (United States)

    Two-dimensional hydrodynamic and transport models were used to simulate tidal and subtidal circulation, residence times, and the longitudinal distributions of conservative constituents in New Bedford Harbor, Massachusetts, before and after a hurricane barrier was constructed. The...

  1. Hazardous substances shipping at inland water harbors

    International Nuclear Information System (INIS)

    Benkovic, Z.

    2009-01-01

    Safety measures and regulations system covering the aspects of fire protection, professional and ecological safety are aimed to create a safe working environment, by detection and remedy of conditions that are potentially hazardous for the well-being of the employees or are leading to certain undesired events. Such unwanted incidents may result in different consequences: operating person's injury, environment pollution or material damage. This study attempts to illustrate the organization of work during hazardous matter loading and unloading at inland water harbors, based on legal provisions and decrees involving safety precautions, and in order to achieve constant enhancement of operating procedure, decreasing thereby the number of work-related injuries and various accidental situations. Fundamental precondition required to prevent possible accidents and to optimize general safety policy is to recognize and control any danger or potential hazard, as well as to be familiar with the legal provisions covering the inland waterway transport of harmful substances.(author)

  2. Predicting dredging-associated effects to coral reefs in Apra Harbor, Guam - Part 1: Sediment exposure modeling.

    Science.gov (United States)

    Gailani, Joseph Z; Lackey, Tahirih C; King, David B; Bryant, Duncan; Kim, Sung-Chan; Shafer, Deborah J

    2016-03-01

    Model studies were conducted to investigate the potential coral reef sediment exposure from dredging associated with proposed development of a deepwater wharf in Apra Harbor, Guam. The Particle Tracking Model (PTM) was applied to quantify the exposure of coral reefs to material suspended by the dredging operations at two alternative sites. Key PTM features include the flexible capability of continuous multiple releases of sediment parcels, control of parcel/substrate interaction, and the ability to efficiently track vast numbers of parcels. This flexibility has facilitated simulating the combined effects of sediment released from clamshell dredging and chiseling within Apra Harbor. Because the rate of material released into the water column by some of the processes is not well understood or known a priori, the modeling approach was to bracket parameters within reasonable ranges to produce a suite of potential results from multiple model runs. Sensitivity analysis to model parameters is used to select the appropriate parameter values for bracketing. Data analysis results include mapping the time series and the maximum values of sedimentation, suspended sediment concentration, and deposition rate. Data were used to quantify various exposure processes that affect coral species in Apra Harbor. The goal of this research is to develop a robust methodology for quantifying and bracketing exposure mechanisms to coral (or other receptors) from dredging operations. These exposure values were utilized in an ecological assessment to predict effects (coral reef impacts) from various dredging scenarios. Copyright © 2015. Published by Elsevier Ltd.

  3. Characterization of differential gene expression in adrenocortical tumors harboring beta-catenin (CTNNB1) mutations.

    Science.gov (United States)

    Durand, Julien; Lampron, Antoine; Mazzuco, Tania L; Chapman, Audrey; Bourdeau, Isabelle

    2011-07-01

    Mutations of β-catenin gene (CTNNB1) are frequent in adrenocortical adenomas (AA) and adrenocortical carcinomas (ACC). However, the target genes of β-catenin have not yet been identified in adrenocortical tumors. Our objective was to identify genes deregulated in adrenocortical tumors harboring CTNNB1 genetic alterations and nuclear accumulation of β-catenin. Microarray analysis identified a dataset of genes that were differently expressed between AA with CTNNB1 mutations and wild-type (WT) tumors. Within this dataset, the expression profiles of five genes were validated by real time-PCR (RT-PCR) in a cohort of 34 adrenocortical tissues (six AA and one ACC with CTNNB1 mutations, 13 AA and four ACC with WT CTNNB1, and 10 normal adrenal glands) and two human ACC cell lines. We then studied the effects of suppressing β-catenin transcriptional activity with the T-cell factor/β-catenin inhibitors PKF115-584 and PNU74654 on gene expression in H295R and SW13 cells. RT-PCR analysis confirmed the overexpression of ISM1, RALBP1, and PDE2A and the down-regulation of PHYHIP in five of six AA harboring CTNNB1 mutations compared with WT AA (n = 13) and normal adrenal glands (n = 10). RALBP1 and PDE2A overexpression was also confirmed at the protein level by Western blotting analysis in mutated tumors. ENC1 was specifically overexpressed in three of three AA harboring CTNNB1 point mutations. mRNA expression and protein levels of RALBP1, PDE2A, and ENC1 were decreased in a dose-dependent manner in H295R cells after treatment with PKF115-584 or PNU74654. This study identified candidate genes deregulated in CTNNB1-mutated adrenocortical tumors that may lead to a better understanding of the role of the Wnt-β-catenin pathway in adrenocortical tumorigenesis.

  4. Beyond Parasitism: Hepatic Lesions in Stranded Harbor Porpoises (Phocoena phocoena) Without Trematode (Campula oblonga) Infections

    NARCIS (Netherlands)

    S. Hiemstra; L. Harkema (Liesbeth); L.C.M. Wiersma (Lidewij); R.I. Keesler

    2015-01-01

    textabstractThe liver can be an indicator of the health of an individual or of a group, which can be especially important to identify agents that can cause disease in multiple species. To better characterize hepatic lesions in stranded harbor porpoises (Phocoena phocoena), we analyzed the livers

  5. Dungeness crab survey for the Southwest Ocean Disposal Site off Grays Harbor, Washington, June 1990

    Energy Technology Data Exchange (ETDEWEB)

    Higgins, B.J.; Pearson, W.H. (Battelle/Marine Sciences Lab., Sequim, WA (United States))

    1991-09-01

    As part of the Grays Harbor Navigation Improvement Project, the Seattle District of the US Army Corps of Engineers has begun active use of the Southwest Ocean Disposal Site off Grays Harbor, Washington. This survey was to verify that the location of the area of high crab density observed during site selection surveys has not shifted into the Southeast Ocean Disposal Site. In June 1990, mean densities of juvenile Dungeness crab were 146 crab/ha within the disposal site and 609 crab/ha outside ad north of the disposal site. At nearshore locations outside the disposal site, juvenile crab density was 3275 crab/ha. Despite the low overall abundance, the spatial distribution of crab was such that the high crab densities in 1990 have remained outside the Southwest Ocean Disposal Site. The survey data have confirmed the appropriateness of the initial selection of the disposal site boundaries and indicated no need to move to the second monitoring tier. 8 refs., 9 figs., 2 tabs.

  6. The War on Cancer: Cold Spring Harbor Laboratory Is Fighting the Good Fight.

    Science.gov (United States)

    Mertz, Leslie

    2017-01-01

    Located on the north shore of Long Island in New York, Cold Spring Harbor Laboratory (Figure 1) started out with a marine biology emphasis at the end of the 19th century, but it soon established itself as a prominent cancer research facility. That strong emphasis on cancer work continues today as this private, not-for-profit research institution enters its 127th year (Figure 2).

  7. Cladophora (Chlorophyta) spp. Harbor Human Bacterial Pathogens in Nearshore Water of Lake Michigan†

    Science.gov (United States)

    Ishii, Satoshi; Yan, Tao; Shively, Dawn A.; Byappanahalli, Muruleedhara N.; Whitman, Richard L.; Sadowsky, Michael J.

    2006-01-01

    Cladophora glomerata, a macrophytic green alga, is commonly found in the Great Lakes, and significant accumulations occur along shorelines during the summer months. Recently, Cladophora has been shown to harbor high densities of the fecal indicator bacteria Escherichia coli and enterococci. Cladophora may also harbor human pathogens; however, until now, no studies to address this question have been performed. In the present study, we determined whether attached Cladophora, obtained from the Lake Michigan and Burns Ditch (Little Calumet River, Indiana) sides of a breakwater during the summers of 2004 and 2005, harbored the bacterial pathogens Shiga toxin-producing Escherichia coli (STEC), Salmonella, Shigella, and Campylobacter. The presence of potential pathogens and numbers of organisms were determined by using cultural methods and by using conventional PCR, most-probable-number PCR (MPN-PCR), and quantitative PCR (QPCR) performed with genus- and toxin-specific primers and probes. While Shigella and STEC were detected in 100% and 25%, respectively, of the algal samples obtained near Burns Ditch in 2004, the same pathogens were not detected in samples collected in 2005. MPN-PCR and QPCR allowed enumeration of Salmonella in 40 to 80% of the ditch- and lakeside samples, respectively, and the densities were up to 1.6 × 103 cells per g Cladophora. Similarly, these PCR methods allowed enumeration of up to 5.4 × 102 Campylobacter cells/g Cladophora in 60 to 100% of lake- and ditchside samples. The Campylobacter densities were significantly higher (P Cladophora samples than in the ditchside Cladophora samples. DNA fingerprint analyses indicated that genotypically identical Salmonella isolates were associated with geographically and temporally distinct Cladophora samples. However, Campylobacter isolates were genetically diverse. Since animal hosts are thought to be the primary habitat for Campylobacter and Salmonella species, our results suggest that Cladophora is a

  8. Cladophora (Chlorophyta) spp. harbor human bacterial pathogens in nearshore water of Lake Michigan.

    Science.gov (United States)

    Ishii, Satoshi; Yan, Tao; Shively, Dawn A; Byappanahalli, Muruleedhara N; Whitman, Richard L; Sadowsky, Michael J

    2006-07-01

    Cladophora glomerata, a macrophytic green alga, is commonly found in the Great Lakes, and significant accumulations occur along shorelines during the summer months. Recently, Cladophora has been shown to harbor high densities of the fecal indicator bacteria Escherichia coli and enterococci. Cladophora may also harbor human pathogens; however, until now, no studies to address this question have been performed. In the present study, we determined whether attached Cladophora, obtained from the Lake Michigan and Burns Ditch (Little Calumet River, Indiana) sides of a breakwater during the summers of 2004 and 2005, harbored the bacterial pathogens Shiga toxin-producing Escherichia coli (STEC), Salmonella, Shigella, and Campylobacter. The presence of potential pathogens and numbers of organisms were determined by using cultural methods and by using conventional PCR, most-probable-number PCR (MPN-PCR), and quantitative PCR (QPCR) performed with genus- and toxin-specific primers and probes. While Shigella and STEC were detected in 100% and 25%, respectively, of the algal samples obtained near Burns Ditch in 2004, the same pathogens were not detected in samples collected in 2005. MPN-PCR and QPCR allowed enumeration of Salmonella in 40 to 80% of the ditch- and lakeside samples, respectively, and the densities were up to 1.6 x 10(3) cells per g Cladophora. Similarly, these PCR methods allowed enumeration of up to 5.4 x 10(2) Campylobacter cells/g Cladophora in 60 to 100% of lake- and ditchside samples. The Campylobacter densities were significantly higher (P Cladophora samples than in the ditchside Cladophora samples. DNA fingerprint analyses indicated that genotypically identical Salmonella isolates were associated with geographically and temporally distinct Cladophora samples. However, Campylobacter isolates were genetically diverse. Since animal hosts are thought to be the primary habitat for Campylobacter and Salmonella species, our results suggest that Cladophora is a

  9. CC8 MRSA strains harboring SCCmec type IVc are predominant in Colombian hospitals.

    Directory of Open Access Journals (Sweden)

    J Natalia Jiménez

    Full Text Available BACKGROUND: Recent reports highlight the incursion of community-associated MRSA within healthcare settings. However, knowledge of this phenomenon remains limited in Latin America. The aim of this study was to evaluate the molecular epidemiology of MRSA in three tertiary-care hospitals in Medellín, Colombia. METHODS: An observational cross-sectional study was conducted from 2008-2010. MRSA infections were classified as either community-associated (CA-MRSA or healthcare-associated (HA-MRSA, with HA-MRSA further classified as hospital-onset (HAHO-MRSA or community-onset (HACO-MRSA according to standard epidemiological definitions established by the U.S. Centers for Disease Control and Prevention (CDC. Genotypic analysis included SCCmec typing, spa typing, PFGE and MLST. RESULTS: Out of 538 total MRSA isolates, 68 (12.6% were defined as CA-MRSA, 243 (45.2% as HACO-MRSA and 227 (42.2% as HAHO-MRSA. The majority harbored SCCmec type IVc (306, 58.7%, followed by SCCmec type I (174, 33.4%. The prevalence of type IVc among CA-, HACO- and HAHO-MRSA isolates was 92.4%, 65.1% and 43.6%, respectively. From 2008 to 2010, the prevalence of type IVc-bearing strains increased significantly, from 50.0% to 68.2% (p = 0.004. Strains harboring SCCmec IVc were mainly associated with spa types t1610, t008 and t024 (MLST clonal complex 8, while PFGE confirmed that the t008 and t1610 strains were closely related to the USA300-0114 CA-MRSA clone. Notably, strains belonging to these three spa types exhibited high levels of tetracycline resistance (45.9%. CONCLUSION: CC8 MRSA strains harboring SCCmec type IVc are becoming predominant in Medellín hospitals, displacing previously reported CC5 HA-MRSA clones. Based on shared characteristics including SCCmec IVc, absence of the ACME element and tetracycline resistance, the USA300-related isolates in this study are most likely related to USA300-LV, the recently-described 'Latin American variant' of USA300.

  10. Brain transcriptomes of harbor seals demonstrate gene expression patterns of animals undergoing a metabolic disease and a viral infection

    Directory of Open Access Journals (Sweden)

    Stephanie M. Rosales

    2016-12-01

    Full Text Available Diseases of marine mammals can be difficult to diagnose because of their life history and protected status. Stranded marine mammals have been a particularly useful resource to discover and comprehend the diseases that plague these top predators. Additionally, advancements in high-throughput sequencing (HTS has contributed to the discovery of novel pathogens in marine mammals. In this study, we use a combination of HTS and stranded harbor seals (Phoca vitulina to better understand a known and unknown brain disease. To do this, we used transcriptomics to evaluate brain tissues from seven neonatal harbor seals that expired from an unknown cause of death (UCD and compared them to four neonatal harbor seals that had confirmed phocine herpesvirus (PhV-1 infections in the brain. Comparing the two disease states we found that UCD animals showed a significant abundance of fatty acid metabolic transcripts in their brain tissue, thus we speculate that a fatty acid metabolic dysregulation contributed to the death of these animals. Furthermore, we were able to describe the response of four young harbor seals with PhV-1 infections in the brain. PhV-1 infected animals showed a significant ability to mount an innate and adaptive immune response, especially to combat viral infections. Our data also suggests that PhV-1 can hijack host pathways for DNA packaging and exocytosis. This is the first study to use transcriptomics in marine mammals to understand host and viral interactions and assess the death of stranded marine mammals with an unknown disease. Furthermore, we show the value of applying transcriptomics on stranded marine mammals for disease characterization.

  11. Investigation of polycyclic aromatic hydrocarbons (PAHs) and cyclic terpenoid biomarkers in the sediments of fishing harbors in Taiwan

    International Nuclear Information System (INIS)

    Kao, Nien-Hsin; Su, Ming-Chien; Fan, Jheng-Rong; Yen, Chih-Chun

    2015-01-01

    Highlights: • Biomarkers in three fishing harbors were investigated and identified. • 17 terpanes, 10 steranes and 10 bicyclic sesquiterpanes were quantified. • Marine diesel and the three kinds of lubricants were studied. • The study can be applied to other harbors to identify oil products in sediments. - Abstract: Three fishing harbors were investigated to study the polycyclic aromatic hydrocarbons in the sediments and trace possible anthropogenic sources by identification of cyclic terpenoid biomarkers. Seventeen terpanes, 10 steranes and 10 bicyclic sesquiterpanes in the marine diesel and the three kinds of lubricants that are mainly used by fishing boats were identified and quantified. Eighteen biomarker diagnostic ratios are suggested and the correlation coefficients among the lubricants and sediment samples have the R 2 value greater than 0.73. Analyzed 16 PAHs in the sediment shows non-normal distributions and the Kruskal Wallis Test shows the significant differences (p value smaller than 0.05) with the greatest variability in benzo[g,h,i]perylene which more than 84% of the effective size (E.S.) is accounted. X-ray Photoelectron Spectroscopy (XPS) analysis was applied and the Kruskal Wallis Test shows a significant difference (p value smaller than 0.05) among certain atoms with the effective size greater than 60%

  12. Jam Formation of Traffic Flow in Harbor Tunnel

    International Nuclear Information System (INIS)

    He Hongdi; Lu Weizhen; Dong Liyun

    2011-01-01

    This paper reports a study concerning occurrence and growth of traffic jam in a harbor tunnel. The single-lane with three sections (downgrade, flat, and upgrade) is taken into account and they are characterized with different velocity limit. At the low density, the traffic current increases linearly with density and saturates at some values of immediately density. As the density increases, the traffic jam appears firstly before the upgrade section and then extends to the downgrade section. Additionally, the relationships of the velocity and headway against position in different densities are obtained from simulation. These results clearly clarify where and when the traffic jam appears. Finally, the critical densities are derived via the theoretical analysis before and after the discontinuous fronts and the theoretical results are consistent with the critical values of simulation results. (interdisciplinary physics and related areas of science and technology)

  13. "Tugboat Annie:" nursing's hero of Pearl Harbor--Grace Lally (1897-1983).

    Science.gov (United States)

    Hawkins, J W; Matthews, I

    1991-01-01

    In 1991 we will mark the 50th anniversary of the Japanese attack on Pearl Harbor. Few nurses know that the Chief Nurse aboard the USS Solace, the only hospital ship in port on that fateful day, played a critical role in caring for the survivors. Grace Lally's calm, professional manner, along with her sensitivity to the needs of her patients, her 12 nurses, and the crew of the Solace made her a hero. This study is an investigation of her role on December 7, 1941, and her contributions as a career military nurse.

  14. Evaluation of Proposed Dredged Material Disposal Alternatives for New York/New Jersey Harbor. Phase 1

    Science.gov (United States)

    1988-08-01

    been developed ( Westerdahl and Skogerboe 1981) and is being used x..-’. to predict surface runoff water quality from dredged material as part of the...Islands in New York Harbor," Miscellaneous Paper D-88-3, US Army Engineer Waterways Experiment Station, Vicksburg, MS. Westerdahl , H. E., and Skogerboe

  15. 77 FR 31067 - Cleveland Commercial Railroad Company, LLC-Continuance in Control Exemption-Cleveland Harbor Belt...

    Science.gov (United States)

    2012-05-24

    ... becoming a Class III rail carrier. CCR has established CHB as a limited liability company and has the... Commercial Railroad Company, LLC--Continuance in Control Exemption--Cleveland Harbor Belt Railroad Cleveland Commercial Railroad Company, LLC (CCR), a Class III rail carrier, has filed a verified notice of exemption...

  16. Contribution of Interstitial Deletion of 21q22.2-3 per se to Prostate Cancer Progression in Tumors Harboring TMPRSS2-ERG Translocations

    Science.gov (United States)

    2015-12-01

    harboring TMPRSS2- ERG translocations PRINCIPAL INVESTIGATOR: Yan Dong CONTRACTING ORGANIZATION: Tulane University New Orleans, LA 70112...0485 to prostate cancer progression in tumors harboring TMPRSS2- ERG translocations 5b. GRANT NUMBER W81XWH-14-1-0485 5c. PROGRAM ELEMENT NUMBER...Unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT TMPRSS2- ERG gene fusions are present in close to 50% of human prostate cancers. Approximately half of the

  17. Production of infectious chimeric hepatitis C virus genotype 2b harboring minimal regions of JFH-1.

    Science.gov (United States)

    Murayama, Asako; Kato, Takanobu; Akazawa, Daisuke; Sugiyama, Nao; Date, Tomoko; Masaki, Takahiro; Nakamoto, Shingo; Tanaka, Yasuhito; Mizokami, Masashi; Yokosuka, Osamu; Nomoto, Akio; Wakita, Takaji

    2012-02-01

    To establish a cell culture system for chimeric hepatitis C virus (HCV) genotype 2b, we prepared a chimeric construct harboring the 5' untranslated region (UTR) to the E2 region of the MA strain (genotype 2b) and the region of p7 to the 3' UTR of the JFH-1 strain (genotype 2a). This chimeric RNA (MA/JFH-1.1) replicated and produced infectious virus in Huh7.5.1 cells. Replacement of the 5' UTR of this chimera with that from JFH-1 (MA/JFH-1.2) enhanced virus production, but infectivity remained low. In a long-term follow-up study, we identified a cell culture-adaptive mutation in the core region (R167G) and found that it enhanced virus assembly. We previously reported that the NS3 helicase (N3H) and the region of NS5B to 3' X (N5BX) of JFH-1 enabled replication of the J6CF strain (genotype 2a), which could not replicate in cells. To reduce JFH-1 content in MA/JFH-1.2, we produced a chimeric viral genome for MA harboring the N3H and N5BX regions of JFH-1, combined with a JFH-1 5' UTR replacement and the R167G mutation (MA/N3H+N5BX-JFH1/R167G). This chimeric RNA replicated efficiently, but virus production was low. After the introduction of four additional cell culture-adaptive mutations, MA/N3H+N5BX-JFH1/5am produced infectious virus efficiently. Using this chimeric virus harboring minimal regions of JFH-1, we analyzed interferon sensitivity and found that this chimeric virus was more sensitive to interferon than JFH-1 and another chimeric virus containing more regions from JFH-1 (MA/JFH-1.2/R167G). In conclusion, we established an HCV genotype 2b cell culture system using a chimeric genome harboring minimal regions of JFH-1. This cell culture system may be useful for characterizing genotype 2b viruses and developing antiviral strategies.

  18. Structural damage monitoring of harbor caissons with interlocking condition

    Energy Technology Data Exchange (ETDEWEB)

    Huynh, Thanh Canh; Lee, So Young; Nauyen, Khac Duy; Kim, Jeong Tae [Pukyong National Univ., Busan (Korea, Republic of)

    2012-12-15

    The objective of this study is to monitor the health status of harbor caissons which have potential foundation damage. To obtain the objective, the following approaches are performed. Firstly, a structural damage monitoring(SDM) method is designed for interlocked multiple caisson structures. The SDM method utilizes the change in modal strain energy to monitor the foundation damage in a target caisson unit. Secondly, a finite element model of a caisson system which consists of three caisson units is established to verify the feasibility of the proposed method. In the finite element simulation, the caisson units are constrained each other by shear key connections. The health status of the caisson system against various levels of foundation damage is monitored by measuring relative modal displacements between the adjacent caissons.

  19. Structural damage monitoring of harbor caissons with interlocking condition

    International Nuclear Information System (INIS)

    Huynh, Thanh Canh; Lee, So Young; Nauyen, Khac Duy; Kim, Jeong Tae

    2012-01-01

    The objective of this study is to monitor the health status of harbor caissons which have potential foundation damage. To obtain the objective, the following approaches are performed. Firstly, a structural damage monitoring(SDM) method is designed for interlocked multiple caisson structures. The SDM method utilizes the change in modal strain energy to monitor the foundation damage in a target caisson unit. Secondly, a finite element model of a caisson system which consists of three caisson units is established to verify the feasibility of the proposed method. In the finite element simulation, the caisson units are constrained each other by shear key connections. The health status of the caisson system against various levels of foundation damage is monitored by measuring relative modal displacements between the adjacent caissons

  20. Heat from harbor to city; Warmte van haven naar stad

    Energy Technology Data Exchange (ETDEWEB)

    Roggen, M. (ed.)

    2004-09-01

    The Rotterdam harbor area is perfect for an industrial heat distribution network. Numerous major heat producers and many potential consumers of all sizes group together in this industrial area. The new Heat Company ('Warmtebedrijf') is making a detailed business plan to build a heat distribution system. [Dutch] Als er een regio is waar een industrieel warmtenet voor de hand ligt, is het het Rotterdamse havengebied wel. Tal van grote warmteproducenten en een woud aan kleinere en grotere afnemers zijn praktisch buren. Om handen en voeten te geven aan dit op papier mooie idee, stelt het kersverse Warmtebedrijf io een gedetailleerd businessplan op.

  1. Novel B19-like parvovirus in the brain of a harbor seal.

    Directory of Open Access Journals (Sweden)

    Rogier Bodewes

    Full Text Available Using random PCR in combination with next-generation sequencing, a novel parvovirus was detected in the brain of a young harbor seal (Phoca vitulina with chronic non-suppurative meningo-encephalitis that was rehabilitated at the Seal Rehabilitation and Research Centre (SRRC in the Netherlands. In addition, two novel viruses belonging to the family Anelloviridae were detected in the lungs of this animal. Phylogenetic analysis of the coding sequence of the novel parvovirus, tentatively called Seal parvovirus, indicated that this virus belonged to the genus Erythrovirus, to which human parvovirus B19 also belongs. Although no other seals with similar signs were rehabilitated in SRRC in recent years, a prevalence study of tissues of seals from the same area collected in the period 2008-2012 indicated that the Seal parvovirus has circulated in the harbor seal population at least since 2008. The presence of the Seal parvovirus in the brain was confirmed by real-time PCR and in vitro replication. Using in situ hybridization, we showed for the first time that a parvovirus of the genus Erythrovirus was present in the Virchow-Robin space and in cerebral parenchyma adjacent to the meninges. These findings showed that a parvovirus of the genus Erythrovirus can be involved in central nervous system infection and inflammation, as has also been suspected but not proven for human parvovirus B19 infection.

  2. Novel B19-like parvovirus in the brain of a harbor seal.

    Science.gov (United States)

    Bodewes, Rogier; Rubio García, Ana; Wiersma, Lidewij C M; Getu, Sarah; Beukers, Martijn; Schapendonk, Claudia M E; van Run, Peter R W A; van de Bildt, Marco W G; Poen, Marjolein J; Osinga, Nynke; Sánchez Contreras, Guillermo J; Kuiken, Thijs; Smits, Saskia L; Osterhaus, Albert D M E

    2013-01-01

    Using random PCR in combination with next-generation sequencing, a novel parvovirus was detected in the brain of a young harbor seal (Phoca vitulina) with chronic non-suppurative meningo-encephalitis that was rehabilitated at the Seal Rehabilitation and Research Centre (SRRC) in the Netherlands. In addition, two novel viruses belonging to the family Anelloviridae were detected in the lungs of this animal. Phylogenetic analysis of the coding sequence of the novel parvovirus, tentatively called Seal parvovirus, indicated that this virus belonged to the genus Erythrovirus, to which human parvovirus B19 also belongs. Although no other seals with similar signs were rehabilitated in SRRC in recent years, a prevalence study of tissues of seals from the same area collected in the period 2008-2012 indicated that the Seal parvovirus has circulated in the harbor seal population at least since 2008. The presence of the Seal parvovirus in the brain was confirmed by real-time PCR and in vitro replication. Using in situ hybridization, we showed for the first time that a parvovirus of the genus Erythrovirus was present in the Virchow-Robin space and in cerebral parenchyma adjacent to the meninges. These findings showed that a parvovirus of the genus Erythrovirus can be involved in central nervous system infection and inflammation, as has also been suspected but not proven for human parvovirus B19 infection.

  3. 33 CFR 165.906 - Lakeside Yacht Club in Cleveland Harbor, Cleveland, OH-regulated navigation areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Lakeside Yacht Club in Cleveland... Guard District § 165.906 Lakeside Yacht Club in Cleveland Harbor, Cleveland, OH—regulated navigation... portion of the vessel extending above the waterline. All of these areas are inside the “Lakeside Yacht...

  4. 75 FR 56130 - Pearl Harbor National Wildlife Refuge, Honolulu County, HI; Comprehensive Conservation Plan and...

    Science.gov (United States)

    2010-09-15

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R1-R-2010-N160; 1265-0000-10137-S3] Pearl Harbor National Wildlife Refuge, Honolulu County, HI; Comprehensive Conservation Plan and... Kamehameha Highway, Room 2C, Hale`iwa, HI 96712. Alternatively, you may fax comments to the refuge at (808...

  5. 78 FR 52753 - Taking of Marine Mammals Incidental to Commercial Fishing Operations; Harbor Porpoise Take...

    Science.gov (United States)

    2013-08-26

    ... strategy enacted in 2010 based on deliberations by the Harbor Porpoise Take Reduction Team. This action is... information (e.g., name, address, etc.), confidential business information, or otherwise sensitive information... Protection Act (MMPA) to reduce the level of serious injury and mortality of the Gulf of Maine/Bay of Fundy...

  6. Occurrence of bovine tuberculosis at Nyala abattoirs in South Darfur State, Sudan

    Directory of Open Access Journals (Sweden)

    M. A. Aljameel

    2015-01-01

    Full Text Available The aim of this study was to determine the occurrence of tuberculosis in cattle slaughtered at Nyala abattoirs, South Darfur State, Sudan during the period April 2006 – May 2008. In total 2794 cattle were examined for tuberculous lesions. Tuberculous lesions (n = 163 were found in 40 (1.4% animals, among which seven had generalized tuberculosis and 33 localized tuberculosis, mainly in the lungs, thoracic lymph nodes, and/or in the liver, spleen, kidneys and mesenteric lymph nodes. Tissue samples were collected either in 10% formal saline for routine histopathology or in ice packs for direct microscopy and culturing. Direct microscopy showed that 124 (76.1% tuberculous lesions harbored acid fast bacilli, whereas 17 (10.4% isolates of Mycobacterium spp. were recovered in pure Lowenstein-Jensen medium cultures and identified as M. bovis (n = 11 and M. farcinogenes (n = 6. Granulomatous inflammation was evident in all sections of tuberculous lesions. Further studies are needed to identify mycobacteria species causing tuberculosis in other animal species.

  7. Investigation and analysis of a mass mortality of commercial lobsters (Homarus americanus) in Seabrook Harbor, New Hampshire during October of 1977

    International Nuclear Information System (INIS)

    Hickey, C.R. Jr.

    1978-06-01

    During latter October 1977, a mass mortality of commercially held lobsters occurred in Seabrook Harbor, New Hampshire, at a location approximately 400-600 feet south of a construction project associated with Seabrook Station. The incident was investigated by the USNRC, with cooperative effort from other federal and several state agencies. Based upon interviews with affected lobstermen, their losses are estimated to total 2372-3440 lobsters, weighing 2965-3440 pounds, the worth between $5100-$10,320. One individual lobsterman could have incurred a loss as great as $4333. Turbidity and siltation from construction activities were alleged to have been the cause of the incident, but no direct relationship between construction and the mortality could be positively confirmed. Extreme natural environmental conditions, preceeding the mortality, combined with a confirmed presence of gaffkemia (red tail disease) in an adequately dense and confined lobster stock appear to have been responsible. The gaffkemia pathogen could have originated from any one of several possible sources, and its presence coincident with construction activities suggests a correlation between the two, but none could be proven. A delay in reporting of the incident to the USNRC, few available specimens, and a paucity of environmental data hampered the investigative efforts

  8. 76 FR 55413 - Proposed Safe Harbor Agreement for California Red-legged Frog, California Tiger Salamander, Smith...

    Science.gov (United States)

    2011-09-07

    ...] Proposed Safe Harbor Agreement for California Red-legged Frog, California Tiger Salamander, Smith's Blue... endangered Smith's blue butterfly (Euphilotes enoptes smithi) under the Endangered Species Act of 1973, as..., California tiger salamander, Smith's blue butterfly, and Yadon's piperia on the property subject to the...

  9. 76 FR 12 - Drawbridge Operation Regulations; New Haven Harbor, Quinnipiac and Mill Rivers, New Haven, CT

    Science.gov (United States)

    2011-01-03

    ... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 117 [Docket No. USCG-2010-1096] Drawbridge Operation Regulations; New Haven Harbor, Quinnipiac and Mill Rivers, New Haven, CT AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from regulations. SUMMARY: The Commander, First Coast Guard...

  10. 3 CFR 8463 - Proclamation 8463 of December 4, 2009. National Pearl Harbor Remembrance Day, 2009

    Science.gov (United States)

    2010-01-01

    ... who selflessly served our Nation at home and abroad during World War II. On a tranquil Sunday morning, as war raged around the globe, the attack on Pearl Harbor effectively ended American isolation... have hereunto set my hand this fourth day of December, in the year of our Lord two thousand nine, and...

  11. Mitigation of Shore Damage Attributed to the Federal Navigation Structures at Port Sanilac Harbor, Michigan.

    Science.gov (United States)

    1975-09-01

    produces waves with nealioible wace heights (i.e., 0.5 feet); (b) all waves were deep water waves with no correction for shallow water; and, (c) the...at that harbor. This would re- sult in a loss to the local economy . Ini addition, littoral drift would resume southward thus affecting the littoral

  12. Cold Spring Harbor symposia on quantitative biology: Volume 51, Molecular biology of /ital Homo sapiens/

    International Nuclear Information System (INIS)

    1986-01-01

    This volume is the second part of a collection of papers submitted by the participants to the 1986 Cold Spring Harbor Symposium on Quantitative Biology entitled Molecular Biology of /ital Homo sapiens/. The 49 papers included in this volume are grouped by subject into receptors, human cancer genes, and gene therapy. (DT)

  13. Incidence of plasmid-linked antibiotic-heavy metal resistant enterics in water-sediment from agricultural and harbor sites

    Energy Technology Data Exchange (ETDEWEB)

    Mietz, J.A.; Sjorgren, R.E.

    1983-01-01

    This study assesses the impact of antibiotics used in clinical and veterinary practices on the incidence of antibiotic-heavy metal resistant enterics in fresh water and sediment from agricultural and harbor sample sites. A total of 848 bacterial strains of the family Enterobacteriaceae was isolated from agricultural and lake harbor samples. These were examined for anitbiotic-heavy metal resistance. A select smaller number of these isolates were also examined for the presence of plasmids and ability to transfer antibiotic resistance via conjugation or transformation. More than 85% of the 848 isolates from all four sites were resistant to Pb, Zn, and Co while 5.6% to 16% were resistant to Te and 2.4% to 5.7% to Hg. Of the total isolates tested, 87% were resistant to six or more antibiotics and 74% were also simultaneously resistant to Co, Zn, and Pb. Testing the resistance of the water isolates to antibiotics used solely in animal husbandry-veterinary medicine indicated that 55.6% of the agricultural isolates possessed resistance to these antibiotics while only 31.9% of the isolates from harbor water showed resistance to the same antibiotics. Of 41 ampicillin resistant isolates examined, 16 (39%) were capable of transferring antibiotic-heavy resistance markers via conjugation. From this same group, plasmid DNA preparations were made. Of these latter preparations, 67% transformed recipient E. coli cells while 58% possessed discernible, often multiple plasmids when examined by gel electrophoresis.

  14. Directional wave and temperature data from nine buoys in Gray's Harbor, Washington, 1994-2002 (NODC Accession 0000756)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Wave data were collected from 9 buoys in Grays Harbor, Washington, from 01 January 1994 to 24 July 2002. Data were collected as part of the Coastal Data Information...

  15. Central nervous system disease and genital disease in harbor porpoises (Phocoena phocoena) are associated with different herpesviruses

    NARCIS (Netherlands)

    C.E. van Elk; M.W.G. van de Bildt (Marco); P.R.W.A. van Run (Peter); De Jong, A. (Anton); S. Getu (Sarah); G.M.G.M. Verjans (George); A.D.M.E. Osterhaus (Albert); T. Kuiken (Thijs)

    2016-01-01

    textabstractHerpesvirus infection causes disease of variable severity in many species, including cetaceans. However, little is known about herpesvirus infection in harbor porpoises (Phocoena phocoena), despite being widespread in temperate coastal waters of the Northern Hemisphere. Therefore, we

  16. Effects of deposition of heavy-metal-polluted harbor mud on microbial diversity and metal resistance in sandy marine sediments

    DEFF Research Database (Denmark)

    Toes, Ann-Charlotte M; Finke, Niko; Kuenen, J Gijs

    2008-01-01

    Deposition of dredged harbor sediments in relatively undisturbed ecosystems is often considered a viable option for confinement of pollutants and possible natural attenuation. This study investigated the effects of deposition of heavy-metal-polluted sludge on the microbial diversity of sandy...... the finding that some groups of clones were shared between the metal-impacted sandy sediment and the harbor control, comparative analyses showed that the two sediments were significantly different in community composition. Consequences of redeposition of metal-polluted sediment were primarily underlined...... with cultivation-dependent techniques. Toxicity tests showed that the percentage of Cd- and Cu-tolerant aerobic heterotrophs was highest among isolates from the sandy sediment with metal-polluted mud on top....

  17. Fabricating the "Southern Belle": Assessing the Role of Imported Material Culture in the Confederacy

    Science.gov (United States)

    Schwalbe, Emily A.

    2017-10-01

    Confederate society was dependent on a rigidly defined hierarchy that assigned roles and appropriate behavior based on race, gender, and wealth. White, wealthy, southern women were dependent on material culture as a socially acceptable means of self-fashioning and making their status public. The Union naval blockade threatened this practice by preventing Confederate markets from accessing imported, status-affirming goods. The industry of blockade running rose to fill this need, often controversially prioritizing cargo space for civilian, luxury products over necessities for the military. This article examines the artifact assemblages of blockade runner sites off the coasts of Wilmington, North Carolina and Charleston, South Carolina through a theoretical framework of agency and costly signaling to make assessments about Confederate identity during the Civil War.

  18. The ``writing on the cosmic wall'': Is there a straightforward explanation of the cosmic microwave background?

    Science.gov (United States)

    Fahr, H. J.; Zönnchen, J. H.

    2018-04-01

    Confederate society was dependent on a rigidly defined hierarchy that assigned roles and appropriate behavior based on race, gender, and wealth. White, wealthy, southern women were dependent on material culture as a socially acceptable means of self-fashioning and making their status public. The Union naval blockade threatened this practice by preventing Confederate markets from accessing imported, status-affirming goods. The industry of blockade running rose to fill this need, often controversially prioritizing cargo space for civilian, luxury products over necessities for the military. This article examines the artifact assemblages of blockade runner sites off the coasts of Wilmington, North Carolina and Charleston, South Carolina through a theoretical framework of agency and costly signaling to make assessments about Confederate identity during the Civil War.

  19. Comparative account of macrofouling ecology at Vijaydurg Harbor and Musakazi-Jaitapur Bay, central western coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Sawant, S.S.; Wagh, A.B.

    The extent and the nature of fouling were studied on mild steel, aluminum, and stainless steel panels at the Vijaydurg Harbor and Musakazi-Jaitapur Bay on the central western coast of India. In addition, cathodically protected and unprotected panels...

  20. 78 FR 24069 - Safety Zone; 12th Annual Saltwater Classic; Port Canaveral Harbor; Port Canaveral, FL

    Science.gov (United States)

    2013-04-24

    ... under Executive Order 13045, Protection of Children from Environmental Health Risks and Safety Risks. This rule is not an economically significant rule and does not create an environmental risk to health...-AA00 Safety Zone; 12th Annual Saltwater Classic; Port Canaveral Harbor; Port Canaveral, FL AGENCY...

  1. 76 FR 33721 - Takes of Marine Mammals Incidental to Specified Activities; Harbor Activities Related to the...

    Science.gov (United States)

    2011-06-09

    ..., incidental to conducting Delta Mariner harbor operations for one year. NMFS reviewed the ULA application and... vitulina), and Northern elephant seals (Mirounga angustirostris) hauled out on Small Haul-out Site 1 to... lions; and 43 Northern elephant seals by Level B harassment only. Description of the Specified...

  2. A case of lung adenocarcinoma harboring EGFR mutation and EML4-ALK fusion gene

    International Nuclear Information System (INIS)

    Tanaka, Hisashi; Hayashi, Akihito; Morimoto, Takeshi; Taima, Kageaki; Tanaka, Yoshihito; Shimada, Michiko; Kurose, Akira; Takanashi, Shingo; Okumura, Ken

    2012-01-01

    Lung cancer is the leading cause of cancer-related death worldwide. Epidermal growth factor receptor (EGFR) - tyrosine kinase inhibitor (TKI) is used for the patients with EGFR-mutant lung cancer. Recently, phase III studies in the patients with EGFR-mutant demonstrated that EGFR-TKI monotherapy improved progression-free survival compared with platinum-doublet chemotherapy. The echinoderm microtubule-associated protein-like 4 (EML4) - anaplastic lymphoma kinase (ALK) fusion oncogene represents one of the newest molecular targets in non-small cell lung cancer (NSCLC). Patients who harbor EML4-ALK fusions have been associated with a lack of EGFR or KRAS mutations. We report a 39-year-old patient diagnosed as adenocarcinoma harboring EGFR mutation and EML4-ALK fusion gene. We treated this patient with erlotinib as the third line therapy, but no clinical benefit was obtained. We experienced a rare case with EGFR mutation and EML4-ALK. Any clinical benefit using EGFR-TKI was not obtained in our case. The therapeutic choice for the patients with more than one driver mutations is unclear. We needs further understanding of the lung cancer molecular biology and the biomarker infomation

  3. 78 FR 46855 - Safety Zone; East End Maritime Foundation Fireworks Display, Greenport Harbor, Greenport, NY

    Science.gov (United States)

    2013-08-02

    ... 1625-AA00 Safety Zone; East End Maritime Foundation Fireworks Display, Greenport Harbor, Greenport, NY... temporary rule proposes to establish a safety zone for the East End Maritime Foundation fireworks display....1. 0 2. Add Sec. 165.T01-0600 to read as follows: Sec. 165.T01-0600 Safety Zone; East End Maritime...

  4. Preliminary assessment of Miramar Petrochemical Harbor as PAH source to Guajará bay (Belém-PA-Brazil surface sediments

    Directory of Open Access Journals (Sweden)

    Silvana do Socorro Veloso Sodré

    Full Text Available Abstract A preliminary study on a petrochemical harbor as a potential source of polycyclic aromatic hydrocarbons (PAH to surface sediments of Guajará bay, located in Belém City, Pará State, Brazil, over the last 10 years is presented here. The 16 priority USEPA PAH were identified and quantified. Surface sediment samples, collected at 5 sites in the bay, near Miramar Petrochemical Harbor (TEMIR, were extracted and analyzed by high performance liquid chromatography with a diode array detector. Total PAH concentration ranged from 533.0 to 3123.3 ng g-1 dry weight with a mean concentration of 1091.9 ng g-1. The most contaminated places were those where muddy sediments were found with highest concentrations of organic matter. The priority PAH with low molecular weight represented 54.4% of the total abundance and indicate that the main source of contamination of the sediments was petrogenic, indicative of the relevant contribution of the petrochemical harbor activity to the input of PAH to Guajará bay. However, pyrolytic PAH coming from fuel combustion, household waste combustion and untreated sewage discharge are also potential contamination sources to this environment.

  5. Anthropogenic inputs of dissolved organic matter in New York Harbor

    Science.gov (United States)

    Gardner, G. B.; Chen, R. F.; Olavasen, J.; Peri, F.

    2016-02-01

    The Hudson River flows into the Atlantic Ocean through a highly urbanized region which includes New York City to the east and Newark, New Jersey to the west. As a result, the export of Dissolved Organic Carbon (DOC) from the Hudson to the Atlantic Ocean includes a significant anthropogenic component. A series of high resolution studies of the DOC dynamics of this system were conducted between 2003 and 2010. These included both the Hudson and adjacent large waterways (East River, Newark Bay, Kill Van Kull and Arthur Kill) using coastal research vessels and smaller tributaries (Hackensack, Pasaic and Raritan rivers) using a 25' boat. In both cases measurements were made using towed instrument packages which could be cycled from near surface to near bottom depths with horizontal resolution of approximately 20 to 200 meters depending on depth and deployment strategy. Sensors on the instrument packages included a CTD to provide depth and salinity information and a chromophoric dissolved organic matter(CDOM) fluorometer to measure the fluorescent fraction of the DOC. Discrete samples allowed calibration of the fluorometer and the CDOM data to be related to DOC. The combined data set from these cruises identified multiple scales of source and transport processes for DOC within the Hudson River/New York Harbor region. The Hudson carries a substantial amount of natural DOC from its 230 km inland stretch. Additional sources exist in fringing salt marshes adjacent to the Hackensack and Raritan rivers. However the lower Hudson/New Harbor region receives a large input of DOC from multiple publically owned treatment works (POTW) discharges. The high resolution surveys allowed us to elucidate the distribution of these sources and the manner in which they are rapidly mixed to create the total export. We estimate that anthropogenic sources account for up to 2.5 times the DOC flux contributed by natural processes.

  6. Isolation, screening, and characterization of surface-active agent-producing, oil-degrading marine bacteria of Mumbai Harbor.

    Science.gov (United States)

    Mohanram, Rajamani; Jagtap, Chandrakant; Kumar, Pradeep

    2016-04-15

    Diverse marine bacterial species predominantly found in oil-polluted seawater produce diverse surface-active agents. Surface-active agents produced by bacteria are classified into two groups based on their molecular weights, namely biosurfactants and bioemulsifiers. In this study, surface-active agent-producing, oil-degrading marine bacteria were isolated using a modified Bushnell-Haas medium with high-speed diesel as a carbon source from three oil-polluted sites of Mumbai Harbor. Surface-active agent-producing bacterial strains were screened using nine widely used methods. The nineteen bacterial strains showed positive results for more than four surface-active agent screening methods; further, these strains were characterized using biochemical and nucleic acid sequencing methods. Based on the results, the organisms belonged to the genera Acinetobacter, Alcanivorax, Bacillus, Comamonas, Chryseomicrobium, Halomonas, Marinobacter, Nesterenkonia, Pseudomonas, and Serratia. The present study confirmed the prevalence of surface-active agent-producing bacteria in the oil-polluted waters of Mumbai Harbor. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. Characteristics of trophic transfer of polychlorinated biphenyls in marine organisms in Incheon North Harbor, Korea.

    Science.gov (United States)

    Kim, Seung Kyu; Lee, Dong Soo; Oh, Jae Ryong

    2002-04-01

    The trophic transfer of polychlorinated biphenyls (PCBs) was characterized for zooplankton (primarily Paracalanus spp. and Acartia spp.), pacific oyster (Crassostrea gigas), shore crab (Hemigrapsus penicillatus), and goby (Acanthogobius hasta) in the aquatic system of Incheon North Harbor, Korea. The congener pattern in the species was clearly divided by the main PCB uptake route. Compared with zooplankton and oyster, the fraction of heavier homologues increased in crab and goby that take PCBs from food. Linear relationships were observed between log (fugacity in lipid/fugacity in seawater) and log Kow for all the species. For zooplankton and oyster, such an observation should not be regarded as a true absence of superhydrophobicity, because establishment of equilibrium with seawater was not evident. For crab and goby, the absence of superhydrophobicity was evidenced by the trophic transfer factor that continuously increased with Kow up to 10(7.8). These results suggest that superhydrophobicity might be species specific. The trophic transfer factors and the fugacity levels in the lipid phase indicated that bioaccumulation in crab and goby advanced beyond the level in equilibrium with seawater in the harbor basin.

  8. West Nile Flavivirus Polioencephalomyelitis in a harbor seal (Phoca vitulina).

    Science.gov (United States)

    Del Piero, F; Stremme, D W; Habecker, P L; Cantile, C

    2006-01-01

    A 12-year-old male harbor seal presented with progressive signs of neurologic dysfunction including head tremors, muzzle twitching, clonic spasms, and weakness. Lesions included polioencephalomyelitis with glial nodules, spheroids, neuronophagia, ring hemorrhages, and a few neutrophils. Neurons, fibers, and glial nodules were multifocally colonized with intracytoplasmic West Nile flavivirus antigens that were demonstrated using indirect immunohistochemical analysis. Flavivirus on cultured cells also was isolated and was identified by use of monoclonal antibodies and reverse transcriptase-polymerase chain reaction analysis. Clinical signs of disease and lesion morphology and distribution were similar to those of equine West Nile virus infection. Similar to horses, alpacas, humans, dogs, and reptiles, seals can be dead-end hosts of West Nile virus.

  9. The isolation and partial characterization of a highly pathogenic herpesvirus from the harbor seal (Phoca vitulina).

    NARCIS (Netherlands)

    A.D.M.E. Osterhaus (Albert); H. Yang (Hong); H.E.M. Spijkers (Ine); J. Groen (Jan); J.S. Teppema; G. van Steenis (Bert)

    1985-01-01

    textabstractThis report describes the first isolation and partial characterization of a herpesvirus from the harbor seal (Phoca vitulina). The virus was isolated during a disease outbreak in a group of young seals nursed in a seal orphanage in The Netherlands. Almost half of the seals died with

  10. 77 FR 42640 - Safety Zone; Can-Am Festival Fireworks, Black River Bay, Sackets Harbor, NY

    Science.gov (United States)

    2012-07-20

    ...-AA00 Safety Zone; Can-Am Festival Fireworks, Black River Bay, Sackets Harbor, NY AGENCY: Coast Guard... Black River Bay during the Can-Am Festival Fireworks display. This temporary safety zone is necessary to... Can-Am Festival Fireworks. This zone will be effective and enforced from 9:15 p.m. until 10:45 p.m. on...

  11. Substantial nitrous oxide emissions from intertidal sediments and groundwater in anthropogenically-impacted West Falmouth Harbor, Massachusetts

    Science.gov (United States)

    Moseman-Valtierra, Serena; Kroeger, Kevin D.; Crusius, John; Baldwin, Sandy; Green, Adrian; Brooks, Thomas W.; Pugh, E.

    2015-01-01

    Large N2O emissions were observed from intertidal sediments in a coastal estuary, West Falmouth Harbor, MA, USA. Average N2O emission rates from 41 chambers during summer 2008 were 10.7 mol N2O m(-2) h(-1)±4.43 μmol N2O m(-2) h(-1) (standard error). Emissions were highest from sediments within a known wastewater plume, where a maximum N2O emission rate was 155 μmol N2O m(-2) h(-1). Intertidal N2O fluxes were positively related to porewater ammonium concentrations at 10 and 25 cm depths. In groundwater from 7 shoreline wells, dissolved N2O ranged from 488% of saturation (56 nM N2O) to more than 13000% of saturation (1529 nM N2O) and was positively related to nitrate concentrations. Fresh and brackish porewater underlying 14 chambers was also supersaturated in N2O, ranging from 2980% to 13175% of saturation. These observations support a relationship between anthropogenic nutrient loading and N2O emissions in West Falmouth Harbor, with both groundwater sources and also local N2O production within nutrient-rich, intertidal sediments in the groundwater seepage face. N2O emissions from intertidal "hotspot" in this harbor, together with estimated surface water emissions, constituted 2.4% of the average overall rate of nitrogen export from the watershed to the estuary. This suggests that N2O emissions factors from coastal ecosystems may be underestimated. Since anthropogenic nutrient loading affects estuaries worldwide, quantification of N2O dynamics is warranted in other anthropogenically-impacted coastal ecosystems.

  12. Substantial nitrous oxide emissions from intertidal sediments and groundwater in anthropogenically-impacted West Falmouth Harbor, Massachusetts.

    Science.gov (United States)

    Moseman-Valtierra, Serena; Kroeger, Kevin D; Crusius, John; Baldwin, Sandra; Green, Adrian; Brooks, T Wallace; Pugh, Emily

    2015-01-01

    Large N2O emissions were observed from intertidal sediments in a coastal estuary, West Falmouth Harbor, MA, USA. Average N2O emission rates from 41 chambers during summer 2008 were 10.7 mol N2O m(-2) h(-1)±4.43 μmol N2O m(-2) h(-1) (standard error). Emissions were highest from sediments within a known wastewater plume, where a maximum N2O emission rate was 155 μmol N2O m(-2) h(-1). Intertidal N2O fluxes were positively related to porewater ammonium concentrations at 10 and 25 cm depths. In groundwater from 7 shoreline wells, dissolved N2O ranged from 488% of saturation (56 nM N2O) to more than 13000% of saturation (1529 nM N2O) and was positively related to nitrate concentrations. Fresh and brackish porewater underlying 14 chambers was also supersaturated in N2O, ranging from 2980% to 13175% of saturation. These observations support a relationship between anthropogenic nutrient loading and N2O emissions in West Falmouth Harbor, with both groundwater sources and also local N2O production within nutrient-rich, intertidal sediments in the groundwater seepage face. N2O emissions from intertidal "hotspot" in this harbor, together with estimated surface water emissions, constituted 2.4% of the average overall rate of nitrogen export from the watershed to the estuary. This suggests that N2O emissions factors from coastal ecosystems may be underestimated. Since anthropogenic nutrient loading affects estuaries worldwide, quantification of N2O dynamics is warranted in other anthropogenically-impacted coastal ecosystems. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. The Mid-Atlantic Engineers: A History of the Baltimore District U.S. Army Corps of Engineers, 1774-1974

    Science.gov (United States)

    1976-08-01

    varied, encom- passing tours of duty on the Savannah River, Georgia; Charleston harbor, South Carolina; Fort Jefferson, Tortugas , Florida; and Fort...7bLtr, Craighill to J. Carey Coale, Chmn, Committee on River and Harbor Approaches, Baltimore Bd of Trade, 21 Mar 1883. Rec Gp 77, entry 969, vo!. VI

  14. Cladophora (Chlorophyta) spp. harbor human bacterial pathogens in nearshore water of Lake Michigan

    Science.gov (United States)

    Ishii, S.; Yan, T.; Shively, D.A.; Byappanahalli, M.N.; Whitman, R.L.; Sadowsky, M.J.

    2006-01-01

    Cladophora glomerata, a macrophytic green alga, is commonly found in the Great Lakes, and significant accumulations occur along shorelines during the summer months. Recently, Cladophora has been shown to harbor high densities of the fecal indicator bacteria Escherichia coli and enterococci. Cladophora may also harbor human pathogens; however, until now, no studies to address this question have been performed. In the present study, we determined whether attachedCladophora, obtained from the Lake Michigan and Burns Ditch (Little Calumet River, Indiana) sides of a breakwater during the summers of 2004 and 2005, harbored the bacterial pathogens Shiga toxin-producing Escherichia coli (STEC),Salmonella, Shigella, and Campylobacter. The presence of potential pathogens and numbers of organisms were determined by using cultural methods and by using conventional PCR, most-probable-number PCR (MPN-PCR), and quantitative PCR (QPCR) performed with genus- and toxin-specific primers and probes. WhileShigella and STEC were detected in 100% and 25%, respectively, of the algal samples obtained near Burns Ditch in 2004, the same pathogens were not detected in samples collected in 2005. MPN-PCR and QPCR allowed enumeration of Salmonella in 40 to 80% of the ditch- and lakeside samples, respectively, and the densities were up to 1.6 × 103 cells per g Cladophora. Similarly, these PCR methods allowed enumeration of up to 5.4 × 102 Campylobacter cells/gCladophora in 60 to 100% of lake- and ditchside samples. The Campylobacterdensities were significantly higher (P fingerprint analyses indicated that genotypically identical Salmonella isolates were associated with geographically and temporally distinct Cladophora samples. However, Campylobacter isolates were genetically diverse. Since animal hosts are thought to be the primary habitat forCampylobacter and Salmonella species, our results suggest that Cladophora is a likely secondary habitat for pathogenic

  15. 76 FR 70479 - Draft Environmental Assessment and Safe Harbor Agreement for the Houston Toad Within Nine Texas...

    Science.gov (United States)

    2011-11-14

    ...] Draft Environmental Assessment and Safe Harbor Agreement for the Houston Toad Within Nine Texas Counties... of the endangered Houston toad (Bufo houstonensis) as a result of conservation actions, land...: [email protected] . Include ``Clear Lake Ecological Services Field Office draft Houston Toad...

  16. Shared and unique components of human population structure and genome-wide signals of positive selection in South Asia.

    Science.gov (United States)

    Metspalu, Mait; Romero, Irene Gallego; Yunusbayev, Bayazit; Chaubey, Gyaneshwer; Mallick, Chandana Basu; Hudjashov, Georgi; Nelis, Mari; Mägi, Reedik; Metspalu, Ene; Remm, Maido; Pitchappan, Ramasamy; Singh, Lalji; Thangaraj, Kumarasamy; Villems, Richard; Kivisild, Toomas

    2011-12-09

    South Asia harbors one of the highest levels genetic diversity in Eurasia, which could be interpreted as a result of its long-term large effective population size and of admixture during its complex demographic history. In contrast to Pakistani populations, populations of Indian origin have been underrepresented in previous genomic scans of positive selection and population structure. Here we report data for more than 600,000 SNP markers genotyped in 142 samples from 30 ethnic groups in India. Combining our results with other available genome-wide data, we show that Indian populations are characterized by two major ancestry components, one of which is spread at comparable frequency and haplotype diversity in populations of South and West Asia and the Caucasus. The second component is more restricted to South Asia and accounts for more than 50% of the ancestry in Indian populations. Haplotype diversity associated with these South Asian ancestry components is significantly higher than that of the components dominating the West Eurasian ancestry palette. Modeling of the observed haplotype diversities suggests that both Indian ancestry components are older than the purported Indo-Aryan invasion 3,500 YBP. Consistent with the results of pairwise genetic distances among world regions, Indians share more ancestry signals with West than with East Eurasians. However, compared to Pakistani populations, a higher proportion of their genes show regionally specific signals of high haplotype homozygosity. Among such candidates of positive selection in India are MSTN and DOK5, both of which have potential implications in lipid metabolism and the etiology of type 2 diabetes. Copyright © 2011 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

  17. South Korea

    International Nuclear Information System (INIS)

    Hayes, P.

    1990-01-01

    South Korea aspires to become a major nuclear supplier in the world nuclear market. There is no doubt that South Korea has great potential to fulfill these aspirations. South Korea is well positioned in terms of competitiveness, market relationships, institutional capability, ability to deliver, and commitment to nonproliferation values. As a mercantilist state, South Korea hopes to capitalize on its close relationships with transnational nuclear corporations in this endeavor. It hopes to participate in two- or three-way joint ventures---especially with the American firms that have traditionally predominated in the South Korean domestic nuclear business---to market their nuclear wares abroad. This paper is divided into four parts. The first section describes South Korea's intent to become a nuclear supplier in the 1990s. It delineates the networks of prior transactions and relationships that South Korea may use to penetrate export markets. The second section reviews South Korea's nuclear export potential, particularly its technological acquisitions from the domestic nuclear program. These capabilities will determine the rate at which South Korea can enter specific nuclear markets. The third section describes the institutional framework in South Korea for the review and approval of nuclear exports

  18. Influenza A (H10N7) Virus Causes Respiratory Tract Disease in Harbor Seals and Ferrets

    NARCIS (Netherlands)

    van den Brand, Judith M A; Wohlsein, Peter; Herfst, Sander; Bodewes, Rogier; Pfankuche, Vanessa M; van de Bildt, Marco W G; Seehusen, Frauke; Puff, Christina; Richard, Mathilde; Siebert, Ursula; Lehnert, Kristina; Bestebroer, Theo; Lexmond, Pascal; Fouchier, Ron A M; Prenger-Berninghoff, Ellen; Herbst, Werner; Koopmans, Marion; Osterhaus, Albert D M E; Kuiken, Thijs; Baumgärtner, Wolfgang

    2016-01-01

    Avian influenza viruses sporadically cross the species barrier to mammals, including humans, in which they may cause epidemic disease. Recently such an epidemic occurred due to the emergence of avian influenza virus of the subtype H10N7 (Seal/H10N7) in harbor seals (Phoca vitulina). This epidemic

  19. 76 FR 21862 - Takes of Marine Mammals Incidental to Specified Activities; Harbor Activities Related to the...

    Science.gov (United States)

    2011-04-19

    ...; and 43 Northern elephant seals by Level B harassment only. To date, NMFS has issued eight, 1-year... elephant seals spend much of the year, generally about nine months, in the ocean. They are usually... Mariner harbor operations for one year. After addressing comments from NMFS, ULA modified its application...

  20. 78 FR 18277 - Special Local Regulation; Low Country Splash, Wando River, Cooper River, and Charleston Harbor...

    Science.gov (United States)

    2013-03-26

    ...-AA08 Special Local Regulation; Low Country Splash, Wando River, Cooper River, and Charleston Harbor... proposes to issue a special local regulation on the waters of the Wando River, Cooper River, and Charleston... Country Splash is scheduled to take place on the waters of the Wando River, Cooper River, and Charleston...

  1. The Wallula fault and tectonic framework of south-central Washington, as interpreted from magnetic and gravity anomalies

    Science.gov (United States)

    Blakely, Richard J.; Sherrod, Brian; Weaver, Craig S.; Wells, Ray; Rohay, Alan C.

    2014-01-01

    The Yakima fold and thrust belt (YFTB) in central Washington has accommodated regional, mostly north-directed, deformation of the Cascadia backarc since prior to emplacement of Miocene flood basalt of the Columbia River Basalt Group (CRBG). The YFTB consists of two structural domains. Northern folds of the YFTB strike eastward and terminate at the western margin of a 20-mGal negative gravity anomaly, the Pasco gravity low, straddling the North American continental margin. Southern folds of the YFTB strike southeastward, form part of the Olympic–Wallowa lineament (OWL), and pass south of the Pasco gravity low as the Wallula fault zone. An upper crustal model based on gravity and magnetic anomalies suggests that the Pasco gravity low is caused in part by an 8-km-deep Tertiary basin, the Pasco sub-basin, abutting the continental margin and concealed beneath CRBG. The Pasco sub-basin is crossed by north-northwest-striking magnetic anomalies caused by dikes of the 8.5 Ma Ice Harbor Member of the CRBG. At their northern end, dikes connect with the eastern terminus of the Saddle Mountains thrust of the YFTB. At their southern end, dikes are disrupted by the Wallula fault zone. The episode of NE–SW extension that promoted Ice Harbor dike injection apparently involved strike-slip displacement on the Saddle Mountains and Wallula faults. The amount of lateral shear on the OWL impacts the level of seismic hazard in the Cascadia region. Ice Harbor dikes, as mapped with aeromagnetic data, are dextrally offset by the Wallula fault zone a total of 6.9 km. Assuming that dike offsets are tectonic in origin, the Wallula fault zone has experienced an average dextral shear of 0.8 mm/y since dike emplacement 8.5 Ma, consistent with right-lateral stream offsets observed at other locations along the OWL. Southeastward, the Wallula fault transfers strain to the north-striking Hite fault, the possible location of the M 5.7 Milton-Freewater earthquake in 1936.

  2. Caffeine in an Urbanized Estuary: Past and Present Influence of Wastewater Effluents in Boston Harbor, MA, USA

    Science.gov (United States)

    Caffeine has been identified by previous research as a potential tracer of sanitary wastewater. To further assess the utility of caffeine as a tracer of wastewater sources, samples from 25 sites throughout Boston Harbor were collected and analyzed for caffeine by LC-MS/MS. Caff...

  3. 76 FR 20287 - Superfund Site, New Bedford Harbor, New Bedford, MA: Anchorage Ground and Regulated Navigation Area

    Science.gov (United States)

    2011-04-12

    ... may lead to the discovery of a significant environmental impact from this proposed rule. List of... engaged in activities associated with remediation efforts in the New Bedford Harbor Superfund Site... activity can be performed without undue risk to environmental remediation efforts. Requests for waivers...

  4. 75 FR 1734 - Children’s Online Privacy Protection Rule Safe Harbor Proposed Self-Regulatory Guidelines; i-SAFE...

    Science.gov (United States)

    2010-01-13

    ... Proposed Self-Regulatory Guidelines; i-SAFE, Inc. Application for Safe Harbor AGENCY: Federal Trade... for public comment concerning proposed self-regulatory guidelines submitted by i-SAFE, Inc. under the... approval self-regulatory guidelines that would implement the Rule's protections.\\3\\ \\1\\ 64 FR 59888 (1999...

  5. Critical ratios in harbor porpoises (Phocoena phocoena) for tonal signals between 0.315 and 150 kHz in random Gaussian white noise.

    Science.gov (United States)

    Kastelein, Ronald A; Wensveen, Paul J; Hoek, Lean; Au, Whitlow W L; Terhune, John M; de Jong, Christ A F

    2009-09-01

    A psychoacoustic behavioral technique was used to determine the critical ratios (CRs) of two harbor porpoises for tonal signals with frequencies between 0.315 and 150 kHz, in random Gaussian white noise. The masked 50% detection hearing thresholds were measured using a "go/no-go" response paradigm and an up-down staircase psychometric method. CRs were determined at one masking noise level for each test frequency and were similar in both animals. For signals between 0.315 and 4 kHz, the CRs were relatively constant at around 18 dB. Between 4 and 150 kHz the CR increased gradually from 18 to 39 dB ( approximately 3.3 dB/octave). Generally harbor porpoises can detect tonal signals in Gaussian white noise slightly better than most odontocetes tested so far. By combining the mean CRs found in the present study with the spectrum level of the background noise levels at sea, the basic audiogram, and the directivity index, the detection threshold levels of harbor porpoises for tonal signals in various sea states can be calculated.

  6. Long-term spatiotemporal trends and health risk assessment of oyster arsenic levels in coastal waters of northern South China Sea.

    Science.gov (United States)

    Wang, Xuefeng; Wang, Lifei; Jia, Xiaoping; Jackson, Donald A

    2017-09-01

    Long-term spatiotemporal trends and health risk assessment of oyster arsenic levels in the coastal waters of northern South China Sea were investigated in order to help improve the quality and safety control and sustainable aquaculture for mollusks in China. Cultured oysters (Crassostrea rivularis) collected from the waters of 23 bays, harbors, and estuaries along the coast of northern South China Sea from 1989 to 2012 were examined for spatial patterns and long-term temporal trends of oyster arsenic levels. Single-factor index and health risk assessment were used to quantify arsenic exposure to human health through oyster consumption. Overall, arsenic was detected in 97.4% of the oyster samples, and oyster arsenic levels were non-detectable-2.51 mg/kg with an average of 0.63 ± 0.54 mg/kg. Oyster arsenic levels in the coastal waters of northern South China Sea showed an overall decline from 1989 to 2012, remained relatively low since 2005, and slightly increased after 2007. Oyster arsenic levels in Guangdong coastal waters were much higher with more variation than in Guangxi and Hainan coastal waters, and the long-term trends of oyster arsenic levels in Guangdong coastal waters dominated the overall trends of oyster arsenic levels in the coastal waters of northern South China Sea. Within Guangdong Province, oyster arsenic levels were highest in east Guangdong coastal waters, followed by the Pearl River estuary and west Guangdong coastal waters. Single-factor index ranged between 0.27 and 0.97, and average health risk coefficient was 3.85 × 10 -5 , both suggesting that oyster arsenic levels in northern South China Sea are within the safe range for human consumption. However, long-term attention should be given to seafood market monitoring in China and the risk of arsenic exposure to human health through oyster consumption.

  7. Ecological evaluation of proposed dredged material from Richmond Harbor

    International Nuclear Information System (INIS)

    Pinza, M.R.; Ward, J.A.; Mayhew, H.L.; Word, J.Q.; Niyogi, D.K.; Kohn, N.P.

    1992-10-01

    During the summer of 1991, Battelle/Marine Sciences Laboratory (MSL) was contracted to conduct sampling and testing of sediments proposed for dredging of Richmond Harbor, California. The MSL collected sediment cores to a depth of -40 ft MLLW (-38 ft + 2 ft overdepth) from 28 (12-in. core) and 30 (4-in. core) stations. The sediment cores were allocated to six composite samples referred to as sediment treatments, which were then subjected to physical, chemical, toxicological, and bioaccumulation testing. Physical and chemical parameters included grain size, total organic carbon (TOC), total volatile solids (TVS), oil and grease, total petroleum hydrocarbons (TPH), polynuclear aromatic hydrocarbons (PAH), chlorinated pesticides, polychlorinated biphenyis (PCBs), priority pollutant metals, and butyltins. The results from the test treatments were compared to results from five reference treatments representative of potential in-bay and offshore disposal sites

  8. Ecological evaluation of proposed dredged material from Richmond Harbor

    Energy Technology Data Exchange (ETDEWEB)

    Pinza, M R; Ward, J A; Mayhew, H L; Word, J Q; Niyogi, D K; Kohn, N P [Battelle/Marine Sciences Lab., Sequim, WA (United States)

    1992-10-01

    During the summer of 1991, Battelle/Marine Sciences Laboratory (MSL) was contracted to conduct sampling and testing of sediments proposed for dredging of Richmond Harbor, California. The MSL collected sediment cores to a depth of [minus]40 ft MLLW ([minus]38 ft + 2 ft overdepth) from 28 (12-in. core) and 30 (4-in. core) stations. The sediment cores were allocated to six composite samples referred to as sediment treatments, which were then subjected to physical, chemical, toxicological, and bioaccumulation testing. Physical and chemical parameters included grain size, total organic carbon (TOC), total volatile solids (TVS), oil and grease, total petroleum hydrocarbons (TPH), polynuclear aromatic hydrocarbons (PAH), chlorinated pesticides, polychlorinated biphenyis (PCBs), priority pollutant metals, and butyltins. The results from the test treatments were compared to results from five reference treatments representative of potential in-bay and offshore disposal sites.

  9. PAH- and PCB-induced Alterations of Protein Tyrosine Kinase and Cytokine Gene Transcription in Harbor Seal (Phoca Vitulina PBMC

    Directory of Open Access Journals (Sweden)

    Jennifer C. C. Neale

    2005-01-01

    Full Text Available Mechanisms underlying in vitro immunomodulatory effects of polycyclic aromatic hydrocarbons (PAHs and polychlorinated biphenyls (PCBs were investigated in harbor seal peripheral leukocytes, via real-time PCR. We examined the relative genetic expression of the protein tyrosine kinases (PTKs Fyn and Itk, which play a critical role in T cell activation, and IL-2, a cytokine of central importance in initiating adaptive immune responses. IL-1, the macrophage-derived pro-inflammatory cytokine of innate immunity, was also included as a measure of macrophage function. Harbor seal PBMC were exposed to the prototypic immunotoxic PAH benzo[a]pyrene (BaP, 3,3',4,4',5,5'-hexachlorobiphenyl (CB-169, a model immunotoxic PCB, or DMSO (vehicle control. Exposure of Con A-stimulated harbor seal PBMC to both BaP and CB-169 produced significantly altered expression in all four targets relative to vehicle controls. The PTKs Fyn and Itk were both up-regulated following exposure to BaP and CB-169. In contrast, transcripts for IL-2 and IL-1 were decreased relative to controls by both treatments. Our findings are consistent with those of previous researchers working with human and rodent systems and support a hypothesis of contaminant-altered lymphocyte function mediated (at least in part by disruption of T cell receptor (TCR signaling and cytokine production.

  10. Enterobacter cloacae Complex Isolates Harboring blaNMC-A or blaIMI-Type Class A Carbapenemase Genes on Novel Chromosomal Integrative Elements and Plasmids.

    Science.gov (United States)

    Boyd, David A; Mataseje, Laura F; Davidson, Ross; Delport, Johannes A; Fuller, Jeff; Hoang, Linda; Lefebvre, Brigitte; Levett, Paul N; Roscoe, Diane L; Willey, Barbara M; Mulvey, Michael R

    2017-05-01

    Carbapenem-resistant Enterobacter cloacae complex isolates submitted to a reference laboratory from 2010 to 2015 were screened by PCR for seven common carbapenemase gene groups, namely, KPC, NDM, OXA-48, VIM, IMP, GES, and NMC-A/IMI. Nineteen of the submitted isolates (1.7%) were found to harbor Ambler class A bla NMC-A or bla IMI -type carbapenemases. All 19 isolates were resistant to at least one carbapenem but susceptible to aminoglycosides, trimethoprim-sulfamethoxazole, tigecycline, and ciprofloxacin. Most isolates (17/19) gave positive results with the Carba-NP test for phenotypic carbapenemase detection. Isolates were genetically diverse by pulsed-field gel electrophoresis macrorestriction analysis, multilocus sequence typing, and hsp60 gene analysis. The genes were found in various Enterobacter cloacae complex species; however, bla NMC-A was highly associated with Enterobacter ludwigii Whole-genome sequencing and bioinformatics analysis revealed that all NMC-A ( n = 10), IMI-1 ( n = 5), and IMI-9 ( n = 2) producers harbored the carbapenemase gene on EludIMEX-1-like integrative mobile elements (EcloIMEXs) located in the identical chromosomal locus. Two novel genes, bla IMI-5 and bla IMI-6 , were harbored on different IncFII-type plasmids. Enterobacter cloacae complex isolates harboring bla NMC-A/IMI -type carbapenemases are relatively rare in Canada. Though mostly found integrated into the chromosome, some variants are located on plasmids that may enhance their mobility potential. © Crown copyright 2017.

  11. Numerical Simulation of Borehole Flow in Deep Monitor Wells, Pearl Harbor Aquifer, Oahu, Hawaii

    Science.gov (United States)

    Rotzoll, K.; Oki, D. S.; El-Kadi, A. I.

    2010-12-01

    Salinity profiles collected from uncased deep monitor wells are commonly used to monitor freshwater-lens thickness in coastal aquifers. However, vertical flow in these wells can cause the measured salinity to differ from salinity in the adjacent aquifer. Substantial borehole flow has been observed in uncased wells in the Pearl Harbor aquifer, Oahu, Hawaii. A numerical modeling approach, incorporating aquifer hydraulic characteristics and recharge rates representative of the Pearl Harbor aquifer, was used to evaluate the effects of borehole flow on measured salinity profiles from deep monitor wells. Borehole flow caused by vertical hydraulic gradients associated with the natural regional groundwater-flow system and local groundwater withdrawals was simulated. Model results were used to estimate differences between vertical salinity profiles in deep monitor wells and the adjacent aquifer in areas of downward, horizontal, and upward flow within the regional flow system—for cases with and without nearby pumped wells. Aquifer heterogeneity, represented in the model as layers of contrasting permeability, was incorporated in model scenarios. Results from this study provide insight into the magnitude of the differences between vertical salinity profiles from deep monitor wells and the salinity distributions in the aquifers. These insights are relevant and are critically needed for management and predictive modeling purposes.

  12. Beyond rhetoric: South-South collaboration for REDD+

    Energy Technology Data Exchange (ETDEWEB)

    Nhantumbo, Isilda; MacQueen, Duncan

    2011-11-15

    Global debates about reducing emissions from deforestation and forest degradation, and promoting conservation, sustainable forest management and enhancement of forest carbon stocks (REDD+) emphasise the need for strategies to build on existing knowledge. In one example of South-South collaboration to do just this, IIED has helped facilitate a Mozambique-Brazil partnership to share expertise and create a unique REDD+ working group. The initiative provides key lessons for other countries contemplating South-South collaboration on REDD+, including the need for charismatic champions, continuity in government representation, and integration across sectors.

  13. The effect of a large Danish offshore wind farm on harbor and grey seal haul-out behaviour

    DEFF Research Database (Denmark)

    Edrén, Susi Manuela Clermont; Andersen, Signe May; Teilmann, Jonas

    2010-01-01

    This study investigates the effects of the construction and operation of a large Danish offshore wind farm on harbor and gray seal haul-out behavior within a nearby (4 km) seal sanctuary. Time-lapse photography, visual monitoring, and aerial surveys were used to monitor the number of seals on land...... in daylight hours. Seals were monitored during two preconstruction periods (19 June–31 August 2001 and April–August 2002), a construction period of the wind farm (August 2002–December 2003), and a period of operation of the wind farm (December 2003–December 2004). Monthly aerial surveys were conducted...... to estimate the proportion of seals in the sanctuary relative to neighboring haul-out sites. From preconstruction to construction and through the first year of operation the number of harbor seals in the sanctuary increased at the same rate as the number of seals at the neighboring haul-out sites. No long...

  14. Colorimetric DNAzyme Biosensor for Convenience Detection of Enterotoxin B Harboring Staphylococcus aureus from Food Samples.

    Science.gov (United States)

    Mondal, Bhairab; N, Bhavanashri; Ramlal, Shylaja; Kingston, Joseph

    2018-02-14

    In the present study, a colorimetric DNAzymes biosensor strategy was devised in combination with immunomagnetic separation for rapid and easy detection of enterotoxin B harboring Staphylococcus aureus from food and clinical samples. The method employs immunocapture of S. aureus and amplification of seb gene by DNAzyme complementary sequence integrated forward primer and with specific reverse primer. The DNAzyme sequence integrated dsDNA PCR products when treated with hemin and TMB (3,3',5,5'-tetramethylbenzidine) in the presence of H 2 O 2 produce colorimetric signal. A linear relationship of optical signal with the initial template of seb was obtained which could be monitored by visually or spectrophotrometrically for qualitative and quantitative detection. The limit of detection for the assay was approximately 10 2 CFU/mL of seb gene harboring target. This method is convenient compared to gel based and ELISA systems. Further, spiking studies and analysis on natural samples emphasized the robustness and applicability of developed method. Altogether, the established assay could be a reliable alternative, low-cost, viable detection tool for the routine investigation of seb from food and clinical sources.

  15. 78 FR 79201 - Medicare and State Health Care Programs: Fraud and Abuse; Electronic Health Records Safe Harbor...

    Science.gov (United States)

    2013-12-27

    ... limitation, kickbacks, bribes, and rebates, whether made directly or indirectly, overtly or covertly, in cash... the purchasing, leasing, or ordering of, or arranging for or recommending the purchasing, leasing, or... harbor at 42 CFR 1001.952(y). Arrangements that disguise the ``purchase'' or lock-in of referrals and...

  16. Threshold received sound pressure levels of single 1-2 kHz and 6-7 kHz up-sweeps and down-sweeps causing startle responses in a harbor porpoise (Phocoena phocoena)

    NARCIS (Netherlands)

    Kastelein, R.A.; Steen, N.; Gransier, R.; Wensveen, P.J.; Jong, C.A.F. de

    2012-01-01

    Mid-frequency and low-frequency sonar systems produce frequency-modulated sweeps which may affect harbor porpoises. To study the effect of sweeps on behavioral responses (specifically startle responses, which we define as sudden changes in swimming speed and/or direction), a harbor porpoise in a

  17. Geographic, seasonal, and diurnal surface behavior of harbor porpoises

    DEFF Research Database (Denmark)

    Teilmann, Jonas; Christiansen, C.T.; Kjellerup, Sanne

    2013-01-01

    are essential information on the status and management of the species. Thirty-five free-ranging harbor porpoises (Phocoena phocoena) were tracked in the region between the Baltic and the North Sea for 25-349 d using Argos satellite transmitters. No differences were found in surface behavior between geographical...... areas or the size of the animals. Slight differences were found between the two sexes and time of day. Surface time peaked in April, where 6% was spent with the transmitter above surface and 61.5% between 0 and 2 m depth, while the minimum values occurred in February (3.4% and 42.5%, respectively......). The analyses reveal that individual variation among porpoises is the most important factor in explaining variation in surface rates. However, the large number of animals documented in the present study covering a wide range of age and sex groups justifies the use of the seasonal average surface times...

  18. Water resources research program. Pollution of coastal waters off Chicago by sinking plumes from the Indiana Harbor Canal

    International Nuclear Information System (INIS)

    Harrison, W.; McCown, D.L.; Raphaelian, L.A.; Saunders, K.D.

    1977-12-01

    On March 2, 1977, during sinking-plume conditions, a portion of the water of the Indiana Harbor Canal (IHC) was injected with samarium and rhodamine-dye tags and a section of the IHC's surface was covered with simulated oily waste tagged with dysprosium. Water samples were taken downcurrent, over a 54-hr period, from a vessel and from the raw-water streams from the intakes at Chicago's South Water Filtration Plant (SWFP). Bottom currents and water temperatures were measured almost continuously at four Lake Michigan stations located between the IHC and the SWFP. Unequivocal evidence is presented for transport of the tagged IHC water and oily waste to the SWFP's intakes. Organic contaminants from the IHC were present in trace concentrations in the SWFP's raw water. A model for the transport and mixing of the entire IHC effluent, for the environmental conditions during the experiment, indicates a minimum dilution of 4 in the plume offshore of the SWFP and, for the assumed plume trajectory, values of 5 x 10 2 and 10 5 at the shore and crib intakes, respectively. A similar model applied to the experimental situation of tagged effluent showed reasonable agreement with measurements. Analysis of historical data indicates that the worst-case pollution event that might be experienced at the SWFP, assuming constant pollutant loading in the IHC, would be due to 24 hr of northwest wind followed by a 3.0-in. (7.6 cm), 24-hr rainfall that coincides with 3.0 x 10 6 m of total wind movement from the southerly quadrants

  19. 78 FR 11116 - Safety Zone; Mamaroneck Beach and Yacht Club Fireworks, Mamaroneck Harbor, Long Island Sound, NY

    Science.gov (United States)

    2013-02-15

    ... 1625-AA00 Safety Zone; Mamaroneck Beach and Yacht Club Fireworks, Mamaroneck Harbor, Long Island Sound... to establish a temporary safety zone on the navigable waters of Long Island Sound in the vicinity of... from a portion of Long Island Sound before, during, and immediately after the fireworks event. DATES...

  20. Cold Spring Harbor symposia on quantitative biology: Volume 49, Recombination at the DNA level

    International Nuclear Information System (INIS)

    1984-01-01

    This volume contains full papers prepared by the participants to the 1984 Cold Springs Harbor Symposia on Quantitative Biology. This year's theme is entitled Recombination at the DNA level. The volume consists of 93 articles grouped into subject areas entitled chromosome mechanics, yeast systems, mammalian homologous recombination, transposons, mu, plant transposons/T4 recombination, topoisomerase, resolvase and gyrase, Escherichia coli general recombination, RecA, repair, leukaryotic enzymes, integration and excision of bacteriophage, site-specific recombination, and recombination in vitro

  1. Seroprevalence of Antibodies against Seal Influenza A(H10N7) Virus in Harbor Seals and Gray Seals from the Netherlands.

    Science.gov (United States)

    Bodewes, Rogier; Rubio García, Ana; Brasseur, Sophie M; Sanchez Conteras, Guillermo J; van de Bildt, Marco W G; Koopmans, Marion P G; Osterhaus, Albert D M E; Kuiken, Thijs

    2015-01-01

    In the spring and summer 2014, an outbreak of seal influenza A(H10N7) virus infection occurred among harbor seals (Phoca vitulina) off the coasts of Sweden and Denmark. This virus subsequently spread to harbor seals off the coasts of Germany and the Netherlands. While thousands of seals were reported dead in Sweden, Denmark and Germany, only a limited number of seals were found dead in the Netherlands. To determine the extent of exposure of seals in the Netherlands to influenza A/H10N7 virus, we measured specific antibody titers in serum samples from live-captured seals and seals admitted for rehabilitation in the Netherlands by use of a hemagglutination inhibition assay and an ELISA. In harbor seals in 2015, antibodies against seal influenza A(H10N7) virus were detected in 41% (32 out of 78) pups, 10% (5 out of 52) weaners, and 58% (7 out of 12) subadults or adults. In gray seals (Halichoerus grypus) in 2015, specific antibodies were not found in the pups (n = 26), but in 26% (5 out of 19) of the older animals. These findings indicate that, despite apparent low mortality, infection with seal influenza A(H10N7) virus was geographically widespread and also occurred in grey seals.

  2. Biodiversity of marine communities in Pearl Harbor, Oahu, Hawaii with observations in 1996 on introduced exotic species (NODC Accession 0000330)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The marine and estuarine invertebrate and fish communities in Pearl Harbor, Oahu, Hawaii were surveyed between January and October, 1996. Samples were taken and...

  3. Investigations of introduced species in Pearl Harbor; Oahu, Hawaii, from 1996-01-11 to 1996-09-18 (NODC Accession 0000330)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The marine and estuarine invertebrate and fish communities in Pearl Harbor, Oahu, Hawaii were surveyed between January and October, 1996. Samples were taken and...

  4. The influence of signal parameters on the sound source localization ability of a harbor porpoise (Phocoena phocoena)

    NARCIS (Netherlands)

    Kastelein, R.A.; Haan, D.de; Verboom, W.C.

    2007-01-01

    It is unclear how well harbor porpoises can locate sound sources, and thus can locate acoustic alarms on gillnets. Therefore the ability of a porpoise to determine the location of a sound source was determined. The animal was trained to indicate the active one of 16 transducers in a 16-m -diam

  5. 33 CFR 110.83 - Chicago Harbor, Ill.

    Science.gov (United States)

    2010-07-01

    .... Beginning at a point 2,120 feet South of the intersection of the North line of the Chicago Yacht Club... the first described line, passing 100 feet East of the Chicago Yacht Club bulkhead, 440 feet; thence.... Beginning at a point 145 feet North of the North line of the Chicago Yacht Club bulkhead, as constructed in...

  6. 33 CFR 110.30 - Boston Harbor, Mass.

    Science.gov (United States)

    2010-07-01

    ... Yacht Club, South Boston. Northerly of a line bearing 96° from the stack of the heating plant of the... Yacht Club property. (b) Dorchester Bay, in vicinity of Savin Hill Yacht Club. Northerly of a line... vicinity of Dorchester Yacht Club. Eastward of a line bearing 21° from the stack located a short distance...

  7. Relation between PAH and black carbon contents in size fractions of Norwegian harbor sediments

    International Nuclear Information System (INIS)

    Oen, Amy M.P.; Cornelissen, Gerard; Breedveld, Gijs D.

    2006-01-01

    Distributions of total organic carbon (TOC), black carbon (BC), and polycyclic aromatic hydrocarbons (PAH) were investigated in different particle size fractions for four Norwegian harbor sediments. The total PAH (16-EPA) concentrations ranged from 2 to 113 mg/kg dry weight with the greatest fraction of PAH mass in the sand fraction for three of the four sediments. TOC contents ranged from 0.84% to 14.2% and BC contents from 0.085% to 1.7%. This corresponds to organic carbon (OC = TOC - BC) contents in the range of 0.81-14% and BC:TOC ratios of 1.3-18.1%. PAH isomer ratios suggested that the PAH in all four sediments were of pyrogenic origin. Furthermore, stronger correlations between PAH versus BC (r 2 = 0.85) than versus OC (r 2 = 0.15) were found. For all size fractions and bulk sediments, the PAH-to-BC ratios for the total PAHs were on average 6 ± 3 mg PAH/g BC. These results suggest that PAH distributions were dominated by the presence of BC, rather than OC. As sorption to BC is much stronger than sorption to OC, this may result in significantly lower dissolved concentrations of PAH than expected on the basis of organic carbon partitioning alone. - PAH contents correlated better with black carbon than organic carbon for four Norwegian harbor sediments

  8. Haul-out behavior of harbor seals (Phoca vitulina in Hood Canal, Washington.

    Directory of Open Access Journals (Sweden)

    Josh M London

    Full Text Available The goal of this study was to model haul-out behavior of harbor seals (Phoca vitulina in the Hood Canal region of Washington State with respect to changes in physiological, environmental, and temporal covariates. Previous research has provided a solid understanding of seal haul-out behavior. Here, we expand on that work using a generalized linear mixed model (GLMM with temporal autocorrelation and a large dataset. Our dataset included behavioral haul-out records from archival and VHF radio tag deployments on 25 individual seals representing 61,430 seal hours. A novel application for increased computational efficiency allowed us to examine this large dataset with a GLMM that appropriately accounts for temporal autocorellation. We found significant relationships with the covariates hour of day, day of year, minutes from high tide and year. Additionally, there was a significant effect of the interaction term hour of day : day of year. This interaction term demonstrated that seals are more likely to haul out during nighttime hours in August and September, but then switch to predominantly daylight haul-out patterns in October and November. We attribute this change in behavior to an effect of human disturbance levels. This study also examined a unique ecological event to determine the role of increased killer whale (Orcinus orca predation on haul-out behavior. In 2003 and 2005 these harbor seals were exposed to unprecedented levels of killer whale predation and results show an overall increase in haul-out probability after exposure to killer whales. The outcome of this study will be integral to understanding any changes in population abundance as a result of increased killer whale predation.

  9. Foraminiferal proxies for pollution monitoring in moderately polluted harbors

    International Nuclear Information System (INIS)

    Armynot du Chatelet, E.; Debenay, J.-P.; Soulard, R.

    2004-01-01

    Foraminiferal density and species richness that decrease with an increase in heavy metal and PAH concentration may be used as pollution indicators. - Benthic foraminifera are increasingly used as environmental bio-indicators, especially in polluted environments where their sensitivity to pollutants may be expressed by a modification of the assemblages. Eighteen sediment samples were collected in September 2000 in five harbors located in moderately polluted estuaries on the coast of Vendee (France) for the study of foraminiferal assemblages. Ten heavy metals and 13 PAH have been analyzed from the sediments. The marine to continental estuarine gradient has a prevalent influence on the foraminiferal distribution. However, the results show that foraminiferal density and species richness of the assemblages decrease with an increase in heavy metal and PAH concentration, and therefore may be used as pollution indicators. Moreover, the more polluted areas are dominated by the tolerant pioneer species Haynesina germanica that may be used as bio-indicator of pollution, mainly in the uppermost areas

  10. Cold Spring Harbor symposia on quantitative biology. Volume XLVII, Part 1. Structures of DNA

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    The proceedings for the 47th Annual Cold Spring Harbor Symposia on Quantitative Biology are presented. This symposium focused on the Structure of DNA. Topics presented covered research in the handedness of DNA, conformational analysis, chemically modified DNA, chemical synthesis of DNA, DNA-protein interactions, DNA within nucleosomes, DNA methylation, DNA replication, gyrases and topoisomerases, recombining and mutating DNA, transcription of DNA and its regulation, the organization of genes along DNA, repetitive DNA and pseudogenes, and origins of replication, centromeres, and teleomeres

  11. St. John's Harbour's South Side Hills internal development concept: going underground for multi-use space

    Energy Technology Data Exchange (ETDEWEB)

    Kierans, T W

    1979-03-01

    The advantages of underground locations for space saving, security, stability, environmental, aesthetic, and weather protection reasons with regard to power plants, municipal transport facilities, liquid fuel storage, national defence structures, public utilities and parking garages have been recognized for many years. The municipal, provincial, and federal authorities responsible for the city and seaport of St. John's, Newfoundland should consider the short-, medium-, and long-term benefits of the comprehensive concept proposed in this paper for the internal development of the South Side Hills - the rocky, sandstone hills that rise steeply to over 220 m between the crowded St. John's Harbour and Freshwater Bay. This proposal outlines a plan of excavation, space utilization, organization, financing, rock support, ventilation, water and energy supply, transportation arrangements and, not of least of all, the important use of the excavated rock to create a system of bottom-founded and floating concrete breakwaters at the entrance to Freshwater Bay. The proposed breakwaters would make it possible for St. John's to claim one of the finest deep-water harbors on the eastern seaboard of North America. Its location close to the North Atlantic main shipping lanes and on the threshold of the potential energy corridor to the Easten Arctic makes it an outstanding and natural location for such a facility. Other benefits include environmental protection and conservation of the natural beauty of the Hills and much improved utilization of the existing harbor. The employment opportunities and the potential for substantial city growth using existing untapped natural resources appear fully to merit the detailed economic cost studies that the concept now requires.

  12. Correlation of ophthalmic examination with carrier status in females potentially harboring a severe Norrie disease gene mutation.

    Science.gov (United States)

    Khan, Arif O; Aldahmesh, Mohammed A; Meyer, Brian

    2008-04-01

    To correlate ophthalmic findings with carrier status for a severe Norrie disease (ND) gene mutation (C95F). Prospective interventional case series. Six potential carriers and 1 obligate carrier from a family harboring the mutation. An ophthalmologist blind to the pedigree performed a full ophthalmic examination for the 7 asymptomatic family members. A peripheral blood sample was collected from each for ND gene sequencing. Ophthalmic examination findings (with attention to the presence or absence of retinal findings) and results of ND gene sequencing. Three carriers were identified by molecular genetics, and all 3 of them had peripheral retinal abnormality. However, 3 of the 4 genetically identified noncarriers also exhibited peripheral retinal abnormality. Two of these noncarriers with retinal findings were the offspring of a confirmed noncarrier. The genetically identified noncarrier with a normal peripheral retinal examination was the daughter of an obligate carrier. The presence of peripheral retinal changes was not useful for carrier prediction in a family harboring ND. There are likely additional loci responsible for phenotypic expression.

  13. First record of Wolbachia in South American terrestrial isopods: prevalence and diversity in two species of Balloniscus (Crustacea, Oniscidea

    Directory of Open Access Journals (Sweden)

    Mauricio Pereira Almerão

    2012-01-01

    Full Text Available Wolbachia are endosymbiotic bacteria that commonly infect arthropods, inducing certain phenotypes in their hosts. So far, no endemic South American species of terrestrial isopods have been investigated for Wolbachia infection. In this work, populations from two species of Balloniscus (B. sellowii and B. glaber were studied through a diagnostic PCR assay. Fifteen new Wolbachia 16S rDNA sequences were detected. Wolbachia found in both species were generally specific to one population, and five populations hosted two different Wolbachia 16S rDNA sequences. Prevalence was higher in B. glaber than in B. sellowii, but uninfected populations could be found in both species. Wolbachia strains from B. sellowii had a higher genetic variation than those isolated from B. glaber. AMOVA analyses showed that most of the genetic variance was distributed among populations of each species rather than between species, and the phylogenetic analysis suggested that Wolbachia strains from Balloniscus cluster within Supergroup B, but do not form a single monophyletic clade, suggesting multiple infections for this group. Our results highlight the importance of studying Wolbachia prevalence and genetic diversity in Neotropical species and suggest that South American arthropods may harbor a great number of diverse strains, providing an interesting model to investigate the evolution of Wolbachia and its hosts.

  14. South-South medical tourism and the quest for health in Southern Africa.

    Science.gov (United States)

    Crush, Jonathan; Chikanda, Abel

    2015-01-01

    Intra-regional South-South medical tourism is a vastly understudied subject despite its significance in many parts of the Global South. This paper takes issue with the conventional notion of South Africa purely as a high-end "surgeon and safari" destination for medical tourists from the Global North. It argues that South-South movement to South Africa for medical treatment is far more significant, numerically and financially, than North-South movement. The general lack of access to medical diagnosis and treatment in SADC countries has led to a growing temporary movement of people across borders to seek help at South African institutions in border towns and in the major cities. These movements are both formal (institutional) and informal (individual) in nature. In some cases, patients go to South Africa for procedures that are not offered in their own countries. In others, patients are referred by doctors and hospitals to South African facilities. But the majority of the movement is motivated by lack of access to basic healthcare at home. The high demand and large informal flow of patients from countries neighbouring South Africa has prompted the South African government to try and formalise arrangements for medical travel to its public hospitals and clinics through inter-country agreements in order to recover the cost of treating non-residents. The danger, for 'disenfranchised' medical tourists who fall outside these agreements, is that medical xenophobia in South Africa may lead to increasing exclusion and denial of treatment. Medical tourism in this region and South-South medical tourism in general are areas that require much additional research. Copyright © 2014. Published by Elsevier Ltd.

  15. Influenza A (H10N7 Virus Causes Respiratory Tract Disease in Harbor Seals and Ferrets.

    Directory of Open Access Journals (Sweden)

    Judith M A van den Brand

    Full Text Available Avian influenza viruses sporadically cross the species barrier to mammals, including humans, in which they may cause epidemic disease. Recently such an epidemic occurred due to the emergence of avian influenza virus of the subtype H10N7 (Seal/H10N7 in harbor seals (Phoca vitulina. This epidemic caused high mortality in seals along the north-west coast of Europe and represented a potential risk for human health. To characterize the spectrum of lesions and to identify the target cells and viral distribution, findings in 16 harbor seals spontaneously infected with Seal/H10N7 are described. The seals had respiratory tract inflammation extending from the nasal cavity to bronchi associated with intralesional virus antigen in respiratory epithelial cells. Virus infection was restricted to the respiratory tract. The fatal outcome of the viral infection in seals was most likely caused by secondary bacterial infections. To investigate the pathogenic potential of H10N7 infection for humans, we inoculated the seal virus intratracheally into six ferrets and performed pathological and virological analyses at 3 and 7 days post inoculation. These experimentally inoculated ferrets displayed mild clinical signs, virus excretion from the pharynx and respiratory tract inflammation extending from bronchi to alveoli that was associated with virus antigen expression exclusively in the respiratory epithelium. Virus was isolated only from the respiratory tract. In conclusion, Seal/H10N7 infection in naturally infected harbor seals and experimentally infected ferrets shows that respiratory epithelial cells are the permissive cells for viral replication. Fatal outcome in seals was caused by secondary bacterial pneumonia similar to that in fatal human cases during influenza pandemics. Productive infection of ferrets indicates that seal/H10N7 may possess a zoonotic potential. This outbreak of LPAI from wild birds to seals demonstrates the risk of such occasions for mammals

  16. Coral baseline survey of Ma'alaea Harbor for light-draft vessels, Island of Maui, December 1997 - January 1998 (NODC Accession 9900025)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In 1968 the United States Congress approved funding for renovations to the existing harbor. Subsequently, a General Design Memorandum and Final Environmental Impact...

  17. Impact of climate changes on the Santos Harbor, São Paulo State (Brazil

    Directory of Open Access Journals (Sweden)

    Paolo Alfredini

    2013-12-01

    Full Text Available Santos Harbor Area (SHA in Sao Paulo Coastline (Brazil is the most important marine cargo transfer terminal in the Southern Hemisphere. A long term relative tidal level variability assessment shows a consistent response to relative sea level rise. A wave data base Wave Watch III was compared with a long term wave data-base generated by the ERA40-ECMWF (2003, both local validated. The current bed level of SHA Outer Channel is -15.00 m (Chart Datum or, in abbreviation, CD, maintained by dredging. According to the cargo throughput forecast, in 2025, the Access Channel will have to be deepened to level of -17.00 m. The feasibility of that choice is discussed from a technical, economical and conceptual navigation point of view in that context. A data set found from a scale model of the whole area of Santos Bay, Estuary and nearby beaches, showed the impact of maritime climate changes upon the coastal area. In the previous researches developed by the authors, it was demonstrated that the wave climate, the tides and tidal currents affect harbor and coastal structures maintenance, beaches stability, tidal inlet, sediment transport, saline intrusion and wetlands. Considering the increasing of the sea hazards and the high values of the infrastructures in that coastline, it is necessary to mitigate the risks. Hence, based on the results obtained by the authors, are highlighted guidelines strategies suggested for Access Channels dimensions, wharves free-board, jetties dimensions, dredging rates, rigid and flexible littoral defenses and land protection against flooding (including wetlands.

  18. Temporal and Spatial Diversity of Bacterial Communities in Coastal Waters of the South China Sea

    Science.gov (United States)

    Du, Jikun; Xiao, Kai; Li, Li; Ding, Xian; Liu, Helu; Lu, Yongjun; Zhou, Shining

    2013-01-01

    Bacteria are recognized as important drivers of biogeochemical processes in all aquatic ecosystems. Temporal and geographical patterns in ocean bacterial communities have been observed in many studies, but the temporal and spatial patterns in the bacterial communities from the South China Sea remained unexplored. To determine the spatiotemporal patterns, we generated 16S rRNA datasets for 15 samples collected from the five regularly distributed sites of the South China Sea in three seasons (spring, summer, winter). A total of 491 representative sequences were analyzed by MOTHUR, yielding 282 operational taxonomic units (OTUs) grouped at 97% stringency. Significant temporal variations of bacterial diversity were observed. Richness and diversity indices indicated that summer samples were the most diverse. The main bacterial group in spring and summer samples was Alphaproteobacteria, followed by Cyanobacteria and Gammaproteobacteria, whereas Cyanobacteria dominated the winter samples. Spatial patterns in the samples were observed that samples collected from the coastal (D151, D221) waters and offshore (D157, D1512, D224) waters clustered separately, the coastal samples harbored more diverse bacterial communities. However, the temporal pattern of the coastal site D151 was contrary to that of the coastal site D221. The LIBSHUFF statistics revealed noticeable differences among the spring, summer and winter libraries collected at five sites. The UPGMA tree showed there were temporal and spatial heterogeneity of bacterial community composition in coastal waters of the South China Sea. The water salinity (P=0.001) contributed significantly to the bacteria-environment relationship. Our results revealed that bacterial community structures were influenced by environmental factors and community-level changes in 16S-based diversity were better explained by spatial patterns than by temporal patterns. PMID:23785512

  19. Settlement of the USS Arizona, Pearl Harbor, Hawaii

    Science.gov (United States)

    Carkin, Brad A.; Kayen, Robert E.

    2013-01-01

    The U.S. Geological Survey, in collaboration with the National Park Service Submerged Resources Center, undertook investigations at the USS Arizona Memorial at Pearl Harbor, Hawaii, in 2002, 2003, and 2005 to characterize geological factors affecting the deterioration and movement of the hull of the USS Arizona. Since sinking on the morning of December 7, 1941, the hull of the USS Arizona has been slowly but steadily disappearing below the surface of Pearl Harbor. Continuous sediment coring at three of four locations around the hull of the Arizona was only partially successful, but it was sufficient to identify a varied sedimentary substrate beneath the hull. A boring near the stern reveals a thick, continuous sequence of soft, gray clay to the bottom of the boring. In contrast, borings near the bow and starboard side, below about 5 meters subbottom depth, indicate the presence of very stiff, brown clay and coral debris and an absence of soft clay. Multisensor core logger scanning of the recovered cores distinguishes the lower density of the soft, gray clay at the stern from the higher density of the stiff, brown clays and coral debris at the bow and starboard side. Uniaxial consolidation testing of the soft gray clay indicates a normally consolidated sequence, whereas the stiff, brown clay and coral debris are overconsolidated. Profiles of shear wave velocity vs. depth obtained through spectral analysis of interface wave testing around the perimeter of the hull in 2005 identified areas of higher velocity, stiffer sediment at the bow and starboard side, which correspond to the dense, stiff clay recovered near the bow and starboard borings. Low shear-wave velocities at the port midship and quarter of the hull correlate with the lower density, softer sediment recovered from the boring at the stern. Cross sections of the subbottom of the Memorial combine results from the sediment borings and geophysical surveys and depict a wedge of soft clay unconformably overlying

  20. 33 CFR 334.1050 - Oakland Outer Harbor adjacent to the Military Ocean Terminal, Bay Area, Pier No. 8 (Port of...

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.1050 Oakland Outer Harbor adjacent to... at 50 FR 42696, Oct. 22, 1985; 51 FR 25198, July 11, 1986, as amended at 62 FR 17557, Apr. 10, 1997] ...

  1. 78 FR 22778 - Safety Zone; Corp. Event Finale UHC, St. Thomas Harbor; St. Thomas, U.S.V.I.

    Science.gov (United States)

    2013-04-17

    ... waters of St. Thomas Harbor in St. Thomas, U.S. Virgin Islands during the Corp. Event Finale UHC, a.... and 5 p.m., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT: If you..., St. Thomas, U. S. Virgin Islands. The fireworks will be launched from a barge stationed near the St...

  2. 76 FR 45602 - Proposed Safe Harbor Agreement for California Red-Legged Frog, at Swallow Creek Ranch, San Luis...

    Science.gov (United States)

    2011-07-29

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R8-ES-2011-N144; 81440-1113-0000-F3] Proposed Safe Harbor Agreement for California Red-Legged Frog, at Swallow Creek Ranch, San Luis Obispo... Ranch in San Luis Obispo County, California. Within the 620 acres of land comprising the Enrolled...

  3. Perivascular Adipose Tissue Harbors Atheroprotective IgM-Producing B Cells

    Directory of Open Access Journals (Sweden)

    Prasad Srikakulapu

    2017-09-01

    Full Text Available Adipose tissue surrounding major arteries (Perivascular adipose tissue or PVAT has long been thought to exist to provide vessel support and insulation. Emerging evidence suggests that PVAT regulates artery physiology and pathology, such as, promoting atherosclerosis development through local production of inflammatory cytokines. Yet the immune subtypes in PVAT that regulate inflammation are poorly characterized. B cells have emerged as important immune cells in the regulation of visceral adipose tissue inflammation and atherosclerosis. B cell-mediated effects on atherosclerosis are subset-dependent with B-1 cells attenuating and B-2 cells aggravating atherosclerosis. While mechanisms whereby B-2 cells aggravate atherosclerosis are less clear, production of immunoglobulin type M (IgM antibodies is thought to be a major mechanism whereby B-1 cells limit atherosclerosis development. B-1 cell-derived IgM to oxidation specific epitopes (OSE on low density lipoproteins (LDL blocks oxidized LDL-induced inflammatory cytokine production and foam cell formation. However, whether PVAT contains B-1 cells and whether atheroprotective IgM is produced in PVAT is unknown. Results of the present study provide clear evidence that the majority of B cells in and around the aorta are derived from PVAT. Interestingly, a large proportion of these B cells belong to the B-1 subset with the B-1/B-2 ratio being 10-fold higher in PVAT relative to spleen and bone marrow. Moreover, PVAT contains significantly greater numbers of IgM secreting cells than the aorta. ApoE−/− mice with B cell-specific knockout of the gene encoding the helix-loop-helix factor Id3, known to have attenuated diet-induced atherosclerosis, have increased numbers of B-1b cells and increased IgM secreting cells in PVAT relative to littermate controls. Immunostaining of PVAT on human coronary arteries identified fat associated lymphoid clusters (FALCs harboring high numbers of B cells, and flow

  4. Metagenomic Survey of Viral Diversity Obtained from Feces of Subantarctic and South American Fur Seals.

    Directory of Open Access Journals (Sweden)

    Mariana Kluge

    Full Text Available The Brazilian South coast seasonally hosts numerous marine species, observed particularly during winter months. Some animals, including fur seals, are found dead or debilitated along the shore and may harbor potential pathogens within their microbiota. In the present study, a metagenomic approach was performed to evaluate the viral diversity in feces of fur seals found deceased along the coast of the state of Rio Grande do Sul. The fecal virome of two fur seal species was characterized: the South American fur seal (Arctocephalus australis and the Subantarctic fur seal (Arctocephalus tropicalis. Fecal samples from 10 specimens (A. australis, n = 5; A. tropicalis, n = 5 were collected and viral particles were purified, extracted and amplified with a random PCR. The products were sequenced through Ion Torrent and Illumina platforms and assembled reads were submitted to BLASTx searches. Both viromes were dominated by bacteriophages and included a number of potentially novel virus genomes. Sequences of picobirnaviruses, picornaviruses and a hepevirus-like were identified in A. australis. A rotavirus related to group C, a novel member of the Sakobuvirus and a sapovirus very similar to California sea lion sapovirus 1 were found in A. tropicalis. Additionally, sequences of members of the Anelloviridae and Parvoviridae families were detected in both fur seal species. This is the first metagenomic study to screen the fecal virome of fur seals, contributing to a better understanding of the complexity of the viral community present in the intestinal microbiota of these animals.

  5. A Comprehensive Copper Compliance Strategy: Implementing Regulatory Guidance at Pearl Harbor Naval Shipyard & Intermediate Maintenance Facility

    Science.gov (United States)

    2007-01-01

    species was not listed in the PHLP database (Bishop Museum, 1998). Personal observations by John Zardus (Kewalo Marine Laboratory, Honolulu, Hawaii...Ringwood, 1992). Specimens collected from an open coastal site by the University of Hawaii ( John Zardus ), did not survive the shipment (less than 24... John Ornellas, Randy Kido, and Rich Anderson from Code 106.3. The Shipyard Pearl Harbor Regional Dive Locker, Code 760, provided professional, high

  6. South-South Collaboration in Health Biotechnology: Growing ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-01

    Jan 1, 2012 ... South-South Collaboration in Health Biotechnology: Growing Partnerships amongst Developing ... the availability of more affordable health products and services. ... of Health Research, New Principal Investigator Award (2007-2012). ... water management: Innovative solutions from the Global South”.

  7. Clean Water Act (Section 404) and Rivers and Harbors Act (Sections 9 and 10)

    International Nuclear Information System (INIS)

    1992-01-01

    This Reference Book contains a current copy of the Clean Water Act (Section 404) and the Rivers and Harbors Act (Sections 9 and 10) and those regulations that implement those sections of the statutes and appear to be most relevant to DOE activities. The document is provided to DOE and contractor staff for informational purposes only and should not be interpreted as legal guidance. Updates that include important new requirements will be provided periodically. Questions concerning this Reference Book may be directed to Mark Petts, IH-231 (FTS 896-2609 or Commercial 202/586-2609)

  8. CLINICAL AND EPIDEMIOLOGIC CONSIDERATIONS OF CLOSTRIDIUM DIFFICILE IN HARBOR SEALS (PHOCA VITULINA) AT A MARINE MAMMAL REHABILITATION CENTER.

    Science.gov (United States)

    Anderson, Chelsea E; Haulena, Martin; Zabek, Erin; Habing, Gregory; Raverty, Stephen

    2015-06-01

    Between 1998 and 2008, 15 cases of segmental to diffuse hemorrhagic to necrohemorrhagic enterocolitis were diagnosed in neonatal and weaned juvenile harbor seals (Phoca vitulina) presented from the Vancouver Aquarium Marine Mammal Rescue Centre for rehabilitation. Based on a combination of gross pathology, histopathology, bacterial isolation, and toxin testing, Clostridium difficile enterocolitis was diagnosed. Most pups were anorexic or inappetant and died acutely with few other premonitory signs. Due to ongoing clinical concerns and possible emergence of this pathogen at the facility, efforts to better characterize the disease and understand the epidemiology of C. difficile was initiated in 95 harbor seal pups presented for rehabilitation in a single stranding season. Fecal samples were collected on admission, following completion of antibiotic treatment, and also prerelease or postmortem. All samples were collected fresh and submitted either directly or stored frozen. Fecal samples were inoculated into selective media for culture and screened by enzyme-linked immunosorbant assay (ELISA) for C. difficile toxins A, B, or both. Results of the 95 seals in the study were as follows: on hospital admit 72 seals were sampled, 10 were culture positive, 12 were ELISA positive; following antibiotic therapy 46 seals were sampled noting three culture positive and nine ELISA positive; prior to release 58 seals were sampled noting zero culture positive and one ELISA positive; and on postmortem exam seven seals were sampled noting zero culture positive and two ELISA positive. Clostridium difficile was not deemed to be the cause of death in any of the animals. Although the exact mechanism of disease is unknown, this study suggests that C. difficile infection is not a significant cause of mortality and may be part of the normal flora in harbor seals undergoing rehabilitation. Morbidity and mortality from this bacterium can likely be minimized by judicious use of antibiotics

  9. In situ assessment of two catfish species (pisces, Ariidae) to evaluate pollution in a harbor

    Science.gov (United States)

    Neta, Raimunda Nonata Fortes Carvalho; Junior, Audalio Rebelo Torres; Sousa, Débora Batista Pinheiro; de Sousa de Oliveira Mota Andrade, Ticianne; Torres, Hetty Salvino; da Silva Castro, Jonatas; da Silva de Almeida, Zafira; Santos, Débora Martins Silva; Tchaicka, Lígia

    2016-12-01

    A histopathological and biometric database for the catfish Sciades herzbergii and Bagre bagre from São Luís Island (Harbor area) and Caranguejos Island (reference area) in Brazil is presented. Branchial and hepatic lesions were classified into three reaction patterns: 1) circulatory or inflammatory disturbances; 2) regressive changes; 3) progressive changes. The total length (Lt), standard length (Ls), furcal length (Lf), total weight (Wt), and gonad weight (Wg) of each fish were recorded. As expected, most populations of catfish considered in this study are highly heterogeneous, with lengths and weights deviating from the reference sample. No histopathological lesions were observed in Sciades herzbergii examined at the reference site (Caranguejos Island). In contrast, 90% of the catfish S. herzbergii from sites located in the Harbor Area (São Luís Island) had one or more types of branchial and hepatic lesions. As opposed to what was observed in S. herzbergii, more than 86.33% of Bagre bagre individuals showed histopathological alterations in both areas. The utility of histopathological lesions and biometric data as sensitive indicators of the health of wild catfish populations has been demonstrated. Sciades herzbergii proved to be a better species for biomonitoring because it was able to differentiate one impacted site (Port Area/ São Luís Island) from a region relatively free of contaminants (Reference Area/ Caranguejos Island).

  10. Human case of bacteremia caused by Streptococcus canis sequence type 9 harboring the scm gene.

    Science.gov (United States)

    Taniyama, Daisuke; Abe, Yoshihiko; Sakai, Tetsuya; Kikuchi, Takahide; Takahashi, Takashi

    2017-01-01

    Streptococcus canis (Sc) is a zoonotic pathogen that is transferred mainly from companion animals to humans. One of the major virulence factors in Sc is the M-like protein encoded by the scm gene, which is involved in anti-phagocytic activities, as well as the recruitment of plasminogen to the bacterial surface in cooperation with enolase, and the consequent enhancement of bacterial transmigration and survival. This is the first reported human case of uncomplicated bacteremia following a dog bite, caused by Streptococcus canis harboring the scm gene. The similarity of the 16S rRNA from the infecting species to that of the Sc type strain, as well as the amplification of the species-specific cfg gene, encoding a co-hemolysin, was used to confirm the species identity. Furthermore, the isolate was confirmed as sequence type 9. The partial scm gene sequence harbored by the isolate was closely related to those of other two Sc strains. While this isolate did not possess the erm (A), erm (B), or mef (A), macrolide/lincosamide resistance genes, it was not susceptible to azithromycin: its susceptibility was intermediate. Even though human Sc bacteremia is rare, clinicians should be aware of this microorganism, as well as Pasteurella sp., Prevotella sp., and Capnocytophaga sp., when examining and treating patients with fever who maintain close contact with companion animals.

  11. Expansion of Adult Human Pancreatic Tissue Yields Organoids Harboring Progenitor Cells with Endocrine Differentiation Potential

    Directory of Open Access Journals (Sweden)

    Cindy J.M. Loomans

    2018-03-01

    Full Text Available Summary: Generating an unlimited source of human insulin-producing cells is a prerequisite to advance β cell replacement therapy for diabetes. Here, we describe a 3D culture system that supports the expansion of adult human pancreatic tissue and the generation of a cell subpopulation with progenitor characteristics. These cells display high aldehyde dehydrogenase activity (ALDHhi, express pancreatic progenitors markers (PDX1, PTF1A, CPA1, and MYC, and can form new organoids in contrast to ALDHlo cells. Interestingly, gene expression profiling revealed that ALDHhi cells are closer to human fetal pancreatic tissue compared with adult pancreatic tissue. Endocrine lineage markers were detected upon in vitro differentiation. Engrafted organoids differentiated toward insulin-positive (INS+ cells, and circulating human C-peptide was detected upon glucose challenge 1 month after transplantation. Engrafted ALDHhi cells formed INS+ cells. We conclude that adult human pancreatic tissue has potential for expansion into 3D structures harboring progenitor cells with endocrine differentiation potential. : In the context of β cell replacement therapy for diabetes, de Koning and colleagues describe a 3D culture platform that supports ex vivo expansion of human pancreatic tissue as organoids. These organoids harbor a subpopulation of ALDHhi cells that display proliferative capacity and can differentiate to an endocrine fate. Keywords: pancreas, organoid, human, ALDH, endocrine differentiation, beta cells, insulin, progenitor, fetal, diabetes

  12. Seasonal Variation of Harbor Seal's Diet from the Wadden Sea in Relation to Prey Availability.

    Directory of Open Access Journals (Sweden)

    Camille de la Vega

    Full Text Available The Wadden Sea has an important role for marine mammals in terms of resting, nursing and foraging. Harbor seal is the most abundant marine mammal species in this area. The use of the food resources of the Wadden Sea by seals is not clear, and previous studies showed that this species can travel kilometers away from their haul-outs to forage in the North Sea. In this study, we analyzed the stable isotopes of vibrissae from 23 dead harbor seals found on the island of Sylt to investigate their diet. The predator´s carbon and nitrogen isotope compositions were compared to the compositions of different potential prey items from the Sylt-Rømø Bight and from the North Sea in order to study seasonal pattern in the diet and in the foraging location. In parallel, seasonal variation of abundance and biomass of the potential prey items from the Sylt-Rømø Bight were studied and compare to their contribution to the seal´s diet. The results revealed a change in the seal´s diet from pelagic sources in spring to a benthic based diet in summer, and an increasing use of the North Sea resources in fall and winter in accordance with the seasonal variation of the availability of prey in the Sylt-Rømø Bight.

  13. A Carbapenem-Resistant Pseudomonas aeruginosa Isolate Harboring Two Copies of blaIMP-34 Encoding a Metallo-β-Lactamase.

    Directory of Open Access Journals (Sweden)

    Tatsuya Tada

    Full Text Available A carbapenem-resistant strain of Pseudomonas aeruginosa, NCGM1984, was isolated in 2012 from a hospitalized patient in Japan. Immunochromatographic assay showed that the isolate was positive for IMP-type metallo-β-lactamase. Complete genome sequencing revealed that NCGM1984 harbored two copies of blaIMP-34, located at different sites on the chromosome. Each blaIMP-34 was present in the same structures of the class 1 integrons, tnpA(ISPa7-intI1-qacG-blaIMP-34-aac(6'-Ib-qacEdelta1-sul1-orf5-tniBdelta-tniA. The isolate belonged to multilocus sequence typing ST235, one of the international high-risk clones. IMP-34, with an amino acid substitution (Glu126Gly compared with IMP-1, hydrolyzed all β-lactamases tested except aztreonam, and its catalytic activities were similar to IMP-1. This is the first report of a clinical isolate of an IMP-34-producing P. aeruginosa harboring two copies of blaIMP-34 on its chromosome.

  14. Rwandan family medicine residents expanding their training into South Africa: the use of South-South medical electives in enhancing learning experiences.

    Science.gov (United States)

    Flinkenflögel, Maaike; Ogunbanjo, Gboyega; Cubaka, Vincent Kalumire; De Maeseneer, Jan

    2015-08-01

    International medical electives are well-accepted in medical education, with the flow of students generally being North-South. In this article we explore the learning outcomes of Rwandan family medicine residents who completed their final year elective in South Africa. We compare the learning outcomes of this South-South elective to those of North-South electives from the literature. In-depth interviews were conducted with Rwandan postgraduate family medicine residents who completed a 4-week elective in South Africa during their final year of training. The interviews were thematically analysed in an inductive way. The residents reported important learning outcomes in four overarching domains namely: medical, organisational, educational, and personal. The learning outcomes of the residents in this South-South elective had substantial similarities to findings in literature on learning outcomes of students from the North undertaking electives in the Southern hemisphere. Electives are a useful learning tool, both for Northern students, and students from universities in the South. A reciprocity-framework is needed to increase mutual benefits for Southern universities when students from the North come for electives. We suggest further research on the possibility of supporting South-South electives by Northern colleagues.

  15. ORF Alignment: NC_006142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... str. Wilmington] ... Length = 240 ... Query: 20 ... TIKVLDHGFIRVIDYMGDDSSIVQAARVSYGKGTKQLNQDKGLINYLLRHYHTTPFEM...CD 79 ... TIKVLDHGFIRVIDYMGDDSSIVQAARVSYGKGTKQLNQDKGLINYLLRHYHTTPFEM...CD Sbjct: 1 ... TIKVLDHGFIRVIDYMGDDSSIVQAARVSYGKGTKQLNQDKGLINYLLRHYHTTPFEMCD 60 ... Query: 140 LPKKVSEKVLAIL

  16. South Africa

    International Nuclear Information System (INIS)

    Fischer, D.

    1990-01-01

    This paper reports that South Africa's main reason for entering the international nuclear market is, and always has been, to sell its uranium abroad. From 1939-45 South Africa took part in the war against Nazi Germany, and the South African government of the time sought to help the Allied war effort in all ways that were practical. Later, during the Cold War, it tried to help build up the West's nuclear arsenal. In 1944, the British government secretly asked General Smuts---prime minister of South Africa since 1939 and a member of Churchill's War Cabinet---to survey South Africa's deposits of uranium. The survey, carried out with U.S. and British help, showed that the deposits were large, generally low-grade, but, in most cases, associated with gold and therefore could be profitably mined. In 1951, South Africa became a significant producer, with lucrative contracts for the sale of all its output to the U.S.-U.K.-Canada Joint Development Agency and one of the three main suppliers to the U.S. nuclear weapons program. In time, government controls eased and uranium production and marketing became a purely commercial operation

  17. The Secant Rate of Corrosion: Correlating Observations of the USS Arizona Submerged in Pearl Harbor

    Science.gov (United States)

    Johnson, Donald L.; DeAngelis, Robert J.; Medlin, Dana J.; Johnson, Jon E.; Carr, James D.; Conlin, David L.

    2018-03-01

    Contrary to previous linear projections of steel corrosion in seawater, analysis of an inert marker embedded in USS Arizona concretion since the 7 December 1941 attack on Pearl Harbor reveals evidence that the effective corrosion rate decreases with time. The secant rate of corrosion, or SRC correlation, derived from this discovery could have a significant impact on failure analysis investigations for concreted shipwrecks or underwater structures. The correlation yields a lower rate of metal thinning than predicted. Development of the correlation is described.

  18. Results of chemical, toxicological, and bioaccumulation evaluations of dioxins, furans, and guaicol/organic acids in sediments from the Grays Harbor/Chehalis River area

    International Nuclear Information System (INIS)

    Word, J.Q.; Ward, J.A.; Squires, A.L.

    1990-09-01

    The Battelle/Marine Sciences Laboratory (MSL) was requested by the US Army Corps of Engineers (USACE), Seattle District, to assist in planning and conducting sampling, toxicological tests, and chemistry evaluations on sediment samples collected from the Chehalis River in Grays Harbor, Washington. The objectives of the study were to investigate the toxicity and biological effects of sediments that might potentially contain dioxins, furans, and organic acids, as a result of industrial practices in the Grays Harbor area, on sensitive marine species. In addition to the toxicological tests conducted using standard bioassays, sediment chemistry tests were performed to determine levels of selected chemicals, and elutriates of sediments were tested chemically and biologically to determine contaminant mobility in water. Also, bioaccumulation measurements were made to determine chemical mobility in animal tissue. A joint task group, including representatives from the USACE, Washington Department of Ecology (WDOE), Washington Department of Natural Resources (WDNR), Washington Department of Fisheries (WDOF), and Region 9 of the US Environmental Protection Agency (USEPA) participated in designing the testing program and reviewing data produced by MSL. The results of this analysis will be included in a supplemental Environmental Assessment (EA) prepared by the USACE for the Grays Harbor Dredging Program, beginning in early 1990. 13 refs., 5 figs., 8 tabs

  19. Hierarchical modeling of genome-wide Short Tandem Repeat (STR) markers infers native American prehistory.

    Science.gov (United States)

    Lewis, Cecil M

    2010-02-01

    This study examines a genome-wide dataset of 678 Short Tandem Repeat loci characterized in 444 individuals representing 29 Native American populations as well as the Tundra Netsi and Yakut populations from Siberia. Using these data, the study tests four current hypotheses regarding the hierarchical distribution of neutral genetic variation in native South American populations: (1) the western region of South America harbors more variation than the eastern region of South America, (2) Central American and western South American populations cluster exclusively, (3) populations speaking the Chibchan-Paezan and Equatorial-Tucanoan language stock emerge as a group within an otherwise South American clade, (4) Chibchan-Paezan populations in Central America emerge together at the tips of the Chibchan-Paezan cluster. This study finds that hierarchical models with the best fit place Central American populations, and populations speaking the Chibchan-Paezan language stock, at a basal position or separated from the South American group, which is more consistent with a serial founder effect into South America than that previously described. Western (Andean) South America is found to harbor similar levels of variation as eastern (Equatorial-Tucanoan and Ge-Pano-Carib) South America, which is inconsistent with an initial west coast migration into South America. Moreover, in all relevant models, the estimates of genetic diversity within geographic regions suggest a major bottleneck or founder effect occurring within the North American subcontinent, before the peopling of Central and South America. 2009 Wiley-Liss, Inc.

  20. Endophytic fungi harbored in Panax notoginseng: diversity and potential as biological control agents against host plant pathogens of root-rot disease

    Directory of Open Access Journals (Sweden)

    You-Kun Zheng

    2017-07-01

    Conclusion: Our results suggested that P. notoginseng harbors diversified endophytic fungi that would provide a basis for the identification of new bioactive compounds, and for effective biocontrol of notoginseng root rot.

  1. Remediating Contaminated Sediments in the Ashtabula Harbor as Part of the Ashtabula River Area of Concern: A Collaboration Success Story

    International Nuclear Information System (INIS)

    Diggs, I.W.; Case, J.L.; Rule, R.W.; Snyder, M.

    2009-01-01

    The U.S. Army Corps of Engineers, Buffalo District (USACE), in close collaboration with the USEPA and members of an Ashtabula, Ohio, stakeholder advocacy group, were able to achieve major success in mitigating ecological impacts from contaminated sediments deposited in the lower Ashtabula River and Ashtabula Harbor after years of effort to obtain the federal funding needed to do so. The river and harbor were subject to unregulated discharges of hazardous chemicals, heavy metals, and low-level radiological contaminants from decades of operations by a variety of industrial, manufacturing, processing and production activities located near or adjacent to the river and harbor areas. Conditions in the ecosystem in and around the lower portion of the river deteriorated to the point that it was designated a Great Lakes Area of Concern (AOC) in 1983. The advocacy group known as the Ashtabula River Partnership (ARP), facilitated through efforts by both USACE and USEPA, developed an innovative plan to remediate the Ashtabula River AOC by conducting a two-phase project, completed with combined funding authorized under the Great Lakes Legacy Act (GLLA) of 2002, and Section 312(a) of the Water Resources Development Act (WRDA) of 1990. Removal of nearly 527,000 m 3 of contaminated sediments from the AOC would significantly reduce the contaminant source term and produce favorable conditions for re-establishing ecosystem balance. This would also be the first project in the nation completed by USACE under its authority to perform environmental dredging covered by WRDA Section 312(a). (authors)

  2. Harnessing the power of South-South partnerships to build capacity ...

    African Journals Online (AJOL)

    and opportunities for South-South partnerships and learning is a potential ... programmes on IPV prevention and transforming men and masculinities show promise in building capacity and sharing expertise through North-South initiatives ( ... violence prevention aids researchers from LMICs to lead, fund, develop, test and ...

  3. Investigation of the marine communities of Midway Harbor and adjacent lagoon, Midway Atoll, Northwest Hawaiian Islands in 1998 (NODC Accession 0001098)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A survey of the marine communities of Midway Atoll harbor and surrounding lagoon was conducted at 12 sites from September 5 to 9, 1998. The primary focus of these...

  4. Determinants and Economic Impacts of North-South and South-South FDI in ASEAN : Panel Regression Analyses

    OpenAIRE

    Peseth, Seng

    2015-01-01

    This paper uses panel data of 10 ASEAN countries from 1995 to 2008 and studies the cross-country and industrial distribution of North and South FDI, investigates host country-specific determinants of the inflows of total FDI, North FDI and South FDI, and also compares the effects of North and South FDI on economic and industrial growth in the region.

  5. Preliminary hard and soft bottom seafloor substrate map derived from gridded sidescan and bathymetry derivatives at Apra Harbor, Guam U.S. Territory.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Preliminary hard and soft seafloor substrate map classified from sidescan data and bathymetric derivatives at Apra Harbor, Guam U.S. Territory. The dataset was...

  6. Dose-response relationships in gene expression profiles in a harbor seal B lymphoma cell line exposed to 17α-ethinyl estradiol

    Directory of Open Access Journals (Sweden)

    Christine Kleinert

    2017-05-01

    Full Text Available The determination of changes in gene expression profiles with xenobiotic dose will allow identifying biomarkers and modes of toxicant action. The harbor seal (Phoca vitulina 11B7501 B lymphoma cell line was exposed to 1, 10, 100, 1000, 10,000, or 25,000 μg/L 17α-ethinyl estradiol (EE2, the active compound of the contraceptive pill for 24 h. Following exposure, RNA was extracted and transformed into cDNA. Transcript expression in exposed vs. control lymphocytes was analyzed via RT-qPCR to identify genes with altered expression. Our analysis indicates that gene expression for all but the reference gene varied with dose, suggesting that different doses induce distinct physiological responses. These findings demonstrate that RT-qPCR could be used to identify immunotoxicity and relative dose in harbor seal leukocytes.

  7. Nigeria-China Economic Relations Under the South-South ...

    African Journals Online (AJOL)

    The defining characteristic of the South-South solidarity is cooperation among the ... relations which appear to be in great disequilibrium and to China's advantage. ... penetration of the Nigerian economy, observers of Nigeria's international ...

  8. "It was pain. That's it. It was pain." Lack of oral health care among otherwise healthy young adults living with HIV in South Africa: A qualitative study.

    Directory of Open Access Journals (Sweden)

    R Frederick Lambert

    Full Text Available The purpose of this study is to understand engagement with and availability of dental services among people living with HIV in a low-income community of South Africa.In depth qualitative interviewing was used to collect data, which was analyzed using an inductive content analytical approach. The study was conducted in Gugulethu, a township community located outside of Cape Town, South Africa. Local public sector health services provided free of charge are the main source of primary health and dental care for this population. Participants included South African adults (age 18-35 recently diagnosed with HIV who had a CD4 count >350 cells/mm3.Many participants had little to no experience with dental care, did not know which health care providers are appropriate to address oral health concerns, were not aware of available dental services, utilized home remedies to treat oral health problems, harbored many misperceptions of dental care, avoided dental services due to fear, and experienced poverty as a barrier to dental services.Our findings suggest that integration of oral healthcare into medical care may increase patient knowledge about oral health and access to care. Leveraging the relatively robust HIV infrastructure to address oral disease may also be an effective approach to reaching these participants and those living in resource poor communities generally.

  9. Evaluation of older bay mud sediment from Richmond Harbor, California

    Energy Technology Data Exchange (ETDEWEB)

    Pinza, M.R.; Mayhew, H.L.; Word, J.Q.

    1996-09-01

    The older, bay mud (OBM) unit predates modem man and could act as a barrier to the downward transport of contaminants from the younger bay mud (YBM) because of its hard-packed consistency. However, its chemical and biological nature have not been well characterized. Battelle/Marine Sciences Laboratory (MSL) conducted three independent studies of OBM sediment in January 1993, January 1994, and October 1994. These studies evaluated potential chemical contamination and biological effects of OBM that could occur as a result of dredging and disposal activities. These evaluations were performed by conducting chemical analysis, solid-phase toxicity tests, suspended- particulate-phase (SPP) toxicity tests, and bioaccumulation tests on the OBM sediment. If the sediment chemistry and toxicity results showed no or minimal contamination and toxicological responses, then either the OBM could be left exposed in Richmond Harbor after dredging the YBM without leaving a source of contamination, or if the project depths necessitate, the OBM would be acceptable for disposal at an appropriate disposal site.

  10. Where are general surgeons located in South Africa? | Dell | South ...

    African Journals Online (AJOL)

    South African Journal of Surgery ... Methods: A descriptive analysis of the general surgical workforce in South Africa was performed. The total number of specialist and non-specialist general surgeons working in the public sector in South Africa was documented between the periods from the 1 October 2014 until 31 ...

  11. South-South cooperation in health: bringing in theory, politics, history, and social justice.

    Science.gov (United States)

    Birn, Anne-Emanuelle; Muntaner, Carles; Afzal, Zabia

    2017-10-02

    Since the mid-2000s, the practice of South-South cooperation in health (SSC) has attracted growing attention among policymakers, health and foreign affairs ministries, global health agencies, and scholars from a range of fields. But the South-South label elucidates little about the actual content of the cooperation and conflates the "where" with the "who, what, how, and why". While there have been some attempts to theorize global health diplomacy and South-South cooperation generally, these efforts do not sufficiently distinguish among the different kinds of practices and political values that fall under the South-South rubric, ranging from economic and geopolitical interests to social justice forms of solidarity. In the spirit of deepening theoretical, historical, and social justice analyses of SSC, this article: (1) critically revisits international relations theories that seek to explain SSC, exploring Marxian and other heterodox theories ignored in the mainstream literature; (2) traces the historical provenance of a variety of forms of SSC; and (3) introduces the concept of social justice-oriented South-South.

  12. Assessement of nonindigenous marine species in harbors and nearby coral reefs on Kauai, Molokai, Maui, and Hawaii, 2002-2003 (NODC Accession 0002270)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Collections and observations in 2002-2003 at harbor and nearby reef sites at Nawilwili and Port Allen, Kauai; Hale O Lono and Kaunakakai, Molokai; Kahului and...

  13. Assessment of nonindigenous marine species in harbors and nearby coral reefs on Kauai, Molokai, Maui, and Hawaii, 2002 - 2003 (NODC Accession 0002270)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Collections and observations in 2002-2003 at harbor and nearby reef sites at Nawilwili and Port Allen, Kauai; Hale O Lono and Kaunakakai, Molokai; Kahului and...

  14. Application of AE to evaluate deterioration of prt and harbor structures

    International Nuclear Information System (INIS)

    Matsuyama, Kimitoshi; Ishibashi, Akichika; Fujiwara, Tetsuro; Kanemoto, Yasuhiro; Hamada, Shigenori; Ohtsu, Masayasu

    1997-01-01

    The degree of concrete deterioration is normally evaluated by uniaxial compression tests of core samples taken from existing concrete structures. The uniaxial compression test can give details on concrete strength, elastic modulus and so forth. By using AE(acoustic emission) technique with uniaxial compression tests, we can get more useful information on interior failures of the core sample. The observation of AE activity was conducted during uniaxial compression tests of concrete specimens and samples. The specimens were cast with 5, 10, 15 and 20% air content. The samples were taken from 2 harbor sites in Japan. Generating behavior of AE was studied quantitatively on the basis of rate process theory. Distribution of pores in the concrete could be measured by the porosimeter. The relation between AE activity in the uniaxial compression test of core samples and concrete property is clarified.

  15. Therapeutic strategies to overcome crizotinib resistance in non-small cell lung cancers harboring the fusion oncogene EML4-ALK

    Science.gov (United States)

    Katayama, Ryohei; Khan, Tahsin M.; Benes, Cyril; Lifshits, Eugene; Ebi, Hiromichi; Rivera, Victor M.; Shakespeare, William C.; Iafrate, A. John; Engelman, Jeffrey A.; Shaw, Alice T.

    2011-01-01

    The echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) fusion oncogene represents a molecular target in a small subset of non-small cell lung cancers (NSCLCs). This fusion leads to constitutive ALK activation with potent transforming activity. In a pivotal phase 1 clinical trial, the ALK tyrosine kinase inhibitor (TKI) crizotinib (PF-02341066) demonstrated impressive antitumor activity in the majority of patients with NSCLC harboring ALK fusions. However, despite these remarkable initial responses, cancers eventually develop resistance to crizotinib, usually within 1 y, thereby limiting the potential clinical benefit. To determine how cancers acquire resistance to ALK inhibitors, we established a model of acquired resistance to crizotinib by exposing a highly sensitive EML4-ALK–positive NSCLC cell line to increasing doses of crizotinib until resistance emerged. We found that cells resistant to intermediate doses of crizotinib developed amplification of the EML4-ALK gene. Cells resistant to higher doses (1 μM) also developed a gatekeeper mutation, L1196M, within the kinase domain, rendering EML4-ALK insensitive to crizotinib. This gatekeeper mutation was readily detected using a unique and highly sensitive allele-specific PCR assay. Although crizotinib was ineffectual against EML4-ALK harboring the gatekeeper mutation, we observed that two structurally different ALK inhibitors, NVP-TAE684 and AP26113, were highly active against the resistant cancer cells in vitro and in vivo. Furthermore, these resistant cells remained highly sensitive to the Hsp90 inhibitor 17-AAG. Thus, we have developed a model of acquired resistance to ALK inhibitors and have shown that second-generation ALK TKIs or Hsp90 inhibitors are effective in treating crizotinib-resistant tumors harboring secondary gatekeeper mutations. PMID:21502504

  16. Ecological evaluation of proposed dredged material from Richmond Harbor Deepening Project and the intensive study of the Turning Basin

    Energy Technology Data Exchange (ETDEWEB)

    Pinza, M.R.; Mayhew, H.L.; Karle, L.M.; Kohn, N.P.; White, P.J.; Word, J.Q.; Michaels, L.L. [Battelle/Marine Sciences Lab., Sequim, WA (United States)

    1995-06-01

    Richmond Harbor is on the eastern shoreline of central San Francisco Bay and its access channels and several of the shipping berths are no longer wide or deep enough to accommodate modem deeper-draft vessels. The Water Resources Development Act of 1986 (PL99-662) authorized the US Army Corps of Engineers (USACE), San Francisco District to deepen and widen the navigation channels in Richmond Harbor. Several options for disposal of the material from this dredging project are under consideration by USACE: disposal within San Francisco Bay, at open-ocean disposal sites, or at uplands disposal sites. Purpose of this study was to conduct comprehensive evaluations, including chemical, biological, and bioaccumulation testing of sediments in selected areas of Richmond Harbor. This information was required by the Environmental Protection Agency (EPA) and USACE. Battelle/Marine Sciences Laboratory collected 20 core samples, both 4-in. and 12-in., to a project depth of -40 ft mean lower low water (MLLW) (-38 ft MLLW plus 2 ft of overdepth) using a vibratory-hammer core. These 20 field samples were combined to form five test composites plus an older bay mud (OBM) composite that were analyzed for physical/chemical parameters, biological toxicity, and tissue chemistry. Solid-phase tests were conducted with the amphipod, Rhepoxynius abronius; the clam, Macoma nasuta; and the polychaete worm, Nephtys caecoides. Suspended-particulate-phase (SPP) tests were conducted with the sanddab, Citharichthys stigmaeus; the mysid, Holmesimysis costata; and the bivalve, Mytilus galloprovincialis. Bioaccumulation of contaminants was measured in tissues of Macoma nasuta and Nereis virens. Sediments from one ocean reference sediment, and two in-bay reference sediments, were tested concurrently. Results from analysis of the five test treatments were statistically compared with the reference sediment R-OS in the first five sections of this report.

  17. Effect of the orientation of the harbor seal vibrissa based biomimetic cylinder on hydrodynamic forces and vortex induced frequency

    Science.gov (United States)

    Kim, HyoJu; Yoon, Hyun Sik

    2017-10-01

    The present study considered the geometric disturbance inspired by a harbor seal vibrissa of which undulated surface structures (HSV) are known as a detecting device to capture the water movement induced by prey fish. As an original research can extend to the flow control based on the biomimetic, this study aims at finding the effect of the angle of attack (AOA) on flow characteristics around the harbor seal vibrissa shaped cylinder, to cover the change of flow direction during the harbor seal's movements and surrounding conditions. Therefore, we considered a wide range of AOA varying from 0 to 90 degree. We carried out large eddy simulation (LES) to investigate the flow around inclined vibrissa shaped cylinder for the Reynolds number (Re) of 500. The elliptic cylinder is considered for the purpose of the comparison. The difference of force coefficients between the HSV and the elliptic cylinder can be classified into three regimes of one large variation region, two invariant regimes according to AOA. In contrast to the elliptic cylinder showing the monotonically decrease of the vortex shedding frequency in AOA, the HSV reveals the increasing and then decreasing behavior of the vortex shedding frequency along the AOA. The same decreasing profile of the vortex shedding frequency means that the HSV lost the unique function on the vortex shedding frequency. The shear layers for the HSV is much longer than that of shear layers for the elliptic cylinder at low angles of the attack. With increasing AOA, the difference of the vortical structures in the wake between the HSV and the elliptic cylinder becomes minor. Thus, it can be concluded that as AOA increases, the bluff body flow overcomes the flow induced by the HSV shape, resulting in the appearance of almost the same flow with the elliptic cylinder.

  18. Transcriptome profiling identifies genes and pathways deregulated upon floxuridine treatment in colorectal cancer cells harboring GOF mutant p53

    Directory of Open Access Journals (Sweden)

    Arindam Datta

    2016-06-01

    Full Text Available Mutation in TP53 is a common genetic alteration in human cancers. Certain tumor associated p53 missense mutants acquire gain-of-function (GOF properties and confer oncogenic phenotypes including enhanced chemoresistance. The colorectal cancers (CRC harboring mutant p53 are generally aggressive in nature and difficult to treat. To identify a potential gene expression signature of GOF mutant p53-driven acquired chemoresistance in CRC, we performed transcriptome profiling of floxuridine (FUdR treated SW480 cells expressing mutant p53R273H (GEO#: GSE77533. We obtained several genes differentially regulated between FUdR treated and untreated cells. Further, functional characterization and pathway analysis revealed significant enrichment of crucial biological processes and pathways upon FUdR treatment in SW480 cells. Our data suggest that in response to chemotherapeutics treatment, cancer cells with GOF mutant p53 can modulate key cellular pathways to withstand the cytotoxic effect of the drugs. The genes and pathways identified in the present study can be further validated and targeted for better chemotherapy response in colorectal cancer patients harboring mutant p53.

  19. 33 CFR 110.95 - Newport Bay Harbor, Calif.

    Science.gov (United States)

    2010-07-01

    ... 268° from Lido Isle East Light 2, this line being the northwest line of the main fairway; west of the... of a line bearing 268° from Newport Bay Channel Light 11, this line being the south line of the main... Channel Light 11, this line being the southerly line of the main fairway. Note: This area is reserved for...

  20. Bioaccumulation of chemical warfare agents, energetic materials, and metals in deep-sea shrimp from discarded military munitions sites off Pearl Harbor

    Science.gov (United States)

    Koide, Shelby; Silva, Jeff A. K.; Dupra, Vilma; Edwards, Margo

    2016-06-01

    The bioaccumulation of munitions-related chemicals at former military deep-water disposal sites is poorly understood. This paper presents the results of human-food-item biota sampling to assess the potential for bioaccumulation of chemical warfare agents, energetic materials, arsenic, and additional munitions-related metals in deep-sea shrimp tissue samples collected during the Hawai'i Undersea Military Munitions Assessment (HUMMA) project to date. The HUMMA investigation area is located within a former munitions sea-disposal site located south of Pearl Harbor on the island of O'ahu, Hawai'i, designated site Hawaii-05 (HI-05) by the United States Department of Defense. Indigenous deep-sea shrimp (Heterocarpus ensifer) were caught adjacent to discarded military munitions (DMM) and at control sites where munitions were absent. Tissue analysis results showed that chemical warfare agents and their degradation products were not present within the edible portions of these samples at detectable concentrations, and energetic materials and their degradation products were detected in only a few samples at concentrations below the laboratory reporting limits. Likewise, arsenic, copper, and lead concentrations were below the United States Food and Drug Administration's permitted concentrations of metals in marine biota tissue (if defined), and their presence within these samples could not be attributed to the presence of DMM within the study area based on a comparative analysis of munitions-adjacent and control samples collected. Based on this current dataset, it can be concluded that DMM existing within the HUMMA study area is not contributing to the bioaccumulation of munitions-related chemicals for the biota species investigated to date.

  1. Ecological evaluation of proposed discharge of dredged material from Oakland Harbor into ocean waters (Phase 1 of -42-foot project)

    International Nuclear Information System (INIS)

    Word, J.Q.; Ward, J.A.; Strand, J.A.; Cullinan, V.I.; Crecelius, E.A.; Steinhauer, W.; Hyland, J.L.

    1990-09-01

    The US Army Corps of Engineers (USACE), San Francisco District, was authorized by the Water Resources Development Act of 1986 (Public Law 99-662) to deepen and widen the navigation channels of Inner and Outer Oakland Harbor, California, to accommodate modern deep-draft vessels. To help provide the scientific basis for determining whether Oakland Harbor sediments are suitable for offshore disposal, the Battelle/Marine Sciences Laboratory collected sediment cores from 20 stations in Oakland Harbor, evaluated the cores geologically, analyzed sediment for selected contaminants, conducted a series of solid phase toxicity tests with four sensitive marine invertebrates (Macoma nasuta, Nephtys caecoides, Ampelisca abdita, and Rhepoxynius abronius), and assessed the bioaccumulation potential of sediment-associated contaminants in tissues of M. nasuta. Toxicological test results indicate that none of the sediment from the channel-area stations (CH-1 - CH-7), the Merritt Sand samples (MS-1 and MS-2), or the reference sediment sites (PR-C and PR-F) resulted in significant sediment toxicity to the four species tested. Sediment treatments showing no significant sediment toxicity as well as no significant bioaccumulation included CH-5, MS-1, MS-2, PR-coarse, and PR-fine. Stations that showed little or no significant sediment toxicity, but significant bioaccumulation included SS-2-L (PAHs); TS-1-L (Cu, PAHs, PCBs, tributyltin, and DDE); TS-1-U (tributyltin); TS-5-U (PAHs, PCBs, DDE, and tributyltin); SS-1-U (PB, PAHs, and PCBs); SS-5-L (PAHs, PCBs, and DDE); CH-6 and CH-7 (PAHs, PCBs, and DDE); Ch-4 and CH-1 (Cr); and CH-3 (DDE). 28 refs., 31 figs., 75 tabs

  2. Boussinesq Modeling for Inlets, Harbors & Structures (Bouss-2D)

    Science.gov (United States)

    2014-10-27

    circulation in surf and swash zone; wave-current interaction in channels and inlets; generation and impacts of infra-gravity waves on ports and...Guam, Samoa, Korea, Japan, Canada, EU countries, South Africa, Brazil, Peru, India, Indonesia , and Persian Gulf states. BMT helps the Corps evaluate

  3. Communication for Policy Research (CPR) South-South | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... of telecom researchers : measures and messages relevant to CPRsouth. Download PDF. Reports. CPRafrica 2010-2012 : a comparative analysis vis-í -vis TPRC, EuroCPR, and CPRsouth/africa. Download PDF. Reports. Communication for Policy Research Africa (CPRafrica) (South-South in contract) : final technical and ...

  4. Behavioral avoidance threshold level of a harbor porpoise (Phocoena phocoena) for a continuous 50 kHz pure tone (L)

    NARCIS (Netherlands)

    Kastelein, R.A.; Verboom, W.C.; Jennings, N.; Haan, D. de

    2008-01-01

    The use of ultrasonic sounds in alarms for gillnets may be advantageous, but the deterring effects of ultrasound on porpoises are not well understood. Therefore a harbor porpoise in a large floating pen was subjected to a continuous 50 kHz pure tone with a source level of 122 +/- 3dB (re 1uPa, rms).

  5. Behavioral avoidance threshold level of a harbor porpoise (Phocoena phocoena) for a continuous 50 kHz pure tone (L)

    NARCIS (Netherlands)

    Kastelein, R.A.; Verboom, W.C.; Jennings, N.; Haan, de D.

    2008-01-01

    The use of ultrasonic sounds in alarms for gillnets may be advantageous, but the deterring effects of ultrasound on porpoises are not well understood. Therefore a harbor porpoise in a large floating pen was subjected to a continuous 50 kHz pure tone with a source level of 122±3 dB (re 1 ¿Pa, rms).

  6. Development of Site-Specific Water Quality Criteria for the Arpa Harbor Wastewater Treatment Plant in Tipalao Bay, Guam

    Science.gov (United States)

    2016-07-01

    flats, estuaries, and coastal creeks. It is usually found within tidally influenced waters , but it may enter freshwater, ascending about 10...based on a dissolved metal concentration endpoint in the receiving body of water . In other words , the translator supports estimations of the fraction of...TECHNICAL REPORT 2068 July 2016 Development of Site-Specific Water Quality Criteria for the Arpa Harbor Wastewater Treatment Plant

  7. Copper storage in the liver of the wild mute swan (Cygnus olor). Its possible relation to pollution of harbor waters by antifouling paints.

    Science.gov (United States)

    Molnar, J J

    1983-12-01

    Postmortem examination of three wild mute swans (Cygnus olor) from a harbor area disclosed an unusual black discoloration of the liver. Chemical, histochemical, and microscopic studies, along with electron-probe microanalysis, showed that cytoplasmic pigment granules in the liver cells contained a copper-protein complex. Similar findings have been reported in Danish and English studies on large numbers of wild mute swans. Two control mute swans from The Bronx Zoo had negligible amounts of hepatic copper. The striking difference between the wild and the captive swans in hepatic copper content suggests that the copper in the wild swans was of environmental origin, most likely from copper-rich antifouling paint used extensively in the marine industry. Flakes of this paint may be ingested by swans searching for food in the sediment of harbor waters.

  8. Water quality in Pearl Harbor and feeder streams during 1971 - 2001 collected primarily by oceanography students from Leeward Community College (NODC Accession 0000590)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Water quality data were collected in Pearl Harbor and surrounding feeder streams from 30 December 1971 to 24 August 2001. Data were collected by Leeward Community...

  9. Restoration Science in New York Harbor: It takes a (large, diverse and engaged) village

    Science.gov (United States)

    Newton, R.; Birney, L.; Janis, S.; Groome, M.; Palmer, M.; Bone, E.; O'Neil, J. M.; Hill, J.; Dennison, W.; Malinowski, P.; Kohne, L.; Molina, M.; Moore, G.; Woods, N.

    2015-12-01

    The Curriculum + Community Enterprise for Restoration Science (CCE-RS) facilitates partnerships between scientists and middle school educators on ecological restoration and environmental monitoring projects. The educational model is designed to wrap around the student, including classroom instruction, field science, after-school programs and engagement with the student's community. Its pillars include: a teacher training fellowship at Pace University, student curriculum, a digital platform, afterschool and summer mentoring, and community exhibits. The digital platform includes a tablet app tailored to the project's field protocols and linked to a database shared across schools and partnering institutions. Through the digital platform, data is integrated into a single citizen-science monitoring project, teachers share curriculum and best practices, and students link directly to their peers at other schools. Curriculum development has been collaborative between scientists, science education specialists, and secondary school teachers. The CCE-RS is rooted in project-based learning: the New York Harbor School has engaged high school students in environmental monitoring and oyster restoration in the Harbor for about the last decade. The science partners (U. of Maryland and Columbia) have been working with students and other citizen scientists in outdoor science over about the last decade. Local partners in outside-the-classroom education include the New York Academy of Sciences, The River Project, which will provide field education services, and Good Shepherd Services, which provides after-school programming in schools serving primarily poor families. Scientists on the project engage directly with teachers and informal educators in curriculum development and citizen-science outreach. We present the lessons learned from our first cohort of Fellows, the pedagogical model, and the digital platform, which is extensible to other ecological restoration settings.

  10. Malaria prophylaxis - the South African viewpoint | Baker | South ...

    African Journals Online (AJOL)

    A consensus meeting was held under the auspices of the Department of National Health and Population Development in September 1991 in order to establish local, current consensus on malaria prophylaxis for the South African traveller within South Africa and neighbouring African countries. The meeting was attended by ...

  11. The South Manchurian Railway Company and the Mining Industry: The Case of the Fushun Coal Mine

    Directory of Open Access Journals (Sweden)

    Tsu-yu Chen

    2015-09-01

    Full Text Available Following the Japanese victory over Czarist Russia in the Russo-Japanese War and the signing of the Treaty of Portsmouth in 1905, the southernmost section of the southern branch of the China Far East Railway (Changchun–Port Arthur was transferred to Japanese control. A new, semi-privately held company, the South Manchuria Railway Company (SMR, Mantetsu, was established with 85.6 percent capitalization by the Japanese government and foreign bonds to operate the railroad and to develop settlements (including highways, public health facilities, educational institutions, and industries (coal mines, harbor facilities, electrical power plants, shale oil plants, chemical plants, and restaurants along its route. SMR nonetheless emphasized railway and mining investment. The centerpiece of its mining interests was the Fushun Coal Mine. Starting in 1917, SMR began to prosper, with most profits coming from its coal mines, and it soon spun off subsidiary companies. In this sense, although the factors that influenced development of the Fushun Coal Mine in each period were different, this development still shows continuity of the business management.

  12. Molecular biology of Homo sapiens: Abstracts of papers presented at the 51st Cold Spring Harbor symposium on quantitative biology

    International Nuclear Information System (INIS)

    Watson, J.D.; Siniscalco, M.

    1986-01-01

    This volume contains abstracts of papers presented at the 51st Cold Springs Harbor Symposium on Quantitative Biology. The topic for this meeting was the ''Molecular Biology of Homo sapiens.'' Sessions were entitled Human Gene Map, Human Cancer Genes, Genetic Diagnosis, Human Evolution, Drugs Made Off Human Genes, Receptors, and Gene Therapy. (DT)

  13. The Dictionary Unit for South African English. South African Concise Oxford Dictionary

    Directory of Open Access Journals (Sweden)

    Rajend Mesthrie

    2011-10-01

    Full Text Available The South African Concise Oxford Dictionary (henceforth SACOD is a South Af-rican version of the Concise Oxford Dictionary, the first time that this particular hybrid has been prepared. It is testimony to the enduring success of the work of the Dictionary Unit for South African English at Rhodes University, headed by teams that included Jean and William Branford in the 1970s, Penny Silva in the 1990s and now, Kathryn Kavanagh. The lexicographical work from the unit saw the publication of four editions of the Dictionary of Southern African English (1978, 1980, 1987, 1991, a South African Pocket Oxford Dictionary (SAPOD and the Dictionary of South African English on Historical Principles (DOSAEHP (1995. SACOD differs from the rest in several ways. It is larger in scope than SAPOD, smaller than DOSAEHP, and unlike DOSAE and DOSAEHP, does not deal with South African words alone. Based on the 10th edition of the Concise Oxford Dictionary SACOD has excised some words from the parent, whilst adding many new words of general English as well as of South Africa.

  14. Improved analysis of emission from maritime transport. A successful pilot in the Rijnmond harbor area, Netherlands; Verbeterde bepaling zeevaartemissies. Een succesvolle pilot in het Rijnmondgebied

    Energy Technology Data Exchange (ETDEWEB)

    Molenaar, R.; Van der Tak, C.; Hulskotte, J. [DCMR Milieudienst Rijnmond, Rotterdam (Netherlands)

    2009-10-15

    Until recently there was much uncertainty about emissions from maritime transport; especially wit respect to the location of the emissions but also partly with regard to volume. By determining the emission of each individual sea-going vessel on its way through the harbor, the total emission of the sector in the Rijnmond harbor area has become much clearer. Key to this approach are the transponder signals frequently sent out by each ship to provide information on location, identity and speed. This new approach turned out to lead to large spatial differences compared to the old generic method in which the total emissions per harbor basin were estimated. [Dutch] Tot voor kort waren de emissies van de zeevaart hoogst onzeker, vooral de locatie van de emissies maar deels ook de omvang. Door van elk individueel zeeschip, op zijn tocht door de haven, de emissie te bepalen is de totale emissie van de sector in het Rijnmondgebied nu veel beter bekend. De sleutel in deze aanpak vormen de transpondersignalen waarmee elk schip zijn plaats, identiteit en snelheid met grote frequentie meldt. De nieuwe methode bleek ruimtelijke grote veranderingen op te leveren ten opzichte van de oude generieke methode waarbij de totale emissies per havenbekken geschat werden.

  15. South Africa

    Science.gov (United States)

    2002-01-01

    This true-color image of South Africa was acquired on May 14, 2000, by NASA's Moderate-resolution Imaging Spectroradiometer, or MODIS. The image was produced using a combination of the sensor's 250-m and 500-m resolution visible wavelength bands. As part of the opening ceremony to begin the joint U.S.-South Africa SAFARI Field Experiment, NASA presented print copies of this image as GIFts to Dr. Ben Ngubane, Minister of Arts, Science and Technology, and Honorable Advocate Ngoaka Ramathlodi, Premier of the Northern Province, South Africa. The area shown in this image encompasses seven capital cities and a number of the region's distinctive geological features can be seen clearly. Toward the northern (top) central part of the image, the browns and tans comprise the Kalahari Desert of southern Botswana. The Tropic of Capricorn runs right through the heart of the Kalahari and the Botswanan capital city of Gaborone sits on the Limpopo River, southeast of the Kalahari. Along the western coastline of the continent is the country of Namibia, where the Namib Desert is framed against the sea by the Kaokoveld Mountains. The Namibian capital of Windhoek is obscured by clouds. Looking closely in the center of the image, the Orange River can be seen running from east to west, demarcating the boundary between Namibia and South Africa. On the southwestern corner of the continent is the hook-like Cape of Good Hope peninsula and Cape Town, the parliamentary capital of South Africa. Running west to east away from Cape Town are the Great Karroo Mountains. The shadow in this image conveys a sense of the very steep grade of the cliffs along the southern coast of South Africa. Port Elizabeth sits on the southeasternmost point of South Africa, and a large phytoplankton bloom can be seen in the water about 100 miles east of there. Moving northward along the east coast, the Drakensberg Mountains are visible. The two small nations of Lesotho and Swaziland are in this region, completely

  16. AFSC/NMML/CCEP: Characterizing and quantifying California sea lion and Pacific harbor seal use of offshore oil and gas platforms in California, 2013-2015

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — California sea lions (Zalophus californianus) and Pacific harbor seals (Phoca vitulina) use offshore oil and gas platforms as resting and foraging areas. Both...

  17. South-South Cooperation in health professional education: A ...

    African Journals Online (AJOL)

    In the literature on the evolution of funding approaches there is criticism of traditional funding strategies and the promotion of inclusive models, such as South-South Cooperation (SSC) and triangular models. The latter are felt to have a number of advantages. This article has four broad objectives: (i) to present a literature ...

  18. The impact of the subtropical South Atlantic SST on South American precipitation

    Directory of Open Access Journals (Sweden)

    A. S. Taschetto

    2008-11-01

    Full Text Available The Community Climate Model (CCM3 from the National Center for Atmospheric Research (NCAR is used to investigate the effect of the South Atlantic sea surface temperature (SST anomalies on interannual to decadal variability of South American precipitation. Two ensembles composed of multidecadal simulations forced with monthly SST data from the Hadley Centre for the period 1949 to 2001 are analysed.

    A statistical treatment based on signal-to-noise ratio and Empirical Orthogonal Functions (EOF is applied to the ensembles in order to reduce the internal variability among the integrations. The ensemble treatment shows a spatial and temporal dependence of reproducibility. High degree of reproducibility is found in the tropics while the extratropics is apparently less reproducible. Austral autumn (MAM and spring (SON precipitation appears to be more reproducible over the South America-South Atlantic region than the summer (DJF and winter (JJA rainfall. While the Inter-tropical Convergence Zone (ITCZ region is dominated by external variance, the South Atlantic Convergence Zone (SACZ over South America is predominantly determined by internal variance, which makes it a difficult phenomenon to predict. Alternatively, the SACZ over western South Atlantic appears to be more sensitive to the subtropical SST anomalies than over the continent.

    An attempt is made to separate the atmospheric response forced by the South Atlantic SST anomalies from that associated with the El Niño – Southern Oscillation (ENSO. Results show that both the South Atlantic and Pacific SSTs modulate the intensity and position of the SACZ during DJF. Particularly, the subtropical South Atlantic SSTs are more important than ENSO in determining the position of the SACZ over the southeast Brazilian coast during DJF. On the other hand, the ENSO signal seems to influence the intensity of the SACZ not only in DJF but especially its oceanic branch during MAM. Both local and

  19. Genes of the unfolded protein response pathway harbor risk alleles for primary open angle glaucoma.

    Directory of Open Access Journals (Sweden)

    Mary Anna Carbone

    Full Text Available The statistical power of genome-wide association (GWA studies to detect risk alleles for human diseases is limited by the unfavorable ratio of SNPs to study subjects. This multiple testing problem can be surmounted with very large population sizes when common alleles of large effects give rise to disease status. However, GWA approaches fall short when many rare alleles may give rise to a common disease, or when the number of subjects that can be recruited is limited. Here, we demonstrate that this multiple testing problem can be overcome by a comparative genomics approach in which an initial genome-wide screen in a genetically amenable model organism is used to identify human orthologues that may harbor risk alleles for adult-onset primary open angle glaucoma (POAG. Glaucoma is a major cause of blindness, which affects over 60 million people worldwide. Several genes have been associated with juvenile onset glaucoma, but genetic factors that predispose to adult onset primary open angle glaucoma (POAG remain largely unknown. Previous genome-wide analysis in a Drosophila ocular hypertension model identified transcripts with altered regulation and showed induction of the unfolded protein response (UPR upon overexpression of transgenic human glaucoma-associated myocilin (MYOC. We selected 16 orthologous genes with 62 polymorphic markers and identified in two independent human populations two genes of the UPR that harbor POAG risk alleles, BIRC6 and PDIA5. Thus, effectiveness of the UPR in response to accumulation of misfolded or aggregated proteins may contribute to the pathogenesis of POAG and provide targets for early therapeutic intervention.

  20. Genes of the unfolded protein response pathway harbor risk alleles for primary open angle glaucoma.

    Science.gov (United States)

    Carbone, Mary Anna; Chen, Yuhong; Hughes, Guy A; Weinreb, Robert N; Zabriskie, Norman A; Zhang, Kang; Anholt, Robert R H

    2011-01-01

    The statistical power of genome-wide association (GWA) studies to detect risk alleles for human diseases is limited by the unfavorable ratio of SNPs to study subjects. This multiple testing problem can be surmounted with very large population sizes when common alleles of large effects give rise to disease status. However, GWA approaches fall short when many rare alleles may give rise to a common disease, or when the number of subjects that can be recruited is limited. Here, we demonstrate that this multiple testing problem can be overcome by a comparative genomics approach in which an initial genome-wide screen in a genetically amenable model organism is used to identify human orthologues that may harbor risk alleles for adult-onset primary open angle glaucoma (POAG). Glaucoma is a major cause of blindness, which affects over 60 million people worldwide. Several genes have been associated with juvenile onset glaucoma, but genetic factors that predispose to adult onset primary open angle glaucoma (POAG) remain largely unknown. Previous genome-wide analysis in a Drosophila ocular hypertension model identified transcripts with altered regulation and showed induction of the unfolded protein response (UPR) upon overexpression of transgenic human glaucoma-associated myocilin (MYOC). We selected 16 orthologous genes with 62 polymorphic markers and identified in two independent human populations two genes of the UPR that harbor POAG risk alleles, BIRC6 and PDIA5. Thus, effectiveness of the UPR in response to accumulation of misfolded or aggregated proteins may contribute to the pathogenesis of POAG and provide targets for early therapeutic intervention.