WorldWideScience

Sample records for wild hordeum species

  1. Geography of genetic differentiation in the barley wild relative Hordeum vulgare subsp. spontaneum in Jordan

    Science.gov (United States)

    Informed collecting, conservation, monitoring and utilization of genetic diversity require knowledge of the distribution and structure of genetic variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic...

  2. Two New American Species of Hordeum (Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1985-01-01

    Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

  3. AFLP genetic polymorphism in wild barley (Hordeum spontaneum) populations in Israel

    NARCIS (Netherlands)

    Turpeinen, T.; Vanhala, T.; Nevo, E.; Nissila, E.

    2003-01-01

    The genetic diversity produced by the amplified fragment length polymorphism (AFLP) method was studied in 94 genotypes of wild barley, Hordeum spontaneum (C. Koch) Thell., originating from ten ecologically and geographically different locations in Israel. Eight primer pairs produced 204 discernible

  4. High capacity of plant regeneration from callus of interspecific hybrids with cultivated barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.

    1986-01-01

    Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...... explants of young spikes on the barley medium J 25-8. The capacity for plant regeneration was dependent on the wild parental species. In particular, combinations with four related wild species, viz. H. jubatum, H. roshevitzii, H. lechleri, and H. procerum, regenerated high numbers of plants from calli....

  5. The genetics and mechanism of avoidance of rust infection in Hordeum chilense

    NARCIS (Netherlands)

    Vaz Patto, M.C.

    2001-01-01

    Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae

  6. Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley

    DEFF Research Database (Denmark)

    Doll, Hans; Brown, A. H. D.

    1979-01-01

    The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...

  7. Untangling nucleotide diversity and evolution of the H genome in polyploid Hordeum and Elymus species based on the single copy of nuclear gene DMC1.

    Directory of Open Access Journals (Sweden)

    Dongfa Sun

    Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor

  8. Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan.

    Science.gov (United States)

    Thormann, Imke; Reeves, Patrick; Reilley, Ann; Engels, Johannes M M; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M

    2016-01-01

    Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum.

  9. Comparative analyses of genetic/epigenetic diversities and structures in a wild barley species (Hordeum brevisubulatum) using MSAP, SSAP and AFLP.

    Science.gov (United States)

    Shan, X H; Li, Y D; Liu, X M; Wu, Y; Zhang, M Z; Guo, W L; Liu, B; Yuan, Y P

    2012-08-17

    We analyzed genetic diversity and population genetic structure of four artificial populations of wild barley (Hordeum brevisubulatum); 96 plants collected from the Songnen Prairie in northeastern China were analyzed using amplified fragment length polymorphism (AFLP), specific-sequence amplified polymorphism (SSAP) and methylation-sensitive amplified polymorphism (MSAP) markers. Indices of (epi-)genetic diversity, (epi-)genetic distance, gene flow, genotype frequency, cluster analysis, PCA analysis and AMOVA analysis generated from MSAP, AFLP and SSAP markers had the same trend. We found a high level of correlation in the artificial populations between MSAP, SSAP and AFLP markers by the Mantel test (r > 0.8). This is incongruent with previous findings showing that there is virtually no correlation between DNA methylation polymorphism and classical genetic variation; the high level of genetic polymorphism could be a result of epigenetic regulation. We compared our results with data from natural populations. The population diversity of the artificial populations was lower. However, different from what was found using AFLP and SSAP, based on MSAP results the methylation polymorphism of the artificial populations was not significantly reduced. This leads us to suggest that the DNA methylation pattern change in H. brevisubulatum populations is not only related to DNA sequence variation, but is also regulated by other controlling systems.

  10. Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences

    DEFF Research Database (Denmark)

    Svitashev, S.; Bryngelsson, T.; Vershinin, A.

    1994-01-01

    A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...

  11. Separate Location of Parental Chromosomes in Squashed Metaphases of Hybrid between Hordeum vulgare L. and Four Polyploid, Alien Species

    DEFF Research Database (Denmark)

    Jensen, J.; Linde-Laursen, Ib

    1984-01-01

    In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...

  12. Fungal Endophytes of Wild Barley and their Effects on Diuraphis noxia Population Development

    Science.gov (United States)

    S.L. Clement; A. Dan Wilson; D.G. Lester; C.M. Davitt

    1997-01-01

    Laboratory experiments were conducted to compare the expression of Diuraphis noxia (Mordvilko) (Homoptera: Aphididae) resistance in four plant introduction (PI) lines of wild barley (Hordeum) infected with different species or strains of endophytic fungi (tribe Balansieae, family Clavicipitaceae, Neotyphodium gen. nov. [formerly...

  13. Can a genetic correlation with seed mass constrain adaptive evolution of seedling desiccation tolerance in wild barley?

    NARCIS (Netherlands)

    Verhoeven, K.J.F.; Biere, A.; Nevo, E.; Van Damme, J.M.M.

    2004-01-01

    Very young seedlings of wild barley Hordeum spontaneum have the ability to survive extended periods of severe drought. This desiccation tolerance is considered an adaptation to the rain-limited and unpredictable habitats that the species occupies. Genetic variation has been observed for this trait,

  14. Species-Level Phylogeny and Polyploid Relationships in Hordeum (Poaceae) Inferred by Next-Generation Sequencing and In Silico Cloning of Multiple Nuclear Loci.

    Science.gov (United States)

    Brassac, Jonathan; Blattner, Frank R

    2015-09-01

    Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.

  15. Localisation of genes for resistance against ¤Blumeria graminis¤ f.sp. ¤hordei¤ and ¤Puccinia graminis¤ in a cross between a barley cultivar and a wild barley (¤Hordeum vulgare¤ ssp. ¤spontaneum¤) line

    DEFF Research Database (Denmark)

    Backes, G.; Madsen, L.H.; Jaiser, H.

    2003-01-01

    The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...... (Hordeum vulgare ssp. spontaneum) line "1B-87" originating from Israel. The population consisted of 121 recombinant inbred lines. Resistance against leaf rust and powdery mildew was tested on detached leaves. The leaf rust isolate "I-80" and the powdery mildew isolate "Va-4", respectively, were used...

  16. Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke

    1986-01-01

    The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...

  17. Mapping and validation of major quantitative trait loci for kernel length in wild barley (Hordeum vulgare ssp. spontaneum).

    Science.gov (United States)

    Zhou, Hong; Liu, Shihang; Liu, Yujiao; Liu, Yaxi; You, Jing; Deng, Mei; Ma, Jian; Chen, Guangdeng; Wei, Yuming; Liu, Chunji; Zheng, Youliang

    2016-09-13

    Kernel length is an important target trait in barley (Hordeum vulgare L.) breeding programs. However, the number of known quantitative trait loci (QTLs) controlling kernel length is limited. In the present study, we aimed to identify major QTLs for kernel length, as well as putative candidate genes that might influence kernel length in wild barley. A recombinant inbred line (RIL) population derived from the barley cultivar Baudin (H. vulgare ssp. vulgare) and the long-kernel wild barley genotype Awcs276 (H.vulgare ssp. spontaneum) was evaluated at one location over three years. A high-density genetic linkage map was constructed using 1,832 genome-wide diversity array technology (DArT) markers, spanning a total of 927.07 cM with an average interval of approximately 0.49 cM. Two major QTLs for kernel length, LEN-3H and LEN-4H, were detected across environments and further validated in a second RIL population derived from Fleet (H. vulgare ssp. vulgare) and Awcs276. In addition, a systematic search of public databases identified four candidate genes and four categories of proteins related to LEN-3H and LEN-4H. This study establishes a fundamental research platform for genomic studies and marker-assisted selection, since LEN-3H and LEN-4H could be used for accelerating progress in barley breeding programs that aim to improve kernel length.

  18. Proteomic response of Hordeum vulgare cv. Tadmor and Hordeum marinum to salinity stress: Similarities and differences between a glycophyte and a halophyte

    Directory of Open Access Journals (Sweden)

    Lucie Maršálová

    2016-08-01

    Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H

  19. Development of cost-effective Hordeum chilense DNA markers: molecular aids for marker-assisted cereal breeding.

    Science.gov (United States)

    Hernández, P; Dorado, G; Ramírez, M C; Laurie, D A; Snape, J W; Martín, A

    2003-01-01

    Hordeum chilense is a potential source of useful genes for wheat breeding. The use of this wild species to increase genetic variation in wheat will be greatly facilitated by marker-assisted introgression. In recent years, the search for the most suitable DNA marker system for tagging H. chilense genomic regions in a wheat background has lead to the development of RAPD and SCAR markers for this species. RAPDs represent an easy way of quickly generating suitable introgression markers, but their use is limited in heterogeneous wheat genetic backgrounds. SCARs are more specific assays, suitable for automatation or multiplexing. Direct sequencing of RAPD products is a cost-effective approach that reduces labour and costs for SCAR development. The use of SSR and STS primers originally developed for wheat and barley are additional sources of genetic markers. Practical applications of the different marker approaches for obtaining derived introgression products are described.

  20. Progenitor-derivative relationships of Hordeum polyploids (Poaceae, Triticeae inferred from sequences of TOPO6, a nuclear low-copy gene region.

    Directory of Open Access Journals (Sweden)

    Jonathan Brassac

    Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.

  1. Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke

    1986-01-01

    The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...

  2. Geographic distribution of wild potato species

    NARCIS (Netherlands)

    Hijmans, R.J.; Spooner, D.M.

    2001-01-01

    The geographic distribution of wild potatoes (Solanaceae sect. Petota) was analyzed using a database of 6073 georeferenced observations. Wild potatoes occur in 16 countries, but 88% of the observations are from Argentina, Bolivia, Mexico, and Peru. Most species are rare and narrowly endemic: for 77

  3. Adaptive microclimatic structural and expressional dehydrin 1 evolution in wild barley, Hordeum spontaneum, at 'Evolution Canyon', Mount Carmel, Israel.

    Science.gov (United States)

    Yang, Zujun; Zhang, Tao; Bolshoy, Alexander; Beharav, Alexander; Nevo, Eviatar

    2009-05-01

    'Evolution Canyon' (ECI) at Lower Nahal Oren, Mount Carmel, Israel, is an optimal natural microscale model for unravelling evolution in action highlighting the twin evolutionary processes of adaptation and speciation. A major model organism in ECI is wild barley, Hordeum spontaneum, the progenitor of cultivated barley, which displays dramatic interslope adaptive and speciational divergence on the 'African' dry slope (AS) and the 'European' humid slope (ES), separated on average by 200 m. Here we examined interslope single nucleotide polymorphism (SNP) sequences and the expression diversity of the drought resistant dehydrin 1 gene (Dhn1) between the opposite slopes. We analysed 47 plants (genotypes), 4-10 individuals in each of seven stations (populations) in an area of 7000 m(2), for Dhn1 sequence diversity located in the 5' upstream flanking region of the gene. We found significant levels of Dhn1 genic diversity represented by 29 haplotypes, derived from 45 SNPs in a total of 708 bp sites. Most of the haplotypes, 25 out of 29 (= 86.2%), were represented by one genotype; hence, unique to one population. Only a single haplotype was common to both slopes. Genetic divergence of sequence and haplotype diversity was generally and significantly different among the populations and slopes. Nucleotide diversity was higher on the AS, whereas haplotype diversity was higher on the ES. Interslope divergence was significantly higher than intraslope divergence. The applied Tajima D rejected neutrality of the SNP diversity. The Dhn1 expression under dehydration indicated interslope divergent expression between AS and ES genotypes, reinforcing Dhn1 associated with drought resistance of wild barley at 'Evolution Canyon'. These results are inexplicable by mutation, gene flow, or chance effects, and support adaptive natural microclimatic selection as the major evolutionary divergent driving force.

  4. Genetic Diversity of Wild Rice Species in Yunnan Province of China

    OpenAIRE

    Zai-quan CHENG; Fu-you YING; Ding-qing LI; Teng-qiong YU; Jian FU; Hui-jun YAN; Qiao-fang ZHONG; Dun-yu ZHANG; Wei-jiao LI; Xing-qi HUANG

    2012-01-01

    Yunnan Province of China is one of the important centers for origin and evolution of cultivated rice worldwide. Wild rice is the ancestor of the cultivated rice. Many elite traits of wild rice have widened the genetic basis in cultivated rice. However, many populations of wild rice species have disappeared in the past few years. Therefore, the current status of wild rice resources should be updated and the genetic diversity of wild rice species should be examined for further germplasm preserv...

  5. The eco-evolutionary impacts of domestication and agricultural practices on wild species.

    Science.gov (United States)

    Turcotte, Martin M; Araki, Hitoshi; Karp, Daniel S; Poveda, Katja; Whitehead, Susan R

    2017-01-19

    Agriculture is a dominant evolutionary force that drives the evolution of both domesticated and wild species. However, the various mechanisms of agriculture-induced evolution and their socio-ecological consequences are not often synthetically discussed. Here, we explore how agricultural practices and evolutionary changes in domesticated species cause evolution in wild species. We do so by examining three processes by which agriculture drives evolution. First, differences in the traits of domesticated species, compared with their wild ancestors, alter the selective environment and create opportunities for wild species to specialize. Second, selection caused by agricultural practices, including both those meant to maximize productivity and those meant to control pest species, can lead to pest adaptation. Third, agriculture can cause non-selective changes in patterns of gene flow in wild species. We review evidence for these processes and then discuss their ecological and sociological impacts. We finish by identifying important knowledge gaps and future directions related to the eco-evolutionary impacts of agriculture including their extent, how to prevent the detrimental evolution of wild species, and finally, how to use evolution to minimize the ecological impacts of agriculture.This article is part of the themed issue 'Human influences on evolution, and the ecological and societal consequences'. © 2016 The Author(s).

  6. Phenotypic selection and regulation of reproduction in different environments in wild barley

    NARCIS (Netherlands)

    Volis, S.; Verhoeven, K.J.F.; Mendlinger, S.; Ward, D.

    2004-01-01

    Plasticity of the phenotypic architecture of wild barley, Hordeum spontaneum, was studied in response to water and nutrient stress. Direct and indirect selection on several vegetative and reproductive traits was estimated and path analysis used to reveal how regulating pathways via maternal

  7. Prevalence of Campylobacter species in wild birds of South Korea.

    Science.gov (United States)

    Kwon, Yong-Kuk; Oh, Jae-Young; Jeong, Ok-Mi; Moon, Oun-Kyoung; Kang, Min-Su; Jung, Byeong-Yeal; An, Byung-Ki; Youn, So-Youn; Kim, Hye-Ryoung; Jang, Il; Lee, Hee-Soo

    2017-10-01

    Campylobacter species cause human gastrointestinal infections worldwide. They commonly inhabit intestines of avian species including wild birds. They might play a role in the spread of infections to humans and other bird species. The prevalence of Campylobacter species in 2164 faecal samples of wild birds (representing 71 species and 28 families) captured across the Korean peninsula was evaluated in this study. The overall prevalence was 15.3% (332/2164). Bird species belonging to the family Charadriidae had the highest isolation rate (30.0%), followed by those belonging to the families Ardeidae (26.4%), Turdidae (21.9%), and Anatidae (15.3%). The prevalence of Campylobacter spp. differed significantly according to migratory habit. Stopover birds were the most commonly infected (19.0%), followed by winter migratory (16.7%) and summer migratory birds (12.3%). However, indigenous birds showed very low prevalence (2.7%). Antimicrobial susceptibility tests were performed for 213 isolates. Results showed that Campylobacter jejuni isolates (n = 169) exhibited resistance to nalidixic acid (5.3%), ciprofloxacin (3.0%), and tetracycline (1.8%), while Campylobacter lari (n = 1) displayed resistance to nalidixic acid and ciprofloxacin. However, all Campylobacter coli isolates (n = 20) were susceptible to all antimicrobials tested. This is the first report on the prevalence of Campylobacter species in wild birds that seasonally or indigenously inhabit the Korean peninsula. Our results indicate that the overall prevalence of Campylobacter in wild birds is moderate. Therefore, birds might serve as significant reservoirs for Campylobacter pathogens.

  8. Genetic variability of concentration of microelements in wild sunflower species and hybrids

    Directory of Open Access Journals (Sweden)

    Kastori Rudolf R.

    2010-01-01

    Full Text Available The aim of this work was to investigate genetic specificity of sunflower nutrition with microelements. Therefore, concentrations of essential (Zn, B, Mn, Cu, Fe and Ni and non-essential (Cr, Al, Cd, As, Pb and Ba micronutrients were analyzed. Five sunflower hybrids the most grown in Serbia and different populations of wild sunflower species originating from North America: Helianthus neglectus Heiser (3, Helianthus agrophyllus T&G (3, Helianthus petiolaris Nutt. (2, Helianthus annuus L. (4 were included in the experiment. Populations of wild sunflower species and hybrids differed significantly with respect to the concentration of analyzed elements. Manganese concentration was significantly higher in hybrids than in wild species. In all genotypes Fe, B and Mn had the highest concentration. Coefficient of variation of microelement concentration depended on genotype and particular element. In wild populations, for essential microelements, it was between 3.7 and 59.5, whereas in hybrids it varied from 10.0 to 48.8. Coefficient of variation of concentration of non-essential microelements in wild populations varied from 7.7 to 73.8, and in hybrids from 15.1 to 48.8. Average coefficient of variation in both wild species and hybrids was the lowest for Mn and Pb. It was the highest for Cr, Ni, and Zn in hybrids and for Cd, Ni, and Cr in wild species. The results suggest that genetic specificity with respect to uptake of microelements in wild species and hybrids is highly expressed. Broad genetic variability of concentrations of microelements in wild species and hybrids indicate that their reactions to deficiency and/or excess of those elements probably are not the same either. This finding may be used in breeding process aimed specifically at improvement of tolerance and capacity to accumulate microelements in sunflower. Phytoremediation technology designed to reduce the amount of microelements in the soil could thus be advanced by utilization of such

  9. Effects of ultraviolet radiation on viability of isolated Beta vulgaris and Hordeum vulgare protoplasts

    International Nuclear Information System (INIS)

    Bornman, J.F.; Bjoern, L.O.; Bornman, C.H.

    1982-01-01

    Estimates of viability as measured by vital straining with fluorescein diacetate were carried out on freshly isolated and partially aged (16-hour-old) Beta vulgaris and Hordeum vulgare mesophyll protoplasts following irradiation with UV-B. Damage to the photosynthetic system by UV-B was determined by delayed light emission (DLE). In the case of freshly isolated Protoplasts Beta was approximately 30% more susceptible than Hordeum following 3h irradiation, with viability decreasing from 90% to 40%. After storage of protoplasts on ice for 16 h UV-B radiation markedly depressed viability in both species, but in the case of Hordeum there was a substantial initial loss of nearly 70% in viability over the first hour of irradiation. The first 10 min of UV-B radiation decreased the intensity of DLE by 40% without appreciably affecting the decay rate. Longer treatment times did not give a proportional effect so that even after 60 min of UV-B the inhibition did not exceed 60%. This suggested that although the enzyme system responsible for FDA hydrolysis may be partially inactivated (viability was 75-80% as compared with 90% in the control), the UV-B did not penetrate the innermost parts of the chloroplasts, but left some thylakoids undamaged. (orig.)

  10. Saponin Profile of Wild Asparagus Species.

    Science.gov (United States)

    Jaramillo-Carmona, Sara; Rodriguez-Arcos, Rocío; Jiménez-Araujo, Ana; López, Sergio; Gil, Juan; Moreno, Roberto; Guillén-Bejarano, Rafael

    2017-03-01

    The aim of this work was to study the saponin profiles from spears of different wild asparagus species in the context of its genetic diversity aside from geographical seed origin. They included Asparagus pseudoscaber Grecescu, Asparagus maritimus (L.) Mill., Asparagus brachiphyllus Turcz., Asparagus prostrates Dumort., and Asparagus officinalis L. The saponin analysis by LC-MS has shown that saponin profile from wild asparagus is similar to that previously described for triguero asparagus from Huétor-Tájar landrace (triguero HT), which had not ever been reported in the edible part of asparagus. All the samples, except A. officinalis, were characterized for having saponins distinct to protodioscin and the total saponin contents were 10-fold higher than those described for commercial hybrids of green asparagus. In particular, A. maritimus from different origins were rich in saponins previously found in triguero HT. These findings supported previous suggestion, based on genetic analysis, about A. maritimus being the origin of triguero HT. Multivariate statistics including principal component analysis and hierarchical clustering analysis were used to define both similarities and differences among samples. The results showed that the greatest variance of the tested wild asparagus could be attributed to differences in the concentration of particular saponins and this knowledge could be a tool for identifying similar species. © 2017 Institute of Food Technologists®.

  11. Gene flow among wild and domesticated almond species: insights from chloroplast and nuclear markers

    Science.gov (United States)

    Delplancke, Malou; Alvarez, Nadir; Espíndola, Anahí; Joly, Hélène; Benoit, Laure; Brouck, Elise; Arrigo, Nils

    2012-01-01

    Hybridization has played a central role in the evolutionary history of domesticated plants. Notably, several breeding programs relying on gene introgression from the wild compartment have been performed in fruit tree species within the genus Prunus but few studies investigated spontaneous gene flow among wild and domesticated Prunus species. Consequently, a comprehensive understanding of genetic relationships and levels of gene flow between domesticated and wild Prunus species is needed. Combining nuclear and chloroplastic microsatellites, we investigated the gene flow and hybridization among two key almond tree species, the cultivated Prunus dulcis and one of the most widespread wild relative Prunus orientalis in the Fertile Crescent. We detected high genetic diversity levels in both species along with substantial and symmetric gene flow between the domesticated P. dulcis and the wild P. orientalis. These results were discussed in light of the cultivated species diversity, by outlining the frequent spontaneous genetic contributions of wild species to the domesticated compartment. In addition, crop-to-wild gene flow suggests that ad hoc transgene containment strategies would be required if genetically modified cultivars were introduced in the northwestern Mediterranean. PMID:25568053

  12. Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae

    Directory of Open Access Journals (Sweden)

    Quanwen Dou

    2016-10-01

    Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.

  13. Physiological and molecular characterization of Si uptake in wild rice species.

    Science.gov (United States)

    Mitani-Ueno, Namiki; Ogai, Hisao; Yamaji, Naoki; Ma, Jian Feng

    2014-07-01

    Cultivated rice (Oryza sativa) accumulates high concentration of silicon (Si), which is required for its high and sustainable production. High Si accumulation in cultivated rice is achieved by a high expression of both influx (Lsi1) and efflux (Lsi2) Si transporters in roots. Herein, we physiologically investigated Si uptake, isolated and functionally characterized Si transporters in six wild rice species with different genome types. Si uptake by the roots was lower in Oryza rufipogon, Oryza barthii (AA genome), Oryza australiensis (EE genome) and Oryza punctata (BB genome), but similar in Oryza glumaepatula and Oryza meridionalis (AA genome) compared with the cultivated rice (cv. Nipponbare). However, all wild rice species and the cultivated rice showed similar concentration of Si in the shoots when grown in a field. All species with AA genome showed the same amino acid sequence of both Lsi1 and Lsi2 as O. sativa, whereas species with EE and BB genome showed several nucleotide differences in both Lsi1 and Lsi2. However, proteins encoded by these genes also showed transport activity for Si in Xenopus oocyte. The mRNA expression of Lsi1 in all wild rice species was lower than that in the cultivated rice, whereas the expression of Lsi2 was lower in O. rufipogon and O. barthii but similar in other species. Similar cellular localization of Lsi1 and Lsi2 was observed in all wild rice as the cultivated rice. These results indicate that superior Si uptake, the important trait for rice growth, is basically conserved in wild and cultivated rice species. © 2013 Scandinavian Plant Physiology Society.

  14. The Effects of Climate Change on Invasion Potential of Wild Barley (Hordeum spontaneum K.Koch in Iran and the World

    Directory of Open Access Journals (Sweden)

    Seyed Karim Mousavi

    2017-09-01

    Full Text Available Introduction Invasive species present a major threat to biodiversity, which may be boosted due to the climate change effects, particularly if desired weather conditions allow weed to spread to new areas. Identification of areas climatically suitable to weed establishment can offer great opportunities for stopping or decelerating invasion process. Bioclimatic and species distribution models that relate geographic data of a species to environmental variables have become an important modeling tool in invasion ecology. Although the predicted area by climex as suitable environmental for a species does not mean that, it can necessarily establish there, it does suggest a beneficial knowledge about detecting areas with invasion potential. Taking advantage of climate match index to predict the potential invasion of wild barley grass weed in Iran and other world regions under current climate and different climate change scenarios are the objectives of current research .Identifying suitable environmental areas for invasive species provides an opportunity to prevent or slow down the invasion process Materials and methods Based on the presence intensity index of weeds, the climate of infestation hotspots in the Lorestan province, including Khorramabad (Aymanabad and Rimmelleh region, Dorud, Kuhdasht and Aleshtar, were defined as the favorable climate for wild barley. Wild barley-infected foci climate in Lorestan province was considered as a desirable climate for this weed. Climatic similarity of different regions of the world with the intended zone was evaluated as a criterion of invasion susceptibility of those regions in the current conditions and under climate change scenarios by using Climex model. Results and Discussion Results showed that Kermanshah, Tehran, Hamedan, Kurdistan, Markazi, Qazvin and Chaharmahal and Bakhtiari with composite match Index greater than 0.81 in compare to infected area in Lorestan, were the most prone province of Iran for wild

  15. Imaging of fast chlorophyll fluorescence induction curve (OJIP) parameters, applied in a screening study with wild barley (Hordeum spontaneum) genotypes under heat stress.

    Science.gov (United States)

    Jedmowski, Christoph; Brüggemann, Wolfgang

    2015-10-01

    We quantified the influence of heat stress (HS) on PSII by imaging of parameters of the fast chlorophyll fluorescence (CF) induction (OJIP) kinetic of 20 genotypes of wild barley (Hordeum spontaneum) covering a broad geographical spectrum. We developed a standardised screening procedure, allowing a repetitive fluorescence measurement of leaf segments. The impact of HS was quantified by calculating a Heat Resistance Index (HRI), derived from the decrease of the Performance Index (PI) caused by HS treatment and following recovery. For the genotype showing the lowest HRI, reduced maximum quantum yield (φP0) and increased relative variable fluorescence of the O-J phase (K-Peak) were detected after HS, whereas the basal fluorescence (F0) remained stable. An additional feature was a lowered fraction of active (QA-reducing) reaction centres (RCs). The disturbances disappeared after one day of recovery. Spatial heterogeneities of fluorescence parameters were detected, as the negative effect of HS was stronger in the leaf areas close to the leaf tip. The results of this study prove that chlorophyll fluorescence imaging (CFI) is suitable for the detection of HS symptoms and that imaging of JIP-Test parameters should be considered in future screening and phenotyping studies aiming for the characterisation of plant genotypes. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Genetic Transformation of Hordeum vulgare ssp. spontaneum for the Development of a Transposon-Based Insertional Mutagenesis System.

    Science.gov (United States)

    Cardinal, Marie-Josée; Kaur, Rajvinder; Singh, Jaswinder

    2016-10-01

    Domestication and intensive selective breeding of plants has triggered erosion of genetic diversity of important stress-related alleles. Researchers highlight the potential of using wild accessions as a gene source for improvement of cereals such as barley, which has major economic and social importance worldwide. Previously, we have successfully introduced the maize Ac/Ds transposon system for gene identification in cultivated barley. The objective of current research was to investigate the response of Hordeum vulgare ssp. spontaneum wild barley accessions in tissue culture to standardize parameters for introduction of Ac/Ds transposons through genetic transformation. We investigated the response of ten wild barley genotypes for callus induction, regenerative green callus induction and regeneration of fertile plants. The activity of exogenous Ac/Ds elements was observed through a transient assay on immature wild barley embryos/callus whereby transformed embryos/calli were identified by the expression of GUS. Transient Ds expression bombardment experiments were performed on 352 pieces of callus (3-5 mm each) or immature embryos in 4 genotypes of wild barley. The transformation frequency of putative transgenic callus lines based on transient GUS expression ranged between 72 and100 % in wild barley genotypes. This is the first report of a transformation system in H. vulgare ssp. spontaneum.

  17. Disentangling urban habitat and matrix effects on wild bee species.

    Science.gov (United States)

    Fischer, Leonie K; Eichfeld, Julia; Kowarik, Ingo; Buchholz, Sascha

    2016-01-01

    In face of a dramatic decline of wild bee species in many rural landscapes, potential conservation functions of urban areas gain importance. Yet effects of urbanization on pollinators, and in particular on wild bees, remain ambiguous and not comprehensively understood. This is especially true for amenity grassland and extensively managed wastelands within large-scale residential housing areas. Using Berlin as a study region, we aimed to investigate (a) if these greenspaces are accepted by wild bee assemblages as foraging habitats; (b) how assemblage structure of bees and individual bee species are affected by different habitat (e.g., management, flower density) and urban matrix variables (e.g., isolation, urbanization); and (c) to what extent grassland restoration can promote bees in urban environments. In summer 2012, we collected 62 bee species belonging to more than 20% of the taxa known for Berlin. Urbanization significantly affected species composition of bees; 18 species were affiliated to different levels of urbanization. Most bee species were not affected by any of the environmental variables tested, and urbanization had a negative effect only for one bee species. Further, we determined that restoration of diverse grasslands positively affected bee species richnesss in urban environments. We conclude that differently structured and managed greenspaces in large-scale housing areas can provide additional foraging habitats and refuges for pollinators. This supports approaches towards a biodiversity friendly management within urban regions and may be of particular importance given that anthropogenic pressure is increasing in many rural landscapes.

  18. Environmental, phenotypic and genetic variation of wild barley (Hordeum spontaneum) from Israel

    NARCIS (Netherlands)

    Vanhala, T.; Rijn, C.P.E.; Buntjer, J.; Stam, P.; Nevo, E.; Poorter, H.; Eeuwijk, van F.A.

    2004-01-01

    Wild relatives of crop plants offer an attractive gene pool for cultivar improvement. We evaluated genetic and phenotypic variation for a set of 72 Israeli accessions of wild barley from 21 populations. These populations were grouped further into four ecotypes. In addition, environmental variables

  19. Disentangling urban habitat and matrix effects on wild bee species

    Directory of Open Access Journals (Sweden)

    Leonie K. Fischer

    2016-11-01

    Full Text Available In face of a dramatic decline of wild bee species in many rural landscapes, potential conservation functions of urban areas gain importance. Yet effects of urbanization on pollinators, and in particular on wild bees, remain ambiguous and not comprehensively understood. This is especially true for amenity grassland and extensively managed wastelands within large-scale residential housing areas. Using Berlin as a study region, we aimed to investigate (a if these greenspaces are accepted by wild bee assemblages as foraging habitats; (b how assemblage structure of bees and individual bee species are affected by different habitat (e.g., management, flower density and urban matrix variables (e.g., isolation, urbanization; and (c to what extent grassland restoration can promote bees in urban environments. In summer 2012, we collected 62 bee species belonging to more than 20% of the taxa known for Berlin. Urbanization significantly affected species composition of bees; 18 species were affiliated to different levels of urbanization. Most bee species were not affected by any of the environmental variables tested, and urbanization had a negative effect only for one bee species. Further, we determined that restoration of diverse grasslands positively affected bee species richnesss in urban environments. We conclude that differently structured and managed greenspaces in large-scale housing areas can provide additional foraging habitats and refuges for pollinators. This supports approaches towards a biodiversity friendly management within urban regions and may be of particular importance given that anthropogenic pressure is increasing in many rural landscapes.

  20. Heterologous expression of Hordeum vulgare cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B

    Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and w......Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned...

  1. Resistance of Hordeum chilense against loose smuts of wheat and barley (Ustilago tritici and U. nuda) and its expression in amphiploids with wheat

    OpenAIRE

    Rubiales, Diego; Moral, Ana

    2011-01-01

    Hordeum chilense is wild barley with high potential for cereal breeding purposes given its high crossability with other members of the Triticeae tribe. It is resistant to loose smuts of wheat (Ustilago tritici). The resistance is expressed in xTritordeum amphipoids, offering perspectives for its utilization both in tritordeum breeding and for its transfer to wheat. H. chilense and tritordeums are also resistant to barley loose smut (U. nuda). © 2010 Blackwell Verlag GmbH.

  2. Synthetic Hexaploids Derived from Wild Species Related to Sweet Potato

    OpenAIRE

    SHIOTANI, Itaru; KAWASE, Tsuneo; 塩谷, 格; 川瀬, 恒男

    1987-01-01

    The utilization of germplasm of the wild species in sweet-potato breeding has been conducted for the last three decades. Such attempts brought some remarkable achievments in improving root yield, starch content and resistance to the nematodes of sweet potato. Some wild plants in polyploid series may have many genes potentially important for further improvement of the agronomic traits. However, the genomic relationship between the wild relatives and hexaploid sweet potato (2n=6x=90) has been u...

  3. Proteomic analysis of seed storage proteins in wild rice species of the Oryza genus.

    Science.gov (United States)

    Jiang, Chunmiao; Cheng, Zaiquan; Zhang, Cheng; Yu, Tengqiong; Zhong, Qiaofang; Shen, J Qingxi; Huang, Xingqi

    2014-01-01

    The total protein contents of rice seeds are significantly higher in the three wild rice species (Oryza rufipogon Grill., Oryza officinalis Wall. and Oryza meyeriana Baill.) than in the cultivated rice (Oryza sativa L.). However, there is still no report regarding a systematic proteomic analysis of seed proteins in the wild rice species. Also, the relationship between the contents of seed total proteins and rice nutritional quality has not been thoroughly investigated. The total seed protein contents, especially the glutelin contents, of the three wild rice species were higher than those of the two cultivated rice materials. Based on the protein banding patterns of SDS-PAGE, O. rufipogon was similar to the two cultivated rice materials, followed by O. officinalis, while O. meyeriana exhibited notable differences. Interestingly, O. meyeriana had high contents of glutelin and low contents of prolamine, and lacked 26 kDa globulin band and appeared a new 28 kDa protein band. However, for O. officinali a 16 kDa protein band was absent and a row of unique 32 kDa proteins appeared. In addition, we found that 13 kDa prolamine band disappeared while special 14 kDa and 12 kDa protein bands were present in O. officinalis. Two-dimensional gel electrophoresis (2-DE) analysis revealed remarkable differences in protein profiles of the wild rice species and the two cultivated rice materials. Also, the numbers of detected protein spots of the three wild rice species were significantly higher than those of two cultivated rice. A total of 35 differential protein spots were found for glutelin acidic subunits, glutelin precursors and glutelin basic subunits in wild rice species. Among those, 18 protein spots were specific and 17 major spots were elevated. Six differential protein spots for glutelin acidic subunits were identified, including a glutelin type-A 2 precursor and five hypothetical proteins. This was the first report on proteomic analysis of the three wild rice species

  4. Wild Musa Species Collection of Purwodadi Botanic Garden: Inventory and Its Morpho - taxonomic Review

    Directory of Open Access Journals (Sweden)

    Lia Hapsari

    2014-01-01

    Full Text Available Indonesia, being part of the center of origin of bananas (Musaceae, has a large number diversity of bananas both wild seeded species and edible seedless cultivated varieties. Inventory of wild Musa species in Purwodadi Botanic Garden has been conducted through compiling data records from PBG’s Registration section, field inspection and observation to living collections in the garden, herbarium specimens and literature studies. The results show that total 17 wild Musa accessions has been recorded planted in Purwodadi Botanic Garden since 1990 until 2012; comprises of 8 Musa acuminata sub species, 2 Musa balbisiana forms, 1 Musa ornata, 1 Musa troglodytarum, 1 Musa borneensis and 4 unidentified species Musa spp.; but only 8 living accessions remained in 2012. Morphotaxonomic review of those 8 wild Musa accessions remained will be discussed in this paper including their geographical distributions. According to its differentiated morphological characteristics observations, it is known that there are three accessions were resembled cultivars and one unidentified species have been determined its species level, so that their registration identity needs to be revised. It is important next to prioritize ex-situ conservation of wild Musa species not yet collected in Purwodadi Botanic Garden especially from Eastern Indonesia.

  5. Broomrape (Orobanche cumana Wallr.) resistance breeding utilizing wild Helianthus species

    Science.gov (United States)

    Wild Helianthus species possess valuable resistance genes for sunflower broomrape (Orobanche cumana Wallr.), especially the 39 largely under-utilized perennial species. Resistance to race F has been transferred into cultivated background via bridging of interspecific amphiploids. More recently, a si...

  6. Wild Prunus Fruit Species as a Rich Source of Bioactive Compounds.

    Science.gov (United States)

    Mikulic-Petkovsek, Maja; Stampar, Franci; Veberic, Robert; Sircelj, Helena

    2016-08-01

    Sugars, organic acids, carotenoids, tocopherols, chlorophylls, and phenolic compounds were quantified in fruit of 4 wild growing Prunus species (wild cherry, bird cherry, blackthorn, and mahaleb cherry) using HPLC-DAD-MSn. In wild Prunus, the major sugars were glucose and fructose, whereas malic and citric acids dominated among organic acids. The most abundant classes of phenolic compounds in the analyzed fruit species were anthocyanins, flavonols, derivatives of cinnamic acids, and flavanols. Two major groups of anthocyanins measured in Prunus fruits were cyanidin-3-rutinoside and cyanidin-3-glucoside. Flavonols were represented by 19 derivatives of quercetin, 10 derivatives of kaempferol, and 2 derivatives of isorhamnetin. The highest total flavonol content was measured in mahaleb cherry and bird cherry, followed by blackthorn and wild cherry fruit. Total phenolic content varied from 2373 (wild cherry) to 11053 mg GAE per kg (bird cherry) and ferric reducing antioxidant power antioxidant activity from 7.26 to 31.54 mM trolox equivalents per kg fruits. © 2016 Institute of Food Technologists®

  7. Species integrity enhanced by a predation cost to hybrids in the wild

    DEFF Research Database (Denmark)

    Nilsson, P. A.; Hulthén, Kaj; Chapman, Ben B.

    2017-01-01

    Species integrity can be challenged, and even eroded, if closely related species can hybridize and produce fertile offspring of comparable fitness to that of parental species. The maintenance of newly diverged or closely related species therefore hinges on the establishment and effectiveness of pre...... barrier to gene flow in the wild. Cyprinid fishes commonly produce fertile, viable hybrid offspring and therefore make excellent study organisms to investigate ecological costs to hybrids. We electronically tagged two freshwater cyprinid fish species (roach Rutilus rutilus and bream Abramis brama...... to directly test for a predation cost to hybrids in the wild. Hybrid individuals were found significantly more susceptible to cormorant predation than individuals from either parental species. Such ecological selection against hybrids contributes to species integrity, and can enhance species diversification....

  8. Occurrence and distribution of Giardia species in wild rodents in Germany.

    Science.gov (United States)

    Helmy, Yosra A; Spierling, Nastasja G; Schmidt, Sabrina; Rosenfeld, Ulrike M; Reil, Daniela; Imholt, Christian; Jacob, Jens; Ulrich, Rainer G; Aebischer, Toni; Klotz, Christian

    2018-03-27

    Giardiasis is an important gastrointestinal parasitic disease in humans and other mammals caused by the protozoan Giardia duodenalis. This species complex is represented by genetically distinct groups (assemblages A-H) with varying zoonotic potential and host preferences. Wild rodents can harbor potentially zoonotic assemblages A and B, and the rodent-specific assemblage G. Other Giardia spp. found in these animals are Giardia muris and Giardia microti. For the latter, only limited information on genetic typing is available. It has been speculated that wild rodents might represent an important reservoir for parasites causing human giardiasis. The aim of this study was to investigate the occurrence and distribution of Giardia spp. and assemblage types in wild rodents from different study sites in Germany. Screening of 577 wild rodents of the genera Apodemus, Microtus and Myodes, sampled at eleven study sites in Germany, revealed a high overall Giardia prevalence. Giardia species determination at the SSU rDNA gene locus revealed that Apodemus mice, depending on species, were predominantly infected with one of two distinct G. muris sequence types. Giardia microti was the predominant parasite species found in voles of the genera Microtus and Myodes. Only a few animals were positive for potentially zoonotic G. duodenalis. Subtyping at the beta-giardin (bg) and glutamine dehydrogenase (gdh) genes strongly supported the existence of different phylogenetic subgroups of G. microti that are preferentially harbored by distinct host species. The present study highlights the preference of G. muris for Apodemus, and G. microti for Microtus and Myodes hosts and argues for a very low prevalence of zoonotic G. duodenalis assemblages in wild rodents in Germany. It also provides evidence that G. muris and G. microti subdivide into several phylogenetically distinguishable subgroups, each of which appears to be preferentially harbored by species of a particular rodent host genus

  9. Natural and human dimensions of a quasi-wild species: The case of kudzu

    Science.gov (United States)

    Li, Z.; Dong, Q.; Albright, Thomas P.; Guo, Q.

    2011-01-01

    The human dimensions of biotic invasion are generally poorly understood, even among the most familiar invasive species. Kudzu (Pueraria montana (Lour.) Merr.) is a prominent invasive plant and an example of quasi-wild species, which has experienced repeated introduction, cultivation, and escape back to the wild. Here, we review a large body of primary scientific and historic records spanning thousands of years to characterize the complex relationships among kudzu, its natural enemies, and humans, and provide a synthesis and conceptual model relevant to the ecology and management of quasi-wild invasive species. We documented over 350, mostly insect, natural enemy species and their impacts on kudzu in its native East Asian range. These natural enemies play a minor role in limiting kudzu in its native range, rarely generating severe impacts on populations of wild kudzu. We identified a number of significant influences of humans including dispersal, diverse cultural selection, and facilitation through disturbances, which catalyzed the expansion and exuberance of kudzu. On the other hand, harvest by humans appears to be the major control mechanism in its native areas. Humans thus have a complex relationship with kudzu. They have acted as both friend and foe, affecting the distribution and abundance of kudzu in ways that vary across its range and over time. Our conceptual model of kudzu emphasizes the importance of multiple human dimensions in shaping the biogeography of a species and illustrates how kudzu and other quasi-wild species are more likely to be successful invaders. ?? 2011 Springer Science+Business Media B.V.(outside the USA).

  10. Natural and human dimensions of a quasi-wild species:the case of kudzu

    Science.gov (United States)

    Zhenyu Li; Quan Dong; Thomas Albright; Qinfeng Guo

    2011-01-01

    The human dimensions of biotic invasion are generally poorly understood, even among the most familiar invasive species. Kudzu (Pueraria montana (Lour.) Merr.) is a prominent invasive plant and an example of quasi-wild species, which has experienced repeated introduction, cultivation, and escape back to the wild. Here, we review a large body of primary scientific and...

  11. Comparative metabolite profiling of Solanum tuberosum against six wild Solanum species with Colorado potato beetle resistance.

    Science.gov (United States)

    Tai, Helen H; Worrall, Kraig; Pelletier, Yvan; De Koeyer, David; Calhoun, Larry A

    2014-09-10

    The Colorado potato beetle Leptinotarsa decemlineata (Say) (CPB) is a coleopteran herbivore that feeds on the foliage on Solanum species, in particular, potato. Six resistant wild Solanum species were identified, and two of these species had low levels of glycoalkaloids. Comparative analysis of the untargeted metabolite profiles of the foliage using UPLC-qTOF-MS was done to find metabolites shared between the wild species but not with Solanum tuberosum (L.) to identify resistance-related metabolites. It was found that only S. tuberosum produced the triose glycoalkaloids solanine and chaconine. Instead, the six wild species produced glycoalkaloids that shared in common tetrose sugar side chains. Additionally, there were non-glycoalkaloid metabolites associated with resistance including hydroxycoumarin and a phenylpropanoid, which were produced in all wild species but not in S. tuberosum.

  12. Meiotic behavior of wild Caricaceae species potentially suitable for papaya improvement

    Directory of Open Access Journals (Sweden)

    Emanuelli Narducci da Silva

    2012-01-01

    Full Text Available The purpose of this study was to evaluate the meiotic behavior and determine the meiotic index and pollen viability of representative plants of the wild species V. goudotiana, V. quercifolia and J. spinosa. Meiotic analysis confirmed that the species are diploid and have 18 chromosomes. Meiosis was partially normal, since some abnormalities, e.g, sticky and lagging chromosomes, precocious segregation, lack of synchrony, and disturbances in the spindle fibers were observed. These abnormalities resulted in post-meiotic products (monads, dyads, triads, and polyads that probably contributed to the meiotic index of 85.7 % (V. goudotiana to 95.9 % (J. spinosa; significant variation was observed in the species V. goudotiana. The pollen viability of 68.0% (V. goudotiana to 96.0 % (J. spinosa was reasonably good in these wild species. Crossings in breeding programs involving V. goudotiana should therefore be carefully planned, since part of the gametes of this species is unviable.

  13. Increases in both acute and chronic temperature potentiate tocotrienol concentrations in wild barley at 'Evolution Canyon'.

    Science.gov (United States)

    Shen, Yu; Lansky, Ephraim; Traber, Maret; Nevo, Eviatar

    2013-09-01

    Biosynthesis of tocols (vitamin E isoforms) is linked to response to temperature in plants. 'Evolution Canyon', an ecogeographical microcosm extending over an average of 200 meters (range 100-400) wide area in the Carmel Mountains of northern Israel, has been suggested as a model for studying global warming. Both domestic (Hordeum vulgare) and wild (Hordeum spontaneum) barley compared with wheat, oat, corn, rice, and rye show high tocotrienol/tocopherol ratios. Therefore, we hypothesized that tocol distribution might change in response to global warming. α-, β-, γ-, and δ-tocopherol, and α-, β-, γ-, and δ-tocotrienol concentrations were measured in wild barley (H. spontaneum) seeds harvested from the xeric (African) and mesic (European) slopes of Evolution Canyon over a six-year period from 2005-2011. Additionally, we examined seeds from areas contiguous to and distant from the part of the Canyon severely burned during the Carmel Fire of December 2010. Increased α-tocotrienol (pslope in contrast to the cooler 'European' slope, and 3) to propinquity to the fire. The study illustrates the role of α-tocotrienol in both chronic and acute temperature adaptation in wild barley and suggests future research into thermoregulatory mechanisms in plants. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

  14. Wild Allium species (Alliaceae used in folk medicine of Tajikistan and Uzbekistan

    Directory of Open Access Journals (Sweden)

    Kurbonova Parvina A

    2006-04-01

    Full Text Available Abstract Background Hitherto available sources from literature mentioned several wild growing Allium species as "edible" or "medicinally used" but without any further specification. Methods New data were gained during recent research missions: Allium plants were collected and shown to the local population which was asked for names and usage of these plants. Results Information was collected about current medical applications of sixteen wild species, nine of which belong to different sections of Allium subgenus Melanocrommyum. These plants are used against headache, cold, and stomach problems, and are mostly applied fresh or after boiling. Conclusion Close taxonomic relatives of the common onion were used similar to cultivated onion species, but medical use like garlic was mostly reported for species taxonomically not related to garlic.

  15. Ribosomal DNA variation in finger millet and wild species of Eleusine (Poaceae).

    Science.gov (United States)

    Hilu, K W; Johnson, J L

    1992-04-01

    Finger millet is an important cereal crop in the semi-arid regions of Africa and India. The crop belongs to the grass genus Eleusine, which includes nine annual and perennial species native to Africa except for the New World species E. tristachya. Ribosomal DNA (rDNA) variation in finger millet and related wild species was used to provide information on the origin of the genomes of this tetraploid crop and point out genetic relationships of the crop to other species in the genus. The restriction endonucleases used revealed a lack of variability in the rDNA spacer region in domesticated finger millet. All the rDNA variants of the crop were found in the proposed direct tetraploid ancestor, E. coracana subsp. africana. Wild and domesticated finger millet displayed the phenotypes found in diploid E. indica. Diploid Eleusine tristachya showed some similarity to the crop in some restriction sites. The remaining species were quite distinct in rDNA fragment patterns. The study supports the direct origin of finger millet from subspecies africana shows E. indica to be one of the genome donors of the crop, and demonstrates that none of the other species examined could have donated the second genome of the crop. The rDNA data raise the possibility that wild and domesticated finger millet could have originated as infraspecific polyploid hybrids from different varieties of E. indica.

  16. Karyotipic asymmetry of both wild and cultivated species of Pennisetum

    Directory of Open Access Journals (Sweden)

    Vânia Helena Techio

    2010-01-01

    Full Text Available This study aimed the establishment of the relation between karyotipic asymmetry values obtained for different accessions of both wild and cultivated species of Pennisetum from Germplasm Bank of Embrapa Gado de Leite/Juiz de Fora-Minas Gerais State, Brazil. Conventional cell cycle synchronization protocols and Feulgen staining method were used to obtain metaphases plates. The wild-type accessions corresponded to the species P. setosum (2n=6x=54, P. nervosum (2n=4x=36, and P. orientale (2n=4x=36, and the cultivated to P. purpureum (2n=4x=28 and P. glaucum (2n=2x=14. No significant difference was found for the total length of chromosomes (p>0.05 among the species. The analysis of intra-chromosomal asymmetry (A1 and inter-chromosomal asymmetry (A2 has shown that P. setosum has a tendency to chromosome asymmetry. P. nervosum, P. orientale, and P. purpureum have presented an intermediary level of asymmetry and P. glaucum, low asymmetry. Considering Stebbins criteria, the karyotype of P. glaucum and those from the three wild species fitted into the category 1A-symmetrical. With regard to P. purpureum, karyotypes of the accessions BAGs 54, 65 and 91 fitted into the category 2B and the other two genotypes (BAGs 63 and 75 fitted into the 1A. Comparison between the karyotype classification according to the inter- and intra-chromosomal asymmetry and Stebbins methodologies revealed that this last one alone was not able to detect small variations between karyotypes of the taxa closely related.

  17. Characterization of the Cultivable Gut Microflora in Wild-Caught 
Mediterranean Fish Species.

    Science.gov (United States)

    Jammal, Ahmad; Bariche, Michel; Zu Dohna, Heinrich; Kambris, Zakaria

    2017-05-01

    Microflora of the gastrointestinal tract plays important roles in food digestion, nutrient absorption and in host defense against ingested pathogens. Several studies have focused on the microflora of farmed fishes, but the gut flora of wild fishes remains poorly characterized. The aim of this work was to provide an overview of the bacteria colonizing the gut of wild-caught fishes and to determine whether some bacterial species can be pathogenic. We isolated cultivable bacteria from fifteen wild-caught Mediterranean fish species corresponding to different habitat, diet and origin. Bacterial species identity was determined by 16s rRNA gene sequencing for the 61 isolates. The potential pathogenicity of isolated bacteria was investigated using fruit fly (Drosophila melanogaster) and zebrafish (Danio rerio) as model organisms. Two bacterial strains (Serratia sp. and Aeromonas salmonicida) were lethal when microinjected to Drosophila, while zebrafish did not develop any disease when exposed to any of 34 isolated bacterial strains. However, it was interesting to note that two bacterial strains (Shewanella and Arthrobacter) isolated from marine fishes were able to colonize the guts of freshwater zebrafish. The results of this study give an overview of the bacterial species found in the guts of wild fishes living off Beirut seashore. It shows that some parameters believed to be limiting factors to host-gut colonization by bacteria can be overcome by some species. This pilot study could be extended by sampling a larger number of fish species with several specimens per fish species, and by identifying uncultivable bacteria that reside in the fish guts. Our results may have implications for the utilization of certain bacterial species in fish farming or their use as bio-indicators for water and/or food quality.

  18. Human impact on wild firewood species in the rural Andes community of Apillapampa, Bolivia.

    Science.gov (United States)

    Thomas, Evert; Douterlungne, David; Vandebroek, Ina; Heens, Frieke; Goetghebeur, Paul; Van Damme, Patrick

    2011-07-01

    Firewood is the basic fuel source in rural Bolivia. A study was conducted in an Andean village of subsistence farmers to investigate human impact on wild firewood species. A total of 114 different fuel species was inventoried during fieldtrips and transect sampling. Specific data on abundance and growth height of wild firewood species were collected in thirty-six transects of 50 ×2 m(2). Information on fuel uses of plants was obtained from 13 local Quechua key participants. To appraise the impact of fuel harvest, the extraction impact value (EIV) index was developed. This index takes into account local participants' appreciation of (1) decreasing plant abundance; (2) regeneration capacity of plants; (3) impact of root harvesting; and (4) quality of firewood. Results suggest that several (sub-)woody plant species are negatively affected by firewood harvesting. We found that anthropogenic pressure, expressed as EIV, covaried with density of firewood species, which could entail higher human pressure on more abundant and/or more accessible species. The apparent negative impact of anthropogenic pressure on populations of wild fuel species is corroborated by our finding that, in addition to altitude, several anthropogenic variables (i.e. site accessibility, cultivation of exotics and burning practices) explain part of the variation in height of firewood species in the surroundings of Apillapampa.

  19. Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bothmer, R. von; Claesson, L.; Flink, J.

    1989-01-01

    A crossing programme for trispecific hybridization including cultivated barely (Hordeum vulgare L.) as the third parent was carried out. The primary hybrids comprised 11 interspecific combinations, each of which had either H. jabatum or H. lechleri as one of the parents. The second parent...

  20. Monitoring potential geographical distribution of four wild bird species in China

    Science.gov (United States)

    Dai, S.; Feng, D.; Xu, B.

    2015-12-01

    The outbreak of highly pathogenic avian influenza (HPAI) of the H5N1 subtype in wild birds and poultry have caught worldwide attention. To explore the association between wild bird migration and avian influenza virus transmission, we monitored potential geographical distribution of four wild bird species that might carry the avian influenza viruses in China. They are Bar-headed geese (Anser indicus), Ruddy Shelduck (Tadorna ferruginea), Whooper Swan (Cygnus cygnus) and Black-headed Gull (Larus ridibundus). They served as major reservoir of the avian influenza viruses. We used bird watching records with the precise latitude/longitude coordinates from January 2002 to August 2014, and environmental variables with a pixel resolution of 5 km × 5 km from 2002 to 2014. The study utilized maximum entropy (MaxEnt) model based on ecological niche model approaches, and got the following results: 1) MaxEnt model have good discriminatory ability with the area under the curve (AUC) of the receiver operating curve (ROC) of 0.86-0.97; 2) The four wild bird species were estimated to concentrate in the North China Plain, the middle and lower region of the Yangtze River, Qinghai Lake, Tianshan Mountain and Tarim Basin, part of Tibet Plateau, and Hengduan Mountains; 3) Radiation and the minimum temperature were found to provide the most significant information. Our findings will help to understand the spread of avian influenza viruses by wild bird migration in China, which benefits for effective monitoring strategies and prevention measures.

  1. Diversity for seedling vigor in wild barley (hordeum vulgare L. subs. simpatina) germplasm

    International Nuclear Information System (INIS)

    Tyagi, K.; Park, M.R.; Lee, H.J.; Lee, C.A.; Rehman, S.; Steffenson, B.; Lee, K.J.; Yun, S.J.

    2011-01-01

    Seedling vigor is important for improving stand establishment of barley crops, particularly in arid regions and areas where the soil temperature is low at sowing time. Three hundred and fifteen wild barley accessions from the Wild Barley Diversity Collection (WBDC) were evaluated for nine seedling vigor traits in a poly house and growth chamber under hydroponic conditions. The accessions exhibited significant differences for all traits investigated. Traits showing greatest phenotypic variation were seedling visual score, plant height, shoot fresh weight, shoot dry weight and shoot length. Seed weight exhibited the least variation. Seed weight was significantly correlated with visual seedling score and shoot and seedling fresh and dry weight. Correlation analysis showed that the visual seedling score was a reliable method for estimating seedling vigor in wild barley. The first three principal components (PC) explained 82.3% of the variation present in the WBDC with PC1(54.0%) associated with shoot fresh weight, shoot dry weight, seedling dry weight, seedling fresh weight, shoot length and seedling length. Accessions from the southwest portion of the Fertile Crescent, like WBDC020 (Turkey), WBDC238 (Jordan) and WBDC244 (Jordan) exhibited the highest positive values for most of the plant vigor traits investigated. These wild barley accessions likely carry alleles that will be useful for the improvement of plant vigor traits in cultivated barley. (author)

  2. 78 FR 13694 - Conference of the Parties to the Convention on International Trade in Endangered Species of Wild...

    Science.gov (United States)

    2013-02-28

    ... Wild Fauna and Flora (CITES); Sixteenth Regular Meeting; Tentative U.S. Negotiating Positions for... Convention on International Trade in Endangered Species of Wild Fauna and Flora (CITES), will attend the... . SUPPLEMENTARY INFORMATION: Background The Convention on International Trade in Endangered Species of Wild Fauna...

  3. IDENTIFICATION AND OCCURRENCE OF FUSARIUM SPECIES ON SEEDS OF COMMON WETCH, WHITE LUPINE AND SOME WILD LEGUMES

    Directory of Open Access Journals (Sweden)

    Tihomir Miličević

    2013-06-01

    Full Text Available The presence and occurrence of Fusarium species was examined on the seeds of cultivated legumes – common vetch (Vicia sativa, white lupine (Lupinus albus, and wild legumes: bird’s-foot trefoil (Lotus corniculatus, wild alfalfa (Medicago sativa, black locust (Robinia pseudoacacia, honey locust (Gleditsia triacanthos, sweet clover (Melilotus officinalis, bird vetch (Vicia cracca and meadow vetchling (Lathyrus pratensis. Thirteen Fusarium species were identified - F. verticillioides, F. acuminatum, F. avenaceum, F. tricinctum F. oxysporum, F. scirpi, F. semitectum, F. culmorum, F. proliferatum, F. pseudograminearum, F. sporotrichioides, F. sambucinum and F. heterosporum. Species F. verticillioides and F. proliferatum were determined on seeds of the cultivated legumes (common vetch and white lupine. Other 11 Fusarium species were determined on seeds of wild legumes (bird’s-foot trefoil, wild alfalfa, sweet clover and bird vetch among which the most prevalent were species F. avenaceum and F. acuminatum.

  4. Molecular characterization of barley ( Hordeum vulgare L.) genome ...

    African Journals Online (AJOL)

    The present work aimed to select drought tolerant barley (Hordeum vulgare L.) cultivars through identification of stress genes responsible for drought tolerance. Several barley genotypes were tested for drought resistance using specific molecular markers, nine out of all the genotypes were chosen for this study; five out of ...

  5. Hordeum vulgare cysteine protease heterologous expressed in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    , (Hordeum vulgare) endoprotease B2 (HvEPB2) was cloned with and without the 5 amino acid C-terminal sequence into the Pichia pastoris expression vector pPICZ Aα and electrotransformed into Pichia pastoris strain SDM1163. Heterologous protein production was induced with 2% MeOH and the protein expression...

  6. OryzaGenome: Genome Diversity Database of Wild Oryza Species

    KAUST Repository

    Ohyanagi, Hajime

    2015-11-18

    The species in the genus Oryza, encompassing nine genome types and 23 species, are a rich genetic resource and may have applications in deeper genomic analyses aiming to understand the evolution of plant genomes. With the advancement of next-generation sequencing (NGS) technology, a flood of Oryza species reference genomes and genomic variation information has become available in recent years. This genomic information, combined with the comprehensive phenotypic information that we are accumulating in our Oryzabase, can serve as an excellent genotype-phenotype association resource for analyzing rice functional and structural evolution, and the associated diversity of the Oryza genus. Here we integrate our previous and future phenotypic/habitat information and newly determined genotype information into a united repository, named OryzaGenome, providing the variant information with hyperlinks to Oryzabase. The current version of OryzaGenome includes genotype information of 446 O. rufipogon accessions derived by imputation and of 17 accessions derived by imputation-free deep sequencing. Two variant viewers are implemented: SNP Viewer as a conventional genome browser interface and Variant Table as a textbased browser for precise inspection of each variant one by one. Portable VCF (variant call format) file or tabdelimited file download is also available. Following these SNP (single nucleotide polymorphism) data, reference pseudomolecules/ scaffolds/contigs and genome-wide variation information for almost all of the closely and distantly related wild Oryza species from the NIG Wild Rice Collection will be available in future releases. All of the resources can be accessed through http://viewer.shigen.info/oryzagenome/.

  7. Genetic diversity in barley landraces (Hordeum vulgare L. subsp.

    Indian Academy of Sciences (India)

    Genetic diversity in barley landraces (Hordeum vulgare L. subsp. vulgare) originated from Crescent Fertile region as detected by seed storage proteins. RIM MZID FARHAT CHIBANI RAYDA BEN AYED MOHSEN HANANA JOELLE BREIDI RABIH KABALAN SAMIH EL-HAJJ HASSAN MACHLAB AHMED REBAI LAMIS ...

  8. Estimating radionuclide transfer to wild species-data requirements and availability for terrestrial ecosystems

    International Nuclear Information System (INIS)

    Beresford, N A; Broadley, M R; Howard, B J; Barnett, C L; White, P J

    2004-01-01

    Assessment of the transfer of radionuclides to wild species is an important component in the estimation of predicted doses to biota. Reviews of available data for the many potential radionuclide-biota combinations which may be required for environmental assessments highlight many data gaps for terrestrial species. Here, we discuss different approaches which have been suggested to compensate for these data gaps. All of the reviewed approaches have merit; however, there is a requirement for transparency in methodology and data provenance which in some instances is currently missing. Furthermore, there is a need to validate the various methodologies to enable their use with confidence. The requirements of improving our ability to predict radionuclide transfer to wild species are discussed and recommendations made

  9. Babesia spp. in European wild ruminant species: parasite diversity and risk factors for infection.

    Science.gov (United States)

    Michel, Adam O; Mathis, Alexander; Ryser-Degiorgis, Marie-Pierre

    2014-06-13

    Babesia are tick-borne parasites that are increasingly considered as a threat to animal and public health. We aimed to assess the role of European free-ranging wild ruminants as maintenance mammalian hosts for Babesia species and to determine risk factors for infection. EDTA blood was collected from 222 roe deer (Capreolus c. capreolus), 231 red deer (Cervus e. elaphus), 267 Alpine chamois (Rupicapra r. rupicapra) and 264 Alpine ibex (Capra i. ibex) from all over Switzerland and analysed by PCR with pan-Babesia primers targeting the 18S rRNA gene, primers specific for B. capreoli and Babesia sp. EU1, and by sequencing. Babesia species, including B. divergens, B. capreoli, Babesia sp. EU1, Babesia sp. CH1 and B. motasi, were detected in 10.7% of all samples. Five individuals were co-infected with two Babesia species. Infection with specific Babesia varied widely between host species. Cervidae were significantly more infected with Babesia spp. than Caprinae. Babesia capreoli and Babesia sp. EU1 were mostly found in roe deer (prevalences 17.1% and 7.7%, respectively) and B. divergens and Babesia sp. CH1 only in red deer. Factors significantly associated with infection were low altitude and young age. Identification of Babesia sp. CH1 in red deer, co-infection with multiple Babesia species and infection of wild Caprinae with B. motasi and Babesia sp. EU1 are novel findings. We propose wild Caprinae as spillover or accidental hosts for Babesia species but wild Cervidae as mammalian reservoir hosts for B. capreoli, possibly Babesia sp. EU1 and Babesia sp. CH1, whereas their role regarding B. divergens is more elusive.

  10. Introduction of wild MAP species into the field culture

    Directory of Open Access Journals (Sweden)

    Dušková, Elena

    2016-07-01

    Full Text Available Althea officinalis L., Dracocephalum moldavica L., Gentiana lutea L., Rhodiola rosea L., and Valeriana officinalis L. are the species of wild medicinal plants which are not very commonly grown in field culture. The methods and practical experiences of their multiplication and growing in a field nursery in Olomouc (the Czech Republic are explained and shown in the manuscript.

  11. Fatty Acid Compositions of Six Wild Edible Mushroom Species

    Science.gov (United States)

    Günç Ergönül, Pelin; Akata, Ilgaz; Kalyoncu, Fatih; Ergönül, Bülent

    2013-01-01

    The fatty acids of six wild edible mushroom species (Boletus reticulatus, Flammulina velutipes var. velutipes, Lactarius salmonicolor, Pleurotus ostreatus, Polyporus squamosus, and Russula anthracina) collected from different regions from Anatolia were determined. The fatty acids were identified and quantified by gas chromatography and studied using fruit bodies. Fatty acid composition varied among species. The dominant fatty acid in fruit bodies of all mushrooms was cis-linoleic acid (18 : 2). Percentage of cis-linoleic acid in species varied from 22.39% to 65.29%. The other major fatty acids were, respectively, cis-oleic, palmitic, and stearic acids. Fatty acids analysis of the mushrooms showed that the unsaturated fatty acids were at higher concentrations than saturated fatty acids. PMID:23844377

  12. Fatty Acid Compositions of Six Wild Edible Mushroom Species

    Directory of Open Access Journals (Sweden)

    Pelin Günç Ergönül

    2013-01-01

    Full Text Available The fatty acids of six wild edible mushroom species (Boletus reticulatus, Flammulina velutipes var. velutipes, Lactarius salmonicolor, Pleurotus ostreatus, Polyporus squamosus, and Russula anthracina collected from different regions from Anatolia were determined. The fatty acids were identified and quantified by gas chromatography and studied using fruit bodies. Fatty acid composition varied among species. The dominant fatty acid in fruit bodies of all mushrooms was cis-linoleic acid (18 : 2. Percentage of cis-linoleic acid in species varied from 22.39% to 65.29%. The other major fatty acids were, respectively, cis-oleic, palmitic, and stearic acids. Fatty acids analysis of the mushrooms showed that the unsaturated fatty acids were at higher concentrations than saturated fatty acids.

  13. Observation of Wild Seaweed Species in Labuhanbua Waters, Indonesia: a preliminary assessment for aquaculture development

    Directory of Open Access Journals (Sweden)

    Erlania .

    2017-05-01

    Full Text Available Seaweed industry has been growing up and is supplied by either wild or cultivated seaweed crops. This study was aimed to present relevant information regarding ecological availability of wild seaweed in Labuhanbua coastal waters, Sumbawa Regency, West Nusa Tenggara and potential use of important species as candidate species for aquaculture. 46 sampling stations were determined along line transects perpendicular to coastal line; and seaweeds sampling were conducted during low tide by using 1 x 1 m2 quadrat transect. Field data consist of in-situ parameter including number of seaweed species and coverage area of each species; and ex-situ parameters consist of carbohydrate, protein, total C, total N, and total P content of seaweeds. The results showed that 33 species were found and three species has the most widely distribu tion, i.e. Padina sp., Dictyota dichotoma, and Gracilaria salicornia. Turbinaria, Dictyota, Padina, Stoechospermum, Hydroclathrus, Halimeda, and Chaetomorpha might be some important species that could be develop as aquaculture species candidates among other uncultivated species that were found along this study location. They have potencies as human food, livestock feed, neutraceuicals, cosmetics, pulp, textile, biofuel and any other industries; but conversely, they were found in lower density at Labuhanbua coastal waters. These species should be develop through aquaculture technology, involve genetic improvement and possibly genetic engineering. Commercial scale cultivation of those important seaweed species will contribute to industrial needs and prevent decreasing of wild seaweed availability in natural ecosystem.

  14. Convention on International Trade in Endangered Species of Wild Fauna and Flora.

    Science.gov (United States)

    Supplement to IUCN Bulletin, 1973

    1973-01-01

    Concern for the endangered species of wild animals and plants of the world prompted the drafting of this international convention regulating the import, export, and re-export of such species. Nations signing this document are required to impose strict controls on the international trade of these plants and animals or their recognizable parts. The…

  15. Evaluation of genetic diversity in barley (Hordeum vulgare L.) from ...

    African Journals Online (AJOL)

    User

    2015-06-03

    Jun 3, 2015 ... were kernel weight per spike and thousand seed weight. ...... Ser. Biol. 17:65-70. CSA (2010) Area and production of crops (private peasant holdings, ... (Hordeum vulgare L.) landraces in variable production system,. Ethiopia.

  16. Chemical, Bioactive, and Antioxidant Potential of Twenty Wild Culinary Mushroom Species

    OpenAIRE

    Sharma, S. K.; Gautam, N.

    2015-01-01

    The chemical, bioactive, and antioxidant potential of twenty wild culinary mushroom species being consumed by the people of northern Himalayan regions has been evaluated for the first time in the present study. Nutrients analyzed include protein, crude fat, fibres, carbohydrates, and monosaccharides. Besides, preliminary study on the detection of toxic compounds was done on these species. Bioactive compounds evaluated are fatty acids, amino acids, tocopherol content, carotenoids (β-carotene, ...

  17. Genomic restructuring in Hordeum chilense durum wheat hybrids ...

    Indian Academy of Sciences (India)

    ANDREIA DELGADO

    4John Innes Centre, Norwich Research Park, Norwich NR4 7UH, UK. 5Departament of Genetics and Biotechnology, University of Tras-os-Montes and Alto ... [Delgado A., Carvalho A., Martín A. C., Martín A. and Lima-Brito J. 2017 Genomic restructuring in F1 Hordeum chilense × durum ...... Academic Press, Burlington,.

  18. Drought Tolerance of Wild and Cultivated Species of Safflower and Assessment of Morphological Variation

    Directory of Open Access Journals (Sweden)

    R Shiravand

    2015-04-01

    Full Text Available Wild species of crop plants carry useful genes which can be used for breeding programs. This study was performed to investigate genetic variation of 46 genotypes from five Carthamus species and to evaluate their drought tolerance under field conditions (normal and deficit moisture environments during 2011at Isfahan university of technology research farm. Results indicated that safflower species had different response to drought stress. Results showed that drought stress significantly reduced seed yield in C. tinctorius and C. palaestinus. The wild species of C. palaestinus had higher seed yield, its component and oil percent compared other species in both moisture conditions. Drought tolerance indice (STI showed that C. palaestinus had the highest drought tolerance. Cluster analysis based on agro-morphological traits indicated that three species C. tinctorius, C palaestinu and C. oxyacanthus had the most similarity among studied species. Finally in respect to high hybridization of two main safflower relatives C. palaestinus (because high STI and C. oxyacanthus (because high stability under drought condition are suitable source for transferring drought tolerance genes to cultivated species.

  19. Free proline accumulation in leaves of cultivated plant species under water deficit conditions

    Directory of Open Access Journals (Sweden)

    Hanna Bandurska

    2013-12-01

    Full Text Available The effect of water deficit caused by soil drought on the content of free proline as well as the degree of cell membrane damages in the leaves of three cultivated plant species having different farm usefulness and water requirements have been studied. The used pIants were: poinsettia (Euphorbia pulcherrima Willd., 'Regina' and 'Cortez' grown for decorative purposes, a green vegetable of broccoli (Brassica oleracea var. botrytis, subvar. cymosa, 'Colonel' and 'Marathon' and a cereal plant of barley (the wild form Hordeum spontaneumm and Hordeum vulgaree 'Maresi'. The examined species differed in the size of the experienced stress. the Iargest RWC reduction was found iii broccoli leaves, while somewhat smaller - in barley. In poinsettia leaves, the reduction of RWC level was not large or did not occur at all. The accumulation of free proline in the species under study was also variable. The largest amount of this amino acid tended to accumulate in broccoli leaves, whereas the increase of its level took place only at a strong dehydration of tissues. The increase of proline level was smaller in barley leaves than in broccoli, but that was found already at a smalI dehydration of tissues. In poinsettia leaves, a several f`old increase of proline level was found at the early stage of the stress. The level of that amino acid gradually increased at consecutive times and did not depend on tissue dehydration. Damage of cell membranes amounted to 8.5-9.5% in barley leaves, about 3% in brocolli and to 0-2.6% in poinsettia. The role of proline in prevention of leaf dehydration and in alleviation of dehydration effects in the studied species has been discussed.

  20. Species diversity and richness of wild birds in Dagona-Waterfowl ...

    African Journals Online (AJOL)

    The study of bird species diversity and richness in Dagona-Waterfowl Sanctuary was carried out during the midst of both early wet and late dry seasons, to provide comprehensive data on wild birds. Dagona Sanctuary is located within the Bade-Nguru Wetland sector. It is one of the important bird areas marked for the ...

  1. A walk on the wild side: Oryza species as source for rice abiotic stress tolerance.

    Science.gov (United States)

    Menguer, Paloma Koprovski; Sperotto, Raul Antonio; Ricachenevsky, Felipe Klein

    2017-01-01

    Oryza sativa, the common cultivated rice, is one of the most important crops for human consumption, but production is increasingly threatened by abiotic stresses. Although many efforts have resulted in breeding rice cultivars that are relatively tolerant to their local environments, climate changes and population increase are expected to soon call for new, fast generation of stress tolerant rice germplasm, and current within-species rice diversity might not be enough to overcome such needs. The Oryza genus contains other 23 wild species, with only Oryza glaberrima being also domesticated. Rice domestication was performed with a narrow genetic diversity, and the other Oryza species are a virtually untapped genetic resource for rice stress tolerance improvement. Here we review the origin of domesticated Oryza sativa from wild progenitors, the ecological and genomic diversity of the Oryza genus, and the stress tolerance variation observed for wild Oryza species, including the genetic basis underlying the tolerance mechanisms found. The summary provided here is important to indicate how we should move forward to unlock the full potential of these germplasms for rice improvement.

  2. Allelic variation, alternative splicing and expression analysis of Psy1 gene in Hordeum chilense Roem. et Schult.

    Directory of Open Access Journals (Sweden)

    Cristina Rodríguez-Suárez

    Full Text Available BACKGROUND: The wild barley Hordeum chilense Roem. et Schult. is a valuable source of genes for increasing carotenoid content in wheat. Tritordeums, the amphiploids derived from durum or common wheat and H. chilense, systematically show higher values of yellow pigment colour and carotenoid content than durum wheat. Phytoene synthase 1 gene (Psy1 is considered a key step limiting the carotenoid biosynthesis, and the correlation of Psy1 transcripts accumulation and endosperm carotenoid content has been demonstrated in the main grass species. METHODOLOGY/PRINCIPAL FINDINGS: We analyze the variability of Psy1 alleles in three lines of H. chilense (H1, H7 and H16 representing the three ecotypes described in this species. Moreover, we analyze Psy1 expression in leaves and in two seed developing stages of H1 and H7, showing mRNA accumulation patterns similar to those of wheat. Finally, we identify thirty-six different transcripts forms originated by alternative splicing of the 5' UTR and/or exons 1 to 5 of Psy1 gene. Transcripts function is tested in a heterologous complementation assay, revealing that from the sixteen different predicted proteins only four types (those of 432, 370, 364 and 271 amino acids, are functional in the bacterial system. CONCLUSIONS/SIGNIFICANCE: The large number of transcripts originated by alternative splicing of Psy1, and the coexistence of functional and non functional forms, suggest a fine regulation of PSY activity in H. chilense. This work is the first analysis of H. chilense Psy1 gene and the results reported here are the bases for its potential use in carotenoid enhancement in durum wheat.

  3. Giemsa C-banded karyotypes of Hordeum taxa from North America

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.

    1986-01-01

    submetacentrics than previously reported in Hordeum distinguished the genomes of H. arizonicum and H. brachyantherum (4x) from Newfoundland. A partial inactivation of the nucleolus organizers of one parental genome in interspecific hybrids is considered more common than generally appreciated....

  4. Variation in the leaf sodium content of the Hordeum vulgare (barley) cultivar Maythorpe and its derived mutant cv. Golden Promise

    International Nuclear Information System (INIS)

    Forster, B.P.; Pakniyat, H.; Macaulay, M.; Matheson, W.; Phillips, M.S.; Thomas, W.T.B.; Powell, W.

    1994-01-01

    Tests for shoot and root sodium content were carried out on various barley cultivars (Hordeum vulgare) and experimental lines including wild barley (H. spontaneum) and derivatives. Lines were grown in hydroculture with and without the addition of salt (NaCl), and sodium concentrations in shoots and roots were determined. Variation in shoot sodium content was found between the various lines; in contrast, no significant differences were found between the lines tested for root sodium content. The most significant finding was the variation in shoot sodium content between the two cultivars Golden Promise and Maythorpe. Golden Promise is a direct gamma-ray induced mutant of the cultivar Maythorpe and the reduced shoot sodium content of Golden Promise can be attributed to radiation treatment. (author)

  5. Genetic analysis on the competitive ability of barley ( Hordeum ...

    African Journals Online (AJOL)

    Genetic analysis on the competitive ability of barley ( Hordeum vulgare L.) recombinant inbred lines intercropped with oat ( Avena sativa L.) weeds. ... Furthermore, the commonly used herbicide price is soaring from time to time and out of the reach of the poor farmers in the developing countries. Therefore, this method is an ...

  6. Prevalence of Chlamydia psittaci and Other Chlamydia Species in Wild Birds in Poland.

    Science.gov (United States)

    Krawiec, Marta; Piasecki, Tomasz; Wieliczko, Alina

    2015-11-01

    Avian chlamydiosis is a zoonotic disease occurring in humans, poultry, and exotic birds. It has been suggested that some wild bird species play an important role as reservoirs for Chlamydia, especially Chlamydia psittaci. Whereas C. psittaci is the predominant chlamydial agent in birds, in the present study we have determined the prevalence of different species of Chlamydia among selected wild bird species in Poland using a rapid and sensitive real-time PCR method. In total, 369 free-living birds from 35 bird species and 15 orders were examined. Samples from 27 birds (7.3%) were positive for chlamydial DNA in the PCR; 22 positive samples (81.5%) belonged to C. psittaci, three to Chlamydia trachomatis (11.1%), and two (7.4%) classified only to the genus Chlamydia. Most of C. psittaci-positive samples belonged to five orders: Anseriformes, Columbiformes, Gruiformes, Phasianiformes, and Passeriformes. All C. trachomatis samples were obtained from Eurasian coots (Gruiformes). Two Chlamydia-positive samples not classified to any Chlamydia species were obtained from a common wood pigeon (Columbiformes) and a common buzzard (Accipitriformes). Detection of C. psittaci and C. trachomatis in free-living bird populations force to think on significance of birds as reservoir of varied Chlamydia species and their epidemiological importance.

  7. Evaluation of genetic diversity in barley ( Hordeum vulgare L.) from ...

    African Journals Online (AJOL)

    This study aimed to determine the genetic diversity and relationships among barley varieties (Hordeum vulgare L.) growing at Wollo Highland areas by using hordein and agro-morphological traits. Twenty (20) varieties were laid down in randomized complete block design (RCBD) design with three replications; they were ...

  8. Evidence of cryptic introgression in tomato (Solanum lycopersicum L.) based on wild tomato species alleles.

    Science.gov (United States)

    Labate, Joanne A; Robertson, Larry D

    2012-08-07

    Many highly beneficial traits (e.g. disease or abiotic stress resistance) have been transferred into crops through crosses with their wild relatives. The 13 recognized species of tomato (Solanum section Lycopersicon) are closely related to each other and wild species genes have been extensively used for improvement of the crop, Solanum lycopersicum L. In addition, the lack of geographical barriers has permitted natural hybridization between S. lycopersicum and its closest wild relative Solanum pimpinellifolium in Ecuador, Peru and northern Chile. In order to better understand patterns of S. lycopersicum diversity, we sequenced 47 markers ranging in length from 130 to 1200 bp (total of 24 kb) in genotypes of S. lycopersicum and wild tomato species S. pimpinellifolium, Solanum arcanum, Solanum peruvianum, Solanum pennellii and Solanum habrochaites. Between six and twelve genotypes were comparatively analyzed per marker. Several of the markers had previously been hypothesized as carrying wild species alleles within S. lycopersicum, i.e., cryptic introgressions. Each marker was mapped with high confidence (etomato whole genome shotgun chromosomes (SL2.40) database. Neighbor-joining trees showed high mean bootstrap support (86.8 ± 2.34%) for distinguishing red-fruited from green-fruited taxa for 38 of the markers. Hybridization and parsimony splits networks, genomic map positions of markers relative to documented introgressions, and historical origins of accessions were used to interpret evolutionary patterns at nine markers with putatively introgressed alleles. Of the 47 genetic markers surveyed in this study, four were involved in linkage drag on chromosome 9 during introgression breeding, while alleles at five markers apparently originated from natural hybridization with S. pimpinellifolium and were associated with primitive genotypes of S. lycopersicum. The positive identification of introgressed genes within crop species such as S. lycopersicum will help

  9. EVALUATION OF THREE WILD SPECIES OF ALMOND ON THE BASIS OF THEIR MORPHOLOGICAL CHARACTERS

    Directory of Open Access Journals (Sweden)

    B BANINASAB

    2007-07-01

    Full Text Available Due to the suitable climatic conditions, Iran is one of the most important growing centre for wild and domesticated species/varieties of almond. Because of the adaptability of wild almond species to severe environmental conditions and resistance to drought, salinity and some pest and diseases, these can be used as rootstock for almond cultivars and in breeding programs for rootstock improvement in Iran. In this study, seeds of Amygdalous scoparia, A.webbii and A. orientalis were planted. The analysis of variance showed a significant difference between species. However, A. scoparia had highest stem height and leaf length. At the end of the experiment, the thickest stems were developed by A. scoparia, whereas the thinnest stems by A. orientalis. A. webbii produced more number and longer roots per seedling than the other two species. The correlation between various morphological traits showed that a few shoot characters were significantly correlated with root traits. However, leaf length, leaf width, leaf area, root number and root diameter for P. webbii, and leaf number, leaf length, leaf width, petiole length and root number characters for P.scoparia, and stem height, leaf number, leaf length, petiole length, internode length and root number for P. orientalis were found to be important morphological traits to evaluate seedling charactristics of wild almond genotypes before their nursery test.

  10. Population Dynamics Among six Major Groups of the Oryza rufipogon Species Complex, Wild Relative of Cultivated Asian Rice.

    Science.gov (United States)

    Kim, HyunJung; Jung, Janelle; Singh, Namrata; Greenberg, Anthony; Doyle, Jeff J; Tyagi, Wricha; Chung, Jong-Wook; Kimball, Jennifer; Hamilton, Ruaraidh Sackville; McCouch, Susan R

    2016-12-01

    Understanding population structure of the wild progenitor of Asian cultivated rice (O. sativa), the Oryza rufipogon species complex (ORSC), is of interest to plant breeders and contributes to our understanding of rice domestication. A collection of 286 diverse ORSC accessions was evaluated for nuclear variation using genotyping-by-sequencing (113,739 SNPs) and for chloroplast variation using Sanger sequencing (25 polymorphic sites). Six wild subpopulations were identified, with 25 % of accessions classified as admixed. Three of the wild groups were genetically and geographically closely related to the O. sativa subpopulations, indica, aus and japonica, and carried O. sativa introgressions; the other three wild groups were genetically divergent, had unique chloroplast haplotypes, and were located at the geographical extremes of the species range. The genetic subpopulations were significantly correlated (r 2  = 0.562) with traditional species designations, O. rufipogon (perennial) and O. nivara (annual), differentiated based on morphology and life history. A wild diversity panel of 95 purified (inbred) accessions was developed for future genetic studies. Our results suggest that the cultivated aus subpopulation is most closely related to an annual wild relative, japonica to a perennial wild relative, and indica to an admixed population of diverse annual and perennial wild ancestors. Gene flow between ORSC and O. sativa is common in regions where rice is cultivated, threatening the identity and diversity of wild ORSC populations. The three geographically isolated ORSC populations harbor variation rarely seen in cultivated rice and provide a unique window into the genetic composition of ancient rice subpopulations.

  11. A survey of wild plant species for food use in Sicily (Italy) - results of a 3-year study in four Regional Parks.

    Science.gov (United States)

    Licata, Mario; Tuttolomondo, Teresa; Leto, Claudio; Virga, Giuseppe; Bonsangue, Giuseppe; Cammalleri, Ignazio; Gennaro, Maria Cristina; La Bella, Salvatore

    2016-02-09

    This paper illustrates the results of a study carried out in four Regional Parks of Sicily (Italy), concerning traditional knowledge on food use of wild plant species. The main aims of the paper were: (i) to verify which wild plant species are used for food purpose in the local culture based on information provided by elderly inhabitants (ii) to verify the presence of wild plant species which have not been cited for food use in previous studies in the Mediterranean area (iii) to determine how many of the most frequently cited wild plant species are cultivated by the local population in the four Sicilian Parks. Semi-structured interviews were carried out in the local communities of the four Regional Parks between 2007 and 2010. A total of 802 people over the age of 60 were interviewed. Cultural Importance Index was used to evaluate the level of importance given to any wild plant species as a food in the local culture. The level of appreciation of the wild plant species and the possible effects of wild plants on human health were also investigated. Local communities currently use a total number of 119 wild species for food purposes. Asteraceae and Brassicaceae were the most represented botanical families. In each of the four Sicilian Parks, Cichorium intybus L. and Foeniculum vulgare Mill. obtained the highest Cultural Importance Index values. Sixty-four species were indicated as also having medicinal properties. Leaves and other aerial plant parts were the parts most-used for the preparation of traditional recipes. The research shows that the level of traditional knowledge on the food uses of wild plant species in the study area is poor. The food uses of plants which are most likely to survive over time are those at the interface of food and medicine. Further agronomic studies are needed for a number of species with a view to introducing them as a crop into non-intensive agricultural systems.

  12. Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis

    DEFF Research Database (Denmark)

    Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1984-01-01

    The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...

  13. Culicoides Species Communities Associated with Wild Ruminant Ecosystems in Spain: Tracking the Way to Determine Potential Bridge Vectors for Arboviruses.

    Directory of Open Access Journals (Sweden)

    Sandra Talavera

    Full Text Available The genus Culicoides Latreille 1809 is a well-known vector for protozoa, filarial worms and, above all, numerous viruses. The Bluetongue virus (BTV and the recently emerged Schmallenberg virus (SBV are responsible for important infectious, non-contagious, insect-borne viral diseases found in domestic ruminants and transmitted by Culicoides spp. Both of these diseases have been detected in wild ruminants, but their role as reservoirs during the vector-free season still remains relatively unknown. In fact, we tend to ignore the possibility of wild ruminants acting as a source of disease (BTV, SBV and permitting its reintroduction to domestic ruminants during the following vector season. In this context, a knowledge of the composition of the Culicoides species communities that inhabit areas where there are wild ruminants is of major importance as the presence of a vector species is a prerequisite for disease transmission. In this study, samplings were conducted in areas inhabited by different wild ruminant species; samples were taken in both 2009 and 2010, on a monthly basis, during the peak season for midge activity (in summer and autumn. A total of 102,693 specimens of 40 different species of the genus Culicoides were trapped; these included major BTV and SBV vector species. The most abundant vector species were C. imicola and species of the Obsoletus group, which represented 15% and 11% of total numbers of specimens, respectively. At the local scale, the presence of major BTV and SBV vector species in areas with wild ruminants coincided with that of the nearest sentinel farms included in the Spanish Bluetongue Entomological Surveillance Programme, although their relative abundance varied. The data suggest that such species do not exhibit strong host specificity towards either domestic or wild ruminants and that they could consequently play a prominent role as bridge vectors for different pathogens between both types of ruminants. This finding

  14. Community and species-specific responses of wild bees to insect pest control programs applied to a pollinator-dependent crop.

    Science.gov (United States)

    Tuell, Julianna K; Isaacs, Rufus

    2010-06-01

    Wild bee conservation is regarded as essential for sustainable production of pollinator-dependent crops, yet little is known about the effects on wild bee communities of typical insect pest management programs used postbloom. We developed an insecticide program risk (IPR) index to quantify the relative risk to wild bees of insecticide programs applied to blueberry fields. This was used to determine the relationship between IPR and the abundance, diversity, and richness of wild bee communities sampled during three successive flowering seasons. In 2 of 3 yr, bee abundance and species richness declined with increasing IPR. Bee diversity declined with IPR in one of 3 yr. These results indicate that wild bee communities are negatively affected by increasingly intensive chemical pest management activities in crop fields and that interyear variability in bee populations has the potential to mask such effects in short-term studies. When several wild bee species were analyzed separately, two of three solitary and one of three social blueberry-foraging species declined with increasing IPR values, suggesting that different life histories and nesting habits may help some bee populations escape the negative effects of insecticides applied after bloom. Pollinator conservation programs aimed strictly at reducing insecticide use may have varying success, depending on the biology of the target bee species. The IPR index provides a standard method to compare pest management programs for their potential effect on wild bee communities, with broad application for use in other agricultural systems.

  15. Chemical, Bioactive, and Antioxidant Potential of Twenty Wild Culinary Mushroom Species

    Science.gov (United States)

    Sharma, S. K.; Gautam, N.

    2015-01-01

    The chemical, bioactive, and antioxidant potential of twenty wild culinary mushroom species being consumed by the people of northern Himalayan regions has been evaluated for the first time in the present study. Nutrients analyzed include protein, crude fat, fibres, carbohydrates, and monosaccharides. Besides, preliminary study on the detection of toxic compounds was done on these species. Bioactive compounds evaluated are fatty acids, amino acids, tocopherol content, carotenoids (β-carotene, lycopene), flavonoids, ascorbic acid, and anthocyanidins. Fruitbodies extract of all the species was tested for different types of antioxidant assays. Although differences were observed in the net values of individual species all the species were found to be rich in protein, and carbohydrates and low in fat. Glucose was found to be the major monosaccharide. Predominance of UFA (65–70%) over SFA (30–35%) was observed in all the species with considerable amounts of other bioactive compounds. All the species showed higher effectiveness for antioxidant capacities. PMID:26199938

  16. Chemical, Bioactive, and Antioxidant Potential of Twenty Wild Culinary Mushroom Species

    Directory of Open Access Journals (Sweden)

    S. K. Sharma

    2015-01-01

    Full Text Available The chemical, bioactive, and antioxidant potential of twenty wild culinary mushroom species being consumed by the people of northern Himalayan regions has been evaluated for the first time in the present study. Nutrients analyzed include protein, crude fat, fibres, carbohydrates, and monosaccharides. Besides, preliminary study on the detection of toxic compounds was done on these species. Bioactive compounds evaluated are fatty acids, amino acids, tocopherol content, carotenoids (β-carotene, lycopene, flavonoids, ascorbic acid, and anthocyanidins. Fruitbodies extract of all the species was tested for different types of antioxidant assays. Although differences were observed in the net values of individual species all the species were found to be rich in protein, and carbohydrates and low in fat. Glucose was found to be the major monosaccharide. Predominance of UFA (65–70% over SFA (30–35% was observed in all the species with considerable amounts of other bioactive compounds. All the species showed higher effectiveness for antioxidant capacities.

  17. Chemical, Bioactive, and Antioxidant Potential of Twenty Wild Culinary Mushroom Species.

    Science.gov (United States)

    Sharma, S K; Gautam, N

    2015-01-01

    The chemical, bioactive, and antioxidant potential of twenty wild culinary mushroom species being consumed by the people of northern Himalayan regions has been evaluated for the first time in the present study. Nutrients analyzed include protein, crude fat, fibres, carbohydrates, and monosaccharides. Besides, preliminary study on the detection of toxic compounds was done on these species. Bioactive compounds evaluated are fatty acids, amino acids, tocopherol content, carotenoids (β-carotene, lycopene), flavonoids, ascorbic acid, and anthocyanidins. Fruitbodies extract of all the species was tested for different types of antioxidant assays. Although differences were observed in the net values of individual species all the species were found to be rich in protein, and carbohydrates and low in fat. Glucose was found to be the major monosaccharide. Predominance of UFA (65-70%) over SFA (30-35%) was observed in all the species with considerable amounts of other bioactive compounds. All the species showed higher effectiveness for antioxidant capacities.

  18. Detection and molecular characterization of feline hemoplasmas in wild felid species in Iran in the Middle East.

    Science.gov (United States)

    Ghazisaeedi, Fereshteh; Atyabi, Nahid; Zahraei Salehi, Taghi; Tabatabaei, Saeid; Ashrafi Tamai, Iraj; Memarian, Iman; Tasker, Séverine

    2017-10-01

    Three feline hemoplasma species exist in felids: Mycoplasma haemofelis, 'Candidatus Mycoplasma haemominutum', and 'Candidatus Mycoplasma turicensis'. The aims of the study were to determine the presence of, and molecularly characterize, any hemoplasmas in wild felids, including the endangered Persian leopard in Iran, the Middle East. Blood samples were collected from 19 wild felids, including three Persian leopards. Using species-specific hemoplasma PCRs and ELISA serological testing for feline leukaemia virus and feline immunodeficiency virus (FIV), two Persian leopards were found to be infected with 'Ca. M. haemominutum' and were seropositive for FIV. Partial 16S rRNA gene sequences were generated for these 'Ca. M. haemominutum' species and subsequent phylogenetic analysis revealed 97.70% to 99.45% sequence identity with those found in domestic cats from Iran and other countries. This study confirms the presence of 'Ca. M. haemominutum' and concurrent FIV antibody in wild felids in Iran. This represents the first report of hemoplasma in wild felids in the Middle East as well as the first report of infection in Persian leopards. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Differential iridoid production as revealed by a diversity panel of 84 cultivated and wild blueberry species.

    Directory of Open Access Journals (Sweden)

    Courtney P Leisner

    Full Text Available Cultivated blueberry (Vaccinium corymbosum, Vaccinium angustifolium, Vaccinium darrowii, and Vaccinium virgatum is an economically important fruit crop native to North America and a member of the Ericaceae family. Several species in the Ericaceae family including cranberry, lignonberry, bilberry, and neotropical blueberry species have been shown to produce iridoids, a class of pharmacologically important compounds present in over 15 plant families demonstrated to have a wide range of biological activities in humans including anti-cancer, anti-bacterial, and anti-inflammatory. While the antioxidant capacity of cultivated blueberry has been well studied, surveys of iridoid production in blueberry have been restricted to fruit of a very limited number of accessions of V. corymbosum, V. angustifolium and V. virgatum; none of these analyses have detected iridoids. To provide a broader survey of iridoid biosynthesis in cultivated blueberry, we constructed a panel of 84 accessions representing a wide range of cultivated market classes, as well as wild blueberry species, and surveyed these for the presence of iridoids. We identified the iridoid glycoside monotropein in fruits and leaves of all 13 wild Vaccinium species, yet only five of the 71 cultivars. Monotropein positive cultivars all had recent introgressions from wild species, suggesting that iridoid production can be targeted through breeding efforts that incorporate wild germplasm. A series of diverse developmental tissues was also surveyed in the diversity panel, demonstrating a wide range in iridoid content across tissues. Taken together, this data provides the foundation to dissect the molecular and genetic basis of iridoid production in blueberry.

  20. Differential iridoid production as revealed by a diversity panel of 84 cultivated and wild blueberry species.

    Science.gov (United States)

    Leisner, Courtney P; Kamileen, Mohamed O; Conway, Megan E; O'Connor, Sarah E; Buell, C Robin

    2017-01-01

    Cultivated blueberry (Vaccinium corymbosum, Vaccinium angustifolium, Vaccinium darrowii, and Vaccinium virgatum) is an economically important fruit crop native to North America and a member of the Ericaceae family. Several species in the Ericaceae family including cranberry, lignonberry, bilberry, and neotropical blueberry species have been shown to produce iridoids, a class of pharmacologically important compounds present in over 15 plant families demonstrated to have a wide range of biological activities in humans including anti-cancer, anti-bacterial, and anti-inflammatory. While the antioxidant capacity of cultivated blueberry has been well studied, surveys of iridoid production in blueberry have been restricted to fruit of a very limited number of accessions of V. corymbosum, V. angustifolium and V. virgatum; none of these analyses have detected iridoids. To provide a broader survey of iridoid biosynthesis in cultivated blueberry, we constructed a panel of 84 accessions representing a wide range of cultivated market classes, as well as wild blueberry species, and surveyed these for the presence of iridoids. We identified the iridoid glycoside monotropein in fruits and leaves of all 13 wild Vaccinium species, yet only five of the 71 cultivars. Monotropein positive cultivars all had recent introgressions from wild species, suggesting that iridoid production can be targeted through breeding efforts that incorporate wild germplasm. A series of diverse developmental tissues was also surveyed in the diversity panel, demonstrating a wide range in iridoid content across tissues. Taken together, this data provides the foundation to dissect the molecular and genetic basis of iridoid production in blueberry.

  1. Abnormal germling development by brown rust and powdery mildew on cer barley mutants

    NARCIS (Netherlands)

    Rubiales, D.; Ramirez, M.C.; Carver, T.L.W.; Niks, R.E.

    2001-01-01

    The barley leaf rust fungus forms appressoria over host leaf stomata and penetrates via the stomatal pore. High levels of avoidance to leaf rust fungi have been described in some wild accessions of Hordeum species where a prominent wax layer on the stomata inhibits triggering of fungal appressorium

  2. Wildly Growing Asparagus (Asparagus officinalis L.) Hosts Pathogenic Fusarium Species and Accumulates Their Mycotoxins.

    Science.gov (United States)

    Stępień, Łukasz; Waśkiewicz, Agnieszka; Urbaniak, Monika

    2016-05-01

    Asparagus officinalis L. is an important crop in many European countries, likely infected by a number of Fusarium species. Most of them produce mycotoxins in plant tissues, thus affecting the physiology of the host plant. However, there is lack of information on Fusarium communities in wild asparagus, where they would definitely have considerable environmental significance. Therefore, the main scientific aim of this study was to identify the Fusarium species and quantify their typical mycotoxins present in wild asparagus plants collected at four time points of the season. Forty-four Fusarium strains of eight species--Fusarium acuminatum, Fusarium avenaceum, Fusarium culmorum, Fusarium equiseti, Fusarium oxysporum, Fusarium proliferatum, Fusarium sporotrichioides, and Fusarium tricinctum--were isolated from nine wild asparagus plants in 2013 season. It is the first report of F. sporotrichioides isolated from this particular host. Fumonisin B1 was the most abundant mycotoxin, and the highest concentrations of fumonisins B1-B3 and beauvericin were found in the spears collected in May. Moniliformin and enniatins were quantified at lower concentrations. Mycotoxins synthesized by individual strains obtained from infected asparagus tissues were assessed using in vitro cultures on sterile rice grain. Most of the F. sporotrichioides strains synthesized HT-2 toxin and F. equiseti strains were found to be effective zearalenone producers.

  3. Identifications of Captive and Wild Tilapia Species Existing in Hawaii by Mitochondrial DNA Control Region Sequence

    Science.gov (United States)

    Wu, Liang; Yang, Jinzeng

    2012-01-01

    Background The tilapia family of the Cichlidae includes many fish species, which live in freshwater and saltwater environments. Several species, such as O. niloticus, O. aureus, and O. mossambicus, are excellent for aquaculture because these fish are easily reproduced and readily adapt to diverse environments. Historically, tilapia species, including O. mossambicus, S. melanotheron, and O. aureus, were introduced to Hawaii many decades ago, and the state of Hawaii uses the import permit policy to prevent O. niloticus from coming into the islands. However, hybrids produced from O. niloticus may already be present in the freshwater and marine environments of the islands. The purpose of this study was to identify tilapia species that exist in Hawaii using mitochondrial DNA analysis. Methodology/Principal Findings In this study, we analyzed 382 samples collected from 13 farm (captive) and wild tilapia populations in Oahu and the Hawaii Islands. Comparison of intraspecies variation between the mitochondrial DNA control region (mtDNA CR) and cytochrome c oxidase I (COI) gene from five populations indicated that mtDNA CR had higher nucleotide diversity than COI. A phylogenetic tree of all sampled tilapia was generated using mtDNA CR sequences. The neighbor-joining tree analysis identified seven distinctive tilapia species: O. aureus, O. mossambicus, O. niloticus, S. melanotheron, O. urolepies, T. redalli, and a hybrid of O. massambicus and O. niloticus. Of all the populations examined, 10 populations consisting of O. aureus, O. mossambicus, O. urolepis, and O. niloticus from the farmed sites were relatively pure, whereas three wild populations showed some degree of introgression and hybridization. Conclusions/Significance This DNA-based tilapia species identification is the first report that confirmed tilapia species identities in the wild and captive populations in Hawaii. The DNA sequence comparisons of mtDNA CR appear to be a valid method for tilapia species

  4. Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)

    DEFF Research Database (Denmark)

    Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B

    1998-01-01

    Regrowth after cutting at four development stages, from heading to grain maturity, was investigated in a pot experiment containing three rye and four barley varieties (including 2 Hordeum spontaneum lines). Regrowth in the barley varieties decreased strongly from heading to grain maturity. Rye ge...

  5. Characterization of seeds of selected wild species of rice (Oryza) stored under high temperature and humidity conditions.

    Science.gov (United States)

    Das, Smruti; Nayak, Monalisa; Patra, B C; Ramakrishnan, B; Krishnan, P

    2010-06-01

    Wild progenitors of rice (Oryza) are an invaluable resource for restoring genetic diversity and incorporating useful traits back into cultivars. Studies were conducted to characterize the biochemical changes, including SDS-PAGE banding pattern of storage proteins in seeds of six wild species (Oryza alta, O. grandiglumis, O. meridionalis, O. nivara, O. officinalis and O. rhizomatis) of rice stored under high temperature (45 degrees C) and humidity (approixmately 100%) for 15 days, which facilitated accelerated deterioration. Under the treated conditions, seeds of different wild rice species showed decrease in per cent germination and concentrations of protein and starch, but increase in conductivity of leachate and content of sugar. The SDS-PAGE analysis of seed proteins showed that not only the total number of bands, but also their intensity in terms of thickness differed for each species under storage. The total number of bands ranged from 11 to 22, but none of the species showed all the bands. Similarity index for protein bands between the control and treated seeds was observed to be least in O. rhizomatis and O. alta, while the indices were 0.7 and 0.625 for O. officinalis and O. nivara, respectively. This study clearly showed that seed deterioration led to distinctive biochemical changes, including the presence or absence as well as altered levels of intensity of proteins. Hence, SDS-PAGE protein banding pattern can be used effectively to characterize deterioration of seeds of different wild species of rice.

  6. A Substantial Fraction of Barley (Hordeum vulgare L. Low Phytic Acid Mutations Have Little or No Effect on Yield across Diverse Production Environments

    Directory of Open Access Journals (Sweden)

    Victor Raboy

    2015-04-01

    Full Text Available The potential benefits of the low phytic acid (lpa seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield. This has given rise to the perception that the lpa trait is tightly correlated with reduced yield in diverse crop species. Here we report a powerful test of this correlation. We measured grain yield in lines homozygous for each of six barley (Hordeum vulgare L. lpa mutations that greatly differ in their seed phytic acid levels. Performance comparisons were between sibling wild-type and mutant lines obtained following backcrossing, and across two years in five Idaho (USA locations that greatly differ in crop yield potential. We found that one lpa mutation (Hvlpa1-1 had no detectable effect on yield and a second (Hvlpa4-1 resulted in yield losses of only 3.5%, across all locations. When comparing yields in three relatively non-stressful production environments, at least three lpa mutations (Hvlpa1-1, Hvlpa3-1, and Hvlpa4-1 typically had yields similar to or within 5% of the wild-type sibling isoline. Therefore in the case of barley, lpa mutations can be readily identified that when simply incorporated into a cultivar result in adequately performing lines, even with no additional breeding for performance within the lpa line. In conclusion, while some barley lpa mutations do impact field performance, a substantial fraction appears to have little or no effect on yield.

  7. Modelling seasonal habitat suitability for wide-ranging species: Invasive wild pigs in northern Australia.

    Directory of Open Access Journals (Sweden)

    Jens G Froese

    Full Text Available Invasive wildlife often causes serious damage to the economy and agriculture as well as environmental, human and animal health. Habitat models can fill knowledge gaps about species distributions and assist planning to mitigate impacts. Yet, model accuracy and utility may be compromised by small study areas and limited integration of species ecology or temporal variability. Here we modelled seasonal habitat suitability for wild pigs, a widespread and harmful invader, in northern Australia. We developed a resource-based, spatially-explicit and regional-scale approach using Bayesian networks and spatial pattern suitability analysis. We integrated important ecological factors such as variability in environmental conditions, breeding requirements and home range movements. The habitat model was parameterized during a structured, iterative expert elicitation process and applied to a wet season and a dry season scenario. Model performance and uncertainty was evaluated against independent distributional data sets. Validation results showed that an expert-averaged model accurately predicted empirical wild pig presences in northern Australia for both seasonal scenarios. Model uncertainty was largely associated with different expert assumptions about wild pigs' resource-seeking home range movements. Habitat suitability varied considerably between seasons, retracting to resource-abundant rainforest, wetland and agricultural refuge areas during the dry season and expanding widely into surrounding grassland floodplains, savanna woodlands and coastal shrubs during the wet season. Overall, our model suggested that suitable wild pig habitat is less widely available in northern Australia than previously thought. Mapped results may be used to quantify impacts, assess risks, justify management investments and target control activities. Our methods are applicable to other wide-ranging species, especially in data-poor situations.

  8. Wild Nicotiana Species as a Source of Cytoplasmic Male Sterility in Nicotianatabacum

    Directory of Open Access Journals (Sweden)

    Nikova V

    2014-12-01

    Full Text Available The results of our experiments executed to obtain tobacco male sterile lines through interspecific hybridization are summarized. Ten wild species from the genus Nicotiana: N. excelsior (exc, N. amplexicaulis (amp, N. rustica (rus, Nicotianaglauca (gla, N. velutina (vel, N. benthamiana (ben, N. maritima (mar, N. paniculata (pan, N. longiflora (lon and N. africana (afr were used as cytoplasmic donors and N. tabacum, cv. HarmanliiskaBasma (HB as a donor of the nucleus. Genetic effects of cytoplasmic-nuclear interaction of the studied species are discussed. Our results suggested that cytoplasmic male sterility (CMS was expressed when the cytoplasms of the above mentioned wild Nicotiana species were combined with the nucleus of N. tabacum. The 10 sources of CMS obtained in tobacco were characterized by altered flower phenotypes. Flowers are classified into types according the stamen, pistil and corolla modification. All these CMS sources were backcrossed to Oriental tobaccos, cvs. Tekne, Nevrokop B-12, Kroumovgrad 90 and Djebel 576, to develop corresponding CMS lines. The investigated cytoplasms produced compete male sterility in all those cultivars. The CMS lines preserved flower types, specific for every “sterile” cytoplasm. The extent of male organ modifications varied from apparently normal (but pollenless stamens in CMS (pan, (afr, some plants of (vel (mar through different degrees of malformations (shriveled anther on shortened filaments (lon, pinnate-like anthers on filaments of normal length (amp, petal - (ben, pistil- or stigma-like structures (rus, (gla to lack of male reproductive organs in (exc and in some plants of (vel, (mar, (rus and (gla. Most of the above mentioned cytoplasms had normal female gametophyte and good seed productivity. Alterations of the pistils were observed in CMS (rus, (exc and (ben causing reduction of the seed set. Electrophoresis of seed proteins of the tobacco cultivars and their CMS lines also suggested that

  9. High altitude species, high profits: can the trade in wild harvested Fritillaria cirrhosa (Liliaceae) be sustained?

    Science.gov (United States)

    Cunningham, A B; Brinckmann, J A; Pei, S-J; Luo, P; Schippmann, U; Long, X; Bi, Y-F

    2018-05-08

    Fritillaria cirrhosa D. Don bulbs contain alkaloids and are one of the most intensively exploited alpine Himalayan medicinal species. In terms of proprietary medicines, our study shows that 210 F. cirrhosa products are offered by 46 suppliers, most of which (44) are situated in China and two in Nepal. A widepread commercial use is as one of the main ingredients in cough syrups. A well known example is "Nin Jiom Pei Pa Koa Herbal Cough & Throat Syrup", which typically contains more F. cirrhosa than any other herbal ingredient in the formulation. The biggest market for F. cirrhosa bulbs is China, where demand exceeds supply of this wild harvested species for use in traditional Chinese medicine (TCM). Cross-border trade from Nepal to China occurs in significant quantities. Bhutan also imports F. cirrhosa bulbs from Nepal. In addition, F. cirrhosa is registered as an active ingredient in traditional herbal medicinal preparations in Australia, Canada, Hong Kong SAR, Malaysia, Republic of Korea, Singapore and Taiwan. There is also an export trade in F. cirrhosa to Europe. Assessing how much F. cirrhosa is traded is complex, however, due to a "look-alike" challenge, as nine Chinese Fritillaria species are traded in Europe (Fritillaria cirrhosa, F. delavayi, F. hupehensis, F. pallidiflora, F. przewalskii, F. thunbergii, F. unibracteata, F. ussuriensis and F. walujewii). The aims of this review were to assess the scale of the global trade in F. cirrhosa, and to synthesise studies of the impacts of wild harvest on F. cirrhosa populations and on the extent of emerging cultivation initiatives as an alternative to wild harvest. Firstly, we reviewed published information on studies on impacts of wild F. cirrhosa harvest from across the geographic range of this species. Secondly, global trade data for F. cirrhosa were analysed. The principal demand for F. cirrhosa bulbs is in China, where hundreds of different companies produce Fritillaria preparations. Trade data also show that

  10. Investigation of wild species potential to increase genetic diversity useful for apple breeding

    Directory of Open Access Journals (Sweden)

    Dan Catalina

    2015-01-01

    Full Text Available The potential of testing new apple cultivars and the possibility to induce valuable traits is directly dependent on the availability of sufficient genetic diversity, while apple breeding has narrowed the genetic ground of commercial cultivars. Wild species were studied in regard to their influence upon progenies and their capacity to enlarge apple genetic diversity. The interspecific seedlings were framed in five biparental mating (paired crosses, in which Malus species were crossed with different cultivars, obtaining half-sib families. The number of F1 progenies per combination varied from 31 (Cluj 218/2 × M. floribunda up to 142 (Reinette Baumann × M. floribunda, with a total of 1650 hybrids F1. The influences upon vigour and juvenile period and possible correlation among fruit size and taste were analyzed. Juvenile period varied from 6.00 (M. zumi × Jonathan to 9.31 years (Cluj 218/2 × M. floribunda. Data based on correlation coefficient illustrated that the fructification year was not influenced by the vigour of trees. The highest value of correlation for fruit’s size and taste was obtained among M. coronaria hybrids. This result might suggest that once the fruit are larger, there is a high chance the taste is also more appreciative and fruit quality for mouth feels increase. Depending on the parental formula, additive effects may be inferior compared to genetic effects of dominance and epistasis. Although M. zumi and M. floribunda achieved the same genetic gain (0.31, M. zumi had a higher expected selection response for fruit size. The difficulty of obtaining seedlings with tasty and large fruit when wild Malus species are used as genitors is resulting from the values of expected selection response data, but in the same time results confirm that wild Malus species are suitable resources for genetic variability, both for dessert and ornamental apple cultivars.

  11. Identification of molecular species of acylglycerols of Philippine wild edible mushroom, Ganoderma lucidum

    Science.gov (United States)

    Wild edible mushrooms are widely consumed in many countries. We successfully cultivated four edible, medicinal Philippine mushrooms in liquid culture. Recently, we identified the molecular species of acylglycerols in the lipid extract of mushroom G. lucidum NRRL66208. One hundred and three molecular...

  12. Viral Encephalopathy and Retinopathy in groupers (Epinephelus spp. in southern Italy: a threat for wild endangered species?

    Directory of Open Access Journals (Sweden)

    Vendramin Niccolò

    2013-01-01

    Full Text Available Abstract Background Betanodaviruses are the causative agents of Viral Encephalopathy and Retinopathy (VER. To date, more than 50 species have proved to be susceptible and among them, those found in genus Epinephelus are highly represented. Clinical disease outbreaks are generally characterized by typical nervous signs and significant mortalities mainly associated with aquaculture activities, although some concerns for the impact of this infection in wild fish have been raised. In this study, the authors present the first documented report describing an outbreak of VER in wild species in the Mediterranean basin. Case presentation In late summer - early winter 2011 (September-December, significant mortalities affecting wild Dusky grouper (Epinephelus marginatus, Golden grouper (Epinephelus costae and European sea bass (Dicentrarchus labrax were reported in the municipality of Santa Maria di Leuca (Northern Ionian Sea, Italy. The affected fish showed an abnormal swimming behavior and swollen abdomens. During this epizootic, five moribund fish showing clear neurological signs were captured and underwent laboratory investigations. Analytical results confirmed the diagnosis of VER in all the specimens. Genetic characterization classified all betanodavirus isolates as belonging to the RGNNV genotype, revealing a close genetic relationship with viral sequences obtained from diseased farmed fish reared in the same area in previous years. Conclusion The close relationship of the viral sequences between the isolates collected in wild affected fish and those isolated during clinical disease outbreaks in farmed fish in the same area in previous years suggests a persistent circulation of betanodaviruses and transmission between wild and farmed stocks. Further investigations are necessary to assess the risk of viral transmission between wild and farmed fish populations, particularly in marine protected areas where endangered species are present.

  13. Molecular characterization of Babesia and Cytauxzoon species in wild South-African meerkats.

    Science.gov (United States)

    Leclaire, Sarah; Menard, Sandie; Berry, Antoine

    2015-04-01

    Piroplasms, including Babesia, Cytauxzoon and Theileria species, frequently infect domestic and wild mammals. At present, there is no information on the occurrence and molecular identity of these tick-borne blood parasites in the meerkat, one of South Africa's most endearing wildlife celebrities. Meerkats live in territorial groups, which may occur on ranchland in close proximity to humans, pets and livestock. Blood collected from 46 healthy meerkats living in the South-African Kalahari desert was screened by microscopy and molecular methods, using PCR and DNA sequencing of 18S rRNA and ITS1 genes. We found that meerkats were infected by 2 species: one species related to Babesia sp. and one species related to Cytauxzoon sp. Ninety one percent of the meerkats were infected by the Cytauxzoon and/or the Babesia species. Co-infection occurred in 46% of meerkats. The pathogenicity and vectors of these two piroplasm species remains to be determined.

  14. Differentiation of Meat Samples from Domestic Horses ( Equus caballus and Asiatic Wild Asses ( Equus hemionus Using a Species-Speci fi c Restriction Site in the Mitochondrial Cytochrome b Region

    Directory of Open Access Journals (Sweden)

    Ralph Kuehn

    2006-12-01

    Full Text Available Recent studies suggest that Asiatic wild asses ( Equus hemionus are being increasingly poached in a commercial fashion. Part of the meat is believed to reach the meat markets in the capital Ulaanbaatar. To test this hypothesis, we collected 500 meat samples between February and May 2006. To differentiate between domestic horse ( Equus caballus and wild ass meat, we developed a restriction fragment length polymorphism (RFLP assay based on the polymerase chain reaction (PCR. We ampli fi ed and sequenced a cytochrome b fragment (335 bp and carried out a multialignment of the generated sequences for the domestic horse, the Asiatic wild ass, the domestic donkey ( Equus asinus and the Przewalski’s horse ( Equus ferus przewalskii . We detected a species-speci fi c restriction site (AatII for the Asiatic wild ass, resulting in a speci fi c restriction fragment length polymorphism (RFLP band pattern. This RFLP assay represents a rapid and cost-effective method to detect wild ass meat. All of the 500 meat samples we collected and analysed within this pilot project proved to be domestic horsemeat as declared by the sales people. Thus, either the assumption that wild ass meat is sold as “cheap horse meat” is wrong, or we picked the wrong markets, products or season.

  15. Cytogenetisch en embryologisch onderzoek aan kruisingen tussen Hordeum vulgare en H. bulbosum

    NARCIS (Netherlands)

    Lange, W.

    1969-01-01

    Crosses between barley (Hordeum vulgare) and bulbous barleygrass ( H.bulbosum) could be valuable for the transfer of such properties as resistance to cold or diseases from H. bulbosum to H. vulgare. From the literature it was known that difficulties arose in the cross: seed abortion necessitating

  16. Transcriptome Sequencing of Diverse Peanut (Arachis Wild Species and the Cultivated Species Reveals a Wealth of Untapped Genetic Variability

    Directory of Open Access Journals (Sweden)

    Ratan Chopra

    2016-12-01

    Full Text Available To test the hypothesis that the cultivated peanut species possesses almost no molecular variability, we sequenced a diverse panel of 22 Arachis accessions representing Arachis hypogaea botanical classes, A-, B-, and K- genome diploids, a synthetic amphidiploid, and a tetraploid wild species. RNASeq was performed on pools of three tissues, and de novo assembly was performed. Realignment of individual accession reads to transcripts of the cultivar OLin identified 306,820 biallelic SNPs. Among 10 naturally occurring tetraploid accessions, 40,382 unique homozygous SNPs were identified in 14,719 contigs. In eight diploid accessions, 291,115 unique SNPs were identified in 26,320 contigs. The average SNP rate among the 10 cultivated tetraploids was 0.5, and among eight diploids was 9.2 per 1000 bp. Diversity analysis indicated grouping of diploids according to genome classification, and cultivated tetraploids by subspecies. Cluster analysis of variants indicated that sequences of B genome species were the most similar to the tetraploids, and the next closest diploid accession belonged to the A genome species. A subset of 66 SNPs selected from the dataset was validated; of 782 SNP calls, 636 (81.32% were confirmed using an allele-specific discrimination assay. We conclude that substantial genetic variability exists among wild species. Additionally, significant but lesser variability at the molecular level occurs among accessions of the cultivated species. This survey is the first to report significant SNP level diversity among transcripts, and may explain some of the phenotypic differences observed in germplasm surveys. Understanding SNP variants in the Arachis accessions will benefit in developing markers for selection.

  17. MORPHOLOGICAL AND AGRONOMICAL CHARACTERISTICS OF SOME WILD AND CULTIVATED ISATIS SPECIES

    Directory of Open Access Journals (Sweden)

    Süleyman KIZIL

    2007-04-01

    Full Text Available The study evaluated Isatis tinctoria, I. constricta, I. glauca, I. cochlearis, I. aucheri and I. demiriziana during 2002-03 and 2003-04 growing seasons for different agronomic characteristics affecting the percentage of dye in them. The results showed wide variations in the agronomic characteristics of Isatis constricta, Isatis cochlearis, Isatis aucheri, Isatis demiriziana collected from wild; compared to culture Isatis tinctoria and Isatis glauca. I. tinctoria showed early emergence (36 day compared to other species, and I. glauca was determined as late fl owering (512 day species. Among Isatis species, I. glauca showed the maximum plant height (113.4 cm, stem diameter (10.84 mm seed yield per plant (103.0 g . Whereas, I. tinctoria produced the largest number of branches per plant (16.8 plant-1 and the maximum number of seeds (17918 per plant.

  18. Development and Meiosis of Three Interspecific Hybrids with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Flink, J.; Linde-Laursen, Ib

    1986-01-01

    The development and meiosis of three interspecific hybrids between cultivated barley (Hordeum vulgare L.) and H. secalinum Schreb., H. tetraploidum Covas, and H. parodii Covas, respectively, were studied. All three hybrid combinations developed very slowly vegetatively. Meiosis of the hybrids...

  19. Clostridium difficile and Clostridium perfringens from wild carnivore species in Brazil.

    Science.gov (United States)

    Silva, Rodrigo Otávio Silveira; D'Elia, Mirella Lauria; Tostes Teixeira, Erika Procópio; Pereira, Pedro Lúcio Lithg; de Magalhães Soares, Danielle Ferreira; Cavalcanti, Álvaro Roberto; Kocuvan, Aleksander; Rupnik, Maja; Santos, André Luiz Quagliatto; Junior, Carlos Augusto Oliveira; Lobato, Francisco Carlos Faria

    2014-08-01

    Despite some case reports, the importance of Clostridium perfringens and Clostridium difficile for wild carnivores remains unclear. Thus, the objective of this study was to identify C. perfringens and C. difficile strains in stool samples from wild carnivore species in Brazil. A total of 34 stool samples were collected and subjected to C. perfringens and C. difficile isolation. Suggestive colonies of C. perfringens were then analyzed for genes encoding the major C. perfringens toxins (alpha, beta, epsilon and iota) and the beta-2 toxin (cpb2), enterotoxin (cpe) and NetB (netb) genes. C. difficile strains were analyzed by multiplex-PCR for toxins A (tcdA) and B (tcdB) and a binary toxin gene (cdtB) and also submitted to a PCR ribotyping. Unthawed aliquots of samples positive for C. difficile isolation were subjected to the detection of A/B toxins by a cytotoxicity assay (CTA). C. perfringens was isolated from 26 samples (76.5%), all of which were genotyped as type A. The netb gene was not detected, whereas the cpb2 and cpe genes were found in nine and three C. perfringens strains, respectively. C. difficile was isolated from two (5.9%) samples. A non-toxigenic strain was recovered from a non-diarrheic maned wolf (Chrysocyon brachyurus). Conversely, a toxigenic strain was found in the sample of a diarrheic ocelot (Leopardus pardallis); an unthawed stool sample was also positive for A/B toxins by CTA, indicating a diagnosis of C. difficile-associated diarrhea in this animal. The present work suggests that wild carnivore species could carry C. difficile strains and that they could be susceptible to C. difficile infection. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Toxocara cati (Nematoda, Ascarididae in different wild feline species in Brazil: new host records

    Directory of Open Access Journals (Sweden)

    Moisés Gallas

    2013-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2013v26n3p117 This is the first detailed description of Toxocara cati parasitizing felines in South America. Seventeen run over wild felines (Leopardus colocolo, Leopardus geoffroyi, Leopardus tigrinus, and Puma yagouaroundi were collected from different towns in the State of Rio Grande do Sul, Brazil. The morphometry of males and females allowed the identification of specimens as being T. cati. The helminths were found in the stomach and intestine of hosts with prevalences of 66.6% in L. colocolo, L. geoffroyi, and L. tigrinus; and 60% in P. yagouaroundi. The ecological parameters were calculated for each host and L. colocolo had the highest infection intensity (22.5 helminths/ host. This is the first report of T. cati parasitizing four wild felines species in southern Brazil, besides a new record of this parasite for two host species.

  1. Selection of Wild Plant Species from Organic Rice Field in Sumberngepoh Village in Malang as Attractant of Trichogramma spp. (Hymenoptera, Trichogrammatidae

    Directory of Open Access Journals (Sweden)

    Wahyu Kusumayanti Putri

    2014-09-01

    Full Text Available One of the actions in biological control is the use of parasitoid. Some wild plant species can attract those parasitoid. By the fact, the objective of this research are to select some of wild plant species attracting Trichogramma spp. These wild plant were belong to Asteraceae (Eupatorium odoratum, Bidens pilosa, Crassocephalum crepidioides and Mimosaceae (Parkia speciosa, Leucaena glauca, Mimosa pudica. Mass rearing of trichogramma spp. was prepared for those purpose. The selection were conducted by using four armed olfactometer. The percentage of the tested Trichogramma spp. attracted to the wild plant species was noted as well as their orientation duration to select the plant species. The difference of the mean of their orientation duration was analyzed statistically by T-Test. Both of plant familia can attract the parasitoid. This were the plant species that attracted Trichogramma spp. From the most attractive to the lowest one : B. pilosa 22 %, E. odoratum 18.6 %, M. pudica 18.2 %, C. crepidioides 13.8 %, P. speciosa 13.6 %, and L. glauca 13.6 %. For the orientation duration, this are the plant species that can attract the parasitoid from the fastest one to the slowest one : P. speciosa 45.5 seconds, C. crepidioides 46.2 seconds, L. glauca 49 seconds, E. odoratum 50.6 seconds , B. pilosa 53.4 seconds, and M. pudica 55.2 seconds. Keywords : Asteraceae, Mimosaceae, Trichogramma spp.

  2. Characterization of senscence-associated NAC transcription factors in Barley (Hordeum Vulgare L.)

    DEFF Research Database (Denmark)

    Podzimska, Dagmara Agata

    , such as yield, biomass production and nutrient quality, and NAC (NAM, ATAF1/2 and CUC2) transcription factors are promising targets for the breeding. The aim of this thesis was thus to assess the role of NAC transcription factors in regulation of senescence in barley (Hordeum vulgare L.) and to contribute...

  3. Polyphenol composition, antioxidant activity and cytotoxicity of seeds from two underexploited wild Licania species

    NARCIS (Netherlands)

    Pessoa, Igor Parra; Neto, José Joaquim Lopes; Almeida, De Thiago Silva; Farias, Davi Felipe; Vieira, Leonardo Rogério; Medeiros, De Jackeline Lima; Boligon, Aline Augusti; Peijnenburg, Ad; Castelar, Ivan; Carvalho, Ana Fontenele Urano

    2016-01-01

    Studies have shown the benefit of antioxidants in the prevention or treatment of human diseases and promoted a growing interest in new sources of plant antioxidants for pharmacological use. This study aimed to add value to two underexploited wild plant species (Licania rigida) and L. tomentosa) from

  4. Characterization and genetic improvement of two wild species blueberry from Costa Rica (Vaccinium consanguineum y V. poasanum)

    International Nuclear Information System (INIS)

    Soto Valverde, Rebeca de los Angeles

    2015-01-01

    Accessions of two wild species blueberry from Costa Rica were characterized for use in the genetic improvement of this crop. A collection of accessions of two wild species blueberry (Vaccinium consanguineum and V. poasanum) were georeferenced and collected in the highlands of the provinces of Alajuela, San Jose and Cartago. The bushes collected were transplanted in the subestacion Fraijanes of the Estacion Experimental Fabio Baudrit Moreno of the Universidad de Costa Rica. Quantitative and qualitative descriptors were evaluated to morphologically characterize in situ and ex situ the accessions collected from each of the two species. The effect of two antimitotic agents, colchicine and oryzalin was determined on the chromosomal duplication of accessions of V. consanguineum and V. poasanum established in vitro. The gibberellic acid was used to promote in vitro germination of the seeds of V. consanguineum and V. poasanum, but reduces the percentage of germination in the latter species if it is used in high doses. The effect of antimitotic agents on the ploidy of both species was determined by flow cytometry [es

  5. Molecular dynamics simulations revealed structural differences among WRKY domain-DNA interaction in barley (Hordeum vulgare).

    Science.gov (United States)

    Pandey, Bharati; Grover, Abhinav; Sharma, Pradeep

    2018-02-12

    The WRKY transcription factors are a class of DNA-binding proteins involved in diverse plant processes play critical roles in response to abiotic and biotic stresses. Genome-wide divergence analysis of WRKY gene family in Hordeum vulgare provided a framework for molecular evolution and functional roles. So far, the crystal structure of WRKY from barley has not been resolved; moreover, knowledge of the three-dimensional structure of WRKY domain is pre-requisites for exploring the protein-DNA recognition mechanisms. Homology modelling based approach was used to generate structures for WRKY DNA binding domain (DBD) and its variants using AtWRKY1 as a template. Finally, the stability and conformational changes of the generated model in unbound and bound form was examined through atomistic molecular dynamics (MD) simulations for 100 ns time period. In this study, we investigated the comparative binding pattern of WRKY domain and its variants with W-box cis-regulatory element using molecular docking and dynamics (MD) simulations assays. The atomic insight into WRKY domain exhibited significant variation in the intermolecular hydrogen bonding pattern, leading to the structural anomalies in the variant type and differences in the DNA-binding specificities. Based on the MD analysis, residual contribution and interaction contour, wild-type WRKY (HvWRKY46) were found to interact with DNA through highly conserved heptapeptide in the pre- and post-MD simulated complexes, whereas heptapeptide interaction with DNA was missing in variants (I and II) in post-MD complexes. Consequently, through principal component analysis, wild-type WRKY was also found to be more stable by obscuring a reduced conformational space than the variant I (HvWRKY34). Lastly, high binding free energy for wild-type and variant II allowed us to conclude that wild-type WRKY-DNA complex was more stable relative to variants I. The results of our study revealed complete dynamic and structural information

  6. Genetic diversity among wild and cultivated barley as revealed by RFLP

    DEFF Research Database (Denmark)

    Petersen, L.; Østergård, H.; Giese, H.

    1994-01-01

    Genetic variability of cultivated and wild barley, Hordeum vulgare ssp. vulgare and spontaneum, respectively, was assessed by RFLP analysis. The material consisted of 13 European varietes, single-plant offspring lines of eight land races from Ethiopia and Nepal, and five accessions of ssp. sponta...... an intermediate level. The proportion of gene diversity residing among,geographical groups (F-ST) varied from 0.19 to 0.94 (average 0.54) per RFLP pattern, indicating large diversification between geographical groups....... was estimated and the barley lines clustered into five groups reflecting geographical origin. The geographical groups of land-race lines showed less intragroup variation than the geographical groups of spontaneum lines. The group of European varieties, representing large variation in agronomic traits, showed...

  7. Diversification of Cercopithifilaria species (Nematoda: Filarioidea in Japanese wild ruminants with description of two new species

    Directory of Open Access Journals (Sweden)

    Uni S.

    2002-12-01

    Full Text Available Twelve of the 17 Cervus nippon nippon deer from Kyushu Island, Japan, that we examined were infected with one or two Cercopithifilaria species. C. longa n. sp. adults were in the subcutaneous tissues of limbs and the abdomen, and C. crassa n. sp. adults were in the skin, mainly in the anterior part of the back ; the distribution of the dermal microfilariae generally matched that of the adult worms. The two new species were assigned to the group of primitive Cercopithifilaria species that parasitize ruminants (bovids and cervids, but the new species could readily be distinguished from others morphologically. C. longa was more primitive and resembled C. bulboidea, one of the five species from the serow Capricornis crispus, a Japanese member of the Caprinae, and species from Bovidae in Africa. C. crassa had a thick body and large spicules like C. rugosicauda from Capreolus capreolus in Europe, the only previously known Cercopithifilaria species from cervids, but it also had one or two hypertrophied pairs of caudal papillae, an unusual character found so far only in Japanese parasites. Among the 12 species known from ruminants, four are African, one is European and more highly evolved, and seven are Japanese, with some being primitive and some more evolved. The great diversity of Cercopithifilaria species in the two wild ruminants that live in Japan seems to have resulted from local speciation, which occurred during the Pleistocene, from a primitive form of the C. longa type derived from Eurasiatic ancestors, which has disappeared or, more probably, not yet been discovered.

  8. Discrimination and similarity evaluation of tissue-cultured and wild Dendrobium species using Fourier transform infrared spectroscopy

    Science.gov (United States)

    Chen, Nai-dong; Chen, Han; Li, Jun; Sang, Mang-mang; Ding, Shen; Yu, Hao

    2015-04-01

    The FTIR method was applied to evaluate the similarity of tissue-cultured and wild Dendrobium huoshanense C.Z. Tang et S.J. Cheng, Dendrobium officinale Kimura et Migo and Dendrobium moniliforme (Linn.) Sw and discriminate different Dendrobium species, especially D. huoshanense and its main goldbrick Dendrobium henanense J.L. Lu et L.X. Gao. Despite the general pattern of the IR spectra, different intensities, shapes and peak positions were found in the IR spectra of these samples, especially in the range of 1800-600 cm-1, which could be used to discriminate them. The methanol, aqueous extracting procedure and the second derivative transformation obviously enlarged the tiny spectral differences among these samples. The similarity evaluation based on the IR spectra and the second derivative IR spectrum revealed that the similarity of the methanol extracts between tissue-cultured and wild Dendrobiums might be lower than that between different Dendrobium species. The similarities of the powders and aqueous extracts between tissue-cultured and wild Dendrobiums were higher than those between different Dendrobium species. The further principal component analysis showed that the first three components explained 99.7%, 87.7% and 85.1% of data variance for powder, methanol extract and aqueous extract, respectively, demonstrating a good discrimination between samples. Our research suggested that the variations of secondary metabolites between different origins of the investigated Dendrobiums might be higher than what we had supposed. Tissue culture techniques were widely used in the conversation of rare and endangered medicinal amedica, however, our study suggested that the chemical constituents of tissue-cultured plants might be quite different from their wild correspondences.

  9. Trans-sialidase inhibition assay detects Trypanosoma cruzi infection in different wild mammal species.

    Science.gov (United States)

    Sartor, Paula A; Ceballos, Leonardo A; Orozco, Marcela M; Cardinal, Marta V; Gürtler, Ricardo E; Leguizamón, María S

    2013-08-01

    The detection of Trypanosoma cruzi infection in mammals is crucial for understanding the eco-epidemiological role of the different species involved in parasite transmission cycles. Xenodiagnosis (XD) and hemoculture (HC) are routinely used to detect T. cruzi in wild mammals. Serological methods are much more limited because they require the use of specific antibodies to immunoglobulins of each mammalian species susceptible to T. cruzi. In this study we detected T. cruzi infection by trans-sialidase (TS) inhibition assay (TIA). TIA is based on the antibody neutralization of a recombinant TS that avoids the use of anti-immunoglobulins. TS activity is not detected in the co-endemic protozoan parasites Leishmania spp and T. rangeli. In the current study, serum samples from 158 individuals of nine wild mammalian species, previously tested by XD, were evaluated by TIA. They were collected from two endemic areas in northern Argentina. The overall TIA versus XD co-reactivity was 98.7% (156/158). All 18 samples from XD-positive mammals were TIA-positive (co-positivity, 100%) and co-negativity was 98.5% (138/140). Two XD-negative samples from a marsupial (Didelphis albiventris) and an edentate (Dasypus novemcinctus) were detected by TIA. TIA could be used as a novel tool for serological detection of Trypanosoma cruzi in a wide variety of sylvatic reservoir hosts.

  10. Sampling wild species to conserve genetic diversity

    Science.gov (United States)

    Sampling seed from natural populations of crop wild relatives requires choice of the locations to sample from and the amount of seed to sample. While this may seem like a simple choice, in fact careful planning of a collector’s sampling strategy is needed to ensure that a crop wild collection will ...

  11. Genetic Analysis of Seed Yield Components and its Association with Forage Production in Wild and Cultivated Species of Sainfoin

    Directory of Open Access Journals (Sweden)

    A. Najafipoor

    2017-02-01

    Full Text Available Little is known about genetic variation of seed related traits and their association with forage characters in sainfoin. In order to investigate the variation and relationship among seed yield and its components, 93 genotypes from 21 wild and cultivated species of genus Onobrychis were evaluated using a randomized complete block design with four replications at Isfahan University of Technology Research Farm, Isfahan, Iran. Analysis of variance showed that there was significant difference among genotypes, indicating existence of considerable genetic variation in this germplasm. Panicle fertility and panicle length had the most variation in cultivated and the wild genotypes, respectively. Results of correlation analysis showed that seed yield was positively correlated with number of stems per plant and number of seeds per panicle and negatively correlated with panicle length and days to 50% flowering. Seed yield had positive correlation with forage yield in wild species while this correlation was not significant in cultivated one. Cluster analysis classified the genotypes into three groups which separate wild and cultivated species. Based on principal component analysis the first component was related to seed yield and the second one was related to components of forage yield which can be used for selection of high forage and seed yielding genotypes.

  12. Evaluation of Wild Lentil Species as Genetic Resources to Improve Drought Tolerance in Cultivated Lentil

    Directory of Open Access Journals (Sweden)

    Linda Y. Gorim

    2017-06-01

    Full Text Available Increasingly unpredictable annual rainfall amounts and distribution patterns have far reaching implications for pulse crop biology. Seedling and whole plant survival will be affected given that water is a key factor in plant photosynthesis and also influences the evolving disease spectrum that affects crops. The wild relatives of cultivated lentil are native to drought prone areas, making them good candidates for the evaluation of drought tolerance traits. We evaluated root and shoot traits of genotypes of cultivated lentil and five wild species grown under two water deficit regimes as well as fully watered conditions over a 13 week period indoors. Plants were grown in sectioned polyvinyl chloride (PVC tubes containing field soil from the A, B, and C horizons. We found that root distribution into different soil horizons varied among wild lentil genotypes. Secondly, wild lentil genotypes employed diverse strategies such as delayed flowering, reduced transpiration rates, reduced plant height, and deep root systems to either escape, evade or tolerate drought conditions. In some cases, more than one drought strategy was observed within the same genotype. Sequence based classification of wild and cultivated genotypes did not explain patterns of drought response. The environmental conditions at their centers of origin may explain the patterns of drought strategies observed in wild lentils. The production of numerous small seeds by wild lentil genotypes may have implications for yield improvement in lentil breeding programs.

  13. Evaluation of the allelopathic potential of water-soluble compounds of barley (Hordeum vulgare L. subsp.vulgare and great brome (Bromus diandrus Roth. using a modified bioassay

    Directory of Open Access Journals (Sweden)

    Bouhaouel, I.

    2016-01-01

    Full Text Available Description of the subject. The present study focuses on the description of the allelopathic interactions between wild and crop species that may occur in a given ecosystem. Objectives. The objective is the evaluation of the allo- and autoinhibition activity of root exudates of barley (Hordeum vulgare L. subsp. vulgare and great brome (Bromus diandrus Roth. seedlings by water-soluble allelochemicals. Method. The allelopathic activities of five Tunisian barley genotypes (modern varieties and landraces, one Saudi Arabian barley landrace and great brome were assessed using a modified laboratory bioassay named "seedling-after-seedling agar method". Results. The barley or the great brome reduced, to a greater extent, the root growth compared to the shoot growth of receiver species. The response of the root system architecture of the great brome towards barley root exudates was studied in detail. All the measured root traits were highly sensitive to the presence of barley. In our conditions, the allelopathic activity of barley root exudates had no apparent relationship with the size of the root and a prominent action of genetic determinants in the allelopathic potential between genotypes is proposed. The alloinhibitory activity of barley or great brome root exudates deferred between the receiver species but was always higher than the autoinhibition potential. The autoinhibition in barley proved to depend on whether the genotypes used as donor and receiver are identical or different, suggesting a specific interaction of allelochemicals with the receiver plant. These molecules seem to be the main actors in the allelopathic barley potential as external factors such variations of pH have no evident relevance in the inhibition process. Conclusions. Barley and great brome exude molecules in their surroundings. This affects the growth of the receiver plants, suggesting that these compounds might contribute to the plant community dynamics.

  14. Molecular identification of infective larvae of three species of Onchocerca found in wild-caught females of Simulium bidentatum in Japan

    Directory of Open Access Journals (Sweden)

    Fukuda M.

    2010-03-01

    Full Text Available Wild female black flies attracted to a man or an idling automobile were collected at Oita, Japan where five cases of zoonotic onchocerciasis had occurred. Among the five Simulium species captured, 2% of Simulium bidentatum, the predominant species, were infected with filarial larvae. There were at least two types of infective larvae, types A and B, based on morphometric observation. Moreover, molecular analysis of the mitochondrial cytochrome c oxidase subunit 1 (CO1 gene revealed that types A and B were represented by a single unknown species of Onchocerca and two species, i.e., Onchocerca dewittei japonica from wild boar, the causative agent of zoonotic onchocerciasis in Japan, and an undescribed Onchocerca sp. from wild boar, respectively. Phylogenetic analysis based on the sequences of the mitochondrial 12S ribosomal RNA (12S rRNA gene also showed that type A is likely to be an unknown species of Onchocerca. Natural infection of black flies with infective larvae of O. dewittei japonica and O. sp. was demonstrated for the first time. The present study strongly suggests that S. bidentatum plays a role as a vector in the transmission of zoonotic onchocerciasis due to O. dewittei japonica in Japan.

  15. Complex Interspecific Hybridization in Barley (Hordeum vulgare L.) and the Possible Occurrence of Apomixis

    DEFF Research Database (Denmark)

    Bothmer, R. von; Bengtsson, M.; Flink, J.

    1988-01-01

    Several complex hybrids were produced from the combination [(Hordeum lechleri, 6 .times. .times. H. procerum, 6 .times.) .times. H. vulgare, 2 .times.]. Crosses with six diploid barley lines resulted in triple hybrids, most of which had a full complement of barley chromosomes (no. 1-7), but were...

  16. NAC Transcription Factors of Barley (Hordeum vulgare L.) and their Involvement in Leaf Senescence

    DEFF Research Database (Denmark)

    Wagner, Michael

    parts of the senescence process. The specific aims of this study were therefore (1) to establish and characterise the NAC transcription factors of the model cereal crop barley (Hordeum vulgare L.) (2) to identify and study putative barley NAC transcription factors involved in the regulation of leaf...

  17. Toxocara cati (Schrank, 1788 (Nematoda, Ascarididae in different wild feline species in Brazil: new host records

    Directory of Open Access Journals (Sweden)

    Moisés Gallas

    2013-09-01

    Full Text Available This is the first detailed description of Toxocara cati parasitizing felines in South America. Seventeen run over wild felines (Leopardus colocolo, Leopardus geoffroyi, Leopardus tigrinus, and Puma yagouaroundi were collected from different towns in the State of Rio Grande do Sul, Brazil. The morphometry of males and females allowed the identification of specimens as being T. cati. The helminths were found in the stomach and intestine of hosts with prevalences of 66.6% in L. colocolo, L. geoffroyi, and L. tigrinus; and 60% in P. yagouaroundi. The ecological parameters were calculated for each host and L. colocolo had the highest infection intensity (22.5 helminths/host. This is the first report of T. cati parasitizing four wild felines species in southern Brazil, besides a new record of this parasite for two host species.

  18. Labeled Azospirillum brasilense wild type and excretion-ammonium strains in association with barley roots.

    Science.gov (United States)

    Santos, Adrian Richard Schenberger; Etto, Rafael Mazer; Furmam, Rafaela Wiegand; Freitas, Denis Leandro de; Santos, Karina Freire d'Eça Nogueira; Souza, Emanuel Maltempi de; Pedrosa, Fábio de Oliveira; Ayub, Ricardo Antônio; Steffens, Maria Berenice Reynaud; Galvão, Carolina Weigert

    2017-09-01

    Soil bacteria colonization in plants is a complex process, which involves interaction between many bacterial characters and plant responses. In this work, we labeled Azospirillum brasilense FP2 (wild type) and HM053 (excretion-ammonium) strains by insertion of the reporter gene gusA-kanamycin into the dinitrogenase reductase coding gene, nifH, and evaluated bacteria colonization in barley (Hordeum vulgare). In addition, we determined inoculation effect based on growth promotion parameters. We report an uncommon endophytic behavior of A. brasilense Sp7 derivative inside the root hair cells of barley and highlight the promising use of A. brasilense HM053 as plant growth-promoting bacterium. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  19. Comparative study on free amino acid composition of wild edible mushroom species.

    Science.gov (United States)

    Ribeiro, Bárbara; Andrade, Paula B; Silva, Branca M; Baptista, Paula; Seabra, Rosa M; Valentão, Patrícia

    2008-11-26

    A comparative study on the amino acid composition of 11 wild edible mushroom species (Suillus bellini, Suillus luteus, Suillus granulatus, Tricholomopsis rutilans, Hygrophorus agathosmus, Amanita rubescens, Russula cyanoxantha, Boletus edulis, Tricholoma equestre, Fistulina hepatica, and Cantharellus cibarius) was developed. To define the qualitative and quantitative profiles, a derivatization procedure with dabsyl chloride was performed, followed by HPLC-UV-vis analysis. Twenty free amino acids (aspartic acid, glutamic acid, asparagine, glutamine, serine, threonine, glycine, alanine, valine, proline, arginine, isoleucine, leucine, tryptophan, phenylalanine, cysteine, ornithine, lysine, histidine, and tyrosine) were determined. B. edulis and T. equestre were revealed to be the most nutritional species, whereas F. hepatica was the poorest. The different species exhibited distinct free amino acid profiles. The quantification of the identified compounds indicated that, in a general way, alanine was the major amino acid. The results show that the analyzed mushroom species possess moderate amino acid contents, which may be relevant from a nutritional point of view because these compounds are indispensable for human health. A combination of different mushroom species in the diet would offer good amounts of amino acids and a great diversity of palatable sensations.

  20. The Complete Chloroplast Genome of Wild Rice (Oryza minuta) and Its Comparison to Related Species.

    Science.gov (United States)

    Asaf, Sajjad; Waqas, Muhammad; Khan, Abdul L; Khan, Muhammad A; Kang, Sang-Mo; Imran, Qari M; Shahzad, Raheem; Bilal, Saqib; Yun, Byung-Wook; Lee, In-Jung

    2017-01-01

    Oryza minuta , a tetraploid wild relative of cultivated rice (family Poaceae), possesses a BBCC genome and contains genes that confer resistance to bacterial blight (BB) and white-backed (WBPH) and brown (BPH) plant hoppers. Based on the importance of this wild species, this study aimed to understand the phylogenetic relationships of O. minuta with other Oryza species through an in-depth analysis of the composition and diversity of the chloroplast (cp) genome. The analysis revealed a cp genome size of 135,094 bp with a typical quadripartite structure and consisting of a pair of inverted repeats separated by small and large single copies, 139 representative genes, and 419 randomly distributed microsatellites. The genomic organization, gene order, GC content and codon usage are similar to those of typical angiosperm cp genomes. Approximately 30 forward, 28 tandem and 20 palindromic repeats were detected in the O . minuta cp genome. Comparison of the complete O. minuta cp genome with another eleven Oryza species showed a high degree of sequence similarity and relatively high divergence of intergenic spacers. Phylogenetic analyses were conducted based on the complete genome sequence, 65 shared genes and matK gene showed same topologies and O. minuta forms a single clade with parental O. punctata . Thus, the complete O . minuta cp genome provides interesting insights and valuable information that can be used to identify related species and reconstruct its phylogeny.

  1. Ecogeographic variation in the morphology of two Asian wild rice species Oryza nivara and O. ruftipogon.

    NARCIS (Netherlands)

    Banaticla, M.C.N.; Sosef, M.S.M.; McNally, K.L.; Sackville Hamilton, R.; Berg, van den R.G.

    2013-01-01

    To search for variation patterns and diagnostic features between Asian wild rice species, several numerical methods were applied to phenotypic data obtained from 116 accessions representing sympatric populations of Oryza nivara and Oryza rufipogon from tropical continental Asia and O. rufipogon

  2. Adaptive management for improving species conservation across the captive-wild spectrum

    Science.gov (United States)

    Canessa, Stefano; Guillera-Arroita, Gurutzeta; Lahoz-Monfort, José J.; Southwell, Darren M; Armstrong, Doug P.; Chadès, Iadine; Lacy, Robert C; Converse, Sarah J.

    2016-01-01

    Conservation of endangered species increasingly envisages complex strategies that integrate captive and wild management actions. Management decisions in this context must be made in the face of uncertainty, often with limited capacity to collect information. Adaptive management (AM) combines management and monitoring, with the aim of updating knowledge and improving decision-making over time. We provide a guide for managers who may realize the potential of AM, but are unsure where to start. The urgent need for iterative management decisions, the existence of uncertainty, and the opportunity for learning offered by often highly-controlled captive environments create favorable conditions for AM. However, experiments and monitoring may be complicated by small sample sizes, and the ability to control the system, including stochasticity and observability, may be limited toward the wild end of the spectrum. We illustrate the key steps to implementing AM in threatened species management using four case studies, including the management of captive programs for cheetah (Acinonyx jubatus) and whooping cranes (Grus americana), of a translocation protocol for Arizona cliffroses Purshia subintegra and of ongoing supplementary feeding of reintroduced hihi (Notiomystis cincta) populations. For each case study, we explain (1) how to clarify whether the decision can be improved by learning (i.e. it is iterative and complicated by uncertainty) and what the management objectives are; (2) how to articulate uncertainty via alternative, testable hypotheses such as competing models or parameter distributions; (3) how to formally define how additional information can be collected and incorporated in future management decisions.

  3. Seed dormancy alleviation of grewia tenax (forssk.): a wild fruit tree species of pakistan

    International Nuclear Information System (INIS)

    Sohail, M.; Saied, A.S.

    2015-01-01

    Grewia tenax (Forssk.) Fiori is a fruit shrub and grows wild in arid and semi-arid tropics of Asia and Africa. The species is highly valuable for the rural populations because of its edible fruit and fodder for livestock. Species has immense potential for re-vegetation of degraded lands, as it has ability to withstand soil salinity and drought. Wild stands of the species are sparse which is supposed to have some kind of seed dormancy. Seeds of G. tenax were subjected to different combinations of heat and cold seed stratification treatments in two consecutive experiments. A positive correlation (r2 = 0.97) was observed between total emergence and weeks of seed exposure to constant dry heat at 40 degree C from 0 to 4 weeks. Maximum germination (70%) was achieved, when seeds were exposed to dry heat at 40 degree C for 4 weeks as compared to control (20%). Seeds exposed to constant heat for 4 weeks also took only 4 and 5 days to reach 1st and 50% emergence, respectively as compared to untreated seeds, which took 10 and 14 days to reach 1st and 50% emergence, respectively. Moreover, emergence spread lasted only 4 days as compared to untreated seeds with 21 days. Our results indicate that seeds of G. tenax possess a limited physiological dormancy which can be overcome by heat stratification. (author)

  4. Wild species of interest for tourism in Manabí and Guayas, Ecuador

    Directory of Open Access Journals (Sweden)

    Sonia Rosete Blandariz

    2018-01-01

    Full Text Available Ethnobotany is the discipline that studies the relationships between man and plants. The purpose of the study was to identify the uses of wild species of interest for tourism in Manabí and Guayas. Interviews, walks and field observations were carried out in areas with little disturbed vegetation. Seventeen species were reported with at least one recognized use, some used for the manufacture of artisanal, ornamental objects, and the majority in danger of extinction due to the degradation of their habitat. The species of greatest interest for tourism due to their beauty and degree of scarcity are Attalea colenda (O.F.Cook Balslev & A.J.Hend. (Arecaceae, Brassia jipijapensis Dodson & N.H.Williams (Orchidaceae, Ceiba trischistandra (A. Gray Bakhuisen (Malvaceae, Erythrina megistophylla Diels (Fabaceae, Erythrina smithiana Krukoff Fabaceae, Macroclinium manabinum (Dodson Dodson (Orchidaceae, Passiflora sprucei Mast. (Passifloraceae, Phytelephas aequatorialis Spruce (Arecaceae and Prestoea acuminata (Willd. H.E.Moore var. acuminata (Arecaceae.

  5. Wild felid species richness affected by a corridor in the Lacandona forest, Mexico

    Directory of Open Access Journals (Sweden)

    Gil–Fernández, M.

    2017-02-01

    Full Text Available Wild felids are one of the most vulnerable species due to habitat loss caused by fragmentation of ecosystems. We analyzed the effect of a structural corridor, defined as a strip of vegetation connecting two habitat patches, on the richness and habitat occupancy of felids on three sites in Marqués de Comillas, Chiapas, one with two isolated forest patches, the second with a structural corridor, and the third inside the Montes Azules Biosphere Reserve. We found only two species (L. pardalis and H. yagouaroundi in the isolated forest patches, five species in the structural corridor, and four species inside the Reserve. The corridor did not significantly affect occupancy, but due to the low detection rates, further investigation is needed to rule out differences. Our results highlight the need to manage habitat connectivity in the remaining forests in order to preserve the felid community of Marqués de Comillas, Chiapas, México.

  6. THE BIOMINERAL CONCENTRATIONS AND ACCUMULATION IN SOME WILD GROWING EDIBLE SPECIES OF MUSHROOMS

    Directory of Open Access Journals (Sweden)

    Carmen Cristina Elekes

    2010-01-01

    Full Text Available Many mushrooms species are known to accumulate metals to a higher level than the plants and are considered as a source of proteins, vitamins – riboflavin, biotin and thiamine, fats, carbohydrates, amino acids and minerals. The trace metals concentrations were established by Inductively Coupled Plasma - Atomic Emission Spectrometry method. The aim of this paper is to determinate the minerals content of some wild growing mushrooms, which may be useful in the phytopharmaceutical biotechnologies in order to obtain important quantities of biominerals accessible for the human body. The results are varying with the analyzed species of mushrooms between 11869.85 and 32088.68 mg/kg for potassium, 240.81 to 716.98 mg/kg for calcium and between 0 to 5350 mg/kg for phosphorus. The highest concentration if potassium was founded in B. griseus species, 32088.68 mg/kg. Only two species, Hygrophorus virgineus and Marasmius oreades show a phosphorus concentration in the fruiting body higher than in soil, indicating the accumulation capacity.

  7. Amino Acid Levels in Muscle Tissue of Six Wild Feathered Species

    Directory of Open Access Journals (Sweden)

    Eva Straková

    2016-01-01

    Full Text Available The objective of this study was to determine and compare the levels of amino acids (AAs in breast and thigh muscles of six species of feathered game of the same age. The experiment involved the following species: wild turkey (Meleagris gallopavo, guinea fowl (Numida meleagris, chukar partridge (Alectoris chucar, Japanese quail (Coturnix coturnix japonica, common pheasant (Phasianus colchicus and grey partridge (Perdix perdix. The highest content of AAs was found in the chukar partridge (breast: 815.7 ± 47.71 g/kg; thigh: 771.4 ± 107.0 g/kg, on a dry matter basis, the lowest levels of AAs were found in Japanese quail (breast: 734.2 ± 45.07 g/kg and grey partridge (thigh: 614.9 ± 49.66 g/kg. In all examined species, the level of histidine in breast muscles differed (P ≤ 0.01 from that in thigh muscles. In all investigated species, the levels of essential AAs in breast muscles were higher (P ≤ 0.01 than those in thigh muscles, whereas the levels of non-essential AAs in breast muscles were lower (P ≤ 0.01 than those in thigh muscles. Breast muscles are therefore more valuable than thigh muscles because of the content of essential AAs.

  8. Tolerance of Hordeum marinum accessions to O2 deficiency, salinity and these stresses combined

    Science.gov (United States)

    Malik, Al Imran; English, Jeremy Parker; Colmer, Timothy David

    2009-01-01

    Background and Aims When root-zone O2 deficiency occurs together with salinity, regulation of shoot ion concentrations is compromised even more than under salinity alone. Tolerance was evaluated amongst 34 accessions of Hordeum marinum, a wild species in the Triticeae, to combined salinity and root-zone O2 deficiency. Interest in H. marinum arises from the potential to use it as a donor for abiotic stress tolerance into wheat. Methods Two batches of 17 H. marinum accessions, from (1) the Nordic Gene Bank and (2) the wheat belt of Western Australia, were exposed to 0·2 or 200 mol m−3 NaCl in aerated or stagnant nutrient solution for 28–29 d. Wheat (Triticum aestivum) was included as a sensitive check species. Growth, root porosity, root radial O2 loss (ROL) and leaf ion (Na+, K+, Cl−) concentrations were determined. Key Results Owing to space constraints, this report is focused mainly on the accessions from the Nordic Gene Bank. The 17 accessions varied in tolerance; relative growth rate was reduced by 2–38 % in stagnant solution, by 8–42 % in saline solution (aerated) and by 39–71 % in stagnant plus saline treatment. When in stagnant solution, porosity of adventitious roots was 24–33 %; salinity decreased the root porosity in some accessions, but had no effect in others. Roots grown in stagnant solution formed a barrier to ROL, but variation existed amongst accessions in apparent barrier ‘strength’. Leaf Na+ concentration was 142–692 µmol g−1 d. wt for plants in saline solution (aerated), and only increased to 247–748 µmol g−1 d. wt in the stagnant plus saline treatment. Leaf Cl− also showed only small effects of stagnant plus saline treatment, compared with saline alone. In comparison with H. marinum, wheat was more adversely affected by each stress alone, and particularly when combined; growth reductions were greater, adventitious root porosity was 21 %, it lacked a barrier to ROL, leaf K+ declined to lower levels, and leaf Na+ and

  9. Exome-wide DNA capture and next generation sequencing in domestic and wild species

    Directory of Open Access Journals (Sweden)

    Ng Sarah B

    2011-07-01

    Full Text Available Abstract Background Gene-targeted and genome-wide markers are crucial to advance evolutionary biology, agriculture, and biodiversity conservation by improving our understanding of genetic processes underlying adaptation and speciation. Unfortunately, for eukaryotic species with large genomes it remains costly to obtain genome sequences and to develop genome resources such as genome-wide SNPs. A method is needed to allow gene-targeted, next-generation sequencing that is flexible enough to include any gene or number of genes, unlike transcriptome sequencing. Such a method would allow sequencing of many individuals, avoiding ascertainment bias in subsequent population genetic analyses. We demonstrate the usefulness of a recent technology, exon capture, for genome-wide, gene-targeted marker discovery in species with no genome resources. We use coding gene sequences from the domestic cow genome sequence (Bos taurus to capture (enrich for, and subsequently sequence, thousands of exons of B. taurus, B. indicus, and Bison bison (wild bison. Our capture array has probes for 16,131 exons in 2,570 genes, including 203 candidate genes with known function and of interest for their association with disease and other fitness traits. Results We successfully sequenced and mapped exon sequences from across the 29 autosomes and X chromosome in the B. taurus genome sequence. Exon capture and high-throughput sequencing identified thousands of putative SNPs spread evenly across all reference chromosomes, in all three individuals, including hundreds of SNPs in our targeted candidate genes. Conclusions This study shows exon capture can be customized for SNP discovery in many individuals and for non-model species without genomic resources. Our captured exome subset was small enough for affordable next-generation sequencing, and successfully captured exons from a divergent wild species using the domestic cow genome as reference.

  10. Exome-wide DNA capture and next generation sequencing in domestic and wild species.

    Science.gov (United States)

    Cosart, Ted; Beja-Pereira, Albano; Chen, Shanyuan; Ng, Sarah B; Shendure, Jay; Luikart, Gordon

    2011-07-05

    Gene-targeted and genome-wide markers are crucial to advance evolutionary biology, agriculture, and biodiversity conservation by improving our understanding of genetic processes underlying adaptation and speciation. Unfortunately, for eukaryotic species with large genomes it remains costly to obtain genome sequences and to develop genome resources such as genome-wide SNPs. A method is needed to allow gene-targeted, next-generation sequencing that is flexible enough to include any gene or number of genes, unlike transcriptome sequencing. Such a method would allow sequencing of many individuals, avoiding ascertainment bias in subsequent population genetic analyses.We demonstrate the usefulness of a recent technology, exon capture, for genome-wide, gene-targeted marker discovery in species with no genome resources. We use coding gene sequences from the domestic cow genome sequence (Bos taurus) to capture (enrich for), and subsequently sequence, thousands of exons of B. taurus, B. indicus, and Bison bison (wild bison). Our capture array has probes for 16,131 exons in 2,570 genes, including 203 candidate genes with known function and of interest for their association with disease and other fitness traits. We successfully sequenced and mapped exon sequences from across the 29 autosomes and X chromosome in the B. taurus genome sequence. Exon capture and high-throughput sequencing identified thousands of putative SNPs spread evenly across all reference chromosomes, in all three individuals, including hundreds of SNPs in our targeted candidate genes. This study shows exon capture can be customized for SNP discovery in many individuals and for non-model species without genomic resources. Our captured exome subset was small enough for affordable next-generation sequencing, and successfully captured exons from a divergent wild species using the domestic cow genome as reference.

  11. The potential of wild vegetation species of Eleusine indica L., and Sonchus arvensis L. for phytoremediation of Cd-contaminated soil

    Directory of Open Access Journals (Sweden)

    Amir Hamzah

    2017-04-01

    Full Text Available Phytoremediation has been intensively studied due its costs effectiveness and environmentally sound. Studies of heavy metal pollution phytoremediation has been done in develop countries, but still limited in Indonesia. This study aims to explore the potential of wild plant species Eleusine indica L. and Sonchus arvensis L. as an agent of phytoremediation on Cd-contaminated soil. This study was done descriptively in Pujon, Malang, Indonesia, to test the ability of two species of wild plants E. indica and S. arvensis in absorbing Cd. Along this research, plant growth and the concentration of Cd in roots, stems and leaves, was monitored. Plant growth was measured every week for three months. The plant roots, stems, and leaves collected separately, then analyzed its Cd levels. The results showed that both of two species of wild plants grew well on soil contaminated Cd. Plant roots can accumulate higher Cd than the stem part. In addition, E indica has the ability to accumulate Cd higher than S. arvensis, i.e. 57.11% and 35.84%, respectively

  12. Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

    DEFF Research Database (Denmark)

    Kirkensgaard, Kristine Groth; Hägglund, Per; Finnie, Christine

    2009-01-01

    to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 A resolution and refined to an R (cryst) of 19.0% and an R (free) of 23.8%. The dimeric protein...

  13. Molecular detection and characterization of potentially new Babesia and Theileria species/variants in wild felids from Kenya.

    Science.gov (United States)

    Githaka, Naftaly; Konnai, Satoru; Kariuki, Edward; Kanduma, Esther; Murata, Shiro; Ohashi, Kazuhiko

    2012-10-01

    Piroplasms frequently infect domestic and wild carnivores. At present, there is limited information on the occurrence and molecular identity of these tick-borne parasites in wild felids in Kenya. In 2009, a pair of captive lions (Panthare leo) was diagnosed with suspected babesiosis and mineral deficiency at an animal orphanage on the outskirts of Nairobi, Kenya. Blood smears indicated presences of haemoparasites in the erythrocytes, however, no further investigations were conducted to identify the infecting agent. The animals recovered completely following diet supplementation and treatment with anti-parasite drug. In this report, we extracted and detected parasite DNA from the two lions and seven other asymptomatic feline samples; two leopards (Panthera pardus) and five cheetahs (Acinonyx jubatus). Reverse line blot with probes specific for Babesia spp. of felines indicated the presence of new Babesia species or genotypes in the lions and leopards, and unknown Theileria sp. in the cheetahs. Phylogenetic analyses using partial sequences of 18S ribosomal RNA (18S rRNA) gene showed that the parasite infecting the lions belong to the Babesia canis complex, and the parasite variant detected in the leopards clusters in a clade bearing other Babesia spp. reported in wild felids from Africa. The cheetah isolates falls in the Theileria sensu stricto group. Our findings indicate the occurrence of potentially new species or genotypes of piroplams in all three feline species. Copyright © 2012 Elsevier B.V. All rights reserved.

  14. The Phytotoxicity of Designated Pollutants on Plant Species

    Science.gov (United States)

    1984-03-01

    Only seeds collected from those flowers exposed during pollin 20. DISTRIBUTION/AVAILABILITY OF ABSTRACT 21. ABSTRACT SECURITY CLASSIFICATION...acid exposure during pollination lowered the germination rate of mature seeds. Plant injury was chiefly a function of acid concentration, but amount...TESTS Species Name Variety Barley Hordeum vulgare L. CM67 Bean Phaseolus vulgaris L. Pinto Citrus Citrus limon (L.) Lupe Lemon Lettuce Lactuca sativa

  15. Long-term occurrence of Trichuris species in wild ruminants in the Czech Republic.

    Science.gov (United States)

    Nechybová, Stanislava; Vejl, Pavel; Hart, Vlastimil; Melounová, Martina; Čílová, Daniela; Vašek, Jakub; Jankovská, Ivana; Vadlejch, Jaroslav; Langrová, Iva

    2018-05-02

    The aim of this study was to identify Trichuris species in wild ruminants from 32 localities in the Czech Republic using morphological and molecular methods (ITS1-5.8S RNA-ITS2 region polymorphisms). Trichurids were obtained from 176 wild ruminants (roe deer, sika deer, red deer, fallow deer and mouflons) that were culled between 2009 and 2017. Trichuris discolor is the predominant trichurid of all of the above-mentioned wild ruminants, whereas Trichuris ovis was identified less frequently in roe deer, fallow deer, sika deer and mouflons. Red deer were parasitised exclusively by T. discolor. Young hosts under 1 year of age were more intensively infected by trichurids than were adults (χ 2  = 32.02, p = 0.00). Trichurid prevalence results obtained through coprological methods and those based on parasitological dissections differed significantly (χ 2  = 16.26, p = 0.00). The regression analysis indicated that the eggs per gram (EPG) threshold (20 EPG) was exceeded only if the host was parasitised by more than 7 trichurid females. Full concordance between the positive results obtained by the coprological methods and those obtained via direct dissections was achieved when the number of trichurid females per host exceeded 51.

  16. Catabolism of (+/-)-abscisic acid by excised leaves of Hordeum vulgare L. cv Dyan and its modification by chemical and environmental factors

    International Nuclear Information System (INIS)

    Cowan, A.K.; Railton, I.D.

    1987-01-01

    Excised light-grown leaves and etiolated leaves of Hordeum vulgare L. cv Dyan catabolized applied (+/-)-[2- 14 C]abscisic acid ([+/-]-[2- 14 C]ABA) to phaseic acid (PA), dihydrophaseic acid (DPA), and 2'-hydroxymethyl ABA (2'-HMABA). Identification of these catabolites was made by microchemical methods and by combined capillary gas chromatography-mass spectrometry (GC-MS) following high dose feeds of nonlabeled substrate to leaves. Circular dichroism analysis revealed that 2'-HMABA was derived from the (-) enantiomer of ABA. Refeeding studies were used to confirm the catabolic route. The methyl ester of (+/-)-[2 14 C]-ABA was hydrolyzed efficiently by light-grown leaves of H. vulgare. Leaf age played a significant role in (+/-)-ABA catabolism, with younger leaves being less able than their older counterparts to catabolize this compound. The catabolism of (+/-)-ABA was inhibited markedly in water-stressed Hordeum leaves which was characterized by a decreased incorporation of label into 2'-HMABA, DPA, and conjugates. The specific, mixed function oxidase inhibitor, ancymidol, did not inhibit, dramatically (+/-)-ABA catabolism in light-grown leaves of Hordeum whereas the 80s ribosome, translational inhibitor, cycloheximide, inhibited this process markedly. The 70s ribosome translational inhibitors, lincomycin and chloramphenicol, were less effective than cycloheximide in inhibiting (+/-)-ABA catabolism, implying that cytoplasmic protein synthesis is necessary for the catabolism of (+/-)-ABA in Hordeum leaves whereas chloroplast protein synthesis plays only a minor role. This further suggests that the enzymes involved in (+/-)-ABA catabolism in this plant are cytoplasmically synthesized and are turned-over rapidly, although the enzyme responsible for glycosylating (+/-)-ABA itself appeared to be stable

  17. Biosynthesis of the leucine derived α-, β- and γ-hydroxynitrile glucosides in barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik

    2016-01-01

    Barley (Hordeum vulgare L.) produces five leucine-derived hydroxynitrile glucosides (HNGs), of which only epiheterodendrin is a cyanogenic glucoside. The four non-cyanogenic HNGs are the β-HNG epidermin and the γ-HNGs osmaronin, dihydroosmaronin and sutherlandin. By analyzing 247 spring barley...

  18. Analysis of Powdery Mildew Resistance in Wild Melon MLO Mutants

    Directory of Open Access Journals (Sweden)

    Cheng Hong

    2015-11-01

    Full Text Available Wild species have a potential value in crop breeding. Explore MLO gene which related with powdery mildew natural resistance is very important for improving the quality of melon. Resistance to powdery mildew was examined in cultivar and wild species by leaf inoculation. The wild germplasms showed resistance to powdery mildew Race1. Cloning and sequence analysis of the CmMLO2 gene identified an 85 bp difference between the wild and cultivated species. The CmMLO2 gene was expressed in the wild germplasm after fluorescence-labeled Agrobacterium-mediated transformation. A positive transgenic plant showed successful invasion by powdery mildew Race1. These results suggested that the wild species might have failed to encode the MLO protein, thereby resulting in the MLO-negative regulation of powdery mildew, which in turn resulted in the broad-spectrum resistance of the wild species to powdery mildew.

  19. Lipid and sugar profiles of various barley cultivars (Hordeum vulgare

    Directory of Open Access Journals (Sweden)

    Pastor Kristian A.

    2015-01-01

    Full Text Available The lipid components and soluble sugars in flour samples of different cultivars of barley (Hordeum vulgare, involving winter malting barley, winter forage barley, spring barley, and hulless barley, were identified. Fatty acids were extracted from flour samples with n-hexane, and derivatized into volatile methyl esters, using TMSH (trimethylsulfonium hydroxide in methanol. Soluble sugars were extracted from defatted and dried samples of barley flour with 96% ethanol, and further derivatized into the corresponding trimethylsilyl (TMS oximes, using hydroxylamine hydrochloride solution and BSTFA (N,O-bis-(trimethylsilyl-trifluoroacetamide. The hexane and alcoholic extracts of barley cultivars were analyzed by GC-MS system. Lipid and sugar compositions were very similar in all barley cultivars. Therefore, multivariate analysis was applied to numerical values of automatically integrated areas of the identified fatty acid methyl esters and TMS oximes of soluble sugars. The application of hierarchical cluster analysis showed a great similarity between the investigated flour samples of barley cultivars, according to their fatty acid content (0.96. Also, significant, but somewhat less similarity was observed regarding the content of soluble sugars (0.70. These preliminary results indicate the possibility of distinguishing flour made of barley, regardless of the variety, from flours made of other cereal species, just by the analysis of the contents of fatty acids and soluble sugars.[Projekat Ministarstva nauke Republike Srbije, br. TR 31066

  20. Testing projected wild bee distributions in agricultural habitats: predictive power depends on species traits and habitat type.

    Science.gov (United States)

    Marshall, Leon; Carvalheiro, Luísa G; Aguirre-Gutiérrez, Jesús; Bos, Merijn; de Groot, G Arjen; Kleijn, David; Potts, Simon G; Reemer, Menno; Roberts, Stuart; Scheper, Jeroen; Biesmeijer, Jacobus C

    2015-10-01

    Species distribution models (SDM) are increasingly used to understand the factors that regulate variation in biodiversity patterns and to help plan conservation strategies. However, these models are rarely validated with independently collected data and it is unclear whether SDM performance is maintained across distinct habitats and for species with different functional traits. Highly mobile species, such as bees, can be particularly challenging to model. Here, we use independent sets of occurrence data collected systematically in several agricultural habitats to test how the predictive performance of SDMs for wild bee species depends on species traits, habitat type, and sampling technique. We used a species distribution modeling approach parametrized for the Netherlands, with presence records from 1990 to 2010 for 193 Dutch wild bees. For each species, we built a Maxent model based on 13 climate and landscape variables. We tested the predictive performance of the SDMs with independent datasets collected from orchards and arable fields across the Netherlands from 2010 to 2013, using transect surveys or pan traps. Model predictive performance depended on species traits and habitat type. Occurrence of bee species specialized in habitat and diet was better predicted than generalist bees. Predictions of habitat suitability were also more precise for habitats that are temporally more stable (orchards) than for habitats that suffer regular alterations (arable), particularly for small, solitary bees. As a conservation tool, SDMs are best suited to modeling rarer, specialist species than more generalist and will work best in long-term stable habitats. The variability of complex, short-term habitats is difficult to capture in such models and historical land use generally has low thematic resolution. To improve SDMs' usefulness, models require explanatory variables and collection data that include detailed landscape characteristics, for example, variability of crops and

  1. Yield-enhancing heterotic QTL transferred from wild species to cultivated rice Oryza sativa L.

    Science.gov (United States)

    Gaikwad, Kiran B; Singh, Naveen; Bhatia, Dharminder; Kaur, Rupinder; Bains, Navtej S; Bharaj, Tajinder S; Singh, Kuldeep

    2014-01-01

    Utilization of "hidden genes" from wild species has emerged as a novel option for enrichment of genetic diversity for productivity traits. In rice we have generated more than 2000 lines having introgression from 'A' genome-donor wild species of rice in the genetic background of popular varieties PR114 and Pusa44 were developed. Out of these, based on agronomic acceptability, 318 lines were used for developing rice hybrids to assess the effect of introgressions in heterozygous state. These introgression lines and their recurrent parents, possessing fertility restoration ability for wild abortive (WA) cytoplasm, were crossed with cytoplasmic male sterile (CMS) line PMS17A to develop hybrids. Hybrids developed from recurrent parents were used as checks to compare the performance of 318 hybrids developed by hybridizing alien introgression lines with PMS17A. Seventeen hybrids expressed a significant increase in yield and its component traits over check hybrids. These 17 hybrids were re-evaluated in large-size replicated plots. Of these, four hybrids, viz., ILH299, ILH326, ILH867 and ILH901, having introgressions from O. rufipogon and two hybrids (ILH921 and ILH951) having introgressions from O. nivara showed significant heterosis over parental introgression line, recurrent parents and check hybrids for grain yield-related traits. Alien introgressions were detected in the lines taken as male parents for developing six superior hybrids, using a set of 100 polymorphic simple sequence repeat (SSR) markers. Percent introgression showed a range of 2.24 from in O. nivara to 7.66 from O. rufipogon. The introgressed regions and their putative association with yield components in hybrids is reported and discussed.

  2. Dietary cladode powder from wild type and domesticated Opuntia species reduces atherogenesis in apoE knock-out mice.

    Science.gov (United States)

    Garoby-Salom, Sandra; Guéraud, Françoise; Camaré, Caroline; de la Rosa, Ana-Paulina Barba; Rossignol, Michel; Santos Díaz, María del Socorro; Salvayre, Robert; Negre-Salvayre, Anne

    2016-03-01

    Dietary intake of Opuntia species may prevent the development of cardiovascular diseases. The present study was designed to characterize the biological antioxidant and anti-inflammatory properties of Opuntia species and to investigate whether Opuntia cladodes prevent the development of atherosclerosis in vivo, in apoE(-)KO mice. The effects of the two Opuntia species, the wild Opuntia streptacantha and the domesticated Opuntia ficus-indica, were tested on the generation of intra- and extracellular reactive oxygen species (ROS) production and kinetics of the LDL oxidation by murine CRL2181 endothelial cells and on the subsequent inflammatory signaling leading to the adhesion of monocytes on the activated endothelium and the formation of foam cells. Opuntia species blocked the extracellular ROS (superoxide anion) generation and LDL oxidation by CRL2181, as well as the intracellular ROS rise and signaling evoked by the oxidized LDL, including the nuclear translocation of the transcription factor NFκB, the expression of ICAM-1 and VCAM-1 adhesion molecules, and the adhesion of monocytes to CRL2181. In vivo, Opuntia significantly reduced the formation of atherosclerotic lesions and the accumulation of 4-hydroxynonenal adducts in the vascular wall of apoE-KO mice, indicating that Opuntia cladodes prevent lipid oxidation in the vascular wall. In conclusion, wild and domesticated Opuntia species exhibit antioxidant, anti-inflammatory, and antiatherogenic properties which emphasize their nutritional benefit for preventing cardiovascular diseases.

  3. Herbicide resistance-endowing ACCase gene mutations in hexaploid wild oat (Avena fatua): insights into resistance evolution in a hexaploid species

    Science.gov (United States)

    Yu, Q; Ahmad-Hamdani, M S; Han, H; Christoffers, M J; Powles, S B

    2013-01-01

    Many herbicide-resistant weed species are polyploids, but far too little about the evolution of resistance mutations in polyploids is understood. Hexaploid wild oat (Avena fatua) is a global crop weed and many populations have evolved herbicide resistance. We studied plastidic acetyl-coenzyme A carboxylase (ACCase)-inhibiting herbicide resistance in hexaploid wild oat and revealed that resistant individuals can express one, two or three different plastidic ACCase gene resistance mutations (Ile-1781-Leu, Asp-2078-Gly and Cys-2088-Arg). Using ACCase resistance mutations as molecular markers, combined with genetic, molecular and biochemical approaches, we found in individual resistant wild-oat plants that (1) up to three unlinked ACCase gene loci assort independently following Mendelian laws for disomic inheritance, (2) all three of these homoeologous ACCase genes were transcribed, with each able to carry its own mutation and (3) in a hexaploid background, each individual ACCase resistance mutation confers relatively low-level herbicide resistance, in contrast to high-level resistance conferred by the same mutations in unrelated diploid weed species of the Poaceae (grass) family. Low resistance conferred by individual ACCase resistance mutations is likely due to a dilution effect by susceptible ACCase expressed by homoeologs in hexaploid wild oat and/or differential expression of homoeologous ACCase gene copies. Thus, polyploidy in hexaploid wild oat may slow resistance evolution. Evidence of coexisting non-target-site resistance mechanisms among wild-oat populations was also revealed. In all, these results demonstrate that herbicide resistance and its evolution can be more complex in hexaploid wild oat than in unrelated diploid grass weeds. Our data provide a starting point for the daunting task of understanding resistance evolution in polyploids. PMID:23047200

  4. Assessment of mammal reproduction for hunting sustainability through community-based sampling of species in the wild.

    Science.gov (United States)

    Mayor, Pedro; El Bizri, Hani; Bodmer, Richard E; Bowler, Mark

    2017-08-01

    Wildlife subsistence hunting is a major source of protein for tropical rural populations and a prominent conservation issue. The intrinsic rate of natural increase. (r max ) of populations is a key reproductive parameter in the most used assessments of hunting sustainability. However, researchers face severe difficulties in obtaining reproductive data in the wild, so these assessments often rely on classic reproductive rates calculated mostly from studies of captive animals conducted 30 years ago. The result is a flaw in almost 50% of studies, which hampers management decision making. We conducted a 15-year study in the Amazon in which we used reproductive data from the genitalia of 950 hunted female mammals. Genitalia were collected by local hunters. We examined tissue from these samples to estimate birthrates for wild populations of the 10 most hunted mammals. We compared our estimates with classic measures and considered the utility of the use of r max in sustainability assessments. For woolly monkey (Lagothrix poeppigii) and tapir (Tapirus terrestris), wild birthrates were similar to those from captive populations, whereas birthrates for other ungulates and lowland-paca (Cuniculus paca) were significantly lower than previous estimates. Conversely, for capuchin monkeys (Sapajus macrocephalus), agoutis (Dasyprocta sp.), and coatis (Nasua nasua), our calculated reproductive rates greatly exceeded often-used values. Researchers could keep applying classic measures compatible with our estimates, but for other species previous estimates of r max may not be appropriate. We suggest that data from local studies be used to set hunting quotas. Our maximum rates of population growth in the wild correlated with body weight, which suggests that our method is consistent and reliable. Integration of this method into community-based wildlife management and the training of local hunters to record pregnancies in hunted animals could efficiently generate useful information of life

  5. Some wild-growing plant species from Serbia and Montenegro as the potential sources of drugs.

    Science.gov (United States)

    Aljancić, I S; Vajs, V E; Tesević, V V; Milosavljević, S M

    2008-01-01

    The results of phytochemical investigation, over the last decade, of some wild-growing plant species from Serbia and Montenegro belonging to the families Asteraceae, Guttiferae and Gentianaceae are reported. Most of the investigated species are endemites and the emphasis in this report is on those exhibiting biological activities that could be regarded as the potential sources of drugs. This review comprises 154 compounds, e.g. sesquiterpene lactones and flavonoids (Asteraceae), xanthones, secoiridoids and C-glucoflavonoids (Gentanaceae) and prenylated phloroglucinols (Guttiferae) as well as some other secondary metabolites, produced by the above families, which could be of pharmacological interest.

  6. Use of Wild Relatives and Closely Related Species to Adapt Common Bean to Climate Change

    Directory of Open Access Journals (Sweden)

    James D. Kelly

    2013-05-01

    Full Text Available Common bean (Phaseolus vulgaris L. is an important legume crop worldwide. However, abiotic and biotic stress limits bean yields to <600 kg ha−1 in low-income countries. Current low yields result in food insecurity, while demands for increased yields to match the rate of population growth combined with the threat of climate change are significant. Novel and significant advances in genetic improvement using untapped genetic diversity available in crop wild relatives and closely related species must be further explored. A meeting was organized by the Global Crop Diversity Trust to consider strategies for common bean improvement. This review resulted from that meeting and considers our current understanding of the genetic resources available for common bean improvement and the progress that has been achieved thus far through introgression of genetic diversity from wild relatives of common bean, and from closely related species, including: P. acutifolius, P. coccineus, P. costaricensis and P. dumosus. Newly developed genomic tools and their potential applications are presented. A broad outline of research for use of these genetic resources for common bean improvement in a ten-year multi-disciplinary effort is presented.

  7. Submergence tolerance in Hordeum marinum

    DEFF Research Database (Denmark)

    Pedersen, Ole; Malik, Al I.; Colmer, Timothy D.

    2010-01-01

    Floodwaters differ markedly in dissolved CO(2), yet the effects of CO(2) on submergence responses of terrestrial plants have rarely been examined. The influence of dissolved CO(2) on underwater photosynthesis and growth was evaluated for three accessions of the wetland plant Hordeum marinum Huds....... All three accessions tolerated complete submergence, but only when in CO(2) enriched floodwater. Plants submerged for 7 days in water at air equilibrium (18 mM CO(2)) suffered loss of biomass, whereas those with 200 mM CO(2) continued to grow. Higher underwater net photosynthesis at 200 mM CO(2......) increased by 2.7- to 3.2-fold sugar concentrations in roots of submerged plants, compared with at air equilibrium CO(2). Leaf gas films enhancing gas exchange with floodwater, lack of a shoot elongation response conserving tissue sugars and high tissue porosity (24-31% in roots) facilitating internal O(2...

  8. Morphology and AFLP markers suggest three Hordeum chilense ecotypes that differ in avoidance to rust fungi

    NARCIS (Netherlands)

    Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.

    2001-01-01

    In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the

  9. Toxoplasmosis in wild and domestic animals

    Science.gov (United States)

    Toxoplasma gondii is widely distributed in wild and domestic animals. The present chapter reviews toxoplasmosis in wild and domestic animals. Coverage in wild animal species is limited to confirmed cases of toxoplasmosis, cases with parasite isolation, cases with parasite detection by PCR, and exper...

  10. Somatic embryogenesis from corolla tubes of interspecific amphiploids between cultivated sunflower (Helianthus annuus L.) and its wild species

    Science.gov (United States)

    Somatic embryogenesis in vitro provides an efficient means of plant multiplication, facilitating sunflower improvement and germplasm innovation. In the present study, using interspecific amphiploids (2n=4x=68) between cultivated sunflower and wild perennial Helianthus species as explant donors, soma...

  11. Foliar phenolic compounds of ten wild species of Verbenacea as antioxidants and specific chemomarkers

    Directory of Open Access Journals (Sweden)

    J. A. Ávila-Reyes

    2017-06-01

    Full Text Available Abstract The family Verbenaceae hosts important species used in traditional medicine of many countries. The taxonomic controversies concerning the specific delimitation of several of its species make it difficult to guarantee the botanical origin of herbal preparations based on species of this family. To contribute to the development of both specific chemomarkers and a quality control tool to authenticate the botanical origin of herbal preparations of Verbenacea species, we determined the foliar HPLC-DAD phenolic profiles and the antioxidant properties of 10 wild species of this family occurring in Mexico. The contents of phenols and flavonoids varied significantly among species. Priva mexicana showed the highest levels of total phenolics (53.4 mg g-1 dry tissue and Verbena carolina had the highest levels of flavonoids (17.89 mg g-1 dry tissue. Relevant antioxidant properties revealed by antiradical and reducing power were found for the analyzed species. These properties varied significantly in a species-dependent manner. The phenolic compounds accumulated were flavones and phenolic acids. Flavones were the only type of flavonoids found. The results of a cluster analysis showed that the compounds were accumulated in species-specific profiles. The phenolic profiles are proposed as valuable chemomarkers that can become a useful tool for the quality control concerning the botanical origin of herbal medicinal preparations based on the species analyzed. In addition, phenolic profiles could contribute importantly to solve the taxonomic controversies concerning species delimitation in the family Verbenaceae.

  12. Babesia spp. in European wild ruminant species: parasite diversity and risk factors for infection

    OpenAIRE

    Michel , Adam O; Mathis , Alexander; Ryser-Degiorgis , Marie-Pierre

    2014-01-01

    International audience; Babesia are tick-borne parasites that are increasingly considered as a threat to animal and public health. We aimed to assess the role of European free-ranging wild ruminants as maintenance mammalian hosts for Babesia species and to determine risk factors for infection. EDTA blood was collected from 222 roe deer (Capreolus c. capreolus), 231 red deer (Cervus e. elaphus), 267 Alpine chamois (Rupicapra r. rupicapra) and 264 Alpine ibex (Capra i. ibex) from all over Switz...

  13. Discerning Silk Produced by Bombyx mori from Those Produced by Wild Species Using an Enzyme-Linked Immunosorbent Assay Combined with Conventional Methods.

    Science.gov (United States)

    You, Qiushi; Li, Qingqing; Zheng, Hailing; Hu, Zhiwen; Zhou, Yang; Wang, Bing

    2017-09-06

    Recently, much interest has been paid to the separation of silk produced by Bombyx mori from silk produced by other species and tracing the beginnings of silk cultivation from wild silk exploitation. In this paper, significant differences between silks from Bombyx mori and other species were found by microscopy and spectroscopy, such as morphology, secondary structure, and amino acid composition. For further accurate identification, a diagnostic antibody was designed by comparing the peptide sequences of silks produced by Bombyx mori and other species. The results of the noncompetitive indirect enzyme-linked immunosorbent assay (ELISA) indicated that the antibody that showed good sensitivity and high specificity can definitely discern silk produced by Bombyx mori from silk produced by wild species. Thus, the antibody-based immunoassay has the potential to be a powerful tool for tracing the beginnings of silk cultivation. In addition, combining the sensitive, specific, and convenient ELISA technology with other conventional methods can provide more in-depth and accurate information for species identification.

  14. Parasites of domestic and wild animals in South Africa. XLIV. Fleas (Insecta : Siphonaptera : Pulicidae collected from 15 carnivore species

    Directory of Open Access Journals (Sweden)

    I.G. Horak

    2004-11-01

    Full Text Available Fleas were collected from 61 wild carnivores belonging to 13 species in various nature reserves and on farms, two feral domestic cats in a nature reserve and a domestic dog in the city of Johannesburg. Eleven flea species, including two subspecies of one of these, belonging to six genera were recovered. Amongst these only Ctenocephalides felis felis and Ctenocephalides felis strongylus are considered specific parasites of carnivores. The remaining ten species normally infest the prey animals of the various carnivores.

  15. Potential Implications of Climate Change on Aegilops Species Distribution: Sympatry of These Crop Wild Relatives with the Major European Crop Triticum aestivum and Conservation Issues.

    Science.gov (United States)

    Ostrowski, Marie-France; Prosperi, Jean-Marie; David, Jacques

    2016-01-01

    Gene flow from crop to wild relatives is a common phenomenon which can lead to reduced adaptation of the wild relatives to natural ecosystems and/or increased adaptation to agrosystems (weediness). With global warming, wild relative distributions will likely change, thus modifying the width and/or location of co-occurrence zones where crop-wild hybridization events could occur (sympatry). This study investigates current and 2050 projected changes in sympatry levels between cultivated wheat and six of the most common Aegilops species in Europe. Projections were generated using MaxEnt on presence-only data, bioclimatic variables, and considering two migration hypotheses and two 2050 climate scenarios (RCP4.5 and RCP8.5). Overall, a general decline in suitable climatic conditions for Aegilops species outside the European zone and a parallel increase in Europe were predicted. If no migration could occur, the decline was predicted to be more acute outside than within the European zone. The potential sympatry level in Europe by 2050 was predicted to increase at a higher rate than species richness, and most expansions were predicted to occur in three countries, which are currently among the top four wheat producers in Europe: Russia, France and Ukraine. The results are also discussed with regard to conservation issues of these crop wild relatives.

  16. Study of the Metatranscriptome of Eight Social and Solitary Wild Bee Species Reveals Novel Viruses and Bee Parasites.

    Science.gov (United States)

    Schoonvaere, Karel; Smagghe, Guy; Francis, Frédéric; de Graaf, Dirk C

    2018-01-01

    Bees are associated with a remarkable diversity of microorganisms, including unicellular parasites, bacteria, fungi, and viruses. The application of next-generation sequencing approaches enables the identification of this rich species composition as well as the discovery of previously unknown associations. Using high-throughput polyadenylated ribonucleic acid (RNA) sequencing, we investigated the metatranscriptome of eight wild bee species ( Andrena cineraria, Andrena fulva, Andrena haemorrhoa, Bombus terrestris, Bombus cryptarum, Bombus pascuorum, Osmia bicornis , and Osmia cornuta ) sampled from four different localities in Belgium. Across the RNA sequencing libraries, 88-99% of the taxonomically informative reads were of the host transcriptome. Four viruses with homology to insect pathogens were found including two RNA viruses (belonging to the families Iflaviridae and Tymoviridae that harbor already viruses of honey bees), a double stranded DNA virus (family Nudiviridae ) and a single stranded DNA virus (family Parvoviridae ). In addition, we found genomic sequences of 11 unclassified arthropod viruses (related to negeviruses, sobemoviruses, totiviruses, rhabdoviruses, and mononegaviruses), seven plant pathogenic viruses, and one fungal virus. Interestingly, nege-like viruses appear to be widespread, host-specific, and capable of attaining high copy numbers inside bees. Next to viruses, three novel parasite associations were discovered in wild bees, including Crithidia pragensis and a tubulinosematid and a neogregarine parasite. Yeasts of the genus Metschnikowia were identified in solitary bees. This study gives a glimpse of the microorganisms and viruses associated with social and solitary wild bees and demonstrates that their diversity exceeds by far the subset of species first discovered in honey bees.

  17. Study of the Metatranscriptome of Eight Social and Solitary Wild Bee Species Reveals Novel Viruses and Bee Parasites

    Directory of Open Access Journals (Sweden)

    Karel Schoonvaere

    2018-02-01

    Full Text Available Bees are associated with a remarkable diversity of microorganisms, including unicellular parasites, bacteria, fungi, and viruses. The application of next-generation sequencing approaches enables the identification of this rich species composition as well as the discovery of previously unknown associations. Using high-throughput polyadenylated ribonucleic acid (RNA sequencing, we investigated the metatranscriptome of eight wild bee species (Andrena cineraria, Andrena fulva, Andrena haemorrhoa, Bombus terrestris, Bombus cryptarum, Bombus pascuorum, Osmia bicornis, and Osmia cornuta sampled from four different localities in Belgium. Across the RNA sequencing libraries, 88–99% of the taxonomically informative reads were of the host transcriptome. Four viruses with homology to insect pathogens were found including two RNA viruses (belonging to the families Iflaviridae and Tymoviridae that harbor already viruses of honey bees, a double stranded DNA virus (family Nudiviridae and a single stranded DNA virus (family Parvoviridae. In addition, we found genomic sequences of 11 unclassified arthropod viruses (related to negeviruses, sobemoviruses, totiviruses, rhabdoviruses, and mononegaviruses, seven plant pathogenic viruses, and one fungal virus. Interestingly, nege-like viruses appear to be widespread, host-specific, and capable of attaining high copy numbers inside bees. Next to viruses, three novel parasite associations were discovered in wild bees, including Crithidia pragensis and a tubulinosematid and a neogregarine parasite. Yeasts of the genus Metschnikowia were identified in solitary bees. This study gives a glimpse of the microorganisms and viruses associated with social and solitary wild bees and demonstrates that their diversity exceeds by far the subset of species first discovered in honey bees.

  18. Characterization and partial purification of beta-1,3-D-glucan (callose) synthase from barley (Hordeum vulgare) leaves

    DEFF Research Database (Denmark)

    Pedersen, L.H.; Jacobsen, S.; Hejgaard, J.

    1993-01-01

    The plasma membrane bound beta-1,3-D-glucan (callose) synthase. assumed to be involved in the resistance to the powdery mildew fungus (Erysiphe graminis f.sp. hordei), was partially purified from a microsomal fraction of green barley leaves (Hordeum vulgare L.). Plasma membranes were enriched...

  19. A globally-distributed alien invasive species poses risks to United States imperiled species.

    Science.gov (United States)

    McClure, Meredith L; Burdett, Christopher L; Farnsworth, Matthew L; Sweeney, Steven J; Miller, Ryan S

    2018-03-28

    In the midst of Earth's sixth mass extinction event, non-native species are a driving factor in many imperiled species' declines. One of the most widespread and destructive alien invasive species in the world, wild pigs (Sus scrofa) threaten native species through predation, habitat destruction, competition, and disease transmission. We show that wild pigs co-occur with up to 87.2% of imperiled species in the contiguous U.S. identified as susceptible to their direct impacts, and we project increases in both the number of species at risk and the geographic extent of risks by 2025. Wild pigs may therefore present a severe threat to U.S. imperiled species, with serious implications for management of at-risk species throughout wild pigs' global distribution. We offer guidance for efficient allocation of research effort and conservation resources across species and regions using a simple approach that can be applied to wild pigs and other alien invasive species globally.

  20. Genetic diversity of wild and cultivated Rubus species in Colombia using AFLP and SSR markers

    Directory of Open Access Journals (Sweden)

    Sandra Bibiana Aguilar

    2007-01-01

    Full Text Available The Andean blackberry belongs to the genus Rubus, the largest of the Rosaceae family and one of the mostdiverse of the plant kingdom. In Colombia Rubus glaucus Benth, known as the Andean raspberry or blackberry, is one of thenine edible of the genus out of forty-four reported species. In this study wild and cultivated genotypes, collected in the CentralAndes of Colombia were analyzed by AFLP and SSR markers. Sexual reproduction seems to play an important role inmaintaining the genetic variability in R. glaucus, and the viability of using the SSR of Rubus alceifolius to characterizeColombian Rubus species was clearly demonstrated. All species evaluated produced very specific banding patterns,differentiating them from the others. Both AFLP and SSR produced bands exclusive to each of the following species: R.robustus, R. urticifolius, R. glaucus, and R. rosifolius. The SSR markers differentiated diploid and tetraploid genotypes of R.glaucus.

  1. Low genetic diversity of the endangered Indian wild ass Equus ...

    Indian Academy of Sciences (India)

    DEVENDRA KHAIRE

    (Equus hemionus khur) belongs to an endangered wild species/subspecies of wild ... species of the Asiatic wild asses, E. hemionus and E. kiang, have been described on .... 57.9. Tseng et al. (2010). 5 -TCA CCC ACT AAA TCT CAA ATC C-3.

  2. Potential species distribution and richness of ixodidae ticks associated with wild vertebrates from Michoacán, Mexico

    NARCIS (Netherlands)

    Vargas-Sandoval, Margarita; Priego-Santander, Angel G.; Larrazabal de la Via, Alejandra Patricia; Sosa-Gutiérrez, Carolina G.; Lara-Chávez, Blanca; Avila-Val, Teresita

    2014-01-01

    Ticks are regarded as the most relevant vectors of disease-causing pathogens in domestic and wild animals. The diversity of Ixodidae is known for a very small number of genera. Ixodes are repre- sented by 26 species, and in 2007 the first reported ticks vectors in Mexico for the causal agent of Lyme

  3. New Microsatellite Markers for Wild and Commercial Species of Passiflora (Passifloraceae and Cross-Amplification

    Directory of Open Access Journals (Sweden)

    Carlos B. M. Cerqueira-Silva

    2014-02-01

    Full Text Available Premise of the study: We developed the first microsatellites for Passiflora setacea and characterized new sets of markers for P. edulis and P. cincinnata, enabling further genetic diversity studies to support the conservation and breeding of passion fruit species. Methods and Results: We developed 69 microsatellite markers and, in conjunction with assessments of cross-amplification using primers available from the literature, present 43 new polymorphic microsatellite loci for three species of Passiflora. The mean number of alleles per locus was 3.1, and the mean values of the expected and observed levels of heterozygosity were 0.406 and 0.322, respectively. Conclusions: These microsatellite markers will be valuable tools for investigating the genetic diversity and population structure of wild and commercial species of passion fruit (Passiflora spp. and may be useful for developing conservation and improvement strategies by contributing to the understanding of the mating system and hybridization within the genus.

  4. Anatomy and histology of the Fibrocartilago humerocapsularis in some species of European wild birds.

    Science.gov (United States)

    Canova, Marco; Bombardi, Cristiano; De Sordi, Nadia; Clavenzani, Paolo; Grandis, Annamaria

    2014-07-01

    The occurrence and structure of the fibrocartilago humerocapsularis (FHC) in the shoulders of 72 subjects of various species of wild birds were evaluated by gross dissection and histological examination with the purpose of increasing the body of knowledge regarding this structure and verifying the functional hypotheses submitted in the past in other species. The results showed that the FHC has a conical shape with a narrow cavity on the inside. The structure is heterogeneous in the various species and consists of different tissues, such as hyaline cartilage, fibrous cartilage, and bone. From the data obtained in this study, there does not appear to be any correlation between ossification and the weight of the prey lifted, wing shape, and aging. This study also provided interesting preliminary data regarding the ossification of the FHC. In fact, in the Hooded Crow (Corvus cornix), the ossification seemed to be correlated with the mechanical stimulation of flying. Additional studies are necessary to confirm this hypothesis. © 2014 Wiley Periodicals, Inc.

  5. Crop-to-wild gene flow and its fitness consequences for a wild fruit tree: Towards a comprehensive conservation strategy of the wild apple in Europe.

    Science.gov (United States)

    Feurtey, Alice; Cornille, Amandine; Shykoff, Jacqui A; Snirc, Alodie; Giraud, Tatiana

    2017-02-01

    Crop-to-wild gene flow can reduce the fitness and genetic integrity of wild species. Malus sylvestris , the European crab-apple fruit tree in particular, is threatened by the disappearance of its habitat and by gene flow from its domesticated relative , Malus domestica . With the aims of evaluating threats for M. sylvestris and of formulating recommendations for its conservation, we studied here, using microsatellite markers and growth experiments: (i) hybridization rates in seeds and trees from a French forest and in seeds used for replanting crab apples in agrosystems and in forests, (ii) the impact of the level of M. domestica ancestry on individual tree fitness and (iii) pollen dispersal abilities in relation to crop-to-wild gene flow. We found substantial contemporary crop-to-wild gene flow in crab-apple tree populations and superior fitness of hybrids compared to wild seeds and seedlings. Using paternity analyses, we showed that pollen dispersal could occur up to 4 km and decreased with tree density. The seed network furnishing the wild apple reintroduction agroforestry programmes was found to suffer from poor genetic diversity, introgressions and species misidentification. Overall, our findings indicate supported threats for the European wild apple steering us to provide precise recommendations for its conservation.

  6. Viability and Risk Assessment in Species Restoration: Planning Reintroductions for the Wild Boar, a Potential Disease Reservoir

    Directory of Open Access Journals (Sweden)

    Néstor Fernández

    2006-06-01

    Full Text Available The reintroduction of large mammals is often considered a priority conservation action in highly industrialized countries in which many of these species have been depleted. However, species reintroduction after decades of absence may involve important risks for human activities and ecological communities, such as favoring the spread of diseases. An example of a potentially troublesome reintroduction is the wild boar, which may act as a reservoir of diseases, e.g., classical swine fever, and cause high economic losses, and has become a species of concern in several European countries for both ecological and recreational reasons. Failure to prevent the disease consequences of species restoration can negate its conservation benefits. Here we evaluated the probability of both successfully reintroducing wild boar into Denmark and limiting their contact with domestic pig farms to which they might spread disease. For this purpose, we developed a spatially explicit, individual-based population model that incorporates information on boar habitat and demography information from Central European populations. We then compared model predictions with the spatial distribution of farms to achieve a spatial assessment of the contact risk. The most restrictive model scenario predicted that nearly 6% of Denmark provides habitat conditions that would allow wild boar to reproduce. The best habitats for reintroduction were aggregated in seven different areas throughout the country in which the extinction probability was < 5%. However, the expected population expansion was very limited in most of these areas. Both the number of suitable areas and the potential for population expansion greatly increased when we relaxed our habitat assumptions about boar forest requirements; this provided a more conservative scenario for a cautious risk analysis. We additionally found that part of the risk of contact with piggeries was associated with the magnitude of the expansion

  7. Morphoagronomic genetic diversity in american wild rice species

    Directory of Open Access Journals (Sweden)

    Elizabeth Ann Veasey

    2008-02-01

    Full Text Available To characterize the genetic variability among species and populations of South American wild rice, eleven populations of Oryza glumaepatula, seven of O. grandiglumis, four of O. latifolia and one of O. alta, from Brazil and Argentina, were evaluated. A greenhouse experiment was conducted in completely randomized blocks with 23 treatments. Twenty morphoagronomic traits were assessed. Univariate analyses were performed with 16 quantitative traits with the partitioning of populations within species. Significant differences (pVisando caracterizar a diversidade genética entre espécies e populações de arroz selvagem da América do Sul, foram avaliadas 11 populações de Oryza glumaepatula, sete de O. grandiglumis, quatro de O. latifolia e uma população de O. alta, originárias do Brasil e Argentina. Foi conduzido um experimento em casa-de-vegetação em blocos ao acaso com 23 tratamentos. Vinte caracteres agro-morfológicos foram avaliados. Análises univariadas foram realizadas para 16 caracteres quantitativos, desdobrando-se o efeito de populações dentro de espécies. Diferenças significativas (p<0,001 entre espécies foram observadas para todos os caracteres bem como entre populações dentro de espécies. A mais variável foi O. glumaepatula seguida de O. latifolia. Análises de agrupamento e discriminante canônica confirmaram a separação das populações de O. glumaepatula das espécies tetraplóides, e a grande variação genética entre populações de O. latifolia. Diferenças morfológicas entre as três espécies tetraplóides parecem suficientes para classificá-las como espécies pelo menos na condição statu nascendi.

  8. Seroprevalence of pestivirus in four species of alpine wild ungulates in the High Valley of Susa, Italy.

    Science.gov (United States)

    Olde Riekerink, R G M; Dominici, A; Barkema, H W; de Smit, A J

    2005-07-01

    Wildlife, once infected, can serve as a reservoir of infectious diseases that form a constant threat to domestic livestock. To make control and eradication programs successful in the long-term, presence of pestivirus in wildlife populations should be monitored. The goal of this study was to investigate seroprevalence of pestivirus in four alpine wild ungulates in the High Valley of Susa, north-west Italy. Species studied were: red deer (Cervus elaphus), roe deer (Capreolus capreolus), wild boar (Sus scrofa) and chamois (Rupicapra rupicapra). A further goal was using virus neutralisation tests (VNT) for four strains of pestivirus in chamois and wild boar. Three hundred and seventy-five serum samples collected during the hunting season of 1999 were tested for pestivirus specific antibodies. Positive sera of chamois and wild boar were subsequently tested in a VNT with four major subtypes of pestivirus, and virus isolation was performed. No antibodies were found in the 73 samples of roe deer, while 7 (12.5%), 8 (5.9%) and 28 (25.5%) of 56, 136 and 110 samples of wild boar, red deer and chamois were ELISA-positive, respectively. Different ranges of titers were found in the VNT and no pestivirus was isolated in the ELISA-positive wild boar and chamois samples. Several possibilities, which might explain the high seroprevalence in chamois are discussed. Pestivirus antibodies were found in three out of four large alpine ungulates in the High Valley of Susa. Seroprevalence was particularly high in chamois. Further investigation is needed to characterise the pestiviruses that circulate in these animals.

  9. Evidence of bovine viral diarrhea virus infection in three species of sympatric wild ungulates in Nevada: life history strategies may maintain endemic infections in wild populations

    Directory of Open Access Journals (Sweden)

    Peregrine Lee Wolff

    2016-03-01

    Full Text Available Evidence for bovine viral diarrhea virus (BVDV infection was detected in 2009-10 while investigating a pneumonia die-off in Rocky Mountain bighorn sheep (Ovis canadensis canadensis, and sympatric mountain goats (Oreamnos americanum in adjacent mountain ranges in Elko County, Nevada. Seroprevalence to BVDV-1 was 81% (N=32 in the bighorns and 100% (N=3 in the mountain goats. Serosurveillance from 2011 to 2015 of surviving bighorns and mountain goats as well as sympatric mule deer (Odocoileus hemionus, indicated a prevalence of 72% (N=45, 45% (N=51, and 51% (N=342 respectively. All species had antibody titers to BVDV1 and BVDV2. BVDV1 was isolated in cell culture from three bighorn sheep and a mountain goat kid. BVDV2 was isolated from two mule deer. Six deer (N=96 sampled in 2013 were positive for BVDV by antigen-capture ELISA on ear notch. Wild ungulates and cattle concurrently graze public and private lands in these two mountain ranges, thus providing potential for interspecies viral transmission. Like cattle, mule deer, mountain goats, and bighorn sheep can be infected with BVDV and can develop clinical disease including immunosuppression. Winter migration patterns that increase densities and species interaction during the first and second trimester of gestation may contribute to the long term maintenance of the virus in these wild ungulates. More studies are needed to determine the population level impacts of BVDV infection on these three species.

  10. Thyroid hormones correlate with basal metabolic rate but not field metabolic rate in a wild bird species.

    Directory of Open Access Journals (Sweden)

    Jorg Welcker

    Full Text Available Thyroid hormones (TH are known to stimulate in vitro oxygen consumption of tissues in mammals and birds. Hence, in many laboratory studies a positive relationship between TH concentrations and basal metabolic rate (BMR has been demonstrated whereas evidence from species in the wild is scarce. Even though basal and field metabolic rates (FMR are often thought to be intrinsically linked it is still unknown whether a relationship between TH and FMR exists. Here we determine the relationship between the primary thyroid hormone triiodothyronine (T3 with both BMR and FMR in a wild bird species, the black-legged kittiwake (Rissa tridactyla. As predicted we found a strong and positive relationship between plasma concentrations of T3 and both BMR and mass-independent BMR with coefficients of determination ranging from 0.36 to 0.60. In contrast there was no association of T3 levels with either whole-body or mass-independent FMR (R(2 =0.06 and 0.02, respectively. In accordance with in vitro studies our data suggests that TH play an important role in modulating BMR and may serve as a proxy for basal metabolism in wild birds. However, the lack of a relationship between TH and FMR indicates that levels of physical activity in kittiwakes are largely independent of TH concentrations and support recent studies that cast doubt on a direct linkage between BMR and FMR.

  11. Thyroid Hormones Correlate with Basal Metabolic Rate but Not Field Metabolic Rate in a Wild Bird Species

    Science.gov (United States)

    Welcker, Jorg; Chastel, Olivier; Gabrielsen, Geir W.; Guillaumin, Jerome; Kitaysky, Alexander S.; Speakman, John R.; Tremblay, Yann; Bech, Claus

    2013-01-01

    Thyroid hormones (TH) are known to stimulate in vitro oxygen consumption of tissues in mammals and birds. Hence, in many laboratory studies a positive relationship between TH concentrations and basal metabolic rate (BMR) has been demonstrated whereas evidence from species in the wild is scarce. Even though basal and field metabolic rates (FMR) are often thought to be intrinsically linked it is still unknown whether a relationship between TH and FMR exists. Here we determine the relationship between the primary thyroid hormone triiodothyronine (T3) with both BMR and FMR in a wild bird species, the black-legged kittiwake (Rissa tridactyla). As predicted we found a strong and positive relationship between plasma concentrations of T3 and both BMR and mass-independent BMR with coefficients of determination ranging from 0.36 to 0.60. In contrast there was no association of T3 levels with either whole-body or mass-independent FMR (R2 = 0.06 and 0.02, respectively). In accordance with in vitro studies our data suggests that TH play an important role in modulating BMR and may serve as a proxy for basal metabolism in wild birds. However, the lack of a relationship between TH and FMR indicates that levels of physical activity in kittiwakes are largely independent of TH concentrations and support recent studies that cast doubt on a direct linkage between BMR and FMR. PMID:23437096

  12. Parasites of domestic and wild animals in South Africa. XLVIII . Ticks (Acari: Ixodidae infesting domestic cats and wild felids in southern Africa

    Directory of Open Access Journals (Sweden)

    Ivan G. Horak

    2010-11-01

    Full Text Available Ticks collected from domestic cats (Felis catus, cheetahs (Acinonyx jubatus,caracals (Caracal caracal, African wild cats (Felis lybica, black-footed cats (Felis nigripes, a serval (Leptailurus serval, lions(Panthera leo, and leopards (Panthera pardus were identified and counted. Thirteen species of ixodid ticks and one argasid tick were identified from domestic cats and 17 species of ixodid ticks from wild felids. The domestic cats and wild felids harboured 11 ixodid species in common. The adults of Haemaphysalis elliptica, the most abundant tick species infesting cats and wild felids, were most numerous on a domestic cat in late winter and in mid-summer, during 2 consecutive years. The recorded geographic distribution of the recently described Haemaphysalis colesbergensis, a parasite of cats and caracals, was extended by 2 new locality records in the Northern Cape Province,South Africa.

  13. Wild food plants of Remote Oceania

    Directory of Open Access Journals (Sweden)

    Will C. McClatchey

    2012-11-01

    Full Text Available Agricultural societies partly depend upon wild foods. Relationships between an agricultural society and its wild foods can be explored by examining how the society responds through colonization of new lands that have not been previously inhabited. The oldest clear example of this phenomenon took place about 5000 years ago in the tropical Western Pacific at the “boundary” interface between Near and Remote Oceania. An inventory of wild and domesticated food plants used by people living along “the remote side of ” that interface has been prepared from the literature. This was then assessed for the roles of plants at the time of original colonization of Remote Oceania. The majority of species are wild foods, and most of these are used as leafy vegetables and fruits. The wild food plants mostly serve as supplements to domesticated species, although there are a few that can be used as substitutes for traditional staples.

  14. Chemical composition of some wild peanut species (Arachis L.) seeds.

    Science.gov (United States)

    Grosso, N R; Nepote, V; Guzmán, C A

    2000-03-01

    Oil, protein, ash, and carbohydrate contents, iodine value, and fatty acid and sterol compositions were studied in seeds of Arachis trinitensis, A. chiquitana, A. kempff-mercadoi, A. diogoi, A. benensis, A. appressipila, A. valida, A. kretschmeri, A. helodes, A. kuhlmannii, A. williamsii, A. sylvestris, A. matiensis, A. pintoi, A. hoehnei, A. villosa, and A. stenosperma. Oil content was greatest in A.stenosperma (mean value = 51.8%). The protein level was higher in A. sylvestris (30.1%) and A. villosa (29.5%). Mean value of oleic acid varied between 30.6% (A. matiensis) and 46.8% (Arachis villosa), and linoleic acid oscillated between 34.1% (A. villosa) and 47.4% (A. appressipila). The better oleic-to-linoleic (O/L) ratio was exhibited by A. villosa (1.38). Some species showed higher concentration of behenic acid. The greatest level of this fatty acid was found in A. matiensis (6.2%). Iodine value was lower in A. valida (99.2). The sterol composition in the different peanut species showed higher concentration of beta-sitosterol (mean values oscillated between 55.7 and 60.2%) followed by campesterol (12.4-16. 5%), stigmasterol (9.7-13.3%), and Delta(5)-avenasterol (9.7-13.4%). The chemical quality and stability of oils (iodine value and O/L ratio) from wild peanut studied in this work are not better than those of cultivated peanut.

  15. Generalists at the interface: Nematode transmission between wild and domestic ungulates.

    Science.gov (United States)

    Walker, Josephine G; Morgan, Eric R

    2014-12-01

    Many parasitic nematode species are generalists capable of infecting multiple host species. The complex life cycle of nematodes, involving partial development outside of the host, facilitates transmission of these parasites between host species even when there is no direct contact between hosts. Infective nematode larvae persist in the environment, and where grazing or water sources are shared ingestion of parasite larvae deposited by different host species is likely. In this paper we examine the extent to which nematode parasite species have been observed in sympatric wild and domestic ungulates. First, using existing host-parasite databases, we describe expected overlap of 412 nematode species between 76 wild and 8 domestic ungulate host species. Our results indicate that host-specific parasites make up less than half of the nematode parasites infecting any particular ungulate host species. For wild host species, between 14% (for common warthog) and 76% (for mouflon) of parasitic nematode species are shared with domestic species. For domestic host species, between 42% (for horse) and 77% (for llamas/alpacas) of parasitic nematode species are shared with wild species. We also present an index of liability to describe the risk of cross-boundary parasites to each host species. We then examine specific examples from the literature in which transmission of nematode parasites between domestic and wild ungulates is described. However, there are many limitations in the existing data due to geographical bias and certain host species being studied more frequently than others. Although we demonstrate that many species of parasitic nematode are found in both wild and domestic hosts, little work has been done to demonstrate whether transmission is occurring between species or whether similar strains circulate separately. Additional research on cross-species transmission, including the use of models and of genetic methods to define strains, will provide evidence to answer this

  16. Generalists at the interface: Nematode transmission between wild and domestic ungulates

    Directory of Open Access Journals (Sweden)

    Josephine G. Walker

    2014-12-01

    Full Text Available Many parasitic nematode species are generalists capable of infecting multiple host species. The complex life cycle of nematodes, involving partial development outside of the host, facilitates transmission of these parasites between host species even when there is no direct contact between hosts. Infective nematode larvae persist in the environment, and where grazing or water sources are shared ingestion of parasite larvae deposited by different host species is likely. In this paper we examine the extent to which nematode parasite species have been observed in sympatric wild and domestic ungulates. First, using existing host–parasite databases, we describe expected overlap of 412 nematode species between 76 wild and 8 domestic ungulate host species. Our results indicate that host-specific parasites make up less than half of the nematode parasites infecting any particular ungulate host species. For wild host species, between 14% (for common warthog and 76% (for mouflon of parasitic nematode species are shared with domestic species. For domestic host species, between 42% (for horse and 77% (for llamas/alpacas of parasitic nematode species are shared with wild species. We also present an index of liability to describe the risk of cross-boundary parasites to each host species. We then examine specific examples from the literature in which transmission of nematode parasites between domestic and wild ungulates is described. However, there are many limitations in the existing data due to geographical bias and certain host species being studied more frequently than others. Although we demonstrate that many species of parasitic nematode are found in both wild and domestic hosts, little work has been done to demonstrate whether transmission is occurring between species or whether similar strains circulate separately. Additional research on cross-species transmission, including the use of models and of genetic methods to define strains, will provide

  17. Transferability of short tandem repeat markers for two wild Canid species inhabiting the Brazilian Cerrado.

    Science.gov (United States)

    Rodrigues, F M; Telles, M P C; Resende, L V; Soares, T N; Diniz-Filho, J A F; Jácomo, A T A; Silveira, L

    2006-12-13

    The maned wolf (Chrysocyon brachyurus) and the crab-eating fox (Cerdocyon thous) are two wild-canid species found in the Brazilian Cerrado. We tested cross-amplification and transferability of 29 short tandem repeat primers originally developed for cattle and domestic dogs and cats on 38 individuals of each of these two species, collected in the Emas National Park, which is the largest national park in the Cerrado region. Six of these primers were successfully transferred (CSSM-038, PEZ-05, PEZ-12, LOCO-13, LOCO-15, and PEZ-20); five of which were found to be polymorphic. Genetic parameter values (number of alleles per locus, observed and expected heterozygosities, and fixation indices) were within the expected range reported for canid populations worldwide.

  18. Comparative shotgun proteomic analysis of wild and domesticated Opuntia spp. species shows a metabolic adaptation through domestication.

    Science.gov (United States)

    Pichereaux, Carole; Hernández-Domínguez, Eric E; Santos-Diaz, Maria Del Socorro; Reyes-Agüero, Antonio; Astello-García, Marizel; Guéraud, Françoise; Negre-Salvayre, Anne; Schiltz, Odile; Rossignol, Michel; Barba de la Rosa, Ana Paulina

    2016-06-30

    The Opuntia genus is widely distributed in America, but the highest richness of wild species are found in Mexico, as well as the most domesticated Opuntia ficus-indica, which is the most domesticated species and an important crop in agricultural economies of arid and semiarid areas worldwide. During domestication process, the Opuntia morphological characteristics were favored, such as less and smaller spines in cladodes and less seeds in fruits, but changes at molecular level are almost unknown. To obtain more insights about the Opuntia molecular changes through domestication, a shotgun proteomic analysis and database-dependent searches by homology was carried out. >1000 protein species were identified and by using a label-free quantitation method, the Opuntia proteomes were compared in order to identify differentially accumulated proteins among wild and domesticated species. Most of the changes were observed in glucose, secondary, and 1C metabolism, which correlate with the observed protein, fiber and phenolic compounds accumulation in Opuntia cladodes. Regulatory proteins, ribosomal proteins, and proteins related with response to stress were also observed in differential accumulation. These results provide new valuable data that will help to the understanding of the molecular changes of Opuntia species through domestication. Opuntia species are well adapted to dry and warm conditions in arid and semiarid regions worldwide, and they are highly productive plants showing considerable promises as an alternative food source. However, there is a gap regarding Opuntia molecular mechanisms that enable them to grow in extreme environmental conditions and how the domestication processes has changed them. In the present study, a shotgun analysis was carried out to characterize the proteomes of five Opuntia species selected by its domestication degree. Our results will help to a better understanding of proteomic features underlying the selection and specialization under

  19. Farmers without borders-genetic structuring in century old barley (Hordeum vulgare).

    Science.gov (United States)

    Forsberg, N E G; Russell, J; Macaulay, M; Leino, M W; Hagenblad, J

    2015-02-01

    The geographic distribution of genetic diversity can reveal the evolutionary history of a species. For crop plants, phylogeographic patterns also indicate how seed has been exchanged and spread in agrarian communities. Such patterns are, however, easily blurred by the intense seed trade, plant improvement and even genebank conservation during the twentieth century, and discerning fine-scale phylogeographic patterns is thus particularly challenging. Using historical crop specimens, these problems are circumvented and we show here how high-throughput genotyping of historical nineteenth century crop specimens can reveal detailed geographic population structure. Thirty-one historical and nine extant accessions of North European landrace barley (Hordeum vulgare L.), in total 231 individuals, were genotyped on a 384 single nucleotide polymorphism assay. The historical material shows constant high levels of within-accession diversity, whereas the extant accessions show more varying levels of diversity and a higher degree of total genotype sharing. Structure, discriminant analysis of principal components and principal component analysis cluster the accessions in latitudinal groups across country borders in Finland, Norway and Sweden. FST statistics indicate strong differentiation between accessions from southern Fennoscandia and accessions from central or northern Fennoscandia, and less differentiation between central and northern accessions. These findings are discussed in the context of contrasting historical records on intense within-country south to north seed movement. Our results suggest that although seeds were traded long distances, long-term cultivation has instead been of locally available, possibly better adapted, genotypes.

  20. Complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera, and comparative analyses with other grass genomes

    Science.gov (United States)

    Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu

    2009-01-01

    Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593

  1. Possible evidence for transport of an iron cyanide complex by plants

    International Nuclear Information System (INIS)

    Samiotakis, M.; Ebbs, S.D.

    2004-01-01

    Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to 15 N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots (δ 15 N%o=1000-1500) and shoots (δ 15 N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater 15 N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane

  2. Possible evidence for transport of an iron cyanide complex by plants

    Energy Technology Data Exchange (ETDEWEB)

    Samiotakis, M.; Ebbs, S.D

    2004-01-01

    Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to {sup 15}N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots ({delta} {sup 15}N%o=1000-1500) and shoots ({delta} {sup 15}N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater {sup 15}N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane.

  3. Recovering the Genetic Identity of an Extinct-in-the-Wild Species: The Puzzling Case of the Alagoas Curassow.

    Science.gov (United States)

    Costa, Mariellen C; Oliveira, Paulo R R; Davanço, Paulo V; Camargo, Crisley de; Laganaro, Natasha M; Azeredo, Roberto A; Simpson, James; Silveira, Luis F; Francisco, Mercival R

    2017-01-01

    The conservation of many endangered taxa relies on hybrid identification, and when hybrids become morphologically indistinguishable from the parental species, the use of molecular markers can assign individual admixture levels. Here, we present the puzzling case of the extinct in the wild Alagoas Curassow (Pauxi mitu), whose captive population descends from only three individuals. Hybridization with the Razor-billed Curassow (P. tuberosa) began more than eight generations ago, and admixture uncertainty affects the whole population. We applied an analysis framework that combined morphological diagnostic traits, Bayesian clustering analyses using 14 microsatellite loci, and mtDNA haplotypes to assess the ancestry of all individuals that were alive from 2008 to 2012. Simulated data revealed that our microsatellites could accurately assign an individual a hybrid origin until the second backcross generation, which permitted us to identify a pure group among the older, but still reproductive animals. No wild species has ever survived such a severe bottleneck, followed by hybridization, and studying the recovery capability of the selected pure Alagoas Curassow group might provide valuable insights into biological conservation theory.

  4. Recovering the Genetic Identity of an Extinct-in-the-Wild Species: The Puzzling Case of the Alagoas Curassow.

    Directory of Open Access Journals (Sweden)

    Mariellen C Costa

    Full Text Available The conservation of many endangered taxa relies on hybrid identification, and when hybrids become morphologically indistinguishable from the parental species, the use of molecular markers can assign individual admixture levels. Here, we present the puzzling case of the extinct in the wild Alagoas Curassow (Pauxi mitu, whose captive population descends from only three individuals. Hybridization with the Razor-billed Curassow (P. tuberosa began more than eight generations ago, and admixture uncertainty affects the whole population. We applied an analysis framework that combined morphological diagnostic traits, Bayesian clustering analyses using 14 microsatellite loci, and mtDNA haplotypes to assess the ancestry of all individuals that were alive from 2008 to 2012. Simulated data revealed that our microsatellites could accurately assign an individual a hybrid origin until the second backcross generation, which permitted us to identify a pure group among the older, but still reproductive animals. No wild species has ever survived such a severe bottleneck, followed by hybridization, and studying the recovery capability of the selected pure Alagoas Curassow group might provide valuable insights into biological conservation theory.

  5. Aerobic salivary bacteria in wild and captive Komodo dragons.

    Science.gov (United States)

    Montgomery, Joel M; Gillespie, Don; Sastrawan, Putra; Fredeking, Terry M; Stewart, George L

    2002-07-01

    During the months of November 1996, August 1997, and March 1998, saliva and plasma samples were collected for isolation of aerobic bacteria from 26 wild and 13 captive Komodo dragons (Varanus komodoensis). Twenty-eight Gram-negative and 29 Gram-positive species of bacteria were isolated from the saliva of the 39 Komodo dragons. A greater number of wild than captive dragons were positive for both Gram-negative and Gram-positive bacteria. The average number of bacterial species within the saliva of wild dragons was 46% greater than for captive dragons. While Escherichia coli was the most common bacterium isolated from the saliva of wild dragons, this species was not present in captive dragons. The most common bacteria isolated from the saliva of captive dragons were Staphylococcus capitis and Staphylococcus capitis and Staphylococcus caseolyticus, neither of which were found in wild dragons. High mortality was seen among mice injected with saliva from wild dragons and the only bacterium isolated from the blood of dying mice was Pasteurella multocida. A competitive inhibition enzyme-linked immunosorbent assay revealed the presence of anti-Pasteurella antibody in the plasma of Komodo dragons. Four species of bacteria isolated from dragon saliva showed resistance to one or more of 16 antimicrobics tested. The wide variety of bacteria demonstrated in the saliva of the Komodo dragon in this study, at least one species of which was highly lethal in mice and 54 species of which are known pathogens, support the observation that wounds inflicted by this animal are often associated with sepsis and subsequent bacteremia in prey animals.

  6. Ethnobotanical review of wild edible plants of Slovakia

    Directory of Open Access Journals (Sweden)

    Łukasz Łuczaj

    2012-11-01

    Full Text Available This paper is an ethnobotanical review of wild edible plants gathered for consumption from the 19th century to the present day, within the present borders of Slovakia. Twenty-four sources (mainly ethnographic documenting the culinary use of wild plants were analysed. The use of 106 species (over 3% of the Slovak flora has been recorded. Nowadays most of them are no longer used, or used rarely, apart from a few species of wild fruits. The most frequently used plants include the fruits of Rubus idaeus, Fragaria spp., Rubus subgenus Rubus, Vaccinium myrtillus, V. vitis-idaea, Fagus sylvatica, Corylus avellana, Prunus spinosa, Pyrus spp., Malus spp., Crataegus spp. and the leaves of Urtica dioica, Rumex acetosa, Chenopodiaceae species, Cardamine amara, Glechoma spp., Taraxacum spp. and Oxalis acetosella. The most commonly used wild food taxa are nearly identical to those used in Poland, and the same negative association of wild vegetables with famine exists in Slovakia, resulting in their near complete disappearance from the present-day diet.

  7. Bioaccumulation of cadmium by spring barley (Hordeum vulgare L. and its effect on selected physiological and morphological parameters

    Directory of Open Access Journals (Sweden)

    Miriama Kopernická

    2016-01-01

    Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was

  8. Population Fluctuations of Insect Predators Species Found on Almond and WildAlmond Tree Adjacent to Pistachio Orchard in Şanlıurfa

    OpenAIRE

    YANIK, Ertan

    2013-01-01

    Almond (Prunus amygdalus Batsch) and wild almond (Amygdalus orientalis) trees are the most abundant species adjacent to pistachio orchards of Sanliurfa province. This study focused on trees that located in the vicinity of the pistachio orchards, to determine whether these alternative habitats are a source of pistachio psilla’s (Agonoscena pistaciae Burck. and Laut.) insect predators species. For this purpose surveys were conducted to population fluctuations of insect predatory species of pist...

  9. Interspecific somatic hybridization between lettuce (Lactuca sativa) and wild species L. virosa.

    Science.gov (United States)

    Matsumoto, E

    1991-02-01

    Somatic hybrids between cultivated lettuce (Lactuca sativa) and a wild species L. virosa were produced by protoplast electrofusion. Hybrid selection was based on inactivation of L. sativa with 20mM iodoacetamide for 15 min, and the inability of L. virosa protoplasts to divide in the culture conditions used. Protoplasts were cultured in agarose beads in a revised MS media. In all 71 calli were formed and 21 of them differentiated shoots on LS medium containing 0.1mg/l NAA and 0.2mg/l BA. Most regenerated plants exhibited intermediate morphology. These plants were confirmed as hybrids by isoenzyme analysis. The majority of somatic hybrids had 2n=4x=36 chromosomes, and had more vigorous growth than either parent. Hybrids had normal flower morphology, but all were sterile.

  10. Female and male life tables for seven wild primate species

    Science.gov (United States)

    Bronikowski, Anne M.; Cords, Marina; Alberts, Susan C.; Altmann, Jeanne; Brockman, Diane K.; Fedigan, Linda M.; Pusey, Anne; Stoinski, Tara; Strier, Karen B.; Morris, William F.

    2016-01-01

    We provide male and female census count data, age-specific survivorship, and female age-specific fertility estimates for populations of seven wild primates that have been continuously monitored for at least 29 years: sifaka (Propithecus verreauxi) in Madagascar; muriqui (Brachyteles hypoxanthus) in Brazil; capuchin (Cebus capucinus) in Costa Rica; baboon (Papio cynocephalus) and blue monkey (Cercopithecus mitis) in Kenya; chimpanzee (Pan troglodytes) in Tanzania; and gorilla (Gorilla beringei) in Rwanda. Using one-year age-class intervals, we computed point estimates of age-specific survival for both sexes. In all species, our survival estimates for the dispersing sex are affected by heavy censoring. We also calculated reproductive value, life expectancy, and mortality hazards for females. We used bootstrapping to place confidence intervals on life-table summary metrics (R0, the net reproductive rate; λ, the population growth rate; and G, the generation time). These data have high potential for reuse; they derive from continuous population monitoring of long-lived organisms and will be invaluable for addressing questions about comparative demography, primate conservation and human evolution. PMID:26928014

  11. Mitochondrial Genome Analysis of Wild Rice (Oryza minuta) and Its Comparison with Other Related Species.

    Science.gov (United States)

    Asaf, Sajjad; Khan, Abdul Latif; Khan, Abdur Rahim; Waqas, Muhammad; Kang, Sang-Mo; Khan, Muhammad Aaqil; Shahzad, Raheem; Seo, Chang-Woo; Shin, Jae-Ho; Lee, In-Jung

    2016-01-01

    Oryza minuta (Poaceae family) is a tetraploid wild relative of cultivated rice with a BBCC genome. O. minuta has the potential to resist against various pathogenic diseases such as bacterial blight (BB), white backed planthopper (WBPH) and brown plant hopper (BPH). Here, we sequenced and annotated the complete mitochondrial genome of O. minuta. The mtDNA genome is 515,022 bp, containing 60 protein coding genes, 31 tRNA genes and two rRNA genes. The mitochondrial genome organization and the gene content at the nucleotide level are highly similar (89%) to that of O. rufipogon. Comparison with other related species revealed that most of the genes with known function are conserved among the Poaceae members. Similarly, O. minuta mt genome shared 24 protein-coding genes, 15 tRNA genes and 1 ribosomal RNA gene with other rice species (indica and japonica). The evolutionary relationship and phylogenetic analysis revealed that O. minuta is more closely related to O. rufipogon than to any other related species. Such studies are essential to understand the evolutionary divergence among species and analyze common gene pools to combat risks in the current scenario of a changing environment.

  12. The wild tomato species Solanum chilense shows variation in pathogen resistance between geographically distinct populations.

    Science.gov (United States)

    Stam, Remco; Scheikl, Daniela; Tellier, Aurélien

    2017-01-01

    Wild tomatoes are a valuable source of disease resistance germplasm for tomato ( Solanum lycopersicum ) breeders. Many species are known to possess a certain degree of resistance against certain pathogens; however, evolution of resistance traits is yet poorly understood. For some species, like Solanum chilense , both differences in habitat and within species genetic diversity are very large. Here we aim to investigate the occurrence of spatially heterogeneous coevolutionary pressures between populations of S. chilense . We investigate the phenotypic differences in disease resistance within S. chilense against three common tomato pathogens ( Alternaria solani , Phytophthora infestans and a Fusarium sp .) and confirm high degrees of variability in resistance properties between selected populations. Using generalised linear mixed models, we show that disease resistance does not follow the known demographic patterns of the species. Models with up to five available climatic and geographic variables are required to best describe resistance differences, confirming the complexity of factors involved in local resistance variation. We confirm that within S. chilense , resistance properties against various pathogens show a mosaic pattern and do not follow environmental patterns, indicating the strength of local pathogen pressures. Our study can form the basis for further investigations of the genetic traits involved.

  13. Natural Chemical Composition of Commercial Fish Species: Characterisation of Pangasius, Wild and Farmed Turbot and Barramundi

    Science.gov (United States)

    Manthey-Karl, Monika; Lehmann, Ines; Ostermeyer, Ute; Schröder, Ute

    2016-01-01

    To comply with the relevant legal requirements and correct labelling, it is necessary for business operators and inspection authorities to know the natural characteristics of the raw material. This study gives a comprehensive overview of muscle flesh composition of farmed and wild Atlantic turbot (Scophthalmus maximus) and barramundi (Lates calcarifer) and of farmed pangasius (Pangasianodon hypophthalmus). The proximate composition, di- and triphosphates and citric acid values are presented in order to evaluate possible indicators for a hidden treatment during processing to fillets. All moisture contents were ≤80%. Even for pangasius, protein values for deep skinned fillets of ≥18% were determined. Only small quantities of naturally occurring citric acid (up to 0.03 g·kg−1) were detectable. The lipid content was the most varying main component within the different species, ranging between 1.2% to 2.0% and 0.3% to 3.0% for farmed turbot and barramundi, respectively. Pangasius flesh had a mean lipid content of 7.8%. Trimming and separation of the red layer reduced the lipid content of the commercially sold white-flesh fillets to 2.7% to 3.5%. Fatty acids profiles, free amino acids, and minerals were analysed to show the nutritional quality of the aquaculture fish species and compared to wild turbot and barramundi. Despite some natural variation, these components can be considered as comparable. PMID:28231154

  14. Natural Chemical Composition of Commercial Fish Species: Characterisation of Pangasius, Wild and Farmed Turbot and Barramundi

    Directory of Open Access Journals (Sweden)

    Monika Manthey-Karl

    2016-08-01

    Full Text Available To comply with the relevant legal requirements and correct labelling, it is necessary for business operators and inspection authorities to know the natural characteristics of the raw material. This study gives a comprehensive overview of muscle flesh composition of farmed and wild Atlantic turbot (Scophthalmus maximus and barramundi (Lates calcarifer and of farmed pangasius (Pangasianodon hypophthalmus. The proximate composition, di- and triphosphates and citric acid values are presented in order to evaluate possible indicators for a hidden treatment during processing to fillets. All moisture contents were ≤80%. Even for pangasius, protein values for deep skinned fillets of ≥18% were determined. Only small quantities of naturally occurring citric acid (up to 0.03 g·kg−1 were detectable. The lipid content was the most varying main component within the different species, ranging between 1.2% to 2.0% and 0.3% to 3.0% for farmed turbot and barramundi, respectively. Pangasius flesh had a mean lipid content of 7.8%. Trimming and separation of the red layer reduced the lipid content of the commercially sold white-flesh fillets to 2.7% to 3.5%. Fatty acids profiles, free amino acids, and minerals were analysed to show the nutritional quality of the aquaculture fish species and compared to wild turbot and barramundi. Despite some natural variation, these components can be considered as comparable.

  15. Endangered Species Day | Endangered Species Coalition

    Science.gov (United States)

    Annual Top 10 Report Protecting the Endangered Species Act Wildlife Voices Stand for Wolves Endangered Campaigns Wildlife Voices Protecting the Endangered Species Act Annual Top 10 Report Endangered Species Day Stand for Wolves Vanishing BOOK: A Wild Success The Endangered Species Act at 40 Endangered Species The

  16. Transcriptome discovery in non-model wild fish species for the development of quantitative transcript abundance assays

    Science.gov (United States)

    Hahn, Cassidy M.; Iwanowicz, Luke R.; Cornman, Robert S.; Mazik, Patricia M.; Blazer, Vicki S.

    2016-01-01

    Environmental studies increasingly identify the presence of both contaminants of emerging concern (CECs) and legacy contaminants in aquatic environments; however, the biological effects of these compounds on resident fishes remain largely unknown. High throughput methodologies were employed to establish partial transcriptomes for three wild-caught, non-model fish species; smallmouth bass (Micropterus dolomieu), white sucker (Catostomus commersonii) and brown bullhead (Ameiurus nebulosus). Sequences from these transcriptome databases were utilized in the development of a custom nCounter CodeSet that allowed for direct multiplexed measurement of 50 transcript abundance endpoints in liver tissue. Sequence information was also utilized in the development of quantitative real-time PCR (qPCR) primers. Cross-species hybridization allowed the smallmouth bass nCounter CodeSet to be used for quantitative transcript abundance analysis of an additional non-model species, largemouth bass (Micropterus salmoides). We validated the nCounter analysis data system with qPCR for a subset of genes and confirmed concordant results. Changes in transcript abundance biomarkers between sexes and seasons were evaluated to provide baseline data on transcript modulation for each species of interest.

  17. Analysis of Rhizome Development in Oryza longistaminata, a Wild Rice Species.

    Science.gov (United States)

    Yoshida, Akiko; Terada, Yasuhiko; Toriba, Taiyo; Kose, Katsumi; Ashikari, Motoyuki; Kyozuka, Junko

    2016-10-01

    Vegetative reproduction is a form of asexual propagation in plants. A wide range of plants develop rhizomes, modified stems that grow underground horizontally, as a means of vegetative reproduction. In rhizomatous species, despite their distinct developmental patterns, both rhizomes and aerial shoots derive from axillary buds. Therefore, it is of interest to understand the basis of rhizome initiation and development. Oryza longistaminata, a wild rice species, develops rhizomes. We analyzed bud initiation and growth of O. longistaminata rhizomes using various methods of morphological observation. We show that, unlike aerial shoot buds that contain a few leaves only, rhizome buds initiate several leaves and bend to grow at right angles to the original rhizome. Rhizomes are maintained in the juvenile phase irrespective of the developmental phase of the aerial shoot. Stem elongation and reproductive transition are tightly linked in the aerial shoots, but are uncoupled in the rhizome. Our findings indicate that developmental programs operate independently in the rhizomes and aerial shoots. Temporal modification of the developmental pathways that are common to rhizomes and aerial shoots may be the source of developmental plasticity. Furthermore, the creation of new developmental systems appears to be necessary for rhizome development. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  18. The novel primers for mammal species identification-based mitochondrial cytochrome b sequence: implication for reserved wild animals in Thailand and endangered mammal species in Southeast Asia.

    Science.gov (United States)

    Muangkram, Yuttamol; Wajjwalku, Worawidh; Amano, Akira; Sukmak, Manakorn

    2018-01-01

    We presented the powerful techniques for species identification using the short amplicon of mitochondrial cytochrome b gene sequence. Two faecal samples and one single hair sample of the Asian tapir were tested using the new cytochrome b primers. The results showed a high sequence similarity with the mainland Asian tapir group. The comparative sequence analysis of the reserved wild mammals in Thailand and the other endangered mammal species from Southeast Asia comprehensibly verified the potential of our novel primers. The forward and reverse primers were 94.2 and 93.2%, respectively, by the average value of the sequence identity among 77 species sequences, and the overall mean distance was 35.9%. This development technique could provide rapid, simple, and reliable tools for species confirmation. Especially, it could recognize the problematic biological specimens contained less DNA material from illegal products and assist with wildlife crime investigation of threatened species and related forensic casework.

  19. Genome-Wide Association Mapping of Stem Rust Resistance in Hordeum vulgare subsp. spontaneum.

    Science.gov (United States)

    Sallam, Ahmad H; Tyagi, Priyanka; Brown-Guedira, Gina; Muehlbauer, Gary J; Hulse, Alex; Steffenson, Brian J

    2017-10-05

    Stem rust was one of the most devastating diseases of barley in North America. Through the deployment of cultivars with the resistance gene Rpg1 , losses to stem rust have been minimal over the past 70 yr. However, there exist both domestic (QCCJB) and foreign (TTKSK aka isolate Ug99) pathotypes with virulence for this important gene. To identify new sources of stem rust resistance for barley, we evaluated the Wild Barley Diversity Collection (WBDC) (314 ecogeographically diverse accessions of Hordeum vulgare subsp. spontaneum ) for seedling resistance to four pathotypes (TTKSK, QCCJB, MCCFC, and HKHJC) of the wheat stem rust pathogen ( Puccinia graminis f. sp. tritici , Pgt ) and one isolate (92-MN-90) of the rye stem rust pathogen ( P. graminis f. sp. secalis , Pgs ). Based on a coefficient of infection, the frequency of resistance in the WBDC was low ranging from 0.6% with HKHJC to 19.4% with 92-MN-90. None of the accessions was resistant to all five cultures of P. graminis A genome-wide association study (GWAS) was conducted to map stem rust resistance loci using 50,842 single-nucleotide polymorphic markers generated by genotype-by-sequencing and ordered using the new barley reference genome assembly. After proper accounting for genetic relatedness and structure among accessions, 45 quantitative trait loci were identified for resistance to P. graminis across all seven barley chromosomes. Three novel loci associated with resistance to TTKSK, QCCJB, MCCFC, and 92-MN-90 were identified on chromosomes 5H and 7H, and two novel loci associated with resistance to HKHJC were identified on chromosomes 1H and 3H. These novel alleles will enhance the diversity of resistance available for cultivated barley. Copyright © 2017 Sallam et al.

  20. Eating from the wild: diversity of wild edible plants used by Tibetans in Shangri-la region, Yunnan, China.

    Science.gov (United States)

    Ju, Yan; Zhuo, Jingxian; Liu, Bo; Long, Chunlin

    2013-04-19

    Locally harvested wild edible plants (WEPs) provide food as well as cash income for indigenous people and are of great importance in ensuring global food security. Some also play a significant role in maintaining the productivity and stability of traditional agro-ecosystems. Shangri-la region of Yunnan Province, SW China, is regarded as a biodiversity hotspot. People living there have accumulated traditional knowledge about plants. However, with economic development, WEPs are threatened and the associated traditional knowledge is in danger of being lost. Therefore, ethnobotanical surveys were conducted throughout this area to investigate and document the wild edible plants traditionally used by local Tibetan people. Twenty-nine villages were selected to carry out the field investigations. Information was collected using direct observation, semi-structured interviews, individual discussions, key informant interviews, focus group discussions, questionnaires and participatory rural appraisal (PRA). Information about 168 wild edible plant species in 116 genera of 62 families was recorded and specimens were collected. Most species were edible greens (80 species) or fruits (78). These WEPs are sources for local people, especially those living in remote rural areas, to obtain mineral elements and vitamins. More than half of the species (70%) have multiple use(s) besides food value. Some are crop wild relatives that could be used for crop improvement. Several also have potential values for further commercial exploitation. However, the utilization of WEPs and related knowledge are eroding rapidly, especially in the areas with convenient transportation and booming tourism. Wild food plants species are abundant and diverse in Shangri-la region. They provide food and nutrients to local people and could also be a source of cash income. However, both WEPs and their associated indigenous knowledge are facing various threats. Thus, conservation and sustainable utilization of these

  1. Occurrence of Listeria species in different captive wild animals of Nandankanan Zoo, Baranga, Odisha, India

    Directory of Open Access Journals (Sweden)

    L.N. Sarangi

    2013-01-01

    Full Text Available Listeria species were isolated from faecal samples collected from different captive wild animals of Nandankanan Zoo, Baranga, Odisha, using selective enrichment medium. The isolates were characterized based on their cell morphology, biochemical and sugar fermentation characteristics as well as culture morphology. Further, in vitro and in vivo pathogenicity tests were carried out to assess the pathogenic potential of the isolates. Listeria were found in 24 (23.07% of the total 104 faecal samples. Listeria were isolated from the samples of tiger, bear, hyena, leopard, zebra, elephant, jackal, lion, barking deer, porcupine, chital, monkey and wild boar. Out of the 24 Listeria isolates 11 were confirmed as L. monocytogenes. The other 13 isolates included L. innocua, L. seeligeri, L. welshimeri and L. ivanovii. The pathogenicity study revealed that only four isolates were pathogenic. Three of these were L. monocytogenes isolated from tiger, hyena and elephant and one was L. ivanovii isolated from leopard. Antibiotic sensitivity of the 24 isolates was high towards ciprofloxacin, levofloxacin, amoxicillin, azithromycin and enrofloxacin. The isolates showed resistance towards oxytetracyclin, gentamicin, cephadroxil, penicillin- G and nalidixic acid.

  2. Carbon source-sink limitations differ between two species with contrasting growth strategies.

    Science.gov (United States)

    Burnett, Angela C; Rogers, Alistair; Rees, Mark; Osborne, Colin P

    2016-11-01

    Understanding how carbon source and sink strengths limit plant growth is a critical knowledge gap that hinders efforts to maximize crop yield. We investigated how differences in growth rate arise from source-sink limitations, using a model system comparing a fast-growing domesticated annual barley (Hordeum vulgare cv. NFC Tipple) with a slow-growing wild perennial relative (Hordeum bulbosum). Source strength was manipulated by growing plants at sub-ambient and elevated CO 2 concentrations ([CO 2 ]). Limitations on vegetative growth imposed by source and sink were diagnosed by measuring relative growth rate, developmental plasticity, photosynthesis and major carbon and nitrogen metabolite pools. Growth was sink limited in the annual but source limited in the perennial. RGR and carbon acquisition were higher in the annual, but photosynthesis responded weakly to elevated [CO 2 ] indicating that source strength was near maximal at current [CO 2 ]. In contrast, photosynthetic rate and sink development responded strongly to elevated [CO 2 ] in the perennial, indicating significant source limitation. Sink limitation was avoided in the perennial by high sink plasticity: a marked increase in tillering and root:shoot ratio at elevated [CO 2 ], and lower non-structural carbohydrate accumulation. Alleviating sink limitation during vegetative development could be important for maximizing growth of elite cereals under future elevated [CO 2 ]. © 2016 John Wiley & Sons Ltd.

  3. Extra soil fertilization of mother plants increases botanical seed yield but not long-term germination in wild Solanum (potato) species

    Science.gov (United States)

    Potato has about 100 wild species relatives that are multiplied in the form of botanical seed populations by genebanks, and distributed for use in research and breeding, so factors that affect long term seed germination are of interest. In 1987 the US Potato Genebank conducted routine seed multiplic...

  4. QTL mapping provides evidence for lack of association of the avoidance of leaf rust in Hordeum chilense with stomata density

    NARCIS (Netherlands)

    Vaz Patto, M.C.; Rubiales, D.; Martin, A.; Hernandez, P.; Lindhout, W.H.; Niks, R.E.; Stam, P.

    2003-01-01

    In cereals, rust fungi are among the most harmful pathogens. Breeders usually rely on short-lived hypersensitivity resistance. As an alternative, "avoidance" may be a more durable defence mechanism to protect plants to rust fungi. In Hordeum chilense avoidance is based on extensive wax covering of

  5. Where did the chili get its spice? Biogeography of capsaicinoid production in ancestral wild chili species.

    Science.gov (United States)

    Tewksbury, Joshua J; Manchego, Carlos; Haak, David C; Levey, Douglas J

    2006-03-01

    The biogeography of pungency in three species of wild chili in the chaco and surrounding highland habitats of southeastern Bolivia is described. We report that Capsicum chacoense, C. baccatum, and C. eximium are polymorphic for production of capsaicin and its analogs, such that completely pungent and completely nonpungent individuals co-occur in some populations. In C. chacoense, the density of plants and the proportion of pungent plants increased with elevation. Above 900 m, all individuals in all populations except two were pungent; nonpungent individuals in at least one of the two polymorphic populations were likely a result of spreading by humans. The occurrence of pungent and nonpungent individuals in three species of ancestral Capsicum and the geographic variation of pungency within species suggest that production of capsaicin and its analogs entails both costs and benefits, which shift from one locality to another. Determining the selection pressures behind such shifts is necessary to understand the evolution of pungency in chilies.

  6. Wild food plants and wild edible fungi of Heihe valley (Qinling Mountains, Shaanxi, central China: herbophilia and indifference to fruits and mushrooms

    Directory of Open Access Journals (Sweden)

    Yongxiang Kang

    2012-12-01

    Full Text Available The aim of the study was to investigate knowledge and use of wild food plants and fungi in Han (i.e. Chinese nationality villages in central China, including famine plants used in the respondents' childhood. A valley adjacent to the extremely species-rich temperate forest vegetation of the Taibai Nature Reserve was chosen. Eighty-two people from 5 villages took part in the study. Altogether, 159 wild food plant species and 13 fungi folk taxa were mentioned by informants. The mean number of freelisted wild foods was very high (24.8; median – 21.5. An average respondent listed many species of wild vegetables (mean – 17, me- dian – 14.5, a few wild fruits (mean – 5.9 and median – 6 and very few fungi (mean – 1.9, median – 1, which they had eaten. Over 50% of respondents mentioned gathering the young shoots or leaves of Celastrus orbiculatus, Staphylea bumalda and S. holocapra, Caryopteris divaricata, Helwingia japonica, Pteridium aquilinum, Pimpinella sp., Amaranthus spp., Matteucia struthiopteris, Allium spp., Cardamine macrophylla and Chenopodium album. Only one species of fruits (Schisandra sphenanthera and none of the mushrooms were mentioned by over half of the respondents. Although very diverse, it can be noted that the use of wild vegetables has decreased compared to the second half of the 20th century, as informants listed several plants which they had stopped using (e.g. Abelia engleriana due to the availability of cultivated vegetables and other foodstuffs. On the other hand, the collection of the most well-known wild vegetables is maintained by selling them to tourists visiting agritourist farms, and restaurants.

  7. 50 CFR 12.34 - Return to the wild.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Return to the wild. 12.34 Section 12.34... SEIZURE AND FORFEITURE PROCEDURES Disposal of Forfeited or Abandoned Property § 12.34 Return to the wild... the wild in suitable habitat within the historical range of the species in the United States with the...

  8. The wild tomato species Solanum chilense shows variation in pathogen resistance between geographically distinct populations

    Directory of Open Access Journals (Sweden)

    Remco Stam

    2017-01-01

    Full Text Available Wild tomatoes are a valuable source of disease resistance germplasm for tomato (Solanum lycopersicum breeders. Many species are known to possess a certain degree of resistance against certain pathogens; however, evolution of resistance traits is yet poorly understood. For some species, like Solanum chilense, both differences in habitat and within species genetic diversity are very large. Here we aim to investigate the occurrence of spatially heterogeneous coevolutionary pressures between populations of S. chilense. We investigate the phenotypic differences in disease resistance within S. chilense against three common tomato pathogens (Alternaria solani, Phytophthora infestans and a Fusarium sp. and confirm high degrees of variability in resistance properties between selected populations. Using generalised linear mixed models, we show that disease resistance does not follow the known demographic patterns of the species. Models with up to five available climatic and geographic variables are required to best describe resistance differences, confirming the complexity of factors involved in local resistance variation. We confirm that within S. chilense, resistance properties against various pathogens show a mosaic pattern and do not follow environmental patterns, indicating the strength of local pathogen pressures. Our study can form the basis for further investigations of the genetic traits involved.

  9. The wild tomato species Solanum chilense shows variation in pathogen resistance between geographically distinct populations

    Science.gov (United States)

    Scheikl, Daniela; Tellier, Aurélien

    2017-01-01

    Wild tomatoes are a valuable source of disease resistance germplasm for tomato (Solanum lycopersicum) breeders. Many species are known to possess a certain degree of resistance against certain pathogens; however, evolution of resistance traits is yet poorly understood. For some species, like Solanum chilense, both differences in habitat and within species genetic diversity are very large. Here we aim to investigate the occurrence of spatially heterogeneous coevolutionary pressures between populations of S. chilense. We investigate the phenotypic differences in disease resistance within S. chilense against three common tomato pathogens (Alternaria solani, Phytophthora infestans and a Fusarium sp.) and confirm high degrees of variability in resistance properties between selected populations. Using generalised linear mixed models, we show that disease resistance does not follow the known demographic patterns of the species. Models with up to five available climatic and geographic variables are required to best describe resistance differences, confirming the complexity of factors involved in local resistance variation. We confirm that within S. chilense, resistance properties against various pathogens show a mosaic pattern and do not follow environmental patterns, indicating the strength of local pathogen pressures. Our study can form the basis for further investigations of the genetic traits involved. PMID:28133579

  10. Mycobacterium spp. in wild game in Slovenia.

    Science.gov (United States)

    Pate, Mateja; Zajc, Urška; Kušar, Darja; Žele, Diana; Vengušt, Gorazd; Pirš, Tina; Ocepek, Matjaž

    2016-02-01

    Wildlife species are an important reservoir of mycobacterial infections that may jeopardise efforts to control and eradicate bovine tuberculosis (bTB), caused by Mycobacterium bovis. Slovenia is officially free of bTB, but no data on the presence of mycobacteria in wild animals has been reported. In this study, samples of liver and lymph nodes were examined from 306 apparently healthy free-range wild animals of 13 species in Slovenia belonging to the families Cervidae, Suidae, Canidae, Mustelidae and Bovidae. Mycobacteria were isolated from 36/306 (11.8%) animals (red deer, roe deer, fallow deer, wild boar and jackal) and identified by PCR, commercial diagnostic kits and sequencing. Non-tuberculous mycobacteria identified in five species were Mycobacterium peregrinum, M. avium subsp. hominissuis, M. intracellulare, M. confluentis, M. fortuitum, M. terrae, M. avium subsp. avium, M. celatum, M. engbaekii, M. neoaurum, M. nonchromogenicum and M. vaccae. Copyright © 2015 Elsevier Ltd. All rights reserved.

  11. Characterization and zoonotic impact of Shiga toxin producing Escherichia coli in some wild bird species

    Directory of Open Access Journals (Sweden)

    Hanaa Mohamed Fadel

    2017-09-01

    Full Text Available Aim: Wild birds are considered silent vectors of some zoonotic water and food borne pathogens of public health significance. Owing to the importance of Shiga toxin producing Escherichia coli (STEC as the most pathogenic among the emerging diarrheagenic E. coli groups that can infect man; the present study was designed to detect the occurrence of STEC among wild birds in Egypt. Materials and Methods: A total of 177 intestinal content swab samples originating from five wild bird species were investigated for the presence of E. coli and STEC by standard culture methods. Suspect STEC isolates were further characterized by serotyping, random amplified polymorphic DNA polymerase chain reaction (RAPD PCR, antimicrobial resistance pattern and PCR detection of stx1, stx2, and eae genes. Results: A total of 30 suspect STEC isolates from 30 positive birds' samples were detected and identified on STEC CHROMagar (semi-captive pigeons, 15; house crows, 8; cattle egrets, 3; moorhens, 2; and house teals, 2. 25 isolates were grouped into 13 serogroups (O:20, O:25, O:26, O:27, O:63, O:78, O:111, O:114, O:125, O:128, O:142, O:153, and O:158, while five were rough strains. The distribution of STEC virulence genes among wild birds was as follows: 16 birds carried stx1 gene only (nine pigeons [28.1%], six crows [7.1%], and one cattle egret [5.6%]. stx1 and stx2 genes together were detected in four birds (one cattle egret [5.6%], two moorhens [6.1%], and one house teal, [10%]. Only one pigeon (3.1% possessed the three alleles. Disk diffusion test results showed that cefixime was the most effective against STEC serotypes with (93.3% sensitivity, followed by gentamycin (56.7%, and amoxicillin (50%. On the other hand, all the recovered STEC isolates were resistant to cefotaxime, doxycycline, cephalothin, and sulfisoxazole. RAPD fingerprinting using primers OPA-2 and OPA-9 showed that STEC isolates were heterogeneous; they yielded 30 and 27 different clusters

  12. Seed viability of five wild Saudi Arabian species by germination and X-ray tests.

    Science.gov (United States)

    Al-Hammad, B A; Al-Ammari, B S

    2017-09-01

    Our objective was to evaluate the usefulness of the germination vs. the X-ray test in determining the initial viability of seeds of five wild species ( Moringa peregrina , Abrus precatorius , Arthrocnemum macrostachyum , Acacia ehrenbergiana and Acacia tortilis ) from Saudi Arabia. Usually several days were required to determine the viability of all five species via germination tests. However, X-ray test will give immediate results on filled/viable seeds. Seeds of all species, except Acacia ehrenbergiana and Acacia tortilis showed high viability in both germination (96-72% at 25/15 °C, 94-70% at 35/25 °C) and X-ray (100-80%) test. Furthermore, there was a general agreement between the germination (19%, 14% at 25/15 °C and 17% and 12% at 35/25 °C) and X-ray (8%, 4%) tests in which seed viability of Acacia ehrenbergiana and Acacia tortilis was very low due to insect damaged embryo as shown in X-ray analysis. Seeds of Abruspreca torius have physical dormancy, which was broken by scarification in concentrated sulfuric acid (10 min), and they exhibited high viability in both the germination (83% at 25/15 °C and 81% at 35/25 °C) and X-ray (96%) tests. Most of the nongerminated seeds of the five species except those of Acacia ehrenbergiana and Acacia tortilis , were alive as judged by the tetrazolium test (TZ). Thus, for the five species examined, the X-ray test was proved to be a good and rapid predictor of seed viability.

  13. Heavy metals in wild marine fish from South China Sea: levels, tissue- and species-specific accumulation and potential risk to humans.

    Science.gov (United States)

    Liu, Jin-Ling; Xu, Xiang-Rong; Ding, Zhen-Hua; Peng, Jia-Xi; Jin, Ming-Hua; Wang, You-Shao; Hong, Yi-Guo; Yue, Wei-Zhong

    2015-10-01

    Heavy metal pollution in marine fish has become an important worldwide concern, not only because of the threat to fish in general, but also due to human health risks associated with fish consumption. To investigate the occurrence of heavy metals in marine fish species from the South China Sea, 14 fish species were collected along the coastline of Hainan China during the spring of 2012 and examined for species- and tissue-specific accumulation. The median concentrations of Cd, Cr, Cu, Zn, Pb and As in muscle tissue of the examined fish species were not detectable (ND), 2.02, 0.24, 2.64, 0.025, and 1.13 mg kg(-1) wet weight, respectively. Levels of Cu, Zn, Cd and Cr were found to be higher in the liver and gills than in muscle, while Pb was preferentially accumulated in the gills. Differing from other heavy metals, As did not exhibit tissue-specific accumulation. Inter-species differences of heavy metal accumulation were attributed to the different habitat and diet characteristics of marine fish. Human dietary exposure assessment suggested that the amounts of both Cr and As in marine wild fish collected from the sites around Hainan, China were not compliant with the safety standard of less than 79.2 g d(-1) for wild marine fish set by the Joint FAO/WHO Expert Committee on Food Additives. Further research to identify the explicit sources of Cr and As in marine fish from South China Sea should be established.

  14. Hepatozoon silvestris sp. nov.: morphological and molecular characterization of a new species of Hepatozoon (Adeleorina: Hepatozoidae) from the European wild cat (Felis silvestris silvestris)

    OpenAIRE

    HOD?I?, ADNAN; ALI?, AMER; PRA?OVI?, SENAD; OTRANTO, DOMENICO; BANETH, GAD; DUSCHER, GEORG GERHARD

    2016-01-01

    SUMMARY Based on morphological and genetic characteristics, we describe a new species of Hepatozoon in the European wild cat (Felis silvestris silvestris), herein named Hepatozoon silvestris sp. nov. The study also provides the first data on the occurrence of H. felis in this wild felid. Hepatozoon meronts were observed in multiple cross-sections of different organs of four (44%) cats. Additionally, extracellular forms, resembling mature gamonts of Hepatozoon, were found in the spleen and myo...

  15. An eceriferum locus, cer-zv, is associated with a defect in cutin responsible for water retention in barley (Hordeum vulgare) leaves.

    Science.gov (United States)

    Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong

    2013-03-01

    Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.

  16. Transcriptome discovery in non-model wild fish species for the development of quantitative transcript abundance assays.

    Science.gov (United States)

    Hahn, Cassidy M; Iwanowicz, Luke R; Cornman, Robert S; Mazik, Patricia M; Blazer, Vicki S

    2016-12-01

    Environmental studies increasingly identify the presence of both contaminants of emerging concern (CECs) and legacy contaminants in aquatic environments; however, the biological effects of these compounds on resident fishes remain largely unknown. High throughput methodologies were employed to establish partial transcriptomes for three wild-caught, non-model fish species; smallmouth bass (Micropterus dolomieu), white sucker (Catostomus commersonii) and brown bullhead (Ameiurus nebulosus). Sequences from these transcriptome databases were utilized in the development of a custom nCounter CodeSet that allowed for direct multiplexed measurement of 50 transcript abundance endpoints in liver tissue. Sequence information was also utilized in the development of quantitative real-time PCR (qPCR) primers. Cross-species hybridization allowed the smallmouth bass nCounter CodeSet to be used for quantitative transcript abundance analysis of an additional non-model species, largemouth bass (Micropterus salmoides). We validated the nCounter analysis data system with qPCR for a subset of genes and confirmed concordant results. Changes in transcript abundance biomarkers between sexes and seasons were evaluated to provide baseline data on transcript modulation for each species of interest. Published by Elsevier Inc.

  17. Genetic Analysis of East Asian Grape Cultivars Suggests Hybridization with Wild Vitis.

    Science.gov (United States)

    Goto-Yamamoto, Nami; Sawler, Jason; Myles, Sean

    2015-01-01

    Koshu is a grape cultivar native to Japan and is one of the country's most important cultivars for wine making. Koshu and other oriental grape cultivars are widely believed to belong to the European domesticated grape species Vitis vinifera. To verify the domesticated origin of Koshu and four other cultivars widely grown in China and Japan, we genotyped 48 ancestry informative single nucleotide polymorphisms (SNPs) and estimated wild and domesticated ancestry proportions. Our principal components analysis (PCA) based ancestry estimation revealed that Koshu is 70% V. vinifera, and that the remaining 30% of its ancestry is most likely derived from wild East Asian Vitis species. Partial sequencing of chloroplast DNA suggests that Koshu's maternal line is derived from the Chinese wild species V. davidii or a closely related species. Our results suggest that many traditional East Asian grape cultivars such as Koshu were generated from hybridization events with wild grape species.

  18. Honey Bee Viruses in Wild Bees: Viral Prevalence, Loads, and Experimental Inoculation

    Science.gov (United States)

    Dolezal, Adam G.; Hendrix, Stephen D.; Scavo, Nicole A.; Carrillo-Tripp, Jimena; Harris, Mary A.; Wheelock, M. Joseph; O’Neal, Matthew E.; Toth, Amy L.

    2016-01-01

    Evidence of inter-species pathogen transmission from managed to wild bees has sparked concern that emerging diseases could be causing or exacerbating wild bee declines. While some pathogens, like RNA viruses, have been found in pollen and wild bees, the threat these viruses pose to wild bees is largely unknown. Here, we tested 169 bees, representing 4 families and 8 genera, for five common honey bee (Apis mellifera) viruses, finding that more than 80% of wild bees harbored at least one virus. We also quantified virus titers in these bees, providing, for the first time, an assessment of viral load in a broad spectrum of wild bees. Although virus detection was very common, virus levels in the wild bees were minimal—similar to or lower than foraging honey bees and substantially lower than honey bees collected from hives. Furthermore, when we experimentally inoculated adults of two different bee species (Megachile rotundata and Colletes inaequalis) with a mixture of common viruses that is lethal to honey bees, we saw no effect on short term survival. Overall, we found that honey bee RNA viruses can be commonly detected at low levels in many wild bee species, but we found no evidence that these pathogens cause elevated short-term mortality effects. However, more work on these viruses is greatly needed to assess effects on additional bee species and life stages. PMID:27832169

  19. Honey Bee Viruses in Wild Bees: Viral Prevalence, Loads, and Experimental Inoculation.

    Science.gov (United States)

    Dolezal, Adam G; Hendrix, Stephen D; Scavo, Nicole A; Carrillo-Tripp, Jimena; Harris, Mary A; Wheelock, M Joseph; O'Neal, Matthew E; Toth, Amy L

    2016-01-01

    Evidence of inter-species pathogen transmission from managed to wild bees has sparked concern that emerging diseases could be causing or exacerbating wild bee declines. While some pathogens, like RNA viruses, have been found in pollen and wild bees, the threat these viruses pose to wild bees is largely unknown. Here, we tested 169 bees, representing 4 families and 8 genera, for five common honey bee (Apis mellifera) viruses, finding that more than 80% of wild bees harbored at least one virus. We also quantified virus titers in these bees, providing, for the first time, an assessment of viral load in a broad spectrum of wild bees. Although virus detection was very common, virus levels in the wild bees were minimal-similar to or lower than foraging honey bees and substantially lower than honey bees collected from hives. Furthermore, when we experimentally inoculated adults of two different bee species (Megachile rotundata and Colletes inaequalis) with a mixture of common viruses that is lethal to honey bees, we saw no effect on short term survival. Overall, we found that honey bee RNA viruses can be commonly detected at low levels in many wild bee species, but we found no evidence that these pathogens cause elevated short-term mortality effects. However, more work on these viruses is greatly needed to assess effects on additional bee species and life stages.

  20. Space use of African wild dogs in relation to other large carnivores.

    Directory of Open Access Journals (Sweden)

    Angela M Darnell

    Full Text Available Interaction among species through competition is a principle process structuring ecological communities, affecting behavior, distribution, and ultimately the population dynamics of species. High competition among large African carnivores, associated with extensive diet overlap, manifests in interactions between subordinate African wild dogs (Lycaon pictus and dominant lions (Panthera leo and spotted hyenas (Crocuta crocuta. Using locations of large carnivores in Hluhluwe-iMfolozi Park, South Africa, we found different responses from wild dogs to their two main competitors. Wild dogs avoided lions, particularly during denning, through a combination of spatial and temporal avoidance. However, wild dogs did not exhibit spatial or temporal avoidance of spotted hyenas, likely because wild dog pack sizes were large enough to adequately defend their kills. Understanding that larger carnivores affect the movements and space use of other carnivores is important for managing current small and fragmented carnivore populations, especially as reintroductions and translocations are essential tools used for the survival of endangered species, as with African wild dogs.

  1. Filarioid infections in wild carnivores: a multispecies survey in Romania.

    Science.gov (United States)

    Ionică, Angela Monica; Matei, Ioana Adriana; D'Amico, Gianluca; Ababii, Jana; Daskalaki, Aikaterini Alexandra; Sándor, Attila D; Enache, Dorin Valter; Gherman, Călin Mircea; Mihalca, Andrei Daniel

    2017-07-13

    Filarioids are vector-borne parasitic nematodes of vertebrates. In Europe, eight species of filarioids, including zoonotic species, have been reported mainly in domestic dogs, and occasionally in wild carnivores. In Romania, infections with Dirofilaria spp. and Acanthocheilonema reconditum are endemic in domestic dogs. Despite the abundant populations of wild carnivores in the country, their role in the epidemiology of filarioid parasites remains largely unknown. The aim of the present study was to assess the host range, prevalence and distribution of filarioid infections in wild carnivores present in Romania. Between May 2014 and February 2016, 432 spleen samples originating from 14 species of wild carnivores have been tested for the presence of DNA of three species of filarioids (D. immitis, D. repens and A. reconditum). Overall 14 samples (3.24%) were molecularly positive. The most prevalent species was D. immitis (1.62%), accounting for 50% (n = 7) of the positive animals. The prevalence of D. repens was 1.39%, while that of A. reconditum was 0.23%. No co-infections were detected. Dirofilaria immitis DNA was detected in five golden jackals, Canis aureus (7.58%), one red fox, Vulpes vulpes (0.33%), and one wildcat, Felis silvestris (10%). The presence of D. repens DNA was detected in two red foxes (0.66%), two golden jackals (3.03%), one grey wolf (7.14%), and one least weasel, Mustela nivalis (33.33%). Acanthocheilonema reconditum DNA was found only in one red fox (0.33%). The present study provides molecular evidence of filarial infections in wild carnivore species in Romania, suggesting their potential epidemiological role and reports a new host species for D. repens.

  2. Loss of memory CD4+ T-cells in semi-wild mandrills (Mandrillus sphinx) naturally infected with species-specific simian immunodeficiency virus SIVmnd-1.

    Science.gov (United States)

    Greenwood, Edward J D; Schmidt, Fabian; Liégeois, Florian; Kondova, Ivanela; Herbert, Anaïs; Ngoubangoye, Barthelemy; Rouet, François; Heeney, Jonathan L

    2014-01-01

    Simian immunodeficiency virus (SIV) infection is found in a number of African primate species and is thought to be generally non-pathogenic. However, studies of wild primates are limited to two species, with SIV infection appearing to have a considerably different outcome in each. Further examination of SIV-infected primates exposed to their natural environment is therefore warranted. We performed a large cross-sectional study of a cohort of semi-wild mandrills with naturally occurring SIV infection, including 39 SIV-negative and 33 species-specific SIVmnd-1-infected animals. This study was distinguished from previous reports by considerably greater sample size, examination of exclusively naturally infected animals in semi-wild conditions and consideration of simian T-lymphotropic virus (STLV) status in addition to SIVmnd-1 infection. We found that SIVmnd-1 infection was associated with a significant and progressive loss of memory CD4(+) T-cells. Limited but significant increases in markers of immune activation in the T-cell populations, significant increases in plasma neopterin and changes to B-cell subsets were also observed in SIV-infected animals. However, no increase in plasma soluble CD14 was observed. Histological examination of peripheral lymph nodes suggested that SIVmnd-1 infection was not associated with a significant disruption of the lymph node architecture. Whilst this species has evolved numerous strategies to resist the development of AIDS, significant effects of SIV infection could be observed when examined in a natural environment. STLVmnd-1 infection also had significant effects on some markers relevant to understanding SIV infection and thus should be considered in studies of SIV infection of African primates where present.

  3. Genetic Analysis of East Asian Grape Cultivars Suggests Hybridization with Wild Vitis.

    Directory of Open Access Journals (Sweden)

    Nami Goto-Yamamoto

    Full Text Available Koshu is a grape cultivar native to Japan and is one of the country's most important cultivars for wine making. Koshu and other oriental grape cultivars are widely believed to belong to the European domesticated grape species Vitis vinifera. To verify the domesticated origin of Koshu and four other cultivars widely grown in China and Japan, we genotyped 48 ancestry informative single nucleotide polymorphisms (SNPs and estimated wild and domesticated ancestry proportions. Our principal components analysis (PCA based ancestry estimation revealed that Koshu is 70% V. vinifera, and that the remaining 30% of its ancestry is most likely derived from wild East Asian Vitis species. Partial sequencing of chloroplast DNA suggests that Koshu's maternal line is derived from the Chinese wild species V. davidii or a closely related species. Our results suggest that many traditional East Asian grape cultivars such as Koshu were generated from hybridization events with wild grape species.

  4. Mobilization and Role of Starch, Protein, and Fat Reserves during Seed Germination of Six Wild Grassland Species.

    Science.gov (United States)

    Zhao, Ming; Zhang, Hongxiang; Yan, Hong; Qiu, Lu; Baskin, Carol C

    2018-01-01

    Since seed reserves can influence seed germination, the quantitative and qualitative differences in seed reserves may relate to the germination characteristics of species. The purpose of our study was to evaluate the correlation between germination and seed reserves, as well as their mobilization during germination of six grassland species ( Chloris virgata , Kochia scoparia , Lespedeza hedysaroides , Astragalus adsurgens , Leonurus artemisia , and Dracocephalum moldavica ) and compare the results with domesticated species. We measured starch, protein, and fat content in dry seeds and the initial absorption of water during imbibition. Starch, soluble protein, fat, and soluble sugar content also were determined at five stages during germination. Starch, protein, and fat reserves in dry seeds were not significantly correlated with germination percentage and rate (speed), but soluble sugar and soluble protein contents at different germination stages were positively significantly correlated with germination rate for the six species. Starch was mainly used during seed imbibition, and soluble protein was used from the imbibition stage to the highest germination stage. Fat content for all species remained relatively constant throughout germination for six species, regardless of the proportion of other seed reserves in the seeds. Our results for fat utilization differ from those obtained for cultivated grasses and legumes. These results provide new insight on the role of seed reserves as energy resources in germination for wild species.

  5. Mobilization and Role of Starch, Protein, and Fat Reserves during Seed Germination of Six Wild Grassland Species

    Directory of Open Access Journals (Sweden)

    Ming Zhao

    2018-02-01

    Full Text Available Since seed reserves can influence seed germination, the quantitative and qualitative differences in seed reserves may relate to the germination characteristics of species. The purpose of our study was to evaluate the correlation between germination and seed reserves, as well as their mobilization during germination of six grassland species (Chloris virgata, Kochia scoparia, Lespedeza hedysaroides, Astragalus adsurgens, Leonurus artemisia, and Dracocephalum moldavica and compare the results with domesticated species. We measured starch, protein, and fat content in dry seeds and the initial absorption of water during imbibition. Starch, soluble protein, fat, and soluble sugar content also were determined at five stages during germination. Starch, protein, and fat reserves in dry seeds were not significantly correlated with germination percentage and rate (speed, but soluble sugar and soluble protein contents at different germination stages were positively significantly correlated with germination rate for the six species. Starch was mainly used during seed imbibition, and soluble protein was used from the imbibition stage to the highest germination stage. Fat content for all species remained relatively constant throughout germination for six species, regardless of the proportion of other seed reserves in the seeds. Our results for fat utilization differ from those obtained for cultivated grasses and legumes. These results provide new insight on the role of seed reserves as energy resources in germination for wild species.

  6. Seed viability of five wild Saudi Arabian species by germination and X-ray tests

    Directory of Open Access Journals (Sweden)

    B.A. Al-Hammad

    2017-09-01

    Full Text Available Our objective was to evaluate the usefulness of the germination vs. the X-ray test in determining the initial viability of seeds of five wild species (Moringa peregrina, Abrus precatorius, Arthrocnemum macrostachyum, Acacia ehrenbergiana and Acacia tortilis from Saudi Arabia. Usually several days were required to determine the viability of all five species via germination tests. However, X-ray test will give immediate results on filled/viable seeds. Seeds of all species, except Acacia ehrenbergiana and Acacia tortilis showed high viability in both germination (96–72% at 25/15 °C, 94–70% at 35/25 °C and X-ray (100–80% test. Furthermore, there was a general agreement between the germination (19%, 14% at 25/15 °C and 17% and 12% at 35/25 °C and X-ray (8%, 4% tests in which seed viability of Acacia ehrenbergiana and Acacia tortilis was very low due to insect damaged embryo as shown in X-ray analysis. Seeds of Abruspreca torius have physical dormancy, which was broken by scarification in concentrated sulfuric acid (10 min, and they exhibited high viability in both the germination (83% at 25/15 °C and 81% at 35/25 °C and X-ray (96% tests. Most of the nongerminated seeds of the five species except those of Acacia ehrenbergiana and Acacia tortilis, were alive as judged by the tetrazolium test (TZ. Thus, for the five species examined, the X-ray test was proved to be a good and rapid predictor of seed viability.

  7. Screening wild oat accessions from Morocco for resistance to Puccinia coronata

    Science.gov (United States)

    Here we report the screening of 338 new accessions of 11 different wild oat species (Avena) from the USDA Small Grains Collection for resistance to crown rust (Puccinia coronata). Wild oat species were originally collected in Morocco by C. Al Faiz, INRAT Rabat: Avena agadiriana, A. atlantica, A. bar...

  8. Weed Control Efficiency of wild Safflower (Carthamus oxyacanthus M. Bieb in Replacement Series Technique of Barley (Hordeum vulgare L. and Common Vetch (Vicia sativa L.

    Directory of Open Access Journals (Sweden)

    abdolreza ahmadi

    2017-08-01

    Full Text Available Introduction In agronomy, natural outlook has been expressed in different forms which stable agriculture is an example. Stable agriculture is ascribed to the authentic management of agricultural resources, which in addition to fulfilling the ever-changing needs of humans, maintains the health of environment and capacity of water and soil resources. Application of herbicides, besides being costly, resulted in the selection of herbicide resistant weed species and has become an environmental contamination factor. However, reduction of herbicide consumption is one of the goals of modern agriculture, with several methods being suggested, including intercropping. In natural conditions of production, environment conservation of weed existence requires cost. One of the important preparations in weed control from the perspective of sustainable agriculture, is using intercropping system. The aim of this study was to determine the role of crop diversity on weed and crop production based on the beneficial effects of intercropping system than pure. Materials and methods In order to study effects of mixed and sole cropping of barley with common vetch on their biologic yield and utilization indices, an experiment was conducted in Agricultural college of the University of Lorestan, during the growing season of 2013-2014 with 24 treatments using the method of rows replacement series technique by the randomized complete block design in a factorial arrangement with three replications. First factor included 6 levels of intercropping: sole cropping of common vetch (100%, 55-45 (Common vetch-barley, 35-65, 45-55, 65-35 and sole cropping of barley and second factor included 4 levels of weed wild safflower, control, 10, 15 and 20 plants per m2. In this experiment WCE, LER and CR were measured. The data were subjected to analysis of variance (ANOVA using Mstat-C computer software. Mean comparisons were performed using Duncan’s multiple range test at two levels of

  9. TaMSH7: A cereal mismatch repair gene that affects fertility in transgenic barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Langridge Peter

    2007-12-01

    Full Text Available Abstract Background Chromosome pairing, recombination and DNA repair are essential processes during meiosis in sexually reproducing organisms. Investigating the bread wheat (Triticum aestivum L. Ph2 (Pairing homoeologous locus has identified numerous candidate genes that may have a role in controlling such processes, including TaMSH7, a plant specific member of the DNA mismatch repair family. Results Sequencing of the three MSH7 genes, located on the short arms of wheat chromosomes 3A, 3B and 3D, has revealed no significant sequence divergence at the amino acid level suggesting conservation of function across the homoeogroups. Functional analysis of MSH7 through the use of RNAi loss-of-function transgenics was undertaken in diploid barley (Hordeum vulgare L.. Quantitative real-time PCR revealed several T0 lines with reduced MSH7 expression. Positive segregants from two T1 lines studied in detail showed reduced MSH7 expression when compared to transformed controls and null segregants. Expression of MSH6, another member of the mismatch repair family which is most closely related to the MSH7 gene, was not significantly reduced in these lines. In both T1 lines, reduced seed set in positive segregants was observed. Conclusion Results presented here indicate, for the first time, a distinct functional role for MSH7 in vivo and show that expression of this gene is necessary for wild-type levels of fertility. These observations suggest that MSH7 has an important function during meiosis and as such remains a candidate for Ph2.

  10. Hybridization between crops and wild relatives: the contribution of cultivated lettuce to the vigour of crop-wild hybrids under drought, salinity and nutrient deficiency conditions

    NARCIS (Netherlands)

    Uwimana, B.; Smulders, M.J.M.; Hooftman, D.A.P.; Hartman, Y.; Tienderen, van P.H.; Jansen, J.; McHale, L.K.; Michelmore, R.W.; Wiel, van de C.C.M.; Visser, R.G.F.

    2012-01-01

    With the development of transgenic crop varieties, crop–wild hybridization has received considerable consideration with regard to the potential of transgenes to be transferred to wild species. Although many studies have shown that crops can hybridize with their wild relatives and that the resulting

  11. Hybridization between crops and wild relatives: the contribution of cultivated lettuce to the vigour of crop-wild hybrids under drought, salinity and nutrient deficiency conditions

    NARCIS (Netherlands)

    Uwimana, B.; Smulders, M.J.M.; Hooftman, D.A.P.; Hartman, Y.; van Tienderen, P.H.; Jansen, J.; McHale, L.K.; Michelmore, R.W.; van de Wiel, C.C.M.; Visser, R.G.F.

    2012-01-01

    With the development of transgenic crop varieties, crop-wild hybridization has received considerable consideration with regard to the potential of transgenes to be transferred to wild species. Although many studies have shown that crops can hybridize with their wild relatives and that the resulting

  12. Comparative analysis of selected semi-persistent and emerging pollutants in wild-caught fish and aquaculture associated fish using Bogue (Boops boops) as sentinel species.

    Science.gov (United States)

    Henríquez-Hernández, Luis Alberto; Montero, Daniel; Camacho, María; Ginés, Rafael; Boada, Luis D; Ramírez Bordón, Besay; Valerón, Pilar F; Almeida-González, Maira; Zumbado, Manuel; Haroun, Ricardo; Luzardo, Octavio P

    2017-03-01

    The marine environment acts as a sink for diverse anthropogenic pollutants, although the environmental contamination may be non-uniformly distributed. In recent decades, the aquaculture sector has experienced a steady growth postulating as a good alternative for seafood production. However, a social debate exits about the differential level of pollutants in wild and farmed species. This study was designed to evaluate the level of pollutants in a sentinel species: Bogue (Boops boops) associated and non-associated to fish-farm cages. A total of 82 chemical substances were determined by gas chromatography-mass spectrometry, including persistent (polychlorobiphenyls (PCBs) and organochlorine pesticides (OCPs)), semi-persistent (bromodiphenyl ethers (BDEs) and polycyclic aromatic hydrocarbons (PAHs)), and emerging pollutants (such as organophosphate flame retardants (OPFRs) and UV-filters). In general, aquaculture-associated bogues showed lower levels of semi-persistent and emerging pollutants than wild-caught fish, especially when sums were considered. Thus, sum of BDEs was significantly lower in the aquaculture group (p=0.01). A similar trend was also observed for benzo(a)anthracene, the UV-filter 2-ethylhexyl-p-methoxycinnamate and some OPFRs. In the case of persistent pollutants, the sum of dioxin-like PCBs and sum of DDTs were lower in the group of wild-caught bogues (p=0.034 and p=0.003, respectively) than in aquaculture-associated bogues, as previously described for some aquaculture species. Fish feed appear as an important factor in the uptake of such substances suggesting a diet intervention to reduce their levels in the aquaculture products. Another interesting result is that for almost all chemical substances analyzed, bogues captured near sewage outfalls showed the highest levels of pollutants, pointing out the need of stringent measures for wastewater treatment units discharging in coastal areas. On the light of these results, further research in specific

  13. Niche conservatism and the invasive potential of the wild boar.

    Science.gov (United States)

    Sales, Lilian Patrícia; Ribeiro, Bruno R; Hayward, Matt Warrington; Paglia, Adriano; Passamani, Marcelo; Loyola, Rafael

    2017-09-01

    Niche conservatism, i.e. the retention of a species' fundamental niche through evolutionary time, is cornerstone for biological invasion assessments. The fact that species tend to maintain their original climate niche allows predictive maps of invasion risk to anticipate potential invadable areas. Unravelling the mechanisms driving niche shifts can shed light on the management of invasive species. Here, we assessed niche shifts in one of the world's worst invasive species: the wild boar Sus scrofa. We also predicted potential invadable areas based on an ensemble of three ecological niche modelling methods, and evaluated the performance of models calibrated with native vs. pooled (native plus invaded) species records. By disentangling the drivers of change on the exotic wild boar population's niches, we found strong evidence for niche conservatism during biological invasion. Ecological niche models calibrated with both native and pooled range records predicted convergent areas. Also, observed niche shifts are mostly explained by niche unfilling, i.e. there are unoccupied areas in the exotic range where climate is analogous to the native range. Niche unfilling is expected as result of recent colonization and ongoing dispersal, and was potentially stronger for the Neotropics, where a recent wave of introductions for pig-farming and game-hunting has led to high wild boar population growth rates. The invasive potential of wild boar in the Neotropics is probably higher than in other regions, which has profound management implications if we are to prevent their invasion into species-rich areas, such as Amazonia, coupled with expansion of African swine fever and possibly great economic losses. Although the originally Eurasian-wide distribution suggests a pre-adaptation to a wide array of climates, the wild boar world-wide invasion does not exhibit evidence of niche evolution. The invasive potential of the wild boar therefore probably lies on the reproductive, dietary and

  14. Identification of Potential Wild Herbal as parts of Landscape Elements

    Science.gov (United States)

    Sulistyantara, Bambang; Mentari, Nio

    2017-10-01

    Many landscape plants can grow on their own without cultivated by humans. They are type of plants that can be found anywhere, so they can be categorized as wild plants. The economic value of wild plants are easy to obtain and their maintenance costs are low. Because wild plants not widely known even a just a few of people that aware of their existence, it is necessary to do a study to learn the potential of the wild plants to be used as an element of landscape. This research aims to identify the species that have potential to be used in landscape design, to describe the benefits of the their implementation as a landscape element, and to recommend the wild plants that have functional value and visual. This research used a scoring method based on the functional and visual criteria, and questionnaires were conducted to 50 students of Landscape Architecture IPB who have completed Landscape Plants courses. Based on the research, there are 150 species of wild plants that found in the study site, and 60 of them are recommended as landscape elements. Then all of the species were arranged as a recommendations book so they can be used as alternative landscape plants.

  15. Use of wild and semi-wild edible plants in nutrition and survival of people in 1430 days of siege of Sarajevo during the war in Bosnia and Herzegovina (1992-1995).

    Science.gov (United States)

    Redzić, Sulejman

    2010-06-01

    This study is a systematic overview of data on use of wild and semi-wild edible plants in nutrition of people in 1430 days of the siege of Sarajevo during aggression on Bosnia and Herzegovina (1992-1995). The author of this study spent all that time in Sarajevo. In 1993, the author prepared a survival program for people that included usage of edible wild plants. In addition, he conducted a detailed survey, including special interviews, on 630 people of average age 37.4 years (55% residential inhabitants, the rest were refuges), 310 males and the rest were females. According to survey, 91 species of mostly wild plants and three species of fungus were used: Küchneromyces mutabilis, Armillariella mellea and Coprinus comatus. Wild vegetables included 49 species, spices 24, wild fruits 16, and 2 species of bread-plants. They belong to 26 plants communities, and grew on 24 different habitats (urban surfaces, river coasts, low forest and scrubs, meadows and rocky grasslands). The 156 plant parts (leaves, young branches, fruit, flower, seed, root and rhizome) from 91 plant species were used. Vegetables were dominant category of use (soups, pottages, sauces) with 80 ways of preparation (30.53%), then salads 41 (15.65%), spices 39 (14.89%), different beverages 38 (14.50%), sweets 21 (8.02%), nutritive teas 15 (5.73%), and other preparations. In order to improve conventional food (war pasta, rice, lentils, old beans) people used spices made from different wild plants.

  16. Fatty Acid Composition of Six Freshwater Wild Cyanobacterial Species

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Dor, I.; Prell, Aleš; Dembitský, V. M.

    2003-01-01

    Roč. 48, č. 1 (2003), s. 71-75 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z5020903 Keywords : cyanobacterial spcies * freshwater wild Subject RIV: EE - Microbiology, Virology Impact factor: 0.857, year: 2003

  17. Hydrotime Analysis of Yellow Sweetclover (Melilotus officinalis (L. Lam., Wild Mustard (Sinapis arvensis L. and Barley (Hordeum vulgare L. Seed Germination

    Directory of Open Access Journals (Sweden)

    A. Derakhshan

    2017-01-01

    Full Text Available Introduction: Seed germination is one of the key stages in the life cycle of plants that can ultimately affect their fitness in the environment. The temporal pattern of seed germination is extremely depended on the soil water potential (Ψ of the germination medium, as this determines the equilibrium water content of the seed. As for temperature, there is a minimum Ψ that must be exceeded in order for seeds complete germination, and seeds in a population vary in the value of this minimum or base Ψ. The germination of a seed population in response to the reduced water potential is modeled using the hydrotime model. According to this model, the time to germination for a given seed fraction (g is inversely related to the difference between the current seed Ψ and the base water potential (Ψb for that fraction (Ψb(g. The hydrotime model functions are well in matching both the timing and the percentage of germination of seed populations in relation to their Ψ environment. In addition, the model outputs which are significant physiologically and ecologically and the parameters of the model can be used to characterize the properties of seed populations. Normal distribution of Ψb among seeds within a population is one of the assumptions of the hydrotime model. However, this assumption may not be met in many species and thus can result in poor predictions. We tried to investigate empirically the validity of this assumption, to compare the fit of alternative distributions and make recommendations to improve germination modeling procedures. Materials and Methods: Seed germination of Melilotus officinalis, Sinapis arvensis and Hordeum vulgare were tested across a range of water potentials (0, -0.2, -0.4, -0.6 and -0.8 MPa for M. officinalis and S. arvensis and 0, -0.3, -0.6, -0.9, -1.2 and -1.5 MPa for H. vulgare and germination responses were described by the hydrotime models based on twelve statistical functions including Normal, Beta, Gamma

  18. Cultivar-Based Introgression Mapping Reveals Wild Species-Derived Pm-0, the Major Powdery Mildew Resistance Locus in Squash

    Science.gov (United States)

    Holdsworth, William L.; LaPlant, Kyle E.; Bell, Duane C.; Jahn, Molly M.; Mazourek, Michael

    2016-01-01

    Powdery mildew is a major fungal disease on squash and pumpkin (Cucurbita spp.) in the US and throughout the world. Genetic resistance to the disease is not known to occur naturally within Cucurbita pepo and only infrequently in Cucurbita moschata, but has been achieved in both species through the introgression of a major resistance gene from the wild species Cucurbita okeechobeensis subsp. martinezii. At present, this gene, Pm-0, is used extensively in breeding, and is found in nearly all powdery mildew-resistant C. pepo and C. moschata commercial cultivars. In this study, we mapped C. okeechobeensis subsp. martinezii-derived single nucleotide polymorphism (SNP) alleles in a set of taxonomically and morphologically diverse and resistant C. pepo and C. moschata cultivars bred at Cornell University that, by common possession of Pm-0, form a shared-trait introgression panel. High marker density was achieved using genotyping-by-sequencing, which yielded over 50,000 de novo SNP markers in each of the three Cucurbita species genotyped. A single 516.4 kb wild-derived introgression was present in all of the resistant cultivars and absent in a diverse set of heirlooms that predated the Pm-0 introgression. The contribution of this interval to powdery mildew resistance was confirmed by association mapping in a C. pepo cultivar panel that included the Cornell lines, heirlooms, and 68 additional C. pepo cultivars and with an independent F2 population derived from C. okeechobeensis subsp. martinezii x C. moschata. The interval was refined to a final candidate interval of 76.4 kb and CAPS markers were developed inside this interval to facilitate marker-assisted selection. PMID:27936008

  19. Cultivar-Based Introgression Mapping Reveals Wild Species-Derived Pm-0, the Major Powdery Mildew Resistance Locus in Squash.

    Science.gov (United States)

    Holdsworth, William L; LaPlant, Kyle E; Bell, Duane C; Jahn, Molly M; Mazourek, Michael

    2016-01-01

    Powdery mildew is a major fungal disease on squash and pumpkin (Cucurbita spp.) in the US and throughout the world. Genetic resistance to the disease is not known to occur naturally within Cucurbita pepo and only infrequently in Cucurbita moschata, but has been achieved in both species through the introgression of a major resistance gene from the wild species Cucurbita okeechobeensis subsp. martinezii. At present, this gene, Pm-0, is used extensively in breeding, and is found in nearly all powdery mildew-resistant C. pepo and C. moschata commercial cultivars. In this study, we mapped C. okeechobeensis subsp. martinezii-derived single nucleotide polymorphism (SNP) alleles in a set of taxonomically and morphologically diverse and resistant C. pepo and C. moschata cultivars bred at Cornell University that, by common possession of Pm-0, form a shared-trait introgression panel. High marker density was achieved using genotyping-by-sequencing, which yielded over 50,000 de novo SNP markers in each of the three Cucurbita species genotyped. A single 516.4 kb wild-derived introgression was present in all of the resistant cultivars and absent in a diverse set of heirlooms that predated the Pm-0 introgression. The contribution of this interval to powdery mildew resistance was confirmed by association mapping in a C. pepo cultivar panel that included the Cornell lines, heirlooms, and 68 additional C. pepo cultivars and with an independent F2 population derived from C. okeechobeensis subsp. martinezii x C. moschata. The interval was refined to a final candidate interval of 76.4 kb and CAPS markers were developed inside this interval to facilitate marker-assisted selection.

  20. The Gene Pool Concept Applied to Crop Wild Relatives: An Evolutionary Perspective

    Science.gov (United States)

    Crop wild relatives (CWR) can provide important resources for the genetic improvement of cultivated species. Because crops are often closely related to many wild species, and because exploration of CWR for useful traits can take many years and substantial resources, the categorization of CWR based o...

  1. Ticks infesting wild and domestic animals and humans of Sri Lanka with new host records.

    Science.gov (United States)

    Liyanaarachchi, D R; Rajakaruna, R S; Dikkumbura, A W; Rajapakse, R P V J

    2015-02-01

    An island-wide collection of tick species infesting humans, domesticated and wild animals and questing ticks in domestic and peridomestic environments was carried out during 2009-2011. A total of 30,461 ticks were collected from 30 different hosts and free living stages from the ground. The collection consisted of 22 tick species from 30 different hosts recording 12 tick species from humans, 19 from domesticated animals and 21 from wild animals, with a total of 97 new host records. The most common tick species on humans were Dermacentor auratus and Amblyomma testudinairum, while Haemaphysalis intermedia, Rhipicephalus microplus and Rhipicephalus sanguineus were common in domesticated and wild animals sharing 20 host species. Among the questing ticks, immature D. auratus was the most abundant. Humans and domesticated animals were mostly infested by the nymphal stages while adult ticks were found on wild animals. High number of new host records could be due to domestic animals picking tick species from wildlife and vise versa at the human/animal interface. Habitat destruction due to forest fragmentation has lead to wild animals roaming in urban and semi-urban neighbourhoods increasing the interactions of wild animals with domesticated animals. Wild animals play a significant role as a reservoir of many tick borne infections which can easily be spread to domesticated animals and then to humans via tick infestations. Data in this paper are useful for those interested in tick infesting wild and domestic animals and humans in describing the zoonotic potential of tick borne infections. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. Serum concentrations of lipids, vitamin d metabolites, retinol, retinyl esters, tocopherols and selected carotenoids in twelve captive wild felid species at four zoos.

    Science.gov (United States)

    Crissey, Susan D; Ange, Kimberly D; Jacobsen, Krista L; Slifka, Kerri A; Bowen, Phyllis E; Stacewicz-Sapuntzakis, Maria; Langman, Craig B; Sadler, William; Kahn, Stephen; Ward, Ann

    2003-01-01

    Serum concentrations of several nutrients were measured in 12 captive wild felid species including caracal (Felis caracal), cheetah (Acinonyx jubatus), cougar (Felis concolor), fishing cat (Felis viverrinus), leopard (Panthera pardus), lion (Panthera leo), ocelot (Felis pardalis), pallas cat (Felis manul), sand cat (Felis margarita), serval (Felis serval), snow leopard (Panthera uncia) and tiger (Panthera tigris). Diet information was collected for these animals from each participating zoo (Brookfield Zoo, Fort Worth Zoo, Lincoln Park Zoological Gardens and North Carolina Zoological Park). The nutritional composition of the diets at each institution met the probable dietary requirements for each species except for the pallas cat. Blood samples were collected from each animal (n = 69) and analyzed for lipids (total cholesterol, triacylglycerides, HDL cholesterol and LDL cholesterol), vitamin D metabolites [25-hydroxycholecalciferol (25(OH)D) and 1,25-dihydroxycholecalciferol (1,25(OH)(2)D)], vitamin A (retinol, retinyl stearate and retinyl palmitate), vitamin E (alpha- and gamma-tocopherol) and selected carotenoids. Species differences were found for all except triacylglycerides and 1,25(OH)(2)D. Genus differences were found for retinol, retinyl palmitate, retinyl stearate, gamma-tocopherol and beta-carotene. Circulating nutrient concentrations for many of the species in this study have not been reported previously and most have not been compared with the animals' dietary intakes. The large number of animals analyzed provides a substantial base for comparing the serum nutrient concentrations of healthy animals, for both wild and captive exotic species.

  3. Interkingdom signaling: The role of homoserine lactones in early responses and resistance in barley (Hordeum vulgare L.)

    OpenAIRE

    Rankl, Simone

    2017-01-01

    N-Acyl-D/L-homoserine lactones (AHLs) are produced as microbial signaling compounds during bacterial intra- and inter-specific communication in the rhizosphere. Thus, plants are naturally exposed to these compounds and respond with tissue-specific reactions. In the present study the impact of AHLs on the monocot barley (Hordeum vulgare L.) was investigated. The treatment with C8- and C12- homoserine lactones (HSL) resulted in root and shoot biomass gain as well as in the formation of lat...

  4. Wild cassava, Manihot spp.: Biology and potentialities for genetic improvement

    Directory of Open Access Journals (Sweden)

    Nassar Nagib M.A.

    2000-01-01

    Full Text Available Wild species of Manihot are progenitors of cassava. They constitute valuable genetic reservoirs presenting genes that show new characters. Screening of these species showed some of them to have a notably high percentage of protein combined with a low percentage of hydrocyanic acid. Study of natural habitats revealed resistance to drought and excessive soil aluminum toxicity as well as adaptation to low temperature. Some of the hybrids obtained showed high root productivity and resistance to stem borers. Apomixis was discovered in the wild and transferred successfully to the cultivate species.

  5. Wild plant species growing closely connected in a subalpine meadow host distinct root-associated bacterial communities

    Directory of Open Access Journals (Sweden)

    Kristin Aleklett

    2015-02-01

    Full Text Available Plant roots are known to harbor large and diverse communities of bacteria. It has been suggested that plant identity can structure these root-associated communities, but few studies have specifically assessed how the composition of root microbiota varies within and between plant species growing under natural conditions. We assessed the community composition of endophytic and epiphytic bacteria through high throughput sequencing using 16S rDNA derived from root tissues collected from a population of a wild, clonal plant (Orange hawkweed–Pilosella aurantiaca as well as two neighboring plant species (Oxeye daisy–Leucanthemum vulgare and Alsike clover–Trifolium hybridum. Our first goal was to determine if plant species growing in close proximity, under similar environmental conditions, still hosted unique root microbiota. Our results showed that plants of different species host distinct bacterial communities in their roots. In terms of community composition, Betaproteobacteria (especially the family Oxalobacteraceae were found to dominate in the root microbiota of L. vulgare and T. hybridum samples, whereas the root microbiota of P. aurantiaca had a more heterogeneous distribution of bacterial abundances where Gammaproteobacteria and Acidobacteria occupied a larger portion of the community. We also explored the extent of individual variance within each plant species investigated, and found that in the plant species thought to have the least genetic variance among individuals (P. aurantiaca still hosted just as diverse microbial communities. Whether all plant species host their own distinct root microbiota and plants more closely related to each other share more similar bacterial communities still remains to be fully explored, but among the plants examined in this experiment there was no trend that the two species belonging to the same family shared more similarities in terms of bacterial community composition.

  6. Bovine tuberculosis in livestock and wild boar on the Mediterranean island, Corsica.

    Science.gov (United States)

    Richomme, Céline; Boschiroli, María Laura; Hars, Jean; Casabianca, François; Ducrot, Christian

    2010-04-01

    The zoonotic agent of bovine tuberculosis (bTB), Mycobacterium bovis, can be transmitted between domestic and wild animals, threatening wildlife populations and control programs for bTB in cattle. In Corsica, a French Mediterranean island where domestic and wild species have close interactions, bTB cases have been reported in cattle, pigs, and wild boar. Moreover, genotypes of M. bovis found in wild and domestic animals from the same area were identical. These data strongly suggest that wild and domestic animals are associated in an epidemiologic bTB-transmission cycle. More investigations are needed, not only to understand the role played by each species in order to implement appropriate control measures, but also to assess the risk of transmission to humans.

  7. Phytochemical characterization of wild edible Boletus sp. from Northeast Portugal

    OpenAIRE

    Heleno, Sandrina A.; Barros, Lillian; Martins, Anabela; Sousa, Maria João; Ferreira, Isabel C.F.R.

    2010-01-01

    Our research has been focused on the documentation of nutritional composition and nutraceutical potential of wild mushrooms, making the information available for a better management and conservation of these species and related habitats. In the present work, the chemical composition and bioactivity of three wild edible Boletus sp. (Boletus aereus, Boletus edulis, Boletus reticulatus) from Northeast Portugal were evaluated, in order to valorise these species as sources of important...

  8. Application of environmental DNA to detect an endangered marine skate species in the wild.

    Science.gov (United States)

    Weltz, Kay; Lyle, Jeremy M; Ovenden, Jennifer; Morgan, Jessica A T; Moreno, David A; Semmens, Jayson M

    2017-01-01

    Environmental DNA (eDNA) techniques have only recently been applied in the marine environment to detect the presence of marine species. Species-specific primers and probes were designed to detect the eDNA of the endangered Maugean skate (Zearaja maugeana) from as little as 1 L of water collected at depth (10-15 m) in Macquarie Harbour (MH), Tasmania. The identity of the eDNA was confirmed as Z. maugeana by sequencing the qPCR products and aligning these with the target sequence for a 100% match. This result has validated the use of this eDNA technique for detecting a rare species, Z. maugeana, in the wild. Being able to investigate the presence, and possibly the abundance, of Z. maugeana in MH and Bathurst harbour (BH), would be addressing a conservation imperative for the endangered Z. maugeana. For future application of this technique in the field, the rate of decay was determined for Z. maugeana eDNA under ambient dissolved oxygen (DO) levels (55% saturation) and lower DO (20% saturation) levels, revealing that the eDNA can be detected for 4 and 16 hours respectively, after which eDNA concentration drops below the detection threshold of the assay. With the rate of decay being influenced by starting eDNA concentrations, it is recommended that samples be filtered as soon as possible after collection to minimize further loss of eDNA prior to and during sample processing.

  9. Application of environmental DNA to detect an endangered marine skate species in the wild.

    Directory of Open Access Journals (Sweden)

    Kay Weltz

    Full Text Available Environmental DNA (eDNA techniques have only recently been applied in the marine environment to detect the presence of marine species. Species-specific primers and probes were designed to detect the eDNA of the endangered Maugean skate (Zearaja maugeana from as little as 1 L of water collected at depth (10-15 m in Macquarie Harbour (MH, Tasmania. The identity of the eDNA was confirmed as Z. maugeana by sequencing the qPCR products and aligning these with the target sequence for a 100% match. This result has validated the use of this eDNA technique for detecting a rare species, Z. maugeana, in the wild. Being able to investigate the presence, and possibly the abundance, of Z. maugeana in MH and Bathurst harbour (BH, would be addressing a conservation imperative for the endangered Z. maugeana. For future application of this technique in the field, the rate of decay was determined for Z. maugeana eDNA under ambient dissolved oxygen (DO levels (55% saturation and lower DO (20% saturation levels, revealing that the eDNA can be detected for 4 and 16 hours respectively, after which eDNA concentration drops below the detection threshold of the assay. With the rate of decay being influenced by starting eDNA concentrations, it is recommended that samples be filtered as soon as possible after collection to minimize further loss of eDNA prior to and during sample processing.

  10. Thermal limits of wild and laboratory strains of two African malaria vector species, Anopheles arabiensis and Anopheles funestus

    Directory of Open Access Journals (Sweden)

    Lyons Candice L

    2012-07-01

    Full Text Available Abstract Background Malaria affects large parts of the developing world and is responsible for almost 800,000 deaths annually. As climates change, concerns have arisen as to how this vector-borne disease will be impacted by changing rainfall patterns and warming temperatures. Despite the importance and controversy surrounding the impact of climate change on the potential spread of this disease, little information exists on the tolerances of several of the vector species themselves. Methods Using a ramping protocol (to assess critical thermal limits - CT and plunge protocol (to assess lethal temperature limits - LT information on the thermal tolerance of two of Africa’s important malaria vectors, Anopheles arabiensis and Anopheles funestus was collected. The effects of age, thermal acclimation treatment, sex and strain (laboratory versus wild adults were investigated for CT determinations for each species. The effects of age and sex for adults and life stage (larvae, pupae, adults were investigated for LT determinations. Results In both species, females are more tolerant to low and high temperatures than males; larvae and pupae have higher upper lethal limits than do adults. Thermal acclimation of adults has large effects in some instances but small effects in others. Younger adults tend to be more tolerant of low or high temperatures than older age groups. Long-standing laboratory colonies are sufficiently similar in thermal tolerance to field-collected animals to provide reasonable surrogates when making inferences about wild population responses. Differences between these two vectors in their thermal tolerances, especially in larvae and pupae, are plausibly a consequence of different habitat utilization. Conclusions Limited plasticity is characteristic of the adults of these vector species relative to others examined to date, suggesting limited scope for within-generation change in thermal tolerance. These findings and the greater tolerance

  11. The Implications of Ranaviruses to European farmed and wild freshwater fish

    DEFF Research Database (Denmark)

    Jensen, Ann Britt Bang

    The present thesis explores the implications of ranaviruses to European farmed and wild freshwater fish. The work presented was carried out as a part of the EU project “Risk assessment of new and emerging systemic iridoviral diseases for European fish and aquatic ecosystems” which was initiated...... in 2005 as a reaction to the speculation that ranaviruses might pose a serious threat to both farmed and wild-living freshwater fish and amphibians within the European community. In the present thesis, the purpose is to determine the implications of ranaviruses to European freshwater farmed and wild...... describing the risk of introduction and spread of exotic ranaviruses in European wild and farmed aquatic ecosystems Objectives 1 and 2 have been addressed by experimental trials involving bath challenges of both European farmed and wild fish species and ornamental fish species. The results showed that some...

  12. Impact of managed honey bee viruses on wild bees.

    Science.gov (United States)

    Tehel, Anja; Brown, Mark Jf; Paxton, Robert J

    2016-08-01

    Several viruses found in the Western honey bee (Apis mellifera) have recently been detected in other bee species, raising the possibility of spill-over from managed to wild bee species. Alternatively, these viruses may be shared generalists across flower-visiting insects. Here we explore the former hypothesis, pointing out weaknesses in the current evidence, particularly in relation to deformed wing virus (DWV), and highlighting research areas that may help test it. Data so far suggest that DWV spills over from managed to wild bee species and has the potential to cause population decline. That DWV and other viruses of A. mellifera are found in other bee species needs to be considered for the sustainable management of bee populations. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. Wild vegetable mixes sold in the markets of Dalmatia (southern Croatia).

    Science.gov (United States)

    Łuczaj, Łukasz; Zovkokončić, Marijana; Miličević, Tihomir; Dolina, Katija; Pandža, Marija

    2013-01-03

    Dalmatia is an interesting place to study the use of wild greens as it lies at the intersection of influence of Slavs, who do not usually use many species of wild greens, and Mediterranean culinary culture, where the use of multiple wild greens is common. The aim of the study was to document the mixtures of wild green vegetables which are sold in all the vegetable markets of Dalmatia. All vendors (68) in all 11 major markets of the Dalmatian coast were interviewed. The piles of wild vegetables they sold were searched and herbarium specimens taken from them. The mean number of species in the mix was 5.7. The most commonly sold wild plants are: Sonchus oleraceus L., Allium ampeloprasum L., Foeniculum vulgare Mill., Urospermum picroides F.W.Schmidt, Papaver rhoeas L., Daucus carota L., Taraxacum sp., Picris echioides L., Silene latifolia Poir. and Crepis spp. Also the cultivated beet (Beta vulgaris L.) and a few cultivated Brassicaceae varieties are frequent components. Wild vegetables from the mix are usually boiled for 20-30 minutes and dressed with olive oil and salt. Altogether at least 37 wild taxa and 13 cultivated taxa were recorded.Apart from the mixes, Asparagus acutifolius L. and Tamus communis L. shoots are sold in separate bunches (they are usually eaten with eggs), as well as some Asteraceae species, the latter are eaten raw or briefly boiled. The rich tradition of eating many wild greens may result both from strong Venetian and Greek influences and the necessity of using all food resources available in the barren, infertile land in the past. Although the number of wild-collected green vegetables is impressive we hypothesize that it may have decreased over the years, and that further in-depth local ethnobotanical studies are needed in Dalmatia to record the disappearing knowledge of edible plants.

  14. The absence of wild game and fish species from the USDA National Nutrient Database for standard reference: addressing information gaps in wild caught foods.

    Science.gov (United States)

    Tidball, Moira M; Tidball, Keith G; Curtis, Paul

    2014-01-01

    We highlighted gaps in nutritional data for wild game meat and wild caught fish that have a regulated harvesting season in New York State, and examined the possible role that wild game and fish play in current trends towards consumption of local, healthy meat sources. This project is part of larger study that examines family food decision-making, and explores possibilities for leveraging the locavore movement in support of consumption of wild game and fish.

  15. CWRML: representing crop wild relative conservation and use data in XML.

    Science.gov (United States)

    Moore, Jonathan D; Kell, Shelagh P; Iriondo, Jose M; Ford-Lloyd, Brian V; Maxted, Nigel

    2008-02-25

    Crop wild relatives are wild species that are closely related to crops. They are valuable as potential gene donors for crop improvement and may help to ensure food security for the future. However, they are becoming increasingly threatened in the wild and are inadequately conserved, both in situ and ex situ. Information about the conservation status and utilisation potential of crop wild relatives is diverse and dispersed, and no single agreed standard exists for representing such information; yet, this information is vital to ensure these species are effectively conserved and utilised. The European Community-funded project, European Crop Wild Relative Diversity Assessment and Conservation Forum, determined the minimum information requirements for the conservation and utilisation of crop wild relatives and created the Crop Wild Relative Information System, incorporating an eXtensible Markup Language (XML) schema to aid data sharing and exchange. Crop Wild Relative Markup Language (CWRML) was developed to represent the data necessary for crop wild relative conservation and ensure that they can be effectively utilised for crop improvement. The schema partitions data into taxon-, site-, and population-specific elements, to allow for integration with other more general conservation biology schemata which may emerge as accepted standards in the future. These elements are composed of sub-elements, which are structured in order to facilitate the use of the schema in a variety of crop wild relative conservation and use contexts. Pre-existing standards for data representation in conservation biology were reviewed and incorporated into the schema as restrictions on element data contents, where appropriate. CWRML provides a flexible data communication format for representing in situ and ex situ conservation status of individual taxa as well as their utilisation potential. The development of the schema highlights a number of instances where additional standards-development may

  16. Hepatozoon silvestris sp. nov.: morphological and molecular characterization of a new species of Hepatozoon (Adeleorina: Hepatozoidae) from the European wild cat (Felis silvestris silvestris).

    Science.gov (United States)

    Hodžić, Adnan; Alić, Amer; Prašović, Senad; Otranto, Domenico; Baneth, Gad; Duscher, Georg Gerhard

    2017-04-01

    Based on morphological and genetic characteristics, we describe a new species of Hepatozoon in the European wild cat (Felis silvestris silvestris), herein named Hepatozoon silvestris sp. nov. The study also provides the first data on the occurrence of H. felis in this wild felid. Hepatozoon meronts were observed in multiple cross-sections of different organs of four (44%) cats. Additionally, extracellular forms, resembling mature gamonts of Hepatozoon, were found in the spleen and myocardium of two cats. Furthermore, tissues of six animals (67%) were positive by PCR. Hepatozoon felis was identified infecting one cat (11%), whereas the 18S rRNA sequences of the remaining five cats (56%) were identical, but distinct from the sequences of H. felis. Phylogenetic analyses revealed that those sequences form a highly supported clade distant from other Hepatozoon spp. Future studies should include domestic cats from the areas where the wild cats positive for H. silvestris sp. nov. were found, in order to investigate their potential role to serve as intermediate hosts of this newly described species. Identification of its definitive host(s) and experimental transmission studies are required for elucidating the full life cycle of this parasite and the possible alternative routes of its transmission.

  17. A study on the comparison of antioxidant effects among wild ginseng, cultivated wild ginseng, and cultivated ginseng extracts

    Directory of Open Access Journals (Sweden)

    Hae Young, Jang

    2008-09-01

    Full Text Available Objective : The objective of this study was to compare the antioxidant effects among wild ginseng, cultivated wild ginseng, and ginseng extracts. Methods : In vitro antioxidant activities were examined by total antioxidant capacity (TAC, oxygen radical scavenging capacity(ORAC, total phenolic content, 1, 1-Diphenyl-2-picrylhydrazyl (DPPH radical scavenging activity, inhibition of induced lipid peroxidation using liver mitochondria, reactive oxygen species(ROS scavenging effect using 2’, 7’-dichlorofluorescein(DCF fluorescence. Results : 1. TAC of 1.5 and 3.75 mg extracts was highest in cultivated wild ginseng, followed by wild ginseng and lowest in ginseng. 2. ORAC of 2, 10, and 20 μg extracts was highest in cultivated wild ginseng, followed by wild ginseng and lowest in ginseng. 3. Total phenolic content of 0.375, 0.938, and 1.875 mg extracts was highest in cultivated wild ginseng, followed by wild ginseng and lowest in ginseng. 4. DPPH(1, 1 -Diphenyl-2-picrylhydrazyl scavenging activity between wild ginseng and cultivated wild ginseng did not differ significantly (p>0.05. 5. Induced lipid peroxidation, measured by TBARS concentration in solution containing rat liver mitochondria incubated in the presence of FeSO4/ascorbic acid was inhibited as amounts of wild ginseng, cultivated wild ginseng, and ginseng extracts increased. TBARS concentration of ginseng extracts were significantly (p<0.05 higher than wild ginseng or cultivated wild ginseng extracts. 6. DCF fluorescence intensity was decreased as concentrations of wild ginseng, cultivated wild ginseng, and ginseng extracts increased, demonstrating that ROS generation was inhibited in a concentrationdependent manner. Conclusions : In summary, the results of this study demonstrate that cultivated wild ginseng extracts had similar antioxidant activities to wild ginseng extracts and greater that of cultivated ginseng extracts.

  18. Wild genius - domestic fool? Spatial learning abilities of wild and domestic guinea pigs

    Directory of Open Access Journals (Sweden)

    Sachser Norbert

    2010-03-01

    Full Text Available Abstract Background Domestic animals and their wild relatives differ in a wide variety of aspects. The process of domestication of the domestic guinea pig (Cavia aperea f. porcellus, starting at least 4500 years ago, led to changes in the anatomy, physiology, and behaviour compared with their wild relative, the wild cavy, Cavia aperea. Although domestic guinea pigs are widely used as a laboratory animal, learning and memory capabilities are often disregarded as being very scarce. Even less is known about learning and memory of wild cavies. In this regard, one striking domestic trait is a reduction in relative brain size, which in the domesticated form of the guinea pig amounts to 13%. However, the common belief, that such a reduction of brain size in the course of domestication of different species is accomplished by less learning capabilities is not at all very well established in the literature. Indeed, domestic animals might also even outperform their wild conspecifics taking advantage of their adaptation to a man-made environment. In our study we compared the spatial learning abilities of wild and domestic guinea pigs. We expected that the two forms are different regarding their learning performance possibly related to the process of domestication. Therefore wild cavies as well as domestic guinea pigs of both sexes, aged 35 to 45 days, were tested in the Morris water maze to investigate their ability of spatial learning. Results Both, wild cavies and domestic guinea pigs were able to learn the task, proving the water maze to be a suitable test also for wild cavies. Regarding the speed of learning, male as well as female domestic guinea pigs outperformed their wild conspecifics significantly. Interestingly, only domestic guinea pigs showed a significant spatial association of the platform position, while other effective search strategies were used by wild cavies. Conclusion The results demonstrate that domestic guinea pigs do not at all

  19. Wild genius - domestic fool? Spatial learning abilities of wild and domestic guinea pigs.

    Science.gov (United States)

    Lewejohann, Lars; Pickel, Thorsten; Sachser, Norbert; Kaiser, Sylvia

    2010-03-25

    Domestic animals and their wild relatives differ in a wide variety of aspects. The process of domestication of the domestic guinea pig (Cavia aperea f. porcellus), starting at least 4500 years ago, led to changes in the anatomy, physiology, and behaviour compared with their wild relative, the wild cavy, Cavia aperea. Although domestic guinea pigs are widely used as a laboratory animal, learning and memory capabilities are often disregarded as being very scarce. Even less is known about learning and memory of wild cavies. In this regard, one striking domestic trait is a reduction in relative brain size, which in the domesticated form of the guinea pig amounts to 13%. However, the common belief, that such a reduction of brain size in the course of domestication of different species is accomplished by less learning capabilities is not at all very well established in the literature. Indeed, domestic animals might also even outperform their wild conspecifics taking advantage of their adaptation to a man-made environment.In our study we compared the spatial learning abilities of wild and domestic guinea pigs. We expected that the two forms are different regarding their learning performance possibly related to the process of domestication. Therefore wild cavies as well as domestic guinea pigs of both sexes, aged 35 to 45 days, were tested in the Morris water maze to investigate their ability of spatial learning. Both, wild cavies and domestic guinea pigs were able to learn the task, proving the water maze to be a suitable test also for wild cavies. Regarding the speed of learning, male as well as female domestic guinea pigs outperformed their wild conspecifics significantly. Interestingly, only domestic guinea pigs showed a significant spatial association of the platform position, while other effective search strategies were used by wild cavies. The results demonstrate that domestic guinea pigs do not at all perform worse than their wild relatives in tests of spatial

  20. Unraveling the genetic history of the European wild goats

    Science.gov (United States)

    Ureña, I.; Ersmark, E.; Samaniego, J. A.; Galindo-Pellicena, M. A.; Crégut-Bonnoure, E.; Bolívar, H.; Gómez-Olivencia, A.; Rios-Garaizar, J.; Garate, D.; Dalén, L.; Arsuaga, J. L.; Valdiosera, C. E.

    2018-04-01

    The population history of the Iberian wild goat and the Alpine ibex has been closely related to that of humans since the Palaeolithic. Current molecular and paleontological studies differ substantially on the phylogenetic origin of the European wild goats, possibly due the loss of genetic variation through time. We investigated the phylogenetic relationship between the Alpine ibex (Capra ibex) and the Iberian wild goat (Capra pyrenaica) including different Iberian wild goat subspecies by applying ancient DNA techniques combined with Next Generation Sequencing technologies. We analysed the cytochrome b gene of the mitochondrial genome in 33 ancient and modern European wild goats from Spain and France together with publicly available genetic information of modern wild goats. This work uncovers for the first time ancient genetic information of the Iberian wild goat and the Alpine ibex, spanning a time range of approximately 40,000 years to the present. Our results suggest genetic continuity between ancient and modern populations and indicate a monophyletic origin of the Alpine ibex and the Iberian wild goat when compared to other Capra species. The monophyly of both species is in agreement with other molecular studies based only on modern populations, therefore supporting one-wave migration of wild goats into Western Europe followed by possible allopatric speciation. We observe three major clades of wild goats in Western Europe: Capra ibex, Capra pyrenaica pyrenaica and the group containing the subspecies Capra pyrenaica hispanica and Capra pyrenaica victoriae. This genetic structure recognizes the distinctiveness of the bucardo (C. p. pyrenaica) from the rest of Iberian wild goats and thus supports the idea that this group is an Evolutionary Significant Unit. The divergence time estimated here indicates an almost contemporaneous split between the three clades around 50,000-90,000 years BP.

  1. Diversity Partitioning of Wild Bee Assemblages (Hymenoptera: Apoidea, Apiformes and Species Preferences for Three Types of Refuge Habitats in an Agricultural Landscape in Poland

    Directory of Open Access Journals (Sweden)

    Banaszak Józef

    2014-09-01

    Full Text Available Abstract Patterns in bee assemblages consisting of 52 core (most abundant species in farmland in the Wielkopolska region of W Poland were analysed. The entomological material was assessed during earlier research in 1978-1993 from 18 plots in three habitat types: shelterbelts, roadsides and forest patches. At the scale of the refuge habitat size analysed here, an increase in area only slightly enhanced bee species richness. The bee assemblage structures of roadsides and forest patches differ significantly, but their indicator species do not form any well-defined ecological groups. In non-linear forest patches, the bee community structure was more homogeneous than on roadsides. These two habitat types differed significantly in their species composition. Nine significant indicator species were found, but they did not share any ecological characteristics. Three factors were found to affect significantly the responses of individual bee species in the agricultural landscape: the degree of isolation of the refuge habitat, the edge ratio, and roadsides as a refuge habitat type. A large part of the regional diversity is due to the heterogeneity of habitats within the landscape. Habitat area has little influence on the diversity of wild bees, at least within the size range analysed here. We concluded from this study that, regardless of the habitat type, the density of bees from the summer phenological period is affected by the number of food plant species. Point forest patches are habitats where summer species from the genus Andrena and the cleptoparasitic genera Nomada and Sphecodes achieve their highest abundances. Roadsides negatively affected abundances of wild bees and there were no characteristic species for this type of habitat. We hypothesised that this might be related to the specific ecological part played by this type of habitat.

  2. The Influence of Processing by Impulse Pressure on the Productivity of the Don Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Pavlova Violetta Aleksandrovna

    2014-04-01

    Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.

  3. Canine Distemper Virus in Wild Felids of Costa Rica.

    Science.gov (United States)

    Avendaño, Roberto; Barrueta, Flor; Soto-Fournier, Sofía; Chavarría, Max; Monge, Otto; Gutiérrez-Espeleta, Gustavo A; Chaves, Andrea

    2016-04-28

    Several highly infectious diseases can be transmitted through feces and cause elevated mortality among carnivore species. One such infectious agent, canine distemper virus (CDV; Paramyxoviridae: Morbillivirus), has been reported to affect wild carnivores, among them several felid species. We screened free-ranging and captive wild carnivores in Costa Rica for CDV. Between 2006 and 2012, we collected 306 fecal samples from 70 jaguars (Panther onca), 71 ocelots ( Leopardus pardalis ), five jaguarundis (Puma yaguaroundi), 105 pumas ( Puma concolor ), five margays ( Leopardus wiedii ), 23 coyotes ( Canis latrans ), and 27 undetermined Leopardus spp. We found CDV in six individuals: one captive jaguarundi (rescued in 2009), three free-ranging ocelots (samples collected in 2012), and two free-ranging pumas (samples collected in 2007). Phylogenetic analyses were performed using sequences of the phosphoprotein (P) gene. We provide evidence of CDV in wild carnivores in Costa Rica and sequence data from a Costa Rican CDV isolate, adding to the very few sequence data available for CDV isolates from wild Central American carnivores.

  4. Detection of cryptic species

    International Nuclear Information System (INIS)

    Cockburn, A.F.; Jensen, T.; Seawright, J.A.

    1998-01-01

    Morphologically similar cryptic species are common in insects. In Anopheles mosquitoes morphologically described species are complexes of cryptic species. Cryptic species are of great practical importance for two reasons: first, one or more species of the complex might not be a pest and control efforts directed at the complex as a whole would therefore be partly wasted; and second, genetic (and perhaps biological) control strategies directed against one species of the complex would not affect other species of the complex. At least one SIT effort has failed because the released sterile insect were of a different species and therefore did not mate with the wild insects being targeted. We use a multidisciplinary approach for detection of cryptic species complexes, focusing first on identifying variability in wild populations using RFLPs of mitochondrial and ribosomal RNA genes (mtDNA and rDNA); followed by confirmation using a variety of other techniques. For rapid identification of wild individuals of field collections, we use a DNA dot blot assay. DNA probes can be isolated by differential screening, however we are currently focusing on the sequencing of the rDNA extragenic spacers. These regions are repeated several hundred times per genome in mosquitoes and evolve rapidly. Molecular drive tends to keen the individual genes homogeneous within a species. (author)

  5. Hybridization between crops and wild relatives: the contribution of cultivated lettuce to the vigour of crop–wild hybrids under drought, salinity and nutrient deficiency conditions

    OpenAIRE

    Uwimana, Brigitte; Smulders, Marinus J.M.; Hooftman, Danny A.P.; Hartman, Yorike; van Tienderen, Peter H.; Jansen, Johannes; McHale, Leah K.; Michelmore, Richard W.; van de Wiel , Clemens C.M.; Visser , Richard G.F.

    2012-01-01

    With the development of transgenic crop varieties, crop–wild hybridization has received considerable consideration with regard to the potential of transgenes to be transferred to wild species. Although many studies have shown that crops can hybridize with their wild relatives and that the resulting hybrids may show improved fitness over the wild parents, little is still known on the genetic contribution of the crop parent to the performance of the hybrids. In this study, we investigated the v...

  6. WILD PIGS: BIOLOGY, DAMAGE, CONTROL TECHINQUES AND MANAGEMENT

    Energy Technology Data Exchange (ETDEWEB)

    Mayer, John; Brisbin, I. Lehr

    2009-12-31

    The existence of problems with wild pigs (Sus scrofa) is nothing new to the Western Hemisphere. Damage by these introduced animals was reported as far back as 1505 by the early Spanish colonies in the Caribbean, where wild pigs were killing the colonists cattle. Droves of these animals also ravaged cultivated crops of maize and sugarcane on islands in the West Indies during this same time period. These wild pigs reportedly were very aggressive and often attacked Spanish soldiers hunting rebellious Indians or escaped slaves on these islands, especially when these animals were cornered. The documentation of such impacts by introduced populations of this species in the United States has subsequently increased in recent years, and continued up through the present (Towne and Wentworth. 1950, Wood and Barrett 1979, Mayer and Brisbin 1991, Dickson et al. 2001). In spite of a fairly constant history in this country since the early 1900s, wild pigs have had a dramatic recent increase in both distribution and numbers in the United States. Between 1989 and 2009, the number of states reporting the presence of introduced wild pigs went from 19 up to as many as 44. This increase, in part natural, but largely manmade, has caused an increased workload and cost for land and resource managers in areas where these new populations are found. This is the direct result of the damage that these introduced animals do. The cost of both these impacts and control efforts has been estimated to exceed a billion dollars annually (Pimentel 2007). The complexity of this problem has been further complicated by the widespread appeal and economic potential of these animals as a big game species (Tisdell 1982, Degner 1989). Wild pigs are a controversial problem that is not going away and will likely only get worse with time. Not only do they cause damage, but wild pigs are also survivors. They reproduce at a rate faster than any other mammal of comparable size, native or introduced; they can eat just

  7. Wild Bee Community Composition and Foraging Behaviour in Commercial Strawberries

    DEFF Research Database (Denmark)

    Ahrenfeldt, Erica Juel

    possibly due to the low biodiversity offered by many commercially driven, single species, Danish forests. At field scale (I) bee species richness was higher in field margins compared to field centres but there was no difference between centre and margin in body-size or activity-density. Sampling time had...... an effect on wild bee community composition with higher activity-density and species richness in late May and late June than in early and mid-June (II). Results thus indicate that functional diversity of visiting wild bee assemblages in strawberry differs depending on the spatial and time scale...

  8. Determination of seed viability of eight wild Saudi Arabian species by germination and X-ray tests.

    Science.gov (United States)

    Al-Turki, Turki A; Baskin, Carol C

    2017-05-01

    Our purpose was to evaluate the usefulness of the germination vs. the X-ray test in determining the initial viability of seeds of eight wild species ( Salvia spinosa , Salvia aegyptiaca , Ochradenus baccatus , Ochradenus arabicus , Suaeda aegyptiaca , Suaeda vermiculata , Prosopisfarcta and Panicumturgidum ) from Saudi Arabia. Several days were required to determine viability of all eight species via germination tests, while immediate results on filled/viable seeds were obtained with the X-ray test. Seeds of all the species, except Sa.aegyptiaca , showed high viability in both the germination (98-70% at 25/15 °C, 93-66% at 35/25 °C) and X-ray (100-75%) test. Furthermore, there was general agreement between the germination (10% at 25/15 °C and 8% at 35/25 °C) and X-ray (5%) tests that seed viability of Sa.aegyptiaca was very low, and X-ray analysis revealed that this was due to poor embryo development. Seeds of P.farcta have physical dormancy, which was broken by scarification in concentrated sulfuric acid (10 min), and they exhibited high viability in both the germination (98% at 25/15 °C and 93% at 35/25 °C) and X-ray (98%) test. Most of the nongerminated seeds of the eight species except those of Sa.aegyptiaca were alive as judged by the tetrazolium test (TZ). Thus, for the eight species examined, the X-ray test was a good and rapid predictor of seed viability.

  9. Hybridization study of wild rice Oryza glumaepatula with varieties of cultivated rice (O. sativa) and wild (O. grandiglumis)

    International Nuclear Information System (INIS)

    Villalobos Cascante, Eddier

    2015-01-01

    The process of interspecific hybridization of the wild species O. glumaepatula is studied with commercial varieties of the species O. sativa and O. grandiglumis, by morphological evaluation and hybrid flow cytometry. Hybrid plants were evaluated of cross between O. glumaepatula, located in the wetlands of Rio Medio Queso and two varieties of O. sativa, Puita Inta and CFX 18 resistant to a herbicide. The technique of Polymerase Chain Reaction Allele Specifies Oligonucleotide (PCR-ASO) was used to detect allelic mutations in the ALS gene conferring herbicide resistance, and it is confirmed the hybrid nature of the plants obtained at crossings. 68 hybrids were obtained: O. glumaepatula x P. Inta, 21 hybrids P. Inta x O. glumaepatula, 4 hybrids O. glumaepatula x CFX-18 and 15 hybrids CFX-18 x O. glumaepatula. 10 morphological descriptors of the genus Oryza were evaluated and determined that are indifferent to the direction and type of crossing, the hybrids resemble to the wild species O. glumaepatula for characters: height, panicle length and ligule length. All hybrids have showed similarity to commercial varieties in flag leaf length. Other characters evaluated in the hybrids have presented maternal effect, heterosis and intermediate values. The protocol of flow cytometry (FCM) is standardized species for Oryza genus analyzing nuclear DNA content of 106 samples of leaf tissue of wild species O. glumaepatula, O. grandiglumis; whose average has been of 0.73 picograms, and natural hybrids product of the cross of these species. The result has been intermediate compared with O. grandiglumis and O. glumaepatula that have made available to 1.0 picograms and 0.50 of DNA respectively. The molecular nature of the hybrids was confirmed in this way. (author) [es

  10. Pathogenicity of two recent Western Mediterranean West Nile virus isolates in a wild bird species indigenous to Southern Europe: the red-legged partridge

    Directory of Open Access Journals (Sweden)

    Sotelo Elena

    2011-01-01

    Full Text Available Abstract West Nile virus (WNV is an emerging zoonotic pathogen whose geographic spread and incidence in humans, horses and birds has increased significantly in recent years. WNV has long been considered a mild pathogen causing self-limiting outbreaks. This notion has changed as WNV is causing large epidemics with a high impact on human and animal health. This has been particularly noteworthy since its introduction into North America in 1999. There, native bird species have been shown to be highly susceptible to WNV infection and disease with high mortalities. For this reason, the effect of WNV infection in North American bird species has been thoroughly studied by means of experimental inoculations in controlled trials. To a lesser extent, European wild birds have been shown to be affected clinically by WNV infection. Yet experimental studies on European wild bird species are lacking. The red-legged partridge (Alectoris rufa is a gallinaceous bird indigenous to the Iberian Peninsula, widely distributed in South Western Europe. It plays a key role in the Mediterranean ecosystem and constitutes an economically important game species. As such it is raised intensively in outdoor facilities. In this work, red-legged partridges were experimentally infected with two recent WNV isolates from the Western Mediterranean area: Morocco/2003 and Spain/2007. All inoculated birds became viremic and showed clinical disease, with mortality rates of 70% and 30%, respectively. These results show that Western Mediterranean WNV variants can be pathogenic for some European bird species, such as the red-legged partridge.

  11. Ethnobotanical investigation of 'wild' food plants used by rice farmers in Kalasin, Northeast Thailand

    Directory of Open Access Journals (Sweden)

    Cruz-Garcia Gisella S

    2011-11-01

    Full Text Available Abstract Background Wild food plants are a critical component in the subsistence system of rice farmers in Northeast Thailand. One of the important characteristics of wild plant foods among farming households is that the main collection locations are increasingly from anthropogenic ecosystems such as agricultural areas rather than pristine ecosystems. This paper provides selected results from a study of wild food conducted in several villages in Northeast Thailand. A complete botanical inventory of wild food plants from these communities and surrounding areas is provided including their diversity of growth forms, the different anthropogenic locations were these species grow and the multiplicity of uses they have. Methods Data was collected using focus groups and key informant interviews with women locally recognized as knowledgeable about contemporarily gathered plants. Plant species were identified by local taxonomists. Results A total of 87 wild food plants, belonging to 47 families were reported, mainly trees, herbs (terrestrial and aquatic and climbers. Rice fields constitute the most important growth location where 70% of the plants are found, followed by secondary woody areas and home gardens. The majority of species (80% can be found in multiple growth locations, which is partly explained by villagers moving selected species from one place to another and engaging in different degrees of management. Wild food plants have multiple edible parts varying from reproductive structures to vegetative organs. More than two thirds of species are reported as having diverse additional uses and more than half of them are also regarded as medicine. Conclusions This study shows the remarkable importance of anthropogenic areas in providing wild food plants. This is reflected in the great diversity of species found, contributing to the food and nutritional security of rice farmers in Northeast Thailand.

  12. Use of somatic cell banks in the conservation of wild felids.

    Science.gov (United States)

    Praxedes, Érika A; Borges, Alana A; Santos, Maria V O; Pereira, Alexsandra F

    2018-05-03

    The conservation of biological resources is an interesting strategy for the maintenance of biodiversity, especially for wild felids who are constantly threatened with extinction. For this purpose, cryopreservation techniques have been used for the long-term storage of gametes, embryos, gonadal tissues, and somatic cells and tissues. The establishment of these banks has been suggested as a practical approach to the preservation of species and, when done in tandem with assisted reproductive techniques, could provide the means for reproducing endangered species. Somatic cell banks have been shown remarkable for the conservation of genetic material of felids; by merely obtaining skin samples, it is possible to sample a large group of individuals without being limited by factors such as gender or age. Thus, techniques for somatic tissue recovery, cryopreservation, and in vitro culture of different wild felids have been developed, resulting in a viable method for the conservation of species. One of the most notable conservation programs for wild felines using somatic samples was the one carried out for the Iberian lynx, the most endangered feline in the world. Other wild felids have also been studied in other continents, such as the jaguar in South America. This review aims to present the technical progress achieved in the conservation of somatic cells and tissues in different wild felids, as well address the progress that has been achieved in a few species. © 2018 Wiley Periodicals, Inc.

  13. Binding of paraquat to cell walls of paraquat resistant and susceptible biotypes of Hordeum glaucum

    International Nuclear Information System (INIS)

    Alizadeh, H.M.; Preston, C.; Powles, S.B.

    1997-01-01

    Full text: Paraquat is a widely used, non-selective, light activated contact herbicide acting as a photosystem electron acceptor. Resistance to paraquat in weed species has occurred in Australia and world-wide following extensive use of this herbicide. The mechanism of resistance to paraquat in 'Hordeum glaucum' is correlated with reduced herbicide translocation and may be due to sequestration of herbicide away from its site of action by either binding to cell walls or other means. We measured paraquat binding to a cell wall fraction in resistant and susceptible biotypes of H. glaucum to determine whether differences in binding of paraquat to cell walls could explain herbicide resistance. The cell wall fraction was isolated from leaves of resistant and susceptible biotypes and incubated with 14 C-labelled paraquat. Of the total paraquat - absorbed by a cell wall preparation, about 80% remains strongly bind to the cell wall and doesn't readily exchange with solution in the absence of divalent cations. Divalent cations (Ca 2+ ,putrescine and paraquat) can competitively exchange for paraquat tightly bound to the cell wall. From kinetic experiments it seems that there are two types of binding sites in the cell wall with different affinities for paraquat. No significant differences between cell wall, characteristics of resistant and susceptible biotypes of H. glaucum have been found in any of our experiments. Therefore, increased binding of paraquat to the cell wall appears not to be a mechanism for exclusion of paraquat in resistant biotype

  14. Wild mushrooms in Ethiopia: A review and synthesis for future perspective

    International Nuclear Information System (INIS)

    Dejene, T.; Oria-de-Rueda, J.A.; Martín-Pinto, P.

    2017-01-01

    Aim of study: To review and provide all-purpose information about wild mushrooms in Ethiopia and to create awareness for conservation and use of mycological resources. Area of study: We focused mainly on Ethiopia, where information about wild mushrooms is scanty and their status is unknown under the rampant degradation of the habitats. Main results: We reviewed all relevant references related to wild mushrooms and their ecological niches, cultural practices and species used for cultivation as well as the anthropogenic factors affecting the conservation of fungal diversity. Research highlights: This review summarizes issues related to the diversity of wild mushrooms, the main ecological niches and their associated fungal species, and mushroom cultivation practices in Ethiopia. Moreover, threats and the need for future conservation of wild mushrooms in the country are also reported. This review paper can serve as base line information and indicator for further mycological studies in Ethiopia as well as in other developing countries with similar scenarios.

  15. Wild mushrooms in Ethiopia: A review and synthesis for future perspective

    Energy Technology Data Exchange (ETDEWEB)

    Dejene, T.; Oria-de-Rueda, J.A.; Martín-Pinto, P.

    2017-11-01

    Aim of study: To review and provide all-purpose information about wild mushrooms in Ethiopia and to create awareness for conservation and use of mycological resources. Area of study: We focused mainly on Ethiopia, where information about wild mushrooms is scanty and their status is unknown under the rampant degradation of the habitats. Main results: We reviewed all relevant references related to wild mushrooms and their ecological niches, cultural practices and species used for cultivation as well as the anthropogenic factors affecting the conservation of fungal diversity. Research highlights: This review summarizes issues related to the diversity of wild mushrooms, the main ecological niches and their associated fungal species, and mushroom cultivation practices in Ethiopia. Moreover, threats and the need for future conservation of wild mushrooms in the country are also reported. This review paper can serve as base line information and indicator for further mycological studies in Ethiopia as well as in other developing countries with similar scenarios.

  16. Wild mushrooms in Ethiopia: A review and synthesis for future perspective

    Directory of Open Access Journals (Sweden)

    Tatek Dejene

    2017-05-01

    Full Text Available Aim of study: To review and provide all-purpose information about wild mushrooms in Ethiopia and to create awareness for conservation and use of mycological resources. Area of study: We focused mainly on Ethiopia, where information about wild mushrooms is scanty and their status is unknown under the rampant degradation of the habitats. Main results: We reviewed all relevant references related to wild mushrooms and their ecological niches, cultural practices and species used for cultivation as well as the anthropogenic factors affecting the conservation of fungal diversity. Research highlights: This review summarizes issues related to the diversity of wild mushrooms, the main ecological niches and their associated fungal species, and mushroom cultivation practices in Ethiopia. Moreover, threats and the need for future conservation of wild mushrooms in the country are also reported. This review paper can serve as base line information and indicator for further mycological studies in Ethiopia as well as in other developing countries with similar scenarios.

  17. Crop wild relatives range shifts and conservation in Europe under climate change

    NARCIS (Netherlands)

    Aguirre Gutierrez, Jesus; Treuren, van R.; Hoekstra, R.; Hintum, van T.J.L.

    2017-01-01

    Aim: Climate change is expected to have a great impact on the distribution of wild flora around the world. Wild plant species are an important component of the genetic resources for crop improvement, which is especially important in face of climate change impacts. Still, many crop wild relatives

  18. Physiological characteristics of three wild sonchus species to prolonged drought tolerance in arid regions

    International Nuclear Information System (INIS)

    Jia, P.Y.; Hu, Y.; Zhang, L.X.; Wu, G.L.

    2018-01-01

    Drought is one of the main abiotic factors determining plants growth and productivity in arid and semiarid regions. Understanding the physiological responses of wild plants to drought in different growth stages is essential to evaluate their ability of drought tolerance and allow identification and selection of valuable tolerant plants to be cultivated and introduced in arid and semiarid regions. Three wild Sonchus species, Sonchus oleraceus L., Sonchus wightianus DC. and Sonchus uliginosus M. B. were compared regarding some physiological indexes in leaves such as antioxidant enzymes (superoxide dismutase and peroxidase), malondialdehyde, osmotic solutes (proline, soluble sugar and soluble protein), photosynthetic pigments (total chlorophyll, chlorophyll a, chlorophyll b and carotenoid) under the natural condition at seeding stage, flowering stage and maturation stage respectively. Comparing to S. uliginosus and S. wightianus, S. oleraceus had the higher peroxidase (POD) and superoxide dismutase (SOD) activities and total chlorophyll (Chla+b) and carotenoid (Car) content in three growth stages, and the higher proline content at flowering and maturation stage and the lower malondialdehyde (MDA) content at seeding stage and flowering stage. But the ratio of Chla/Chlb and Car/Chla+b in S. uliginosus were significantly higher than that in S. oleraceus and S. wightianus. These findings suggested that S. oleraceus had the higher tolerance to prolonged drought than S. wightianus and S. uliginosus due to the better capacity to prevent oxidative damage to cellular components and osmoregulation and photosynthetic ability and S. uliginosus were more photo-protected under drought. The research results were instructive for cultivation and introduction of S. oleraceus in arid and semiarid regions. (author)

  19. Facultative parthenogenesis discovered in wild vertebrates.

    Science.gov (United States)

    Booth, Warren; Smith, Charles F; Eskridge, Pamela H; Hoss, Shannon K; Mendelson, Joseph R; Schuett, Gordon W

    2012-12-23

    Facultative parthenogenesis (FP)-asexual reproduction by bisexual species-has been documented in a variety of multi-cellular organisms but only recently in snakes, varanid lizards, birds and sharks. Unlike the approximately 80 taxa of unisexual reptiles, amphibians and fishes that exist in nature, FP has yet to be documented in the wild. Based on captive documentation, it appears that FP is widespread in squamate reptiles (snakes, lizards and amphisbaenians), and its occurrence in nature seems inevitable, yet the task of detecting FP in wild individuals has been deemed formidable. Here we show, using microsatellite DNA genotyping and litter characteristics, the first cases of FP in wild-collected pregnant females and their offspring of two closely related species of North American pitviper snakes-the copperhead (Agkistrodon contortrix) and cottonmouth (Agkistrodon piscivorus). Our findings support the view that non-hybrid origins of parthenogenesis, such as FP, are more common in squamates than previously thought. With this confirmation, FP can no longer be viewed as a rare curiosity outside the mainstream of vertebrate evolution. Future research on FP in squamate reptiles related to proximate control of induction, reproductive competence of parthenogens and population genetics modelling is warranted.

  20. Detection of cryptic species

    Energy Technology Data Exchange (ETDEWEB)

    Cockburn, A F; Jensen, T; Seawright, J A [United States Dept. of Agriculture, Agricultural Research Service, Medical and Veterinary Entomology Research Lab., Gainesville, FL (United States)

    1998-01-01

    Morphologically similar cryptic species are common in insects. In Anopheles mosquitoes morphologically described species are complexes of cryptic species. Cryptic species are of great practical importance for two reasons: first, one or more species of the complex might not be a pest and control efforts directed at the complex as a whole would therefore be partly wasted; and second, genetic (and perhaps biological) control strategies directed against one species of the complex would not affect other species of the complex. At least one SIT effort has failed because the released sterile insect were of a different species and therefore did not mate with the wild insects being targeted. We use a multidisciplinary approach for detection of cryptic species complexes, focusing first on identifying variability in wild populations using RFLPs of mitochondrial and ribosomal RNA genes (mtDNA and rDNA); followed by confirmation using a variety of other techniques. For rapid identification of wild individuals of field collections, we use a DNA dot blot assay. DNA probes can be isolated by differential screening, however we are currently focusing on the sequencing of the rDNA extragenic spacers. These regions are repeated several hundred times per genome in mosquitoes and evolve rapidly. Molecular drive tends to keen the individual genes homogeneous within a species. (author). 11 refs, 2 figs, 2 tabs.

  1. Molecular Investigation on the Presence of Hepatitis E Virus (HEV) in Wild Game in North-Western Italy.

    Science.gov (United States)

    Serracca, Laura; Battistini, Roberta; Rossini, Irene; Mignone, Walter; Peletto, Simone; Boin, Claudia; Pistone, Giancarlo; Ercolini, Riccardo; Ercolini, Carlo

    2015-09-01

    Meat products from HEV-infected reservoir animal species are capable of transmitting HEV to humans and represent a public health concern. Human HEV cases have been linked to the consumption of raw or undercooked pig liver sausages, pork, and game meats, such as wild boars and deer worldwide. Direct exposure to swine or wild game species might also represent a source of HEV transmission especially for veterinarians, hunters, or butchers. A limited amount of data is available on HEV prevalence in wild boars in Italy and no data are available for other wild game species intended for human consumption. In this study, the circulation of HEV in four different animal species hunted in north-western Italy was evaluated to gain insight into the infection levels and the genetic diversity of the virus in such animal populations. Liver samples of 372 wild boars, 30 roe deer, 47 European hares and 38 coypus were analyzed for HEV RNA by real-time RT-PCR; positive samples were then sequenced and submitted to phylogenetic analysis. HEV RNA was detected in the livers of 7/372 (1.9%) wild boars tested, while no sample was positive for roe deer, European hare, and coypu. Phylogenetic analysis showed that wild boar HEV sequences belonged to HEV subtypes 3e, 3c, and 3f. Our results indicate that HEV is circulating only in wild boar among the considered game species in north-western Italy and suggest a potential zoonotic risk related to handling and/or consumption of raw or undercooked meat and products made of the liver from this species.

  2. Divergence in wine characteristics produced by wild and domesticated strains of Saccharomyces cerevisiae

    Science.gov (United States)

    Hyma, Katie E; Saerens, Sofie M; Verstrepen, Kevin J; Fay, Justin C

    2011-01-01

    The budding yeast Saccharomyces cerevisiae is the primary species used by wine makers to convert sugar into alcohol during wine fermentation. Saccharomyces cerevisiae is found in vineyards, but is also found in association with oak trees and other natural sources. Although wild strains of S. cerevisiae as well as other Saccharomyces species are also capable of wine fermentation, a genetically distinct group of S. cerevisiae strains is primarily used to produce wine, consistent with the idea that wine making strains have been domesticated for wine production. In this study, we demonstrate that humans can distinguish between wines produced using wine strains and wild strains of S. cerevisiae as well as its sibling species, Saccharomyces paradoxus. Wine strains produced wine with fruity and floral characteristics, whereas wild strains produced wine with earthy and sulfurous characteristics. The differences that we observe between wine and wild strains provides further evidence that wine strains have evolved phenotypes that are distinct from their wild ancestors and relevant to their use in wine production. PMID:22093681

  3. Wild vegetable mixes sold in the markets of Dalmatia (southern Croatia

    Directory of Open Access Journals (Sweden)

    Łuczaj Łukasz

    2013-01-01

    Full Text Available Abstract Background Dalmatia is an interesting place to study the use of wild greens as it lies at the intersection of influence of Slavs, who do not usually use many species of wild greens, and Mediterranean culinary culture, where the use of multiple wild greens is common. The aim of the study was to document the mixtures of wild green vegetables which are sold in all the vegetable markets of Dalmatia. Methods All vendors (68 in all 11 major markets of the Dalmatian coast were interviewed. The piles of wild vegetables they sold were searched and herbarium specimens taken from them. Results The mean number of species in the mix was 5.7. The most commonly sold wild plants are: Sonchus oleraceus L., Allium ampeloprasum L., Foeniculum vulgare Mill., Urospermum picroides F.W.Schmidt, Papaver rhoeas L., Daucus carota L., Taraxacum sp., Picris echioides L., Silene latifolia Poir. and Crepis spp. Also the cultivated beet (Beta vulgaris L. and a few cultivated Brassicaceae varieties are frequent components. Wild vegetables from the mix are usually boiled for 20–30 minutes and dressed with olive oil and salt. Altogether at least 37 wild taxa and 13 cultivated taxa were recorded. Apart from the mixes, Asparagus acutifolius L. and Tamus communis L. shoots are sold in separate bunches (they are usually eaten with eggs, as well as some Asteraceae species, the latter are eaten raw or briefly boiled. Conclusions The rich tradition of eating many wild greens may result both from strong Venetian and Greek influences and the necessity of using all food resources available in the barren, infertile land in the past. Although the number of wild-collected green vegetables is impressive we hypothesize that it may have decreased over the years, and that further in-depth local ethnobotanical studies are needed in Dalmatia to record the disappearing knowledge of edible plants.

  4. The comparison of phenotypic characteristics of current varieties and wild species of Fragaria

    Directory of Open Access Journals (Sweden)

    Skender Azra

    2015-01-01

    Full Text Available The aim of this study was to compare the major pomological and antioxidant properties of fruits which are comparatively studied in wild strawberry (Fragaria vesca L., taken from natural habitats and commercially important varieties that are grown in the Una - Sana Canton (Bosnia and Herzegovina: Marmolada, Clery, Maya, Arosa and Elsanta. The aim was also to point out the potential superiority of the wild forms, how rich they are in vitamin C, phenol and anthocyanin, in order to be considered as a potential source of natural antioxidants. The results of analyzing the contents of vitamin C and the total phenols of fruit indicate that a wild strawberry has significantly higher antioxidant content of these components than all the commercial varieties tested. The content of vitamin C in fruits of a wild strawberry was 72 mg/100g and the phenol content 94.8 mg/100g. Their inclusion in breeding programs can provide significant potential to create varieties which will possess a better fruit quality with a higher content of antioxidant components. A wild strawberry is a significant genetic potential of particular importance for conservation and biodiversity of certain areas, as well as for the selection and breeding of cultivated fruit trees. The highest content of the total anthocyanin of fruit is registered in Marmolada (134.7 mg/100g.

  5. Wild cervids are host for tick vectors of babesia species with zoonotic capability in Belgium.

    Science.gov (United States)

    Lempereur, Laetitia; Wirtgen, Marc; Nahayo, Adrien; Caron, Yannick; Shiels, Brian; Saegerman, Claude; Losson, Bertrand; Linden, Annick

    2012-04-01

    Babesiosis is a tick-borne disease caused by different species of intraerythrocytic protozoan parasites within the genus Babesia. Different species of Babesia are described as potentially zoonotic and cause a malaria-like disease mainly in immunocompromised humans. Interest in the zoonotic potential of Babesia is growing and babesiosis has been described by some authors as an emergent zoonotic disease. The role of cervids to maintain tick populations and act as a reservoir host for some Babesia spp. with zoonotic capability is suspected. To investigate the range and infection rate of Babesia species, ticks were collected from wild cervids in southern Belgium during 2008. DNA extraction was performed for individual ticks, and each sample was evaluated for the absence of PCR inhibition using a PCR test. A Babesia spp. genus-specific PCR based on the 18S rRNA gene was applied to validated tick DNA extracts. A total of 1044 Ixodes ricinus ticks were collected and 1023 validated samples were subsequently screened for the presence of Babesia spp. DNA. Twenty-eight tick samples were found to be positive and identified after sequencing as containing DNA representing: Babesia divergens (3), B. divergens-like (5), Babesia sp. EU1 (11), Babesia sp. EU1-like (3), B. capreoli (2), or unknown Babesia sp. (4). This study confirms the presence of potentially zoonotic species and Babesia capreoli in Belgium, with a tick infection rate of 2.7% (95% CI 1.8,3.9%). Knowledge of the most common reservoir source for transmission of zoonotic Babesia spp. will be useful for models assessing the risk potential of this infection to humans.

  6. Seed coat microsculpturing is related to genomic components in wild Brassica juncea and Sinapis arvensis.

    Science.gov (United States)

    Wang, Ying-hao; Wei, Wei; Kang, Ding-ming; Ma, Ke-ping

    2013-01-01

    It has been reported that wild Brassica and related species are widely distributed across Xinjiang, China, and there has been an argument for species identification. Seed coat microsculpturing (SCM) is known to be an excellent character for taxonomic and evolutionary studies. By identifying collections from Xinjiang, China, and combining SCM pattern, flow cytometry, and genome-specific DNA markers as well as sexual compatibility with known species, this study aimed to detect potential relationships between SCM and genomic types in wild Brassica and related species. Three wild collections were found to be tetraploid with a SCM reticulate pattern similar to B. juncea, and containing A and B genome-specific loci, indicating relatively high sexual compatibility with B. juncea. The others were diploid, carrying S-genome-specific DNA markers, and having relatively high sexual compatibility with Sinapis arvensis. Moreover, their SCM was in a rugose pattern similar to that of S. arvensis. It was suggested that SCM, as a morphological characteristic, can reflect genomic type, and be used to distinguish B-genome species such as B. juncea from the related S. arvensis. The relationship between SCM and genomic type can support taxonomic studies of the wild Brassica species and related species.

  7. Wild vascular plants gathered for consumption in the Polish countryside: a review.

    Science.gov (United States)

    Łuczaj, Łukasz; Szymański, Wojciech M

    2007-04-15

    This paper is an ethnobotanical review of wild edible plants gathered for consumption from the end of the 18th century to the present day, within the present borders of Poland. 42 ethnographic and botanical sources documenting the culinary use of wild plants were analyzed. The use of 112 species (3.7% of the flora) has been recorded. Only half of them have been used since the 1960s. Three species: Cirsium rivulare, Euphorbia peplus and Scirpus sylvaticus have never before been reported as edible by ethnobotanical literature. The list of wild edible plants which are still commonly gathered includes only two green vegetables (Rumex acetosa leaves for soups and Oxalis acetosella as children's snack), 15 folk species of fruits and seeds (Crataegus spp., Corylus avellana, Fagus sylvatica, Fragaria vesca, Malus domestica, Prunus spinosa, Pyrus spp., Rosa canina, Rubus idaeus, Rubus sect. Rubus, Sambucus nigra, Vaccinium myrtillus, V. oxycoccos, V. uliginosum, V. vitis-idaea) and four taxa used for seasoning or as preservatives (Armoracia rusticana root and leaves, Carum carvi seeds, Juniperus communis pseudo-fruits and Quercus spp. leaves). The use of other species is either forgotten or very rare. In the past, several species were used for food in times of scarcity, most commonly Chenopodium album, Urtica dioica, U. urens, Elymus repens, Oxalis acetosella and Cirsium spp., but now the use of wild plants is mainly restricted to raw consumption or making juices, jams, wines and other preserves. The history of the gradual disappearance of the original barszcz, Heracleum sphondylium soup, from Polish cuisine has been researched in detail and two, previously unpublished, instances of its use in the 20th century have been found in the Carpathians. An increase in the culinary use of some wild plants due to media publications can be observed. Poland can be characterized as a country where the traditions of culinary use of wild plants became impoverished very early, compared to

  8. Contribution of Plantation Forest on Wild Bees (Hymenoptera: Apoidea Pollinators Conservation in Mount Slamet, Central Java, Indonesia

    Directory of Open Access Journals (Sweden)

    Imam Widhiono

    2017-12-01

    Full Text Available Wild bee pollinators (Hymenoptera : Apiade diversity and abundance were studied in three types of plantation forest on Mt. Slamet (Central Java Province, Indonesia. The aims of the research was to know the diversity and abundance of wild bee pollinators and to determine the possibility of plantation forest contribution on wild bees conservation. Sampling has been done at three stands: a pine forest (PF, with Pinus merkusii, an Agathis forest (AF, with Agathis damara and a community forest (CF, with Albizia falctaria. Each habitat was divided into 5 line transect (100 x 5 m and sweep nets were used to collect the wild bee samples. Sampling was done eah month from April to August 2015. The diversity of wild bees was high (12 species in 9 genera; members of the Apidae (7 species were dominant. The most abundant species across the forests were Apis cerana (343 individuals; 25.5% of total, Trigona laeviceps (195 individuals; 14.5%, and Megachille relativa (165 individuals; 12.3%. Measurements of species diversity (H’, species evenness (E, habitat similarity (Ss and species richness indicated that the wild bee species diversity in the region was relatively high (H’ = 1.275 to (H’ = 1.730;(E= 0.870 to (E = 0.93. The result showed that the diversity of wild bees in three different plantation forest habitats on Mt. Slamet were similar and can be concluded that plantation forest types were important for pollinator conservation, and an appropriate future preservation strategy should include of the areas of all plantation forest types.

  9. Organic farmers use of wild food plants and fungi in a hilly area in Styria (Austria

    Directory of Open Access Journals (Sweden)

    Schunko Christoph

    2010-06-01

    Full Text Available Abstract Background Changing lifestyles have recently caused a severe reduction of the gathering of wild food plants. Knowledge about wild food plants and the local environment becomes lost when plants are no longer gathered. In Central Europe popular scientific publications have tried to counter this trend. However, detailed and systematic scientific investigations in distinct regions are needed to understand and preserve wild food uses. This study aims to contribute to these investigations. Methods Research was conducted in the hill country east of Graz, Styria, in Austria. Fifteen farmers, most using organic methods, were interviewed in two distinct field research periods between July and November 2008. Data gathering was realized through freelisting and subsequent semi-structured interviews. The culinary use value (CUV was developed to quantify the culinary importance of plant species. Hierarchical cluster analysis was performed on gathering and use variables to identify culture-specific logical entities of plants. The study presented was conducted within the framework of the master's thesis about wild plant gathering of the first author. Solely data on gathered wild food species is presented here. Results Thirty-nine wild food plant and mushroom species were identified as being gathered, whereas 11 species were mentioned by at least 40 percent of the respondents. Fruits and mushrooms are listed frequently, while wild leafy vegetables are gathered rarely. Wild foods are mainly eaten boiled, fried or raw. Three main clusters of wild gathered food species were identified: leaves (used in salads and soups, mushrooms (used in diverse ways and fruits (eaten raw, with milk (products or as a jam. Conclusions Knowledge about gathering and use of some wild food species is common among farmers in the hill country east of Graz. However, most uses are known by few farmers only. The CUV facilitates the evaluation of the culinary importance of species and

  10. Organic farmers use of wild food plants and fungi in a hilly area in Styria (Austria)

    Science.gov (United States)

    2010-01-01

    Background Changing lifestyles have recently caused a severe reduction of the gathering of wild food plants. Knowledge about wild food plants and the local environment becomes lost when plants are no longer gathered. In Central Europe popular scientific publications have tried to counter this trend. However, detailed and systematic scientific investigations in distinct regions are needed to understand and preserve wild food uses. This study aims to contribute to these investigations. Methods Research was conducted in the hill country east of Graz, Styria, in Austria. Fifteen farmers, most using organic methods, were interviewed in two distinct field research periods between July and November 2008. Data gathering was realized through freelisting and subsequent semi-structured interviews. The culinary use value (CUV) was developed to quantify the culinary importance of plant species. Hierarchical cluster analysis was performed on gathering and use variables to identify culture-specific logical entities of plants. The study presented was conducted within the framework of the master's thesis about wild plant gathering of the first author. Solely data on gathered wild food species is presented here. Results Thirty-nine wild food plant and mushroom species were identified as being gathered, whereas 11 species were mentioned by at least 40 percent of the respondents. Fruits and mushrooms are listed frequently, while wild leafy vegetables are gathered rarely. Wild foods are mainly eaten boiled, fried or raw. Three main clusters of wild gathered food species were identified: leaves (used in salads and soups), mushrooms (used in diverse ways) and fruits (eaten raw, with milk (products) or as a jam). Conclusions Knowledge about gathering and use of some wild food species is common among farmers in the hill country east of Graz. However, most uses are known by few farmers only. The CUV facilitates the evaluation of the culinary importance of species and makes comparisons

  11. Chemical composition of oils from wild almond (Prunus scoparia and wild pistachio (Pistacia atlantica

    Directory of Open Access Journals (Sweden)

    Jafari Mohammadi, S. A.

    2013-03-01

    Full Text Available The aim of this study was to determine the fatty acids, sterols and triacylglycerol compositions as well as the amount of tocopherols, total phenols and pigments wild almond and cold pressed wild pistachio oils. Triacylglycerols, tocopherols and pigments were analyzed with HPLC, fatty acids and sterols with gas chromatography, and total phenols photometrically. The main fatty acids in both samples were oleic, linoleic and palmitic acids. The most predominant TAG species are SLL + PLO (21.83% in wild pistachio oil and OOO (47.27% in wild almond oil. Pheophytin a was the major pigment in wild pistachio oil. There were no pigments detected in wild almond oil. Total phenols were 57.6 mg kg-1 oil for wild pistachio and 45.3 mg kg-1 oil for wild almond oil.El objetivo de este estudio fue determinar la composición en ácidos grasos, esteroles, triglicéridos, así como tocoferoles, fenoles totales y pigmentos de aceites de almendras y pistachos silvestres prensados en frío. Triglicéridos (TAG, tocoferoles y pigmentos se analizaron mediante HPLC, los ácidos grasos y esteroles mediante cromatografía de gases, y los fenoles totales espectrofotométricamente. Los principales ácidos grasos de ambas especies fueron los ácidos oleico, linoleico y palmítico. Las especies de TAG predominantes son SLL + OLP (21,83% en el pistacho silvestre y OOO (47,27% en almendras silvestre. Feofitina a es un pigmento importante en los aceites de pistacho silvestre. No se detectó pigmentos en los aceites de almendras silvestres. Los fenoles totales fueron 57,6 mg kg-1 y 45,3 mg kg-1 en los aceites de pistacho silvestre y de almendra silvestre respectivamente.

  12. An improved embryo-rescue protocol for hybrid progeny from seedless Vitis vinifera grapes × wild Chinese Vitis species.

    Science.gov (United States)

    Li, Gui Rong; Ji, Wei; Wang, Gang; Zhang, Jian Xia; Wang, Yue Jin

    A highly efficient technique of embryo rescue is critical when using stenospermocarpic Vitis vinifera cultivars (female parents) to breed novel, disease-resistant, seedless grape cultivars by hybridizing with wild Chinese Vitis species (male parents) having many disease-resistance alleles. The effects of various factors on the improvement of embryo formation, germination, and plantlet development for seven hybrid combinations were studied. The results indicated that Beichun and Shuangyou were the best male parents. The best sampling time for ovule inoculation differed among the female parents. When hybrid ovules were cultured on a double-phase medium with five different solid medium types, percent embryo formation was highest (11.3-28.3%) on a modified MM3 medium. Percentages of embryo germination (15.4-55.4%) and plantlet development (11.15-44.6%) were all highest when embryos were cultured on Woody Plant Medium + 5.7 μM indole-3-acetic acid + 4.4 μM 6-benzylaminopurine + 1.4 μM gibberellic acid + 2% sucrose + 0.05% casein hydrolysate + 0.3% activated charcoal + 0.7% agar. In the absence of other amino acids, the addition of proline significantly increased embryo formation (36.1%), embryo germination (64.6%), and plantlet development (90.5%). A highly efficient protocol has been developed for hybrid embryo rescue from seedless V. vinifera grapes × wild Chinese Vitis species that results in a significant improvement in breeding efficiency for new disease-resistant seedless grapes.

  13. History and conservation of wild and cultivated plant diversity in Uganda: Forest species and banana varieties as case studies

    Directory of Open Access Journals (Sweden)

    Alan C. Hamilton

    2016-02-01

    Full Text Available The history of wild and cultivated plant diversity in Uganda is reviewed, taking forest species and bananas as examples. Palynological research into past human influences on forests is reassessed. The evidence suggests that crops were first introduced into the country at about 1000 BCE, farming communities practicing slash and burn agriculture started to significantly influence the floristic composition of forests during the 1st millennium BCE and there was a major episode of forest reduction at about 1000 CE related to socio-economic change. Bananas were probably introduced in the early centuries CE. The colonial era from 1894 saw the introduction of new concepts of land ownership and the establishment of forest reserves and agricultural stations. Forests and banana diversity are currently under threat, Uganda having a very high rate of deforestation and endemic banana varieties proving susceptible to introduced pests and diseases. It is suggested that, under these circumstances, conservationists take an opportunistic approach to field engagement, making use of favourable local conditions as they arise. Partnerships should be sought with elements of society concerned with sustainable use, provision of ecosystem services and cultural survival to widen the social base of plant conservation. International organisations involved in conservation of plant genetic resources and wild plant species should collaborate with one another to develop the conceptual basis of plant conservation, to make it more relevant to countries like Uganda.

  14. Introgression from cultivated rice alters genetic structures of wild relative populations: implications for in situ conservation

    Science.gov (United States)

    Jin, Xin; Chen, Yu; Liu, Ping; Li, Chen; Cai, Xingxing; Rong, Jun

    2018-01-01

    Abstract Maintaining genetic integrity is essential for in situ and ex situ conservation of crop wild relative (CWR) species. However, introgression of crop alleles into CWR species/populations may change their genetic structure and diversity, resulting in more invasive weeds or, in contrast, the extinction of endangered populations. To determine crop-wild introgression and its consequences, we examined the genetic structure and diversity of six wild rice (Oryza rufipogon) populations under in situ conservation in China. Thirty-four simple sequence repeat (SSR) and 34 insertion/deletion markers were used to genotype the wild rice populations and two sets of rice cultivars (O. sativa), corresponding to the two types of molecular markers. Shared alleles and STRUCTURE analyses suggested a variable level of crop-wild introgression and admixture. Principal coordinates and cluster analyses indicated differentiation of wild rice populations, which was associated with the spatial distances to cultivated rice fields. The level of overall genetic diversity was comparable between wild rice populations and rice cultivars, but a great number of wild-specific alleles was detected in the wild populations. We conclude based on the results that crop-wild introgression can considerably alter the pattern of genetic structure and relationships of CWR populations. Appropriate measures should be taken for effective in situ conservation of CWR species under the scenario of crop-wild introgression. PMID:29308123

  15. Morphological and Molecular Data Reveal Three Distinct Populations of Indian Wild Rice Oryza rufipogon Griff. Species Complex.

    Science.gov (United States)

    Singh, Balwant; Singh, Nisha; Mishra, Shefali; Tripathi, Kabita; Singh, Bikram P; Rai, Vandna; Singh, Ashok K; Singh, Nagendra K

    2018-01-01

    Wild relatives of crops possess adaptive mutations for agronomically important traits, which could play significant role in crop improvement for sustainable agriculture. However, global climate change and human activities pose serious threats to the natural habitats leading to erosion of genetic diversity of wild rice populations. The purpose of this study was to explore and characterize India's huge untapped wild rice diversity in Oryza rufipogon Griff. species complex from a wide range of ecological niches. We made strategic expeditions around diversity hot spots in 64 districts of nine different agro-climatic zones of the country and collected 418 wild rice accessions. Significant variation was observed among the accessions for 46 morphological descriptors, allowing classification into O. nivara, O. rufipogon , and O. sativa f. spontanea morpho-taxonomic groups. Genome-specific pSINE1 markers confirmed all the accessions having AA genome, which were further classified using ecotype-specific pSINE1 markers into annual, perennial, intermediate, and an unknown type. Principal component analysis revealed continuous variation for the morphological traits in each ecotype group. Genetic diversity analysis based on multi-allelic SSR markers clustered these accessions into three major groups and analysis of molecular variance for nine agro-climatic zones showed that 68% of the genetic variation was inherent amongst individuals while only 11% of the variation separated the zones, though there was significant correlation between genetic and spatial distances of the accessions. Model based population structure analysis using genome wide bi-allelic SNP markers revealed three sub-populations designated 'Pro-Indica,' 'Pro-Aus,' and 'Mid-Gangetic,' which showed poor correspondence with the morpho - taxonomic classification or pSINE1 ecotypes. There was Pan-India distribution of the 'Pro-Indica' and 'Pro-Aus' sub-populations across agro-climatic zones, indicating a more

  16. Morphological and Molecular Data Reveal Three Distinct Populations of Indian Wild Rice Oryza rufipogon Griff. Species Complex

    Science.gov (United States)

    Singh, Balwant; Singh, Nisha; Mishra, Shefali; Tripathi, Kabita; Singh, Bikram P.; Rai, Vandna; Singh, Ashok K.; Singh, Nagendra K.

    2018-01-01

    Wild relatives of crops possess adaptive mutations for agronomically important traits, which could play significant role in crop improvement for sustainable agriculture. However, global climate change and human activities pose serious threats to the natural habitats leading to erosion of genetic diversity of wild rice populations. The purpose of this study was to explore and characterize India’s huge untapped wild rice diversity in Oryza rufipogon Griff. species complex from a wide range of ecological niches. We made strategic expeditions around diversity hot spots in 64 districts of nine different agro-climatic zones of the country and collected 418 wild rice accessions. Significant variation was observed among the accessions for 46 morphological descriptors, allowing classification into O. nivara, O. rufipogon, and O. sativa f. spontanea morpho-taxonomic groups. Genome-specific pSINE1 markers confirmed all the accessions having AA genome, which were further classified using ecotype-specific pSINE1 markers into annual, perennial, intermediate, and an unknown type. Principal component analysis revealed continuous variation for the morphological traits in each ecotype group. Genetic diversity analysis based on multi-allelic SSR markers clustered these accessions into three major groups and analysis of molecular variance for nine agro-climatic zones showed that 68% of the genetic variation was inherent amongst individuals while only 11% of the variation separated the zones, though there was significant correlation between genetic and spatial distances of the accessions. Model based population structure analysis using genome wide bi-allelic SNP markers revealed three sub-populations designated ‘Pro-Indica,’ ‘Pro-Aus,’ and ‘Mid-Gangetic,’ which showed poor correspondence with the morpho-taxonomic classification or pSINE1 ecotypes. There was Pan-India distribution of the ‘Pro-Indica’ and ‘Pro-Aus’ sub-populations across agro-climatic zones

  17. Study on Analysis of Variance on the indigenous wild and cultivated rice species of Manipur Valley

    Science.gov (United States)

    Medhabati, K.; Rohinikumar, M.; Rajiv Das, K.; Henary, Ch.; Dikash, Th.

    2012-10-01

    The analysis of variance revealed considerable variation among the cultivars and the wild species for yield and other quantitative characters in both the years of investigation. The highly significant differences among the cultivars in year wise and pooled analysis of variance for all the 12 characters reveal that there are enough genetic variabilities for all the characters studied. The existence of genetic variability is of paramount importance for starting a judicious plant breeding programme. Since introduced high yielding rice cultivars usually do not perform well. Improvement of indigenous cultivars is a clear choice for increase of rice production. The genetic variability of 37 rice germplasms in 12 agronomic characters estimated in the present study can be used in breeding programme

  18. Brachypodium distachyon

    DEFF Research Database (Denmark)

    Tanackovic, Vanja

    Starch is one of the most abundant polysaccharides on the Earth, the principal energy storage of most plant species and of crucial significance for humans as a major nutrient in human diet. The majority of produced starch comes from cereals, domesticated grasses, characterized by specific en......­hanced traits known as the domestication syndrome. Wild grasses, on the other side, still have traits lost during the process. Brachypodium distachyon (Brachypodium) is one of the wild grass recently introduced as a model plant for temperate cereals, closely related to pre-domesticated cereals such as barley...... (Hordeum vulgare). This thesis focuses on domestication of grasses – the cereal ancestors, starch in the grass Brachypodium distachyon, and its comparison to domesticated cereal. Grasses can potentially be used for the reintroduction of the lost grass traits, like health-promoting carbohydrates. Therefore...

  19. Streptococcus pharyngis sp. nov., a novel streptococcal species isolated from the respiratory tract of wild rabbits.

    Science.gov (United States)

    Vela, Ana I; Casas-Díaz, Encarna; Lavín, Santiago; Domínguez, Lucas; Fernández-Garayzábal, Jose F

    2015-09-01

    Four isolates of an unknown Gram-stain-positive, catalase-negative coccus-shaped organism, isolated from the pharynx of four wild rabbits, were characterized by phenotypic and molecular genetic methods. The micro-organisms were tentatively assigned to the genus Streptococcus based on cellular morphological and biochemical criteria, although the organisms did not appear to correspond to any species with a validly published name. Comparative 16S rRNA gene sequencing confirmed their identification as members of the genus Streptococcus, being most closely related phylogenetically to Streptococcus porcorum 682-03(T) (96.9% 16S rRNA gene sequence similarity). Analysis of rpoB and sodA gene sequences showed divergence values between the novel species and S. porcorum 682-03(T) (the closest phylogenetic relative determined from 16S rRNA gene sequences) of 18.1 and 23.9%, respectively. The novel bacterial isolate could be distinguished from the type strain of S. porcorum by several biochemical characteristics, such as the production of glycyl-tryptophan arylamidase and α-chymotrypsin, and the non-acidification of different sugars. Based on both phenotypic and phylogenetic findings, it is proposed that the unknown bacterium be assigned to a novel species of the genus Streptococcus, and named Streptococcus pharyngis sp. nov. The type strain is DICM10-00796B(T) ( = CECT 8754(T) = CCUG 66496(T)).

  20. Necrophagous diptera associated with wild animal carcasses in southern Brazil

    Directory of Open Access Journals (Sweden)

    Ândrio Z. da Silva

    2014-12-01

    Full Text Available Necrophagous Diptera associated with wild animal carcasses in southern Brazil. The aim of this study was to acquire a better knowledge concerning the diversity of necrophagous Diptera that develop on wild animal carcasses. For this purpose, the decomposition of six wild animal carcasses was observed in order to collect and identify the main species of necrophagous flies associated with the decomposition process. The carcasses were found on highways near the cities of Pelotas and Capão do Leão in the initial stage of decomposition, with no significant injuries or prior larval activity. Four wild animal models were represented in this study: two specimens of Didelphis albiventris Lund, 1840; two Tupinambis merianae Linnaeus, 1758; one Nothura maculosa Temminck, 1815; and one Cerdocyon thous Linnaeus, 1766. A total of 16,242 flies from 14 species were reared in the laboratory, where Muscidae presented the greatest diversity of necrophagous species. Overall, (i carcasses with larger biomass developed a higher abundance of flies and (ii the necrophagous community was dominated by Calliphoridae, two patterns that were predicted from published literature; and (iii the highest diversity was observed on the smaller carcasses exposed to the lowest temperatures, a pattern that may have been caused by the absence of the generalist predator Chrysomya albiceps (Wiedemann, 1819. (iv An UPGMA analysis revealed a similar pattern of clusters of fly communities, where the same species were structuring the groupings.

  1. Survey for West Nile virus antibodies in wild ducks, 2004-06, USA

    Science.gov (United States)

    Hofmeister, Erik K.; Jankowski, Mark D.; Goldberg, Diana R.; Franson, J. Christian

    2016-01-01

    Detection of West Nile virus (WNV) in ducks has been reported in North America in isolated cases of mortality in wild waterbirds and following outbreaks in farmed ducks. Although the virus has been noted as an apparent incidental finding in several species of ducks, little is known about the prevalence of exposure or the outcome of infection with WNV in wild ducks in North America. From 2004–06, we collected sera from 1,406 wild-caught American Wigeon (Anas americana), Mallard (Anas platyrhynchos), and Northern Pintail (Anas acuta) ducks at national wildlife refuges (NWRs) in North Dakota and Wood Ducks (Aix sponsa) at NWRs in South Carolina and Tennessee. We measured the prevalence of previous exposure to WNV in these ducks by measuring WNV antibodies and evaluated variation in exposure among species, age, and year. Additionally, we evaluated the performance of a commercial antibody to wild bird immunoglobulin in duck species that varied in their phylogenetic relatedness to the bird species the antibody was directed against. As determined by a screening immunoassay and a confirmatory plaque reduction neutralization assay, the prevalence of WNV antibody was 10%. In light of experimental studies that show ducks to be relatively resistant to mortality caused by WNV, the antibody prevalence we detected suggests that wild ducks may be less-frequently exposed to WNV than expected for birds inhabiting wetlands where they may acquire infection from mosquitoes.

  2. Impacts of neonicotinoid use on long-term population changes in wild bees in England

    Science.gov (United States)

    Woodcock, Ben A.; Isaac, Nicholas J. B.; Bullock, James M.; Roy, David B.; Garthwaite, David G.; Crowe, Andrew; Pywell, Richard F.

    2016-08-01

    Wild bee declines have been ascribed in part to neonicotinoid insecticides. While short-term laboratory studies on commercially bred species (principally honeybees and bumblebees) have identified sub-lethal effects, there is no strong evidence linking these insecticides to losses of the majority of wild bee species. We relate 18 years of UK national wild bee distribution data for 62 species to amounts of neonicotinoid use in oilseed rape. Using a multi-species dynamic Bayesian occupancy analysis, we find evidence of increased population extinction rates in response to neonicotinoid seed treatment use on oilseed rape. Species foraging on oilseed rape benefit from the cover of this crop, but were on average three times more negatively affected by exposure to neonicotinoids than non-crop foragers. Our results suggest that sub-lethal effects of neonicotinoids could scale up to cause losses of bee biodiversity. Restrictions on neonicotinoid use may reduce population declines.

  3. Synthetic seeds of a wild passionfruit species with ornamental potential

    Directory of Open Access Journals (Sweden)

    Maurecilne Lemes Silva

    2015-12-01

    Full Text Available Passiflora cincinnata is a wild species of passion fruit with a wide geographical distribution. It has vigorous growth, climbing habit and very showy and fragrant flowers. The aim of the present investigation was to obtain synthetic seeds from encapsulated zygotic and somatic embryos of P. cincinnata, cultivated under different conditions. Precotyledonary and cotyledonary stage embryos were obtained from zygotic embryos cultivated on MS medium supplemented with 18.1 μM of 2,4-Acid-dichlorophenoxyacetic (2,4-D and 4.5 μM of Benzyladenine (BA. Zygotic embryos and somatic embryos stages were encapsulated using sodium alginate (2.5% w v-1 and CaCl2.2H2O (1 mM as complexing agent. The zygotic and somatic embryos were encapsulated in a matrix containing (I sodium alginate, (II sodium alginate + artificial endosperm and (III sodium alginate + artificial endosperm supplemented with activated charcoal (0.15% w/v. Zygotic embryos encapsulated in the matrix (I, matrix (II and matrix (III and cultivated in flasks, germinated at rates of 79%, 76% and 86% respectively. The cotyledonary somatic embryos encapsulated in the 3 different matrices showed better germination rates when cultivated on cellulose plugs, with more than 50% of embryos converted into plants. Precotyledonary somatic embryos did not germinated regardless the matrix and cultivation. When cultivating the alginate beads ex vitro, both substrate Plantmax and Florialite showed low number of germinated embryos, and the best result (12.67% were obtained using Florialite and embryos encapsulated in the matrix (I.

  4. Diversity of Wild Bees along Elevational Gradient in an Agricultural Area in Central Java, Indonesia

    Directory of Open Access Journals (Sweden)

    Imam Widhiono

    2017-01-01

    Full Text Available Increases in mean temperature affect the diversity and abundance of wild bees in agricultural ecosystems. Pollinator community composition is expected to change along an elevational gradient due to differences in the daily ambient temperature. This study investigated the diversity and abundance of wild bees in an agricultural area along an elevational gradient in Central Java, Indonesia. Wild bees were collected using a sweep net in 40 green bean (Phaseolus vulgaris cultivation sampling locations at seven different elevations (8, 108, 224, 424, 644, 893, and 1017 m above sea level. Species diversity was determined using the Shannon–Wiener diversity index. We identified 932 individuals from 8 species of wild bee belonging to 3 families. The family Apidae was predominant, with 6 species, while only 1 species was found from each of Megachilidae and Halictidae. Across the study sites, diversity increased with increasing elevation (H′ = 1.4, D = 0.25, and E = 0.78 at low elevation to H′ = 2.04, D = 0.13, and E = 0.96 at high elevation, and higher numbers of species were found at middle and high elevations. Species richness and abundance increased linearly with increasing elevation, and species diversity was highest at middle elevations.

  5. Seed coat microsculpturing is related to genomic components in wild Brassica juncea and Sinapis arvensis.

    Directory of Open Access Journals (Sweden)

    Ying-hao Wang

    Full Text Available It has been reported that wild Brassica and related species are widely distributed across Xinjiang, China, and there has been an argument for species identification. Seed coat microsculpturing (SCM is known to be an excellent character for taxonomic and evolutionary studies. By identifying collections from Xinjiang, China, and combining SCM pattern, flow cytometry, and genome-specific DNA markers as well as sexual compatibility with known species, this study aimed to detect potential relationships between SCM and genomic types in wild Brassica and related species. Three wild collections were found to be tetraploid with a SCM reticulate pattern similar to B. juncea, and containing A and B genome-specific loci, indicating relatively high sexual compatibility with B. juncea. The others were diploid, carrying S-genome-specific DNA markers, and having relatively high sexual compatibility with Sinapis arvensis. Moreover, their SCM was in a rugose pattern similar to that of S. arvensis. It was suggested that SCM, as a morphological characteristic, can reflect genomic type, and be used to distinguish B-genome species such as B. juncea from the related S. arvensis. The relationship between SCM and genomic type can support taxonomic studies of the wild Brassica species and related species.

  6. Gene flow and genetic diversity in cultivated and wild cacao (Theobroma cacao) in Bolivia.

    Science.gov (United States)

    Chumacero de Schawe, Claudia; Durka, Walter; Tscharntke, Teja; Hensen, Isabell; Kessler, Michael

    2013-11-01

    The role of pollen flow within and between cultivated and wild tropical crop species is little known. To study the pollen flow of cacao, we estimated the degree of self-pollination and pollen dispersal distances as well as gene flow between wild and cultivated cacao (Theobroma cacao L.). We studied pollen flow and genetic diversity of cultivated and wild cacao populations by genotyping 143 wild and 86 cultivated mature plants and 374 seedlings raised from 19 wild and 25 cultivated trees at nine microsatellite loci. A principal component analysis distinguished wild and cultivated cacao trees, supporting the notion that Bolivia harbors truly wild cacao populations. Cultivated cacao had a higher level of genetic diversity than wild cacao, presumably reflecting the varied origin of cultivated plants. Both cacao types had high outcrossing rates, but the paternity analysis revealed 7-14% self-pollination in wild and cultivated cacao. Despite the tiny size of the pollinators, pollen was transported distances up to 3 km; wild cacao showed longer distances (mean = 922 m) than cultivated cacao (826 m). Our data revealed that 16-20% of pollination events occurred between cultivated and wild populations. We found evidence of self-pollination in both wild and cultivated cacao. Pollination distances are larger than those typically reported in tropical understory tree species. The relatively high pollen exchange from cultivated to wild cacao compromises genetic identity of wild populations, calling for the protection of extensive natural forest tracts to protect wild cacao in Bolivia.

  7. Qualitative characterisation of cultivated and wild edible plants: Mineral elements, phenols content and antioxidant capacity

    Directory of Open Access Journals (Sweden)

    Grazia Disciglio

    2017-12-01

    Full Text Available This study investigated the qualitative characteristics of several edible wild herbaceous species, including those most consumed in Foggia Province (southern Italy. Analysis of qualitative characteristics was performed for the edible parts of 11 wild species (Beta vulgaris L., Foeniculum vulgare Miller, Centaurea solstitialis L., Cichorium intybus L., Scolymus hispanicus L., Sonchus oleraceus L., Borago officinalis L., Diplotaxis erucoides L., Diplotaxis tenuifolia (L. DC, Sinapis arvensis L., Portulaca oleracea L. and three cultivated species (C. intybus, B. officinalis, D. tenuifolia. The plants were collected from areas in the Foggia countryside, and the edible part of each species was analysed for dry matter, protein, cation and anion contents as well as total phenols and antioxidant activities. Among the cations, calcium was the most differentiated among species, ranging 784 mg kg–1 fresh weight (Fw for B. vulgaris to 5886 mg kg–1 Fw for S. hispanicus. The nitrate contents were also highly variable, from 75 mg kg–1 Fw for C. intybus to 3874 mg kg–1 Fw for D. tenuifolia. Total polyphenols ranged from 1054 mg gallic acid equivalents (GAE mg kg–1 Fw for C. solstitialis to 3664 mg GAE mg kg–1 Fw for S. arvensis. Antioxidant activities ranged from 839 mg Trolox equivalents (TE kg–1 Fw for B. vulgaris to 5658 mg TE kg–1 Fw for C. intybus. Significant differences were also noted between wild and cultivated plants in the qualitative parameters. Total polyphenols and antioxidant activity were higher in wild C. intybus and B. officinalis than in their cultivated counterparts. Multivariate analysis (cluster analysis and linear discriminant analysis allowed integration of the ANOVA data to determine the qualitative characteristics of the wild species that contribute most to group differences. The results of the present study aims to improve current knowledge about edible wild species as vegetable sources in the Mediterranean diet.

  8. International trade of CITES listed bird species in China.

    Science.gov (United States)

    Li, Linlin; Jiang, Zhigang

    2014-01-01

    Commercial trade of wild birds may devastate wild bird populations. Convention on International Trade in Endangered Species of Wild Fauna and Flora (CITES) controls the trade of wild species listed in its appendices to avoid these species being threatened by international trade. China used to be one of the major trading countries with significant bird trade with foreign countries; on the other hand, China is a country with unique avian fauna, many Important Bird Areas and critically endangered bird species. What is the role of the country in world wild bird trade? What kind of insights can we extract from trade records for improving future management of wild bird trade in the country? We retrieved and analyzed international trade records of the CITES listed bird species of China from 1981 to 2010 from the CITES Trade Database maintained by United Nations Environment Program and World Conservation Monitoring Centre (UNEP-WCMC). We found that: (1) International trade of live birds in China peaked during the late 1990s, then decreased to the level before the surge of trade in a few years, the trade dynamics of wild birds may be affected by governmental policy and the outbreak of avian influenza during the period. (2) Most frequently traded CITES Appendix listed birds in China were parrots, most of which were exotic species to the country. (3) Birds were mainly traded for commercial purpose. Exotic birds in trade were mainly captive-bred while the most Chinese birds traded internationally were captured from the wild. Since many bird species in international trade are threatened to extinction, China should take stricter measures on importing of wild-captured birds and should collaborate with the countries of original in the international bird trade to avoid unsustainable harvesting of wild birds. It is urgent for China to carry out population surveys on those domestic bird species once in significant international trade and to make better conservation decisions based on

  9. International Trade of CITES Listed Bird Species in China

    Science.gov (United States)

    Li, Linlin; Jiang, Zhigang

    2014-01-01

    Commercial trade of wild birds may devastate wild bird populations. Convention on International Trade in Endangered Species of Wild Fauna and Flora (CITES) controls the trade of wild species listed in its appendices to avoid these species being threatened by international trade. China used to be one of the major trading countries with significant bird trade with foreign countries; on the other hand, China is a country with unique avian fauna, many Important Bird Areas and critically endangered bird species. What is the role of the country in world wild bird trade? What kind of insights can we extract from trade records for improving future management of wild bird trade in the country? We retrieved and analyzed international trade records of the CITES listed bird species of China from 1981 to 2010 from the CITES Trade Database maintained by United Nations Environment Program and World Conservation Monitoring Centre (UNEP-WCMC). We found that: (1) International trade of live birds in China peaked during the late 1990s, then decreased to the level before the surge of trade in a few years, the trade dynamics of wild birds may be affected by governmental policy and the outbreak of avian influenza during the period. (2) Most frequently traded CITES Appendix listed birds in China were parrots, most of which were exotic species to the country. (3) Birds were mainly traded for commercial purpose. Exotic birds in trade were mainly captive-bred while the most Chinese birds traded internationally were captured from the wild. Since many bird species in international trade are threatened to extinction, China should take stricter measures on importing of wild-captured birds and should collaborate with the countries of original in the international bird trade to avoid unsustainable harvesting of wild birds. It is urgent for China to carry out population surveys on those domestic bird species once in significant international trade and to make better conservation decisions based on

  10. Evaluation of wild animals browsing preferences in forage resources

    Directory of Open Access Journals (Sweden)

    Giovanni Argenti

    2017-09-01

    Full Text Available Excessive presence of wild ungulates can produce negative effects on herbaceous crops or woody species, and to face this problem, habitat improvements are often performed to recreate suitable environments for a given animal species and to attract animals far from cultivated crops. A common example of these interventions is represented by grassland restoration and to evaluate the real animal preferences on restored forage resources a proper trial was established in a hilly area of Tuscany (central Italy, inside the historical Park of Pratolino, near Florence. The trial compared six different forage species or mixtures sown in plots: vegetal material was represented by two pure stands (Onobrychis viciifolia and Medicago sativa and four mixtures differing in number and kind of used species. Plots were utilised only by wild animals occurring in the area. Data collection consisted of botanical samples in each plot in different periods to obtain the percent presence of each species. At the same time, a visual estimation of animal intake on all occurring species was performed to obtain the browsing ratio of single species and overall defoliation rate for each species/mixture. Moreover, six camera traps were placed on the boundary of the experimental site to record videos of wild animals browsing in the area for identification of animals actually occurring on different plots and for comparison of these results with botanical data. Vegetation surveys permitted a proper evaluation of animals intake and of their feeding preferences. In general, sown species performed a major role in animal browsing, even if in some periods also a few native species (such as Plantago lanceolata or Cichorium intybus were utilised in a strong way, depending on vegetation context and existing biomass. Camera traps results permitted the identification of browsing animal species (mainly represented by roe deer and plots frequentation resulted to be highly related to animal

  11. Wild food plants used by the Tibetans of Gongba Valley (Zhouqu county, Gansu, China)

    Science.gov (United States)

    2014-01-01

    Background The ethnobotany of Tibetans is a seriously under-studied topic. The aim of the study was to investigate knowledge and use of wild food plants in a valley inhabited by Tibetans in the Gannan Tibetan Autonomous Region. Methods The field research was carried out in a wooded mountain valley in 9 neighbouring villages the Zhouqu (Brugchu) county, and comprised 17 interviews with single informants and 14 group interviews, involving 122 people altogether. Results We recorded the use of 81 species of vascular plants from 41 families. Fruits formed the largest category, with 42 species, larger than the wild greens category, with 36 species. We also recorded the culinary use of 5 species of edible flowers, 7 species with underground edible organs and 5 taxa of fungi. On average, 16.2 edible taxa were listed per interview (median – 16). Green vegetables formed the largest category of wild foods (mean – 8.7 species, median – 9 species), but fruits were listed nearly as frequently (mean – 6.9, median – 6). Other categories were rarely mentioned: flowers (mean – 0.2, median – 0), underground edible parts (mean – 0.3, median – 0) and mushrooms (mean – 1.5, – median 1). Wild vegetables are usually boiled and/or fried and served as side-dishes (cai). They are often lacto-fermented. Wild fruits are mainly collected by children and eaten raw, they are not stored for further use. The most widely used wild vegetables are: Eleuterococcus spp., Pteridium aquilinum, Helwingia japonica, Aralia chinensis, Allium victorialis, Pteridium aquilinum, Ixeris chinensis, Thlaspi arvense and Chenopodium album. The culinary use of Caltha palustris as a green vegetable is very interesting. In its raw state, marsh marigold is a toxic plant, due to the presence of protoanemonin. In this area it is dried or lactofermented before use. The most commonly eaten fruits are: Pyrus xerophila, Prunus salicina, Berchemia sinica, Rubus spp. and Eleagnus umbellata. Conclusions The

  12. Selective depredation of planted hardwood seedlings by wild pigs in a wetland restoration area

    International Nuclear Information System (INIS)

    Mayer, J.J.

    1999-01-01

    Following the planting of several thousand hardwood seedlings in a 69-ha wetland restoration area in west-central South Carolina, wild pigs (Sus scrofa) depredated a large percentage of the young trees. This planting was undertaken as part of a mitigation effort to restore a bottomland hardwood community in the corridor and delta of a third order stream that had been previously impacted by the discharge of heated nuclear reactor effluent. The depredated restoration areas had been pretreated with both herbicide and control burning prior to planting the hardwood seedlings. After discovery of the wild pig damage, these areas were surveyed on foot to assess the magnitude of the depredation on the planted seedling crop. Foraging by the local wild pigs in the pretreatment areas selectively impacted only four of the nine hardwood species used in this restoration effort. Based on the surveys, the remaining five species did not appear to have been impacted at all. A variety of reasons could be used to explain this phenomenon. The pretreatment methodology is thought to have been the primary aspect of the restoration program that initially led the wild pigs to discover the planted seedlings. In addition, it is possible that a combination of other factors associated with odor and taste may have resulted in the selective depredation. Future wetland restoration efforts in areas with wild pigs should consider pretreatment methods and species to be planted. If pretreatment methods and species such as discussed in the present study must be used, then the prior removal of wild pigs from surrounding lands will help prevent depredations by this non-native species

  13. Selective depredation of planted hardwood seedlings by wild pigs in a wetland restoration area

    Energy Technology Data Exchange (ETDEWEB)

    Mayer, J.J.

    1999-12-17

    Following the planting of several thousand hardwood seedlings in a 69-ha wetland restoration area in west-central South Carolina, wild pigs (Sus scrofa) depredated a large percentage of the young trees. This planting was undertaken as part of a mitigation effort to restore a bottomland hardwood community in the corridor and delta of a third order stream that had been previously impacted by the discharge of heated nuclear reactor effluent. The depredated restoration areas had been pretreated with both herbicide and control burning prior to planting the hardwood seedlings. After discovery of the wild pig damage, these areas were surveyed on foot to assess the magnitude of the depredation on the planted seedling crop. Foraging by the local wild pigs in the pretreatment areas selectively impacted only four of the nine hardwood species used in this restoration effort. Based on the surveys, the remaining five species did not appear to have been impacted at all. A variety of reasons could be used to explain this phenomenon. The pretreatment methodology is thought to have been the primary aspect of the restoration program that initially led the wild pigs to discover the planted seedlings. In addition, it is possible that a combination of other factors associated with odor and taste may have resulted in the selective depredation. Future wetland restoration efforts in areas with wild pigs should consider pretreatment methods and species to be planted. If pretreatment methods and species such as discussed in the present study must be used, then the prior removal of wild pigs from surrounding lands will help prevent depredations by this non-native species.

  14. Wild vascular plants gathered for consumption in the Polish countryside: a review

    Directory of Open Access Journals (Sweden)

    Szymański Wojciech M

    2007-04-01

    Full Text Available Abstract Background This paper is an ethnobotanical review of wild edible plants gathered for consumption from the end of the 18th century to the present day, within the present borders of Poland. Methods 42 ethnographic and botanical sources documenting the culinary use of wild plants were analyzed. Results The use of 112 species (3.7% of the flora has been recorded. Only half of them have been used since the 1960s. Three species: Cirsium rivulare, Euphorbia peplus and Scirpus sylvaticus have never before been reported as edible by ethnobotanical literature. The list of wild edible plants which are still commonly gathered includes only two green vegetables (Rumex acetosa leaves for soups and Oxalis acetosella as children's snack, 15 folk species of fruits and seeds (Crataegus spp., Corylus avellana, Fagus sylvatica, Fragaria vesca, Malus domestica, Prunus spinosa, Pyrus spp., Rosa canina, Rubus idaeus, Rubus sect. Rubus, Sambucus nigra, Vaccinium myrtillus, V. oxycoccos, V. uliginosum, V. vitis-idaea and four taxa used for seasoning or as preservatives (Armoracia rusticana root and leaves, Carum carvi seeds, Juniperus communis pseudo-fruits and Quercus spp. leaves. The use of other species is either forgotten or very rare. In the past, several species were used for food in times of scarcity, most commonly Chenopodium album, Urtica dioica, U. urens, Elymus repens, Oxalis acetosella and Cirsium spp., but now the use of wild plants is mainly restricted to raw consumption or making juices, jams, wines and other preserves. The history of the gradual disappearance of the original barszcz, Heracleum sphondylium soup, from Polish cuisine has been researched in detail and two, previously unpublished, instances of its use in the 20th century have been found in the Carpathians. An increase in the culinary use of some wild plants due to media publications can be observed. Conclusion Poland can be characterized as a country where the traditions of culinary

  15. Gene capture from across the grass family in the allohexaploid Elymus repens (L.) Gould (Poaceae, Triticeae) as evidenced by ITS, GBSSI, and molecular cytogenetics.

    Science.gov (United States)

    Mahelka, Václav; Kopecký, David

    2010-06-01

    Four accessions of hexaploid Elymus repens from its native Central European distribution area were analyzed using sequencing of multicopy (internal transcribed spacer, ITS) and single-copy (granule-bound starch synthase I, GBSSI) DNA in concert with genomic and fluorescent in situ hybridization (GISH and FISH) to disentangle its allopolyploid origin. Despite extensive ITS homogenization, nrDNA in E. repens allowed us to identify at least four distinct lineages. Apart from Pseudoroegneria and Hordeum, representing the major genome constituents, the presence of further unexpected alien genetic material, originating from species outside the Triticeae and close to Panicum (Paniceae) and Bromus (Bromeae), was revealed. GBSSI sequences provided information complementary to the ITS. Apart from Pseudoroegneria and Hordeum, two additional gene variants from within the Triticeae were discovered: One was Taeniatherum-like, but the other did not have a close relationship with any of the diploids sampled. GISH results were largely congruent with the sequence-based markers. GISH clearly confirmed Pseudoroegneria and Hordeum as major genome constituents and further showed the presence of a small chromosome segment corresponding to Panicum. It resided in the Hordeum subgenome and probably represents an old acquisition of a Hordeum progenitor. Spotty hybridization signals across all chromosomes after GISH with Taeniatherum and Bromus probes suggested that gene acquisition from these species is more likely due to common ancestry of the grasses or early introgression than to recent hybridization or allopolyploid origin of E. repens. Physical mapping of rDNA loci using FISH revealed that all rDNA loci except one minor were located on Pseudoroegneria-derived chromosomes, which suggests the loss of all Hordeum-derived loci but one. Because homogenization mechanisms seem to operate effectively among Pseudoroegneria-like copies in this species, incomplete ITS homogenization in our samples

  16. WILD PIG ATTACKS ON HUMANS

    Energy Technology Data Exchange (ETDEWEB)

    Mayer, J.

    2013-04-12

    Attacks on humans by wild pigs (Sus scrofa) have been documented since ancient times. However, studies characterizing these incidents are lacking. In an effort to better understand this phenomenon, information was collected from 412 wild pig attacks on humans. Similar to studies of large predator attacks on humans, data came from a variety of sources. The various attacks compiled occurred in seven zoogeographic realms. Most attacks occurred within the species native range, and specifically in rural areas. The occurrence was highest during the winter months and daylight hours. Most happened under non-hunting circumstances and appeared to be unprovoked. Wounded animals were the chief cause of these attacks in hunting situations. The animals involved were typically solitary, male and large in size. The fate of the wild pigs involved in these attacks varied depending upon the circumstances, however, most escaped uninjured. Most human victims were adult males traveling on foot and alone. The most frequent outcome for these victims was physical contact/mauling. The severity of resulting injuries ranged from minor to fatal. Most of the mauled victims had injuries to only one part of their bodies, with legs/feet being the most frequent body part injured. Injuries were primarily in the form of lacerations and punctures. Fatalities were typically due to blood loss. In some cases, serious infections or toxemia resulted from the injuries. Other species (i.e., pets and livestock) were also accompanying some of the humans during these attacks. The fates of these animals varied from escaping uninjured to being killed. Frequency data on both non-hunting and hunting incidents of wild pig attacks on humans at the Savannah River Site, South Carolina, showed quantitatively that such incidents are rare.

  17. Root Traits, Nodulation and Root Distribution in Soil for Five Wild Lentil Species and Lens culinaris (Medik. Grown under Well-Watered Conditions

    Directory of Open Access Journals (Sweden)

    Linda Y. Gorim

    2017-09-01

    Full Text Available The efficient use of resources such as water and nutrients by plants is increasingly important as the world population food demand continues to grow. With the increased production of lentil in the temperate zones of North America, improvement in yield needs to be maintained. The use of wild lentil genotypes as sources of genetic diversity for introgression into cultivated lentil is an important breeding strategy, but little is known about their root systems. We evaluated the root systems of five wild lentil species and Lens culinaris under fully watered conditions. Plants were grown in 60 cm tubes containing equal volumes of soil collected from the reconstructed A, B, and C horizons. Significant differences were observed for root traits and fine root distribution between and within species and the proportion of root biomass partitioned into each soil layer was unique for each genotype. We also observed variability in nodule number and nodule shape within and between genotypes. Some genotypes more efficiently used water for either biomass or seed production. The allocation of resources to seed production also varied between genotypes. These observations could have impact on the design of future lentil breeding in the context of strategies for managing changes in rainfall amount and distribution for lentil production ecosystems.

  18. Seed Carotenoid and Tocochromanol Composition of Wild Fabaceae Species Is Shaped by Phylogeny and Ecological Factors

    Science.gov (United States)

    Fernández-Marín, Beatriz; Míguez, Fátima; Méndez-Fernández, Leire; Agut, Agustí; Becerril, José M.; García-Plazaola, José I.; Kranner, Ilse; Colville, Louise

    2017-01-01

    Carotenoids distribution and function in seeds have been very scarcely studied, notwithstanding their pivotal roles in plants that include photosynthesis and phytohormone synthesis, pigmentation, membrane stabilization and antioxidant activity. Their relationship with tocochromanols, whose critical role in maintaining seed viability has already been evidenced, and with chlorophylls, whose retention in mature seed is thought to have negative effects on storability, remain also unexplored. Here, we aimed at elucidating seed carotenoids relationship with tocochromanols and chlorophylls with regard to phylogenetic and ecological traits and at understanding their changes during germination. The composition and distribution of carotenoids were investigated in seeds of a wide range of wild species across the Fabaceae (the second-most economically important family after the Poaceae). Photosynthetic pigments and tocochromanols were analyzed by HPLC in mature dry seeds of 50 species representative of 5 subfamilies within the Fabaceae (including taxa that represent all continents, biomes and life forms within the family) and at key timepoints during seedling establishment in three species representative of distinct clades. Total-carotenoids content positively correlated with tocopherols in the basal subfamilies Detarioideae, Cercidoideae, and Dialioideae, and with chlorophylls in the Papilionoideae. Papilionoideae lacked tocotrienols and had the highest total-carotenoids, chlorophyll and γ-tocopherol contents. Interestingly, lutein epoxide was present in 72% of the species including several herbs from different subfamilies. Overall, species original from temperate biomes presented higher carotenoids and lower tocochromanols levels than those from tropical biomes. Also shrub species showed higher carotenoids content than herbs and trees. During germination, total content of photosynthetic pigments increased in parallel to changes in relative abundance of carotenoids

  19. Quantitative analysis of sesquiterpene lactone cnicin in seven Centaurea species wild-growing in Serbia and Montenegro using 1H-NMR spectroscopy

    Directory of Open Access Journals (Sweden)

    IRIS DJORDJEVIC

    2007-12-01

    Full Text Available 1H-NMR spectroscopy was applied for the quantitative analysis of cnicin, a bioactive germacranolide type sesquiterpene lactone, in the aerial parts of seven wild-growing Centaurea species collected in Serbia and Montenegro. The analysis was performed by comparison of the integral of the one-proton signal of cnicin (H-13, δ 5.75 with that of the two-proton singlet (δ 6.98 of 2,6-bis(1,1-dimethylethyl-4-methylphenol (BHT, used as the internal standard. Cnicin, within concentration the range 1.06–6.12 mg/g, calculated per weight of the fresh plant material was detected in six species, the exception being C. salonitana. This method allows the rapid and simple quantification of cnicin without any pre-purification step.

  20. WOW! Windows on the Wild: A Biodiversity Primer.

    Science.gov (United States)

    Braus, Judy, Ed.; And Others

    Windows on the Wild is an environmental education program of the World Wildlife Fund. This issue of WOW! focuses on biodiversity. Topics include: an interview with one of the world's leading experts on biodiversity; the lighter side of biodiversity through comics and cartoons; a species-scape that compares the number of species on the planet;…

  1. Reverse spillover of avian viral vaccine strains from domesticated poultry to wild birds.

    Science.gov (United States)

    Rohaim, M A; El Naggar, R F; Helal, A M; Hussein, H A; Munir, Muhammad

    2017-06-16

    Transmission of viruses from the commercial poultry to wild birds is an emerging paradigm of livestock-wildlife interface. Here, we report the identification and isolation of vaccine strains of avian paramyxovirus serotype 1 (APMV1) and avian coronaviruses (ACoV) from different wild bird species across eight Egyptian governorates between January 2014 and December 2015. Surveillance of avian respiratory viruses in free-ranging wild birds (n=297) identified three species that harboured or excreted APMV1 and ACoVs. Genetic characterization and phylogenetic analysis of recovered viruses revealed a close association with the most widely utilized vaccine strains in the country. These results highlight the potential spillover of vaccine-viruses probably due to extensive use of live-attenuated vaccines in the commercial poultry, and close interaction between domesticated and wild bird populations. Further exploring the full spectrum of vaccine-derived viral vaccine strains in wild birds might help to assess the emergence of future wild-birds origin viruses. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  2. FELINE IMMUNODEFICIENCY VIRUS (FIV) IN WILD PALLAS’ CATS

    Science.gov (United States)

    Brown, Meredith A.; Munkhtsog, Bariushaa; Troyer, Jennifer L.; Ross, Steve; Sellers, Rani; Fine, Amanda E.; Swanson, William F.; Roelke, Melody E.; O’Brien1, Stephen J.

    2009-01-01

    Feline immunodeficiency virus (FIV), a feline lentivirus related to HIV, causes immune dysfunction in domestic and wild cats. The Pallas’ cat is the only species from Asia known to harbor a species-specific strain of FIV designated FIVOma in natural populations. Here, a 25% seroprevalence of FIV is reported from 28 wild Mongolian Pallas’ cats sampled from 2000-2008. Phylogenetic analysis of proviral RT-Pol from eight FIVOma isolates from Mongolia, Russia, China and Kazakhstan reveals a unique monophyletic lineage of the virus within the Pallas’ cat population, most closely related to the African cheetah and leopard FIV strains. Histopathological examination of lymph node and spleen from infected and uninfected Pallas’ cats suggests that FIVOma causes immune depletion in its’ native host. PMID:19926144

  3. Factors that Influence Mycobacterium bovis Infection in Red Deer and Wild Boar in an Epidemiological Risk Area for Tuberculosis of Game Species in Portugal.

    Science.gov (United States)

    Madeira, S; Manteigas, A; Ribeiro, R; Otte, J; Fonseca, A Pina; Caetano, P; Abernethy, D; Boinas, F

    2017-06-01

    Bovine tuberculosis (bTB) is a worldwide zoonotic disease of domestic and wild animals. Eradication has proved elusive in those countries with intensive national programmes but with ongoing transmission between wildlife and cattle. In Portugal, a high-risk area for bTB was defined and specific measures implemented to assess and minimize the risk from wildlife. Data from the 2011 to 2014 hunting seasons for red deer (Cervus elaphus) and wild boar (Sus scrofa) were analysed with bovine demographic and bTB information to assess factors that determined the occurrence and distribution of bTB in both species. The likelihood of bTB-like lesions in wild boar was positively associated with density of red deer, wild boar and cattle, while for red deer, only their density and age were significant factors. The likelihood of Mycobacterium bovis isolation in wild boar was associated with density of cattle and red deer and also with the anatomical location of lesions, while for red deer, none of the variables tested were statistically significant. Our results suggest that, in the study area, the role of red deer and wild boar may be different from the one previously suggested by other authors for the Iberian Peninsula, as red deer may be the driving force behind M. bovis transmission to wild boar. These findings may assist the official services and game managing bodies for the management of hunting zones, what could also impact the success of the bTB eradication programme. © 2015 Blackwell Verlag GmbH.

  4. Helminths of Wild Predatory Mammals (Mammalia, Carnivora of Ukraine. Trematodes

    Directory of Open Access Journals (Sweden)

    Korol E. N.

    2016-08-01

    Full Text Available The paper summarises information on 11 species of trematodes parasitic in 9 species of wild carnivorans of Ukraine. The largest number of trematode species (9 was found in the red fox (Vulpes vulpes. Alaria alata (Diplostomidae appeared to be the most common trematode parasite in the studied group; it was found in 4 host species from 9 administrative regions and Crimea.

  5. Winery wastewater inhibits seed germination and vegetative growth of common crop species.

    Science.gov (United States)

    Mosse, Kim P M; Patti, Antonio F; Christen, Evan W; Cavagnaro, Timothy R

    2010-08-15

    The ability to reuse winery wastewater would be of significant benefit to the wine industry, as it could potentially be a cost-effective method of wastewater management, whilst at the same time providing a valuable water resource. This study investigated the effects of different dilutions of a semi-synthetic winery wastewater on the growth and germination of four common crop species in a glasshouse study; barley (Hordeum vulgare), millet (Pennisetum glaucum), lucerne (Medicago sativa) and phalaris (Phalaris aquatica). The wastewater caused a significant delay in the germination of lucerne, millet and phalaris, although overall germination percentage of all species was not affected. Vegetative growth was significantly reduced in all species, with millet being the most severely affected. The germination index of barley correlated very highly (r(2)=0.99) with barley biomass, indicating that barley seed germination bioassays are highly relevant to plant growth, and therefore may be of use as a bioassay for winery wastewater toxicity. Copyright 2010 Elsevier B.V. All rights reserved.

  6. A test of the habitat suitability model for Merriam's wild turkeys

    Science.gov (United States)

    Mark A. Rumble; Stanley H. Anderson

    1996-01-01

    An important research area regarding the wild turkey (Meleagris gallopavo) is development of sound habitat models. Habitat models provide standardized methods to quantify wild turkey habitat and stimulate new research hypotheses. Habitat suitability index (HSI) models show species-habitat relationships on a scale of O-l, with 1 being optimum. A...

  7. Hybrids between cultivated and wild carrots in natural populations in Denmark

    DEFF Research Database (Denmark)

    Magnussen, L.S.; Hauser, Thure Pavlo

    2007-01-01

    Many cultivated plant species are able to hybridize with related wild plants. However, it is not clear whether their hybrids are able to survive and reproduce outside managed fields, and if cultivar genes introgress into wild populations. In areas where wild carrots co-occur with carrot root......-crops, pollen and seeds may flow from two different sources in the fields to the surrounding wild populations: from pure cultivar plants that occasionally flower, and from flowering 'bolters' that originate from hybridizations between wild (male) and cultivated carrots (female) in seed production fields...... by AFLP. Four hybrids were identified among the 71 plants analysed, and these were most likely F(2) or backcross individuals, sired by pollen from hybrid bolters. Wild populations close to fields were genetically somewhat more similar to cultivars than wild populations far from fields, suggesting...

  8. Genetic diversity in Oryza glumaepatula wild rice populations in Costa Rica and possible gene flow from O. sativa.

    Science.gov (United States)

    Fuchs, Eric J; Meneses Martínez, Allan; Calvo, Amanda; Muñoz, Melania; Arrieta-Espinoza, Griselda

    2016-01-01

    Wild crop relatives are an important source of genetic diversity for crop improvement. Diversity estimates are generally lacking for many wild crop relatives. The objective of the present study was to analyze how genetic diversity is distributed within and among populations of the wild rice species Oryza glumaepatula in Costa Rica. We also evaluated the likelihood of gene flow between wild and commercial rice species because the latter is commonly sympatric with wild rice populations. Introgression may change wild species by incorporating alleles from domesticated species, increasing the risk of losing original variation. Specimens from all known O. glumaepatula populations in Costa Rica were analyzed with 444 AFLP markers to characterize genetic diversity and structure. We also compared genetic diversity estimates between O. glumaepatula specimens and O. sativa commercial rice. Our results showed that O. glumaepatula populations in Costa Rica have moderately high levels of genetic diversity, comparable to those found in South American populations. Despite the restricted distribution of this species in Costa Rica, populations are fairly large, reducing the effects of drift on genetic diversity. We found a dismissible but significant structure (θ = 0.02 ± 0.001) among populations. A Bayesian structure analysis suggested that some individuals share a significant proportion of their genomes with O. sativa. These results suggest that gene flow from cultivated O. sativa populations may have occurred in the recent past. These results expose an important biohazard: recurrent hybridization may reduce the genetic diversity of this wild rice species. Introgression may transfer commercial traits into O. glumaepatula, which in turn could alter genetic diversity and increase the likelihood of local extinction. These results have important implications for in situ conservation strategies of the only wild populations of O. glumaepatula in Costa Rica.

  9. SALMON AND THE ENDANGERED SPECIES ACT: TROUBLESOME QUESTIONS

    Science.gov (United States)

    Throughout the Pacific Northwest and California, all wild salmon runs have declined since 1850 and some have disappeared. A sustainable future for wild salmon remains elusive. In response to requirements of the U.S. Endangered Species Act, the Canadian Species at Risk Act, and ...

  10. Traditional knowledge of wild edible plants used in Palestine (Northern West Bank: A comparative study

    Directory of Open Access Journals (Sweden)

    Khlaif Rasha B

    2008-05-01

    Full Text Available Abstract Background A comparative food ethnobotanical study was carried out in fifteen local communities distributed in five districts in the Palestinian Authority, PA (northern West Bank, six of which were located in Nablus, two in Jenin, two in Salfit, three in Qalqilia, and two in Tulkarm. These are among the areas in the PA whose rural inhabitants primarily subsisted on agriculture and therefore still preserve the traditional knowledge on wild edible plants. Methods Data on the use of wild edible plants were collected for one-year period, through informed consent semi-structured interviews with 190 local informants. A semi-quantitative approach was used to document use diversity, and relative importance of each species. Results and discussion The study recorded 100 wild edible plant species, seventy six of which were mentioned by three informants and above and were distributed across 70 genera and 26 families. The most significant species include Majorana syriaca, Foeniculum vulgare, Malvasylvestris, Salvia fruticosa, Cyclamen persicum, Micromeria fruticosa, Arum palaestinum, Trigonella foenum-graecum, Gundelia tournefortii, and Matricaria aurea. All the ten species with the highest mean cultural importance values (mCI, were cited in all five areas. Moreover, most were important in every region. A common cultural background may explain these similarities. One taxon (Majoranasyriaca in particular was found to be among the most quoted species in almost all areas surveyed. CI values, as a measure of traditional botanical knowledge, for edible species in relatively remote and isolated areas (Qalqilia, and Salfit were generally higher than for the same species in other areas. This can be attributed to the fact that local knowledge of wild edible plants and plant gathering are more spread in remote or isolated areas. Conclusion Gathering, processing and consuming wild edible plants are still practiced in all the studied Palestinian areas. About 26

  11. Could abiotic stress tolerance in wild relatives of rice be used to improve Oryza sativa?

    Science.gov (United States)

    Atwell, Brian J; Wang, Han; Scafaro, Andrew P

    2014-02-01

    Oryza sativa and Oryza glaberrima have been selected to acquire and partition resources efficiently as part of the process of domestication. However, genetic diversity in cultivated rice is limited compared to wild Oryza species, in spite of 120,000 genotypes being held in gene banks. By contrast, there is untapped diversity in the more than 20 wild species of Oryza, some having been collected from just a few coastal locations (e.g. Oryza schlechteri), while others are widely distributed (e.g. Oryza nivara and Oryza rufipogon). The extent of DNA sequence diversity and phenotypic variation is still being established in wild Oryza, with genetic barriers suggesting a vast range of morphologies and function even within species, such as has been demonstrated for Oryza meridionalis. With increasing climate variability and attempts to make more marginal land arable, abiotic and biotic stresses will be managed over the coming decades by tapping into the genetic diversity of wild relatives of O. sativa. To help create a more targeted approach to sourcing wild rice germplasm for abiotic stress tolerance, we have created a climate distribution map by plotting the natural occurrence of all Oryza species against corresponding temperature and moisture data. We then discuss interspecific variation in phenotype and its significance for rice, followed by a discussion of ways to integrate germplasm from wild relatives into domesticated rice. Crown Copyright © 2013. Published by Elsevier Ireland Ltd. All rights reserved.

  12. Influenza virus and endothelial cells: a species specific relationship

    Directory of Open Access Journals (Sweden)

    Kirsty Renfree Short

    2014-12-01

    Full Text Available Influenza A virus infection is an important cause of respiratory disease in humans. The original reservoirs of influenza A virus are wild waterfowl and shorebirds, where virus infection causes limited, if any, disease. Both in humans and in wild waterbirds, epithelial cells are the main target of infection. However, influenza virus can spread from wild bird species to terrestrial poultry. Here, the virus can evolve into highly pathogenic avian influenza (HPAI. Part of this evolution involves increased viral tropism for endothelial cells. HPAI virus infections not only cause severe disease in chickens and other terrestrial poultry species but can also spread to humans and back to wild bird populations. Here, we review the role of the endothelium in the pathogenesis of influenza virus infection in wild birds, terrestrial poultry and humans with a particular focus on HPAI viruses. We demonstrate that whilst the endothelium is an important target of virus infection in terrestrial poultry and some wild bird species, in humans the endothelium is more important in controlling the local inflammatory milieu. Thus, the endothelium plays an important, but species-specific, role in the pathogenesis of influenza virus infection.

  13. Under what circumstances can wildlife farming benefit species conservation?

    Directory of Open Access Journals (Sweden)

    Laura Tensen

    2016-04-01

    Full Text Available Wild animals and their derivatives are traded worldwide. Consequent poaching has been a main threat to species conservation. As current interventions and law enforcement cannot circumvent the resulting extinction of species, an alternative approach must be considered. It has been suggested that commercial breeding can keep the pressure off wild populations, referred to as wildlife farming. During this review, it is argued that wildlife farming can benefit species conservation only if the following criteria are met: (i the legal products will form a substitute, and consumers show no preference for wild-caught animals; (ii a substantial part of the demand is met, and the demand does not increase due to the legalized market; (iii the legal products will be more cost-efficient, in order to combat the black market prices; (iv wildlife farming does not rely on wild populations for re-stocking; (v laundering of illegal products into the commercial trade is absent. For most species encountered in the wildlife trade, these criteria are unlikely to be met in reality and commercial breeding has the potential to have the opposite effect to what is desired for conservation. For some species, however, none of the criteria are violated, and wildlife farming can be considered a possible conservation tool as it may help to take the pressure off wild populations. For these species, future research should focus on the impact of legal products on the market dynamics, effective law enforcement that can prevent corruption, and wildlife forensics that enable the distinction between captive-bred and wild-caught species.

  14. [Wild animals and law and ethics in France].

    Science.gov (United States)

    Nouët, Jean-Claude

    2013-01-01

    Legal systems applying to wild animals are very different depending on whether the animals are in captivity or under human control, or whether they are in the wild. Animals in captivity, like domesticated animals, are covered by protective measures for the welfare of the individual animal, but wild animals are not considered as individuals but only as members of a species, their numbers being controlled by humans and determined by human interests. In the light of contemporary scientific knowledge, such legal approaches are now inappropriate and can no longer be accepted for ethical reasons. The legal systems need to develop and must include a definition of the animal as an individual and as a sentient being.

  15. Genetic variability and evolutionary implications of RNA silencing suppressor genes in RNA1 of sweet potato chlorotic stunt virus isolates infecting sweetpotato and related wild species.

    Directory of Open Access Journals (Sweden)

    Arthur K Tugume

    Full Text Available BACKGROUND: The bipartite single-stranded RNA genome of Sweet potato chlorotic stunt virus (SPCSV, genus Crinivirus; Closteroviridae encodes a Class 1 RNase III (RNase3, a putative hydrophobic protein (p7 and a 22-kDa protein (p22 from genes located in RNA1. RNase3 and p22 suppress RNA silencing, the basal antiviral defence mechanism in plants. RNase3 is sufficient to render sweetpotato (Ipomoea batatas virus-susceptible and predisposes it to development of severe diseases following infection with unrelated virus. The incidence, strains and gene content of SPCSV infecting wild plant species have not been studied. METHODOLOGY/PRINCIPAL FINDINGS: Thirty SPCSV isolates were characterized from 10 wild Ipomoea species, Hewittia sublobata or Lepistemon owariensis (family Convolvulaceae in Uganda and compared with 34 local SPCSV isolates infecting sweetpotatoes. All isolates belonged to the East African (EA strain of SPCSV and contained RNase3 and p7, but p22 was not detected in six isolates. The three genes showed only limited genetic variability and the proteins were under purifying selection. SPCSV isolates lacking p22 synergized with Sweet potato feathery mottle virus (SPFMV, genus potyvirus; Potyviridae and caused severe symptoms in co-infected sweetpotato plants. One SPCSV isolate enhanced accumulation of SPFMV, but no severe symptoms developed. A new whitefly-transmitted virus (KML33b encoding an RNase3 homolog (<56% identity to SPCSV RNase3 able to suppresses sense-mediated RNA silencing was detected in I. sinensis. CONCLUSIONS/SIGNIFICANCE: SPCSV isolates infecting wild species and sweetpotato in Uganda were genetically undifferentiated, suggesting inter-species transmission of SPCSV. Most isolates in Uganda contained p22, unlike SPCSV isolates characterized from other countries and continents. Enhanced accumulation of SPFMV and increased disease severity were found to be uncoupled phenotypic outcomes of RNase3-mediated viral synergism in

  16. Lead Concentrations in Soils and Some Wild Plant Species Along Two Busy Roads in Pakistan.

    Science.gov (United States)

    Khalid, Noreen; Hussain, Mumtaz; Young, Hillary S; Ashraf, Muhammad; Hameed, Mansoor; Ahmad, Rashid

    2018-02-01

    This study assessed the level of Pb in soil and five wild plant species (Calotropis procera, Datura alba, Parthenium hysterophorus, Cenchrus ciliaris and Ricinus communis) during all the four seasons. Two busy roads varying in age and traffic volume were selected i.e., Faisalabad-Sargodha road (FSR) and Pindi Bhattian to Lillah (M-2) in the Punjab, Pakistan. Results showed raised levels of Pb in both plants and soil samples along both roads. The range of Pb concentration in plants was 0.08-3.98 and 1.95-4.74 mg kg - 1 for soil. Higher Pb contamination was recorded along FSR road as compared to M-2. Among seasons, the higher Pb concentration was found during summer, probably due to very high temperature. Among all the plants studied, Calotropis procera accumulated the highest level (3.98 mg kg - 1 dry wt.) of Pb; Thus, it can be used as good biomonitor/phytoremediator at Pb contaminated areas.

  17. Zinc blotting assay for detection of zinc binding prolamin in barley (Hordeum vulgare) grain

    DEFF Research Database (Denmark)

    Uddin, Mohammad Nasir; Nielsen, Ane Langkilde-Lauesen; Vincze, Eva

    2014-01-01

    In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc......-binding protein. However, to our knowledge so far this zinc blotting assay has never been applied to detect a prolamin fraction in barley grains. A radioactive zinc (65ZnCl2) blotting technique was optimized to detect zinc-binding prolamins, followed by development of an easy-to-follow nonradioactive colorimetric...... zinc blotting method with a zinc-sensing dye, dithizone. Hordeins were extracted from mature barley grain, separated by SDS-PAGE, blotted on a membrane, renatured, overlaid, and probed with zinc; subsequently, zinc-binding specificity of certain proteins was detected either by autoradiography or color...

  18. Infections of nervous necrosis virus in wild and cage-reared marine fish from South China Sea with unexpected wide host ranges.

    Science.gov (United States)

    Liu, X D; Huang, J N; Weng, S P; Hu, X Q; Chen, W J; Qin, Z D; Dong, X X; Liu, X L; Zhou, Y; Asim, M; Wang, W M; He, J G; Lin, L

    2015-06-01

    The concerns about the impact of the nervous necrosis virus (NNV) infections in wild fish have been raised. This paper presents the results of quarterly surveys of NNV in wild and cage-reared marine fish from South China Sea. Samples of 892 wild fish belonging to 69 species and 381 cage-reared fish belonging to 11 species were collected and were detected by seminested PCR and nested PCR. In the case of seminested PCR, the positive signal was detected in 3.0% and 3.1% samples of wild and cage-reared fish, respectively. However, by nested RT-PCR, the positive signal was observed in 42.3% and 63.0% samples of wild and cage-reared fish, respectively. If the fish species were considered, the positive signal was detected in 21.7% and 72.7% species of wild and cage-reared fish by seminested PCR assay, respectively. However, by nested RT-PCR, the positive signal was observed in 65.2% and 100% species of wild and cage-reared fish, respectively. The nucleotide sequences of the nested PCR products were determined. Phylogenetic tree showed that all the obtained viral isolates belonged to the red-spotted grouper nervous necrosis virus (RGNNV) genotype. Thirty-five species of the marine fish were the new hosts of NNV. © 2014 John Wiley & Sons Ltd.

  19. A genetic analysis of the introgression process from cultivated lettuce (Lactuca sativa L.) to wild prickly lettuce (L. serriola L.)

    NARCIS (Netherlands)

    Uwimana, B.

    2011-01-01

    Many plant species can hybridise and produce fertile offspring. Hybridization between cultivated species and their wild relatives has raised concerns with regard to GM crops, as it constitutes a possible route along which the transgene could disperse from crops into related wild species,

  20. Interspecific variation of total seed protein in wild rice germplasm using SDS-Page

    International Nuclear Information System (INIS)

    Shah, S.M.A.; Hidayat-ur-Rahman; Abbasi, F.M.; Ashiq, M.; Rabbani, A.M.; Khan, I.A.; Shinwari, Z.K.; Shah, Z.

    2011-01-01

    Variation in seed protein of 14 wild rice species (Oryza spp.) along with cultivated rice species (O. sativa) was studied using sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE) to assess genetic diversity in the rice germplasm. SDS bands were scored as present (1) or absent (0) for protein sample of each genotype. On the basis of cluster analysis, four clusters were identified at a similarity level of 0.85. O. nivara, O. rufipogon and O. sativa with AA genomes constituted the first cluster. The second cluster comprised O. punctata of BB genome and wild rice species of CC genome i.e., O. rhizomatis and O. officinalis. However, it also contained O. barthii and O. glumaepatula of AA genome. O. australiensis with EE genome, and O. latifolia, O. alta and O. grandiglumis having CCDD genomes comprised the third cluster. The fourth cluster consisted of wild rice species, O. brachyantha with EE genome along with two other wild rice species, O. longistaminata and O. meridionalis of AA genome. Overall, on the basis of total seed protein, the grouping pattern of rice genotypes was mostly compatible with their genome status. The results of the present work depicted considerable interspecific genetic variation in the investigated germplasm for total seed protein. Moreover, the results obtained in this study also suggest that analysis of seed protein can also provide a better understanding of genetic affinity of the germplasm. (author)

  1. West Nile Virus and Usutu Virus Monitoring of Wild Birds in Germany

    Science.gov (United States)

    Michel, Friederike; Fast, Christine; Reuschel, Maximilian; Müller, Kerstin; Urbaniak, Sylvia; Brandes, Florian; Schwehn, Rebekka; Groschup, Martin H.; Ziegler, Ute

    2018-01-01

    By systematically setting up a unique nation-wide wild bird surveillance network, we monitored migratory and resident birds for zoonotic arthropod-borne virus infections, such as the flaviviruses West Nile virus (WNV) and Usutu virus (USUV). More than 1900 wild bird blood samples, from 20 orders and 136 different bird species, were collected between 2014 and 2016. Samples were investigated by WNV and USUV-specific real-time polymerase chain reactions as well as by differentiating virus neutralization tests. Dead bird surveillance data, obtained from organ investigations in 2016, were also included. WNV-specific RNA was not detected, whereas four wild bird blood samples tested positive for USUV-specific RNA. Additionally, 73 USUV-positive birds were detected in the 2016 dead bird surveillance. WNV neutralizing antibodies were predominantly found in long-distance, partial and short-distance migrants, while USUV neutralizing antibodies were mainly detected in resident wild bird species, preferentially with low seroprevalences. To date, WNV-specific RNA has neither been detected in wild birds, nor in mosquitoes, thus, we conclude that WNV is not yet present in Germany. Continued wild bird and mosquito monitoring studies are essential to detect the incursion of zoonotic viruses and to allow risk assessments for zoonotic pathogens. PMID:29361762

  2. Plant Fitness Assessment for Wild Relatives of Insect Resistant Bt-Crops

    Directory of Open Access Journals (Sweden)

    D. K. Letourneau

    2012-01-01

    Full Text Available When field tests of transgenic plants are precluded by practical containment concerns, manipulative experiments can detect potential consequences of crop-wild gene flow. Using topical sprays of bacterial Bacillus thuringiensis larvicide (Bt and larval additions, we measured fitness effects of reduced herbivory on Brassica rapa (wild mustard and Raphanus sativus (wild radish. These species represent different life histories among the potential recipients of Bt transgenes from Bt cole crops in the US and Asia, for which rare spontaneous crosses are expected under high exposure. Protected wild radish and wild mustard seedlings had approximately half the herbivore damage of exposed plants and 55% lower seedling mortality, resulting in 27% greater reproductive success, 14-day longer life-spans, and 118% more seeds, on average. Seed addition experiments in microcosms and in situ indicated that wild radish was more likely to spread than wild mustard in coastal grasslands.

  3. Freeze-tolerance of Trichinella muscle larvae in experimentally infected wild boars.

    Science.gov (United States)

    Lacour, Sandrine A; Heckmann, Aurélie; Macé, Pauline; Grasset-Chevillot, Aurélie; Zanella, Gina; Vallée, Isabelle; Kapel, Christian M O; Boireau, Pascal

    2013-05-20

    Freeze-tolerance of encapsulated Trichinella muscle larvae (ML) is mainly determined by Trichinella species, but is also influenced by host species, the age of the infection and the storage time and temperature of the infected meat. Moreover, the freeze-tolerance of the encapsulated species appears to be correlated to the development of thick capsule walls which increases with age. An extended infection period and the muscle composition in some hosts (e.g. herbivores) may provide freeze-avoiding matrices due to high carbohydrate contents. The present experiment compares freeze-tolerance of Trichinella spiralis and Trichinella britovi ML in wild boar meat 24 weeks post inoculation (wpi). Three groups of four wild boars were infected with 200, 2000 or 20,000 ML of T. britovi (ISS 1575), respectively. Additionally, three wild boars were inoculated with 20,000 ML of T. spiralis (ISS 004) and two animals served as negative controls. All wild boars were sacrificed 24 wpi. Muscle samples of 70 g were stored at -21°C for 19, 30 and 56 h, and for 1-8 weeks. Larvae were recovered by artificial digestion. Their mobilities were recorded using Saisam(®) image analysis software and their infectivities were evaluated using mouse bioassays. Samples frozen for 19, 30 and 56 h allowed recovery of mobile ML, but samples frozen for 1 or 2 weeks did not. Correspondingly, only T. spiralis and T. britovi larvae isolated from wild boar meat frozen for 19, 30 and 56 h established in mice. This study showed that freezing at -21°C for 1 week inactivated T. spiralis and T. britovi ML encapsulated in wild boar meat for 24 weeks. Copyright © 2013 Elsevier B.V. All rights reserved.

  4. 50 CFR 16.11 - Importation of live wild mammals.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Importation of live wild mammals. 16.11 Section 16.11 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR... species of so-called “flying fox” or fruit bat of the genus Pteropus; (2) any species of mongoose or...

  5. The population structure of wild sorghum species in agro-ecological ...

    African Journals Online (AJOL)

    The range of allelic frequencies varied from low (˂0.4), to moderate (0.4-0.7) and to high (0.7) in the AEZs. Wild sorghum populations had moderate to high expected heterozygosity (HE) values of between 0.453 in LM1 to 0.715 in LM2. Differences in the magnitude of diversity was significant in the counties (Busia HE = 0.59 ...

  6. Differences in gorilla nettle-feeding between captivity and the wild: local traditions, species typical behaviors or merely the result of nutritional deficiencies?

    Science.gov (United States)

    Masi, Shelly

    2011-11-01

    Behavioral and cognitive studies on captive apes often pay little attention to the specific environmental conditions of their study subjects. A recent report form Byrne et al. (Anim Cogn doi: 10.1007/s10071-011-0403-8, 2011), comparing nettle-feeding techniques between captive and wild gorillas, claimed to document "the strongest evidence yet to come from any great ape that observational learning of a skilled conspecific" can allow social learning and culture in gorillas. An earlier study with similar findings placed emphasis instead on the many similarities and claims for species typical behavior, thus a genetic hypothesis instead of a cultural hypothesis. This commentary aims at formulating a third environmental hypothesis based on path-dependent behavioral differences owing to different diet and availability of nutritional resources of wild and captive gorillas. Captive diet provides gorillas with a much lower concentration of fibers. Gorillas are hindgut fermenters, and this deficit of natural fermentation of fibers may impact their health and their behavior in zoos. Results of Byrne et al.'s study will be discussed comparing feeding choice and availability of nutritional resources of wild and captive gorillas, showing that in captivity gorilla, motivation to consume certain food or certain plant parts may differ drastically from that of wild gorillas. This view does not intend to deny that social learning and culture may exist in gorillas, but to guide and encourage future works investigating social learning in great apes to take more accurately into account the living conditions and, when comparing populations, the possible environmental differences. © Springer-Verlag 2011

  7. Distribution of Wild and Cultivated Grapes in Turkey

    Directory of Open Access Journals (Sweden)

    Ibrahim H UZUN

    2010-12-01

    Full Text Available Turkey is one of main gene centers in the world for grapes. It is believed that cultivated grapes have their origins in Turkey and the surrounding countries. Vitis vinifera ssp sylvestris is the only wild grape species in this region. That is why Turkey has a very large amount of wild grapevine populations and grape cultivars which offer to grapevine breeders a valuable gene pool. Wild grapevines have significant characters for inducing the resistence to biotic and abiotic stress factors, such as resistance to lime, drought, pests and diseases. Turkey has over 1.600 local grape cultivars, among which the majority of them are conserved at the national grape collection vineyard in Tekirda?. They are mostly used as table grapes, dried grapes or for local consumptions. Wild grapes are distributed all over the country territory, mainly in the river basins and forests. Wild grape collection vineyards were established at some universities in Turkey. These grapevines will be screened for the resistance to biotic and abiotic stress factors.

  8. Irrigation method does not affect wild bee pollinators of hybrid sunflower

    Directory of Open Access Journals (Sweden)

    Hillary Sardiñas

    2016-09-01

    Full Text Available Irrigation method has the potential to directly or indirectly influence populations of wild bee crop pollinators nesting and foraging in irrigated crop fields. The majority of wild bee species nest in the ground, and their nests may be susceptible to flooding. In addition, their pollination of crops can be influenced by nectar quality and quantity, which are related to water availability. To determine whether different irrigation methods affect crop pollinators, we compared the number of ground-nesting bees nesting and foraging in drip- and furrow-irrigated hybrid sunflower fields in the Sacramento Valley. We found that irrigation method did not impact wild bee nesting rates or foraging bee abundance or bee species richness. These findings suggest that changing from furrow irrigation to drip irrigation to conserve water likely will not alter hybrid sunflower crop pollination.

  9. Genetic diversity associated with conservation of endangered Dongxiang wild rice (Oryza rufipogon)

    Science.gov (United States)

    The wild progenitor species (Oryza rufipogon) of Asian cultivated rice (O. sativa) is located in Dongxiang county, China where it is considered the northernmost range worldwide. Nine ex situ and three in situ populations of the Dongxiang wild rice (DXWR) and four groups of modern cultivars were geno...

  10. Radioactive cesium elution speed in dried wild Mushrooms collected in 2015

    International Nuclear Information System (INIS)

    Yamaguchi, Toshiro; Arai, Hirotsugu; Ohnuma, Tohru; Arai, Hiromu; Takyu, Sodai; Matsuyama, Tetsuo; Ishii, Keizo

    2016-01-01

    Dried wild mushrooms (12 species, 13 samples) collected in Nagano, Fukushima, and Miyagi Prefectures, Japan, in 2015 were immersed in water for 1,440 min. The elution rate of radioactive cesium (Cs) was calculated based on its radioactivity, which was measured with a high-purity germanium semiconductor detector (GX2018; CANBERRA Industries, Meriden, CT, USA) before and after immersion for each mushroom. Immersion fluid was sampled after 10, 30, 60, 180, 360, and 1,440 min of immersion and dried on aluminum foil. Then, imaging plates (BAS-III, Fujifilm, Tokyo, Japan) exposed to the dried immersion fluid were measured with a Bio-imaging Analyzer System-1800 II (Fujifilm). The 50% elution time of each wild mushroom was calculated based on the photo stimulated luminescence density of the autoradiographs. The radioactive Cs elution rate was > 80% for 11 samples (84% of total) comprising 11 mushroom species. Moreover, the 50% elution time was < 30 min for 9 samples (69% of total) comprising 9 species. This shows that the radioactive Cs elution rate and elution speed were not constant among mushroom species. Based on these results, immersing the mushrooms, which were dried, in water for at least 120 min is an effective method for removing radioactive Cs from wild mushrooms. (author)

  11. Reactivity of erythron in wild mice of a zone of the Chernobyl disaster

    International Nuclear Information System (INIS)

    Goncharov, S.V.

    2009-01-01

    The species distinctions on hematological parameters in wild rodents were studied. A number of red cells, hematocrit and hemoglobin of the wild mice from points with exposure dose about 5-6 μGy/h were clearly different from control. Among studied wild mice, the highest sensitivity of hemoglobin to sodium nitrite has been recorded in Clethrionomys glareolus and the lowest one is in Apodemus flavicollis. (authors)

  12. Differential Antioxidative Responses to Water Deficit Among four Barley (Hordeum vulgare L. Genotypes

    Directory of Open Access Journals (Sweden)

    Z Amini

    2013-08-01

    Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P

  13. Taxonomic and functional trait diversity of wild bees in different urban settings.

    Science.gov (United States)

    Normandin, Étienne; Vereecken, Nicolas J; Buddle, Christopher M; Fournier, Valérie

    2017-01-01

    Urbanization is one of the major anthropogenic processes contributing to local habitat loss and extirpation of numerous species, including wild bees, the most widespread pollinators. Little is known about the mechanisms through which urbanization impacts wild bee communities, or the types of urban green spaces that best promote their conservation in cities. The main objective of this study was to describe and compare wild bee community diversity, structure, and dynamics in two Canadian cities, Montreal and Quebec City. A second objective was to compare functional trait diversity among three habitat types (cemeteries, community gardens and urban parks) within each city. Bees were collected using pan traps and netting on the same 46 sites, multiple times, over the active season in 2012 and 2013. A total of 32,237 specimens were identified, representing 200 species and 6 families, including two new continental records, Hylaeus communis Nylander (1852) and Anthidium florentinum (Fabricius, 1775). Despite high community evenness, we found significant abundance of diverse species, including exotic ones. Spatio-temporal analysis showed higher stability in the most urbanized city (Montreal) but low nestedness of species assemblages among the three urban habitats in both cities. Our study demonstrates that cities are home to diverse communities of wild bees, but in turn affect bee community structure and dynamics. We also found that community gardens harbour high levels of functional trait diversity. Urban agriculture therefore contributes substantially to the provision of functionally diverse bee communities and possibly to urban pollination services.

  14. Zoonotic pathogens in Atlantic Forest wild rodents in Brazil: Bartonella and Coxiella infections.

    Science.gov (United States)

    Rozental, Tatiana; Ferreira, Michelle Santos; Guterres, Alexandro; Mares-Guia, Maria Angélica; Teixeira, Bernardo R; Gonçalves, Jonathan; Bonvicino, Cibele Rodrigues; D'Andrea, Paulo Sergio; de Lemos, Elba Regina Sampaio

    2017-04-01

    Zoonotic pathogens comprise a significant and increasing fraction of all emerging and re-emerging infectious diseases that plague humans. Identifying host species is one of the keys to controlling emerging infectious diseases. From March 2007 until April 2012, we collected a total of 131 wild rodents in eight municipalities of Rio de Janeiro, Brazil. We investigated these rodents for infection with Coxiella burnetii, Bartonella spp. and Rickettsia spp. In total, 22.1% (29/131) of the rodents were infected by at least one pathogen; co-infection was detected in 1.5% (2/131) of rodents. Coxiella burnetii was detected in 4.6% (6/131) of the wild animals, 17.6% of the rodents harbored Bartonella spp. No cases of Rickettsia were identified. Bartonella doshiae and Bartonella vinsonii were the species found on the wild mammals. This report is the first to note C. burnetii, B. doshiae and B. vinsonii natural infections in Atlantic Forest wild rodents in Brazil. Our work highlights the potential risk of transmission to humans, since most of the infected specimens belong to generalist species that live near human dwellings. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. The Genetic Structure of Wild Orobanche cumana Wallr. (Orobanchaceae Populations in Eastern Bulgaria Reflects Introgressions from Weedy Populations

    Directory of Open Access Journals (Sweden)

    Rocío Pineda-Martos

    2014-01-01

    Full Text Available Orobanche cumana is a holoparasitic plant naturally distributed from central Asia to south-eastern Europe, where it parasitizes wild Asteraceae species. It is also an important parasitic weed of sunflower crops. The objective of this research was to investigate genetic diversity, population structure, and virulence on sunflower of O. cumana populations parasitizing wild plants in eastern Bulgaria. Fresh tissue of eight O. cumana populations and mature seeds of four of them were collected in situ on wild hosts. Genetic diversity and population structure were studied with SSR markers and compared to weedy populations. Two main gene pools were identified in Bulgarian populations, with most of the populations having intermediate characteristics. Cross-inoculation experiments revealed that O. cumana populations collected on wild species possessed similar ability to parasitize sunflower to those collected on sunflower. The results were explained on the basis of an effective genetic exchange between populations parasitizing sunflower crops and those parasitizing wild species. The occurrence of bidirectional gene flow may have an impact on wild populations, as new physiological races continuously emerge in weedy populations. Also, genetic variability of wild populations may favour the ability of weedy populations to overcome sunflower resistance mechanisms.

  16. The Genetic Structure of Wild Orobanche cumana Wallr. (Orobanchaceae) Populations in Eastern Bulgaria Reflects Introgressions from Weedy Populations

    Science.gov (United States)

    Pineda-Martos, Rocío; Pujadas-Salvà, Antonio J.; Fernández-Martínez, José M.; Stoyanov, Kiril; Pérez-Vich, Begoña

    2014-01-01

    Orobanche cumana is a holoparasitic plant naturally distributed from central Asia to south-eastern Europe, where it parasitizes wild Asteraceae species. It is also an important parasitic weed of sunflower crops. The objective of this research was to investigate genetic diversity, population structure, and virulence on sunflower of O. cumana populations parasitizing wild plants in eastern Bulgaria. Fresh tissue of eight O. cumana populations and mature seeds of four of them were collected in situ on wild hosts. Genetic diversity and population structure were studied with SSR markers and compared to weedy populations. Two main gene pools were identified in Bulgarian populations, with most of the populations having intermediate characteristics. Cross-inoculation experiments revealed that O. cumana populations collected on wild species possessed similar ability to parasitize sunflower to those collected on sunflower. The results were explained on the basis of an effective genetic exchange between populations parasitizing sunflower crops and those parasitizing wild species. The occurrence of bidirectional gene flow may have an impact on wild populations, as new physiological races continuously emerge in weedy populations. Also, genetic variability of wild populations may favour the ability of weedy populations to overcome sunflower resistance mechanisms. PMID:25143963

  17. Bartonella clarridgeiae and Bartonella vinsonii subsp. berkhoffii exposure in captive wild canids in Brazil.

    Science.gov (United States)

    Fleischman, D A; Chomel, B B; Kasten, R W; André, M R; Gonçalves, L R; Machado, R Z

    2015-02-01

    SUMMARY Wild canids are potential hosts for numerous species of Bartonella, yet little research has been done to quantify their infection rates in South America. We sought to investigate Bartonella seroprevalence in captive wild canids from 19 zoos in São Paulo and Mato Grosso states, Brazil. Blood samples were collected from 97 wild canids belonging to four different native species and three European wolves (Canis lupus). Indirect immunofluorescent antibody testing was performed to detect the presence of B. henselae, B. vinsonii subsp. berkhoffii, B. clarridgeiae, and B. rochalimae. Overall, Bartonella antibodies were detected in 11 of the canids, including five (12·8%) of 39 crab-eating foxes (Cerdocyon thous), three (11·1%) of 27 bush dogs (Speothos venaticus), two (8·7%) of 23 maned wolves (Chrysocyon brachyurus) and one (12·5%) of eight hoary foxes (Lycalopex vetulus), with titres ranging from 1:64 to 1:512. Knowing that many species of canids make excellent reservoir hosts for Bartonella, and that there is zoonotic potential for all Bartonella spp. tested for, it will be important to conduct further research in non-captive wild canids to gain an accurate understanding of Bartonella infection in free-ranging wild canids in South America.

  18. Wild canids as sentinels of ecological health: a conservation medicine perspective.

    Science.gov (United States)

    Aguirre, A Alonso

    2009-03-26

    The extinction of species across the globe is accelerating, directly or indirectly due to human activities. Biological impoverishment, habitat fragmentation, climate change, increasing toxification, and the rapid global movement of people and other living organisms have worked synergistically to diminish ecosystem function. This has resulted in unprecedented levels of disease emergence, driven by human-induced environmental degradation, which poses a threat to the survival and health of biodiversity. The emerging discipline of conservation medicine addresses these concerns through the following entities: humans; global climate; habitat destruction and alteration; biodiversity, including wildlife populations; domestic animals; and pathogens, parasites and pollutants. Furthermore, conservation medicine focuses on explicit linkages between these entities. As a crisis discipline, the usefulness of conservation medicine ultimately will depend on its applicability to solving problems. The perspectives and scientific findings of conservation medicine provide input into biomedical education; and policy and management of ecosystems, habitats and imperiled species. A sentinel species is one that has presented itself, or has been selected, to provide insight into the state (health) of an ecosystem, based on user-defined (e.g., researchers, conservationists or policymakers) objectives (e.g., disease, parasites, toxics, climate change, habitat destruction), coupled with the utility and vulnerability of this species to the perceived stress. The scientific information generated by the sentinel species should empower stakeholders and decision-makers to take mitigative action or support predictive capabilities; the "utility" of the species selected should consider its value and relevance to conservationists and to society at large (e.g., education and outreach; social sciences). Wild canids may serve as excellent sentinel species of emerging canine vector-borne diseases. Several

  19. Endophytic Colonization and In Planta Nitrogen Fixation by a Herbaspirillum sp. Isolated from Wild Rice Species

    Science.gov (United States)

    Elbeltagy, Adel; Nishioka, Kiyo; Sato, Tadashi; Suzuki, Hisa; Ye, Bin; Hamada, Toru; Isawa, Tsuyoshi; Mitsui, Hisayuki; Minamisawa, Kiwamu

    2001-01-01

    Nitrogen-fixing bacteria were isolated from the stems of wild and cultivated rice on a modified Rennie medium. Based on 16S ribosomal DNA (rDNA) sequences, the diazotrophic isolates were phylogenetically close to four genera: Herbaspirillum, Ideonella, Enterobacter, and Azospirillum. Phenotypic properties and signature sequences of 16S rDNA indicated that three isolates (B65, B501, and B512) belong to the Herbaspirillum genus. To examine whether Herbaspirillum sp. strain B501 isolated from wild rice, Oryza officinalis, endophytically colonizes rice plants, the gfp gene encoding green fluorescent protein (GFP) was introduced into the bacteria. Observations by fluorescence stereomicroscopy showed that the GFP-tagged bacteria colonized shoots and seeds of aseptically grown seedlings of the original wild rice after inoculation of the seeds. Conversely, for cultivated rice Oryza sativa, no GFP fluorescence was observed for shoots and only weak signals were observed for seeds. Observations by fluorescence and electron microscopy revealed that Herbaspirillum sp. strain B501 colonized mainly intercellular spaces in the leaves of wild rice. Colony counts of surface-sterilized rice seedlings inoculated with the GFP-tagged bacteria indicated significantly more bacterial populations inside the original wild rice than in cultivated rice varieties. Moreover, after bacterial inoculation, in planta nitrogen fixation in young seedlings of wild rice, O. officinalis, was detected by the acetylene reduction and 15N2 gas incorporation assays. Therefore, we conclude that Herbaspirillum sp. strain B501 is a diazotrophic endophyte compatible with wild rice, particularly O. officinalis. PMID:11679357

  20. Newly Identified Wild Rice Accessions Conferring High Salt Tolerance Might Use a Tissue Tolerance Mechanism in Leaf

    Science.gov (United States)

    Prusty, Manas R.; Kim, Sung-Ryul; Vinarao, Ricky; Entila, Frederickson; Egdane, James; Diaz, Maria G. Q.; Jena, Kshirod K.

    2018-01-01

    Cultivated rice (Oryza sativa L.) is very sensitive to salt stress. So far a few rice landraces have been identified as a source of salt tolerance and utilized in rice improvement. These tolerant lines primarily use Na+ exclusion mechanism in root which removes Na+ from the xylem stream by membrane Na+ and K+ transporters, and resulted in low Na+ accumulation in shoot. Identification of a new donor source conferring high salt tolerance is imperative. Wild relatives of rice having wide genetic diversity are regarded as a potential source for crop improvement. However, they have been less exploited against salt stress. Here, we simultaneously evaluated all 22 wild Oryza species along with the cultivated tolerant lines including Pokkali, Nona Bokra, and FL478, and sensitive check varieties under high salinity (240 mM NaCl). Based on the visual salt injury score, three species (O. alta, O. latifolia, and O. coarctata) and four species (O. rhizomatis, O. eichingeri, O. minuta, and O. grandiglumis) showed higher and similar level of tolerance compared to the tolerant checks, respectively. All three CCDD genome species exhibited salt tolerance, suggesting that the CCDD genome might possess the common genetic factors for salt tolerance. Physiological and biochemical experiments were conducted using the newly isolated tolerant species together with checks under 180 mM NaCl. Interestingly, all wild species showed high Na+ concentration in shoot and low concentration in root unlike the tolerant checks. In addition, the wild-tolerant accessions showed a tendency of a high tissue tolerance in leaf, low malondialdehyde level in shoot, and high retention of chlorophyll in the young leaves. These results suggest that the wild species employ tissue tolerance mechanism to manage salt stress. Gene expression analyses of the key salt tolerance-related genes suggested that high Na+ in leaf of wild species might be affected by OsHKT1;4-mediated Na+ exclusion in leaf and the following Na

  1. Wild beans (Phaseolus L.) of North America

    Science.gov (United States)

    The wild relatives of the five domesticated species of bean (Phaseolus L.) are widely distributed across the tropics and subtropics of the New World, with taxa extending to the Canadian border, the Caribbean islands and Bermuda, the Galapagos Islands, and south to Argentina. Mesoamerica holds the la...

  2. Confronting species distribution model predictions with species functional traits.

    Science.gov (United States)

    Wittmann, Marion E; Barnes, Matthew A; Jerde, Christopher L; Jones, Lisa A; Lodge, David M

    2016-02-01

    Species distribution models are valuable tools in studies of biogeography, ecology, and climate change and have been used to inform conservation and ecosystem management. However, species distribution models typically incorporate only climatic variables and species presence data. Model development or validation rarely considers functional components of species traits or other types of biological data. We implemented a species distribution model (Maxent) to predict global climate habitat suitability for Grass Carp (Ctenopharyngodon idella). We then tested the relationship between the degree of climate habitat suitability predicted by Maxent and the individual growth rates of both wild (N = 17) and stocked (N = 51) Grass Carp populations using correlation analysis. The Grass Carp Maxent model accurately reflected the global occurrence data (AUC = 0.904). Observations of Grass Carp growth rate covered six continents and ranged from 0.19 to 20.1 g day(-1). Species distribution model predictions were correlated (r = 0.5, 95% CI (0.03, 0.79)) with observed growth rates for wild Grass Carp populations but were not correlated (r = -0.26, 95% CI (-0.5, 0.012)) with stocked populations. Further, a review of the literature indicates that the few studies for other species that have previously assessed the relationship between the degree of predicted climate habitat suitability and species functional traits have also discovered significant relationships. Thus, species distribution models may provide inferences beyond just where a species may occur, providing a useful tool to understand the linkage between species distributions and underlying biological mechanisms.

  3. Development of known-fate survival monitoring techniques for juvenile wild pigs (Sus scrofa)

    Science.gov (United States)

    David A. Keiter; John C. Kilgo; Mark A. Vukovich; Fred L. Cunningham; James C. Beasley

    2017-01-01

    Context. Wild pigs are an invasive species linked to numerous negative impacts on natural and anthropogenic ecosystems in many regions of the world. Robust estimates of juvenile wild pig survival are needed to improve population dynamics models to facilitate management of this economically and ecologically...

  4. Wildlife trade in Brazil: a closer look at wild pets welfare issues.

    Science.gov (United States)

    Kuhnen, V V; Kanaan, V T

    2014-02-01

    Wild animals have been kept as pets for centuries, in Brazil companionship is one of the main reasons why wild species are legally bred and traded. This paper is an attempt to call the attention for problems concerning the welfare of wild pets involved in the trading system in Brazil. Some issues presented are: a) the significant increase in the number of wildlife breeders and traders and the difficulties faced by of the Brazilian government in controlling this activity; b) the main welfare issues faced by breeders and owners of wild pets; and c) the destination of wild pets no longer wanted. Finally, some recommendations are made having the welfare of the animals as a priority.

  5. Variable Nitrogen Fixation in Wild Populus.

    Directory of Open Access Journals (Sweden)

    Sharon L Doty

    Full Text Available The microbiome of plants is diverse, and like that of animals, is important for overall health and nutrient acquisition. In legumes and actinorhizal plants, a portion of essential nitrogen (N is obtained through symbiosis with nodule-inhabiting, N2-fixing microorganisms. However, a variety of non-nodulating plant species can also thrive in natural, low-N settings. Some of these species may rely on endophytes, microorganisms that live within plants, to fix N2 gas into usable forms. Here we report the first direct evidence of N2 fixation in the early successional wild tree, Populus trichocarpa, a non-leguminous tree, from its native riparian habitat. In order to measure N2 fixation, surface-sterilized cuttings of wild poplar were assayed using both 15N2 incorporation and the commonly used acetylene reduction assay. The 15N label was incorporated at high levels in a subset of cuttings, suggesting a high level of N-fixation. Similarly, acetylene was reduced to ethylene in some samples. The microbiota of the cuttings was highly variable, both in numbers of cultured bacteria and in genetic diversity. Our results indicated that associative N2-fixation occurred within wild poplar and that a non-uniformity in the distribution of endophytic bacteria may explain the variability in N-fixation activity. These results point to the need for molecular studies to decipher the required microbial consortia and conditions for effective endophytic N2-fixation in trees.

  6. Wild birds learn to eavesdrop on heterospecific alarm calls.

    Science.gov (United States)

    Magrath, Robert D; Haff, Tonya M; McLachlan, Jessica R; Igic, Branislav

    2015-08-03

    Many vertebrates gain critical information about danger by eavesdropping on other species' alarm calls [1], providing an excellent context in which to study information flow among species in animal communities [2-4]. A fundamental but unresolved question is how individuals recognize other species' alarm calls. Although individuals respond to heterospecific calls that are acoustically similar to their own, alarms vary greatly among species, and eavesdropping probably also requires learning [1]. Surprisingly, however, we lack studies demonstrating such learning. Here, we show experimentally that individual wild superb fairy-wrens, Malurus cyaneus, can learn to recognize previously unfamiliar alarm calls. We trained individuals by broadcasting unfamiliar sounds while simultaneously presenting gliding predatory birds. Fairy-wrens in the experiment originally ignored these sounds, but most fled in response to the sounds after two days' training. The learned response was not due to increased responsiveness in general or to sensitization following repeated exposure and was independent of sound structure. Learning can therefore help explain the taxonomic diversity of eavesdropping and the refining of behavior to suit the local community. In combination with previous work on unfamiliar predator recognition (e.g., [5]), our results imply rapid spread of anti-predator behavior within wild populations and suggest methods for training captive-bred animals before release into the wild [6]. A remaining challenge is to assess the importance and consequences of direct association of unfamiliar sounds with predators, compared with social learning-such as associating unfamiliar sounds with conspecific alarms. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Complementary crops and landscape features sustain wild bee communities.

    Science.gov (United States)

    Martins, Kyle T; Albert, Cécile H; Lechowicz, Martin J; Gonzalez, Andrew

    2018-06-01

    Wild bees, which are important for commercial pollination, depend on floral and nesting resources both at farms and in the surrounding landscape. Mass-flowering crops are only in bloom for a few weeks and unable to support bee populations that persist throughout the year. Farm fields and orchards that flower in succession potentially can extend the availability of floral resources for pollinators. However, it is unclear whether the same bee species or genera will forage from one crop to the next, which bees specialize on particular crops, and to what degree inter-crop visitation patterns will be mediated by landscape context. We therefore studied local- and landscape-level drivers of bee diversity and species turnover in apple orchards, blueberry fields, and raspberry fields that bloom sequentially in southern Quebec, Canada. Despite the presence of high bee species turnover, orchards and small fruit fields complemented each other phenologically by supporting two bee genera essential to their pollination: mining bees (Andrena spp.) and bumble bees (Bombus spp.). A number of bee species specialized on apple, blueberry, or raspberry blossoms, suggesting that all three crops could be used to promote regional bee diversity. Bee diversity (rarefied richness, wild bee abundance) was highest across crops in landscapes containing hedgerows, meadows, and suburban areas that provide ancillary nesting and floral resources throughout the spring and summer. Promoting phenological complementarity in floral resources at the farmstead and landscape scales is essential to sustaining diverse wild bee populations. © 2018 by the Ecological Society of America.

  8. Accumulation of Heavy Metals by Wild Mushrooms in Ibadan, Nigeria

    OpenAIRE

    Chinatu Charity Ndimele; Prince Emeka Ndimele; Kanayo Stephen Chukwuka

    2017-01-01

    Background. Many companies in Nigeria generate industrial effluents, including heavy metals. These metals can be accumulated by biota such as mushrooms, which are then eaten by the populace. Objectives. The present study investigates the metal content of wild mushrooms in order to educate the local population on the safety of their consumption. Methods. Seven different species of wild mushrooms (Cortinarius melliolens, Chlorophyllum brunneum, Pleurotus florida, Volvariella speciosa, Can...

  9. Visitation by wild and managed bees (Hymenoptera: Apoidea) to eastern U.S. native plants for use in conservation programs.

    Science.gov (United States)

    Tuell, Julianna K; Fiedler, Anna K; Landis, Douglas; Isaacs, Rufus

    2008-06-01

    Addition of floral resources to agricultural field margins has been shown to increase abundance of beneficial insects in crop fields, but most plants recommended for this use are non-native annuals. Native perennial plants with different bloom periods can provide floral resources for bees throughout the growing season for use in pollinator conservation projects. To identify the most suitable plants for this use, we examined the relative attractiveness to wild and managed bees of 43 eastern U.S. native perennial plants, grown in a common garden setting. Floral characteristics were evaluated for their ability to predict bee abundance and taxa richness. Of the wild bees collected, the most common species (62%) was Bombus impatiens Cresson. Five other wild bee species were present between 3 and 6% of the total: Lasioglossum admirandum (Sandhouse), Hylaeus affinis (Smith), Agapostemon virescens (F.), Halictus ligatus Say, and Ceratina calcarata/dupla Robertson/Say. The remaining wild bee species were present at wild bees; 9 were highly attractive, and 20 were moderately attractive. Honey bees visited 24 of the 43 plant species at least once. Floral area was the only measured factor accounting for variation in abundance and richness of wild bees but did not explain variation in honey bee abundance. Results of this study can be used to guide selection of flowering plants to provide season-long forage for conservation of wild bees.

  10. Wild Edible Plants Used by the Polish Community in Misiones, Argentina.

    Science.gov (United States)

    Kujawska, Monika; Łuczaj, Łukasz

    We studied the cultural significance of wild edible plants for Eastern European migrants who settled in rural subtropical areas of South America. In 50 interviews with Polish migrants and their descendants in northern Misiones, Argentina, we recorded the use of 41 botanical species and two mushroom taxa. Different cultural significance indices were applied and sociodemographic factors such as gender, age and origin were addressed. Out of the ten most salient species, nine were fruits ( Eugenia uniflora , Eugenia involucrata , Rollinia salicifolia , Campomanesia xanthocarpa , Syagrus romanzoffiana , Allophylus edulis , Plinia peruviana , Plinia rivularis , Eugenia pyriformis ) and only one was a green vegetable ( Hypochaeris chillensis ). None of our informants reported famine foods, recreational teas or condiments. Men mentioned more wild edible species than women due to their more extensive knowledge of the forest plants growing further from settlements.

  11. DNA barcoding of wild edible mushrooms consumed by the ethnic tribes of India.

    Science.gov (United States)

    Khaund, Polashree; Joshi, S R

    2014-10-15

    Wild edible mushrooms are consumed by the tribes of Meghalaya in the North-Eastern region of India, as part of their ethnic cuisine because of their favored organoleptic characteristics and traditionally known health benefits. Majority of these mushrooms have not yet been characterized in detail and are slowly shrinking in their natural habitats owing to anthropogenic factors and climate change. In the present study, representative specimens of ten morphologically distinct groups of wild edible mushrooms available in the traditional markets and their respective forest habitats, were subjected to multi-loci molecular characterization using SSU, ITS, RPB1 and RPB2 markers. The species identities inferred for the ten mushroom types using the SSU marker matched their morphological description in the case of four morphological groups only whereas the ITS marker successfully resolved the species identity for nine out of the ten mushroom groups under study. Both the protein coding gene markers RPB1 and RPB2 successfully resolved the species identity for three out of the ten morphologically distinct groups. Finally the most likely identity of the wild edible mushrooms under study has been suggested by matching their unique morphological characteristics with the generated DNA barcoding data. The present molecular characterization reveals the ten widely consumed wild mushroom types of Meghalaya, India to be Gomphus floccosus, Lactarius deliciosus, Lactarius volemus, Cantharellus cibarius, Tricholoma viridiolivaceum, Inocybe aff. sphaerospora, Laccaria vinaceoavellanea, Albatrellus ellisii, Ramaria maculatipes and Clavulina cristata. The final species identity generated by the ITS marker matched more accurately with the morphological characteristics/appearance of the specimens indicating the ITS region as a reliable barcode for identifying wild edible mushrooms. Copyright © 2014 Elsevier B.V. All rights reserved.

  12. Cytogenetic studies and karyotype nomenclature of three wild canid species: maned wolf (Chrysocyon brachyurus), bat-eared fox (Otocyon megalotis) and fennec fox (Fennecus zerda).

    Science.gov (United States)

    Pieńkowska-Schelling, A; Schelling, C; Zawada, M; Yang, F; Bugno, M; Ferguson-Smith, M

    2008-01-01

    We have analysed the chromosomes of three wild and endangered canid species: the maned wolf (Chrysocyon brachyurus), the bat-eared fox (Otocyon megalotis) and the fennec fox (Fennecuszerda) using classical and molecular cytogenetic methods. For the first time detailed and encompassing descriptions of the chromosomes are presented including the chromosomal assignment of nucleolar organizer regions and the 5S rRNA gene cluster. We propose a karyotype nomenclature with ideograms including more than 300 bands per haploid set for each of these three species which will form the basis for further research. In addition, we propose four basic different patterns of karyotype organization in the family Canidae. A comparison of these patterns with the most recent molecular phylogeny of Canidae revealed that the karyotype evolution of a species is not always strongly connected with its phylogenetic position. Our findings underline the need and justification for basic cytogenetic work in rare and exotic species. (c) 2008 S. Karger AG, Basel.

  13. Epidemiological study of the intestinal helminths of wild boar (Sus scrofa) and mouflon (Ovis gmelini musimon) in central Italy.

    Science.gov (United States)

    Magi, M; Bertani, M; Dell'Omodarme, M; Prati, M C

    2002-12-01

    Since 1995 the population of wild ungulates increased significantly in the "Parco provinciale dei Monti Livornesi" (Livorno, Tuscany, Central Italy). We studied the intestinal macroparasites of two hosts, the wild boar (Sus scrofa) and the mouflon (Ovis gmelini musimon). In the case of wild boars we found a dominant parasite species, Globocephalus urosubulatus. For this parasite the frequency distribution of the number of parasites per host agrees with a negative binomial distribution. There is not a significant correlation between the age of the animals and the parasitosis. Furthermore the mean parasite burden of male and female wild boars does not differ significantly. In the case of mouflons we found a dominant parasite species Nematodirus filicollis with Trichuris ovis as codominant species.

  14. Genome size, cytogenetic data and transferability of EST-SSRs markers in wild and cultivated species of the genus Theobroma L. (Byttnerioideae, Malvaceae)

    Science.gov (United States)

    da Silva, Rangeline Azevedo; Souza, Gustavo; Lemos, Lívia Santos Lima; Lopes, Uilson Vanderlei; Patrocínio, Nara Geórgia Ribeiro Braz; Alves, Rafael Moysés; Marcellino, Lucília Helena; Clement, Didier; Micheli, Fabienne

    2017-01-01

    The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR) of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI− bands). The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC) ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted. PMID:28187131

  15. Genome size, cytogenetic data and transferability of EST-SSRs markers in wild and cultivated species of the genus Theobroma L. (Byttnerioideae, Malvaceae.

    Directory of Open Access Journals (Sweden)

    Rangeline Azevedo da Silva

    Full Text Available The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI- bands. The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted.

  16. Market tntegration between farmed and wild fish

    DEFF Research Database (Denmark)

    Bronnmann, Julia; Ankamah-Yeboah, Isaac; Nielsen, Max

    2016-01-01

    Following decade-long growth in worldwide farming of pangasius and tilapia, imports to Germany, a main European market, have been reduced since 2010. One reason for this might be supply growth of wild species at the total German whitefish market, if market integration exists between farmed and wi...

  17. Presence of Vaccine-Derived Newcastle Disease Viruses in Wild Birds.

    Directory of Open Access Journals (Sweden)

    Andrea J Ayala

    Full Text Available Our study demonstrates the repeated isolation of vaccine-derived Newcastle disease viruses from different species of wild birds across four continents from 1997 through 2014. The data indicate that at least 17 species from ten avian orders occupying different habitats excrete vaccine-derived Newcastle disease viruses. The most frequently reported isolates were detected among individuals in the order Columbiformes (n = 23, followed in frequency by the order Anseriformes (n = 13. Samples were isolated from both free-ranging (n = 47 and wild birds kept in captivity (n = 7. The number of recovered vaccine-derived viruses corresponded with the most widely utilized vaccines, LaSota (n = 28 and Hitchner B1 (n = 19. Other detected vaccine-derived viruses resembled the PHY-LMV2 and V4 vaccines, with five and two cases, respectively. These results and the ubiquitous and synanthropic nature of wild pigeons highlight their potential role as indicator species for the presence of Newcastle disease virus of low virulence in the environment. The reverse spillover of live agents from domestic animals to wildlife as a result of the expansion of livestock industries employing massive amounts of live virus vaccines represent an underappreciated and poorly studied effect of human activity on wildlife.

  18. Presence of Vaccine-Derived Newcastle Disease Viruses in Wild Birds

    Science.gov (United States)

    Ayala, Andrea J.; Dimitrov, Kiril M.; Becker, Cassidy R.; Goraichuk, Iryna V.; Arns, Clarice W.; Bolotin, Vitaly I.; Ferreira, Helena L.; Gerilovych, Anton P.; Goujgoulova, Gabriela V.; Martini, Matheus C.; Muzyka, Denys V.; Orsi, Maria A.; Scagion, Guilherme P.; Silva, Renata K.; Solodiankin, Olexii S.; Stegniy, Boris T.; Miller, Patti J.; Afonso, Claudio L.

    2016-01-01

    Our study demonstrates the repeated isolation of vaccine-derived Newcastle disease viruses from different species of wild birds across four continents from 1997 through 2014. The data indicate that at least 17 species from ten avian orders occupying different habitats excrete vaccine-derived Newcastle disease viruses. The most frequently reported isolates were detected among individuals in the order Columbiformes (n = 23), followed in frequency by the order Anseriformes (n = 13). Samples were isolated from both free-ranging (n = 47) and wild birds kept in captivity (n = 7). The number of recovered vaccine-derived viruses corresponded with the most widely utilized vaccines, LaSota (n = 28) and Hitchner B1 (n = 19). Other detected vaccine-derived viruses resembled the PHY-LMV2 and V4 vaccines, with five and two cases, respectively. These results and the ubiquitous and synanthropic nature of wild pigeons highlight their potential role as indicator species for the presence of Newcastle disease virus of low virulence in the environment. The reverse spillover of live agents from domestic animals to wildlife as a result of the expansion of livestock industries employing massive amounts of live virus vaccines represent an underappreciated and poorly studied effect of human activity on wildlife. PMID:27626272

  19. Seroepidemiologic survey for Chlamydia suis in wild boar (Sus scrofa) populations in Italy.

    Science.gov (United States)

    Di Francesco, Antonietta; Donati, Manuela; Morandi, Federico; Renzi, Maria; Masia, Marco Antonio; Ostanello, Fabio; Salvatore, Daniela; Cevenini, Roberto; Baldelli, Raffaella

    2011-07-01

    We used serology to estimate the prevalence of exposure to chlamydiae in Italian populations of wild boars (Sus scrofa). Sera from 173 hunter-killed wild boars harvested during the 2006-2009 hunting seasons in three Italian regions were tested for antibodies to Chlamydia suis, Chlamydophila pecorum, Chlamydophila abortus, and Chlamydophila psittaci by the microimmunofluorescence test. Antibody titers to chlamydiae ≥ 1:32 were detected in 110 of the 173 samples tested (63.6%). Specific reactivity could be assessed only in 44 sera with antibody titers to C. suis that were two- to threefold higher than antibody titers against the other chlamydial species; the other 66 sera had similar reactivity against all the chlamydia species tested. Antibody to C. suis was detected in sera from wild boar populations with rare or no known contact with domestic pigs. These results suggest that the wild boar could be a chlamydia reservoir and may acquire chlamydiae independent of contacts with the domestic pig.

  20. Genome Sequences of Oryza Species

    KAUST Repository

    Kumagai, Masahiko

    2018-02-14

    This chapter summarizes recent data obtained from genome sequencing, annotation projects, and studies on the genome diversity of Oryza sativa and related Oryza species. O. sativa, commonly known as Asian rice, is the first monocot species whose complete genome sequence was deciphered based on physical mapping by an international collaborative effort. This genome, along with its accurate and comprehensive annotation, has become an indispensable foundation for crop genomics and breeding. With the development of innovative sequencing technologies, genomic studies of O. sativa have dramatically increased; in particular, a large number of cultivars and wild accessions have been sequenced and compared with the reference rice genome. Since de novo genome sequencing has become cost-effective, the genome of African cultivated rice, O. glaberrima, has also been determined. Comparative genomic studies have highlighted the independent domestication processes of different rice species, but it also turned out that Asian and African rice share a common gene set that has experienced similar artificial selection. An international project aimed at constructing reference genomes and examining the genome diversity of wild Oryza species is currently underway, and the genomes of some species are publicly available. This project provides a platform for investigations such as the evolution, development, polyploidization, and improvement of crops. Studies on the genomic diversity of Oryza species, including wild species, should provide new insights to solve the problem of growing food demands in the face of rapid climatic changes.

  1. Genome Sequences of Oryza Species

    KAUST Repository

    Kumagai, Masahiko; Tanaka, Tsuyoshi; Ohyanagi, Hajime; Hsing, Yue-Ie C.; Itoh, Takeshi

    2018-01-01

    This chapter summarizes recent data obtained from genome sequencing, annotation projects, and studies on the genome diversity of Oryza sativa and related Oryza species. O. sativa, commonly known as Asian rice, is the first monocot species whose complete genome sequence was deciphered based on physical mapping by an international collaborative effort. This genome, along with its accurate and comprehensive annotation, has become an indispensable foundation for crop genomics and breeding. With the development of innovative sequencing technologies, genomic studies of O. sativa have dramatically increased; in particular, a large number of cultivars and wild accessions have been sequenced and compared with the reference rice genome. Since de novo genome sequencing has become cost-effective, the genome of African cultivated rice, O. glaberrima, has also been determined. Comparative genomic studies have highlighted the independent domestication processes of different rice species, but it also turned out that Asian and African rice share a common gene set that has experienced similar artificial selection. An international project aimed at constructing reference genomes and examining the genome diversity of wild Oryza species is currently underway, and the genomes of some species are publicly available. This project provides a platform for investigations such as the evolution, development, polyploidization, and improvement of crops. Studies on the genomic diversity of Oryza species, including wild species, should provide new insights to solve the problem of growing food demands in the face of rapid climatic changes.

  2. A comparison of brain gene expression levels in domesticated and wild animals.

    Directory of Open Access Journals (Sweden)

    Frank W Albert

    2012-09-01

    Full Text Available Domestication has led to similar changes in morphology and behavior in several animal species, raising the question whether similarities between different domestication events also exist at the molecular level. We used mRNA sequencing to analyze genome-wide gene expression patterns in brain frontal cortex in three pairs of domesticated and wild species (dogs and wolves, pigs and wild boars, and domesticated and wild rabbits. We compared the expression differences with those between domesticated guinea pigs and a distant wild relative (Cavia aperea as well as between two lines of rats selected for tameness or aggression towards humans. There were few gene expression differences between domesticated and wild dogs, pigs, and rabbits (30-75 genes (less than 1% of expressed genes were differentially expressed, while guinea pigs and C. aperea differed more strongly. Almost no overlap was found between the genes with differential expression in the different domestication events. In addition, joint analyses of all domesticated and wild samples provided only suggestive evidence for the existence of a small group of genes that changed their expression in a similar fashion in different domesticated species. The most extreme of these shared expression changes include up-regulation in domesticates of SOX6 and PROM1, two modulators of brain development. There was almost no overlap between gene expression in domesticated animals and the tame and aggressive rats. However, two of the genes with the strongest expression differences between the rats (DLL3 and DHDH were located in a genomic region associated with tameness and aggression, suggesting a role in influencing tameness. In summary, the majority of brain gene expression changes in domesticated animals are specific to the given domestication event, suggesting that the causative variants of behavioral domestication traits may likewise be different.

  3. Helminth parasites of wild boar, Sus scrofa, in Iran.

    Science.gov (United States)

    Eslami, A; Farsad-Hamdi, S

    1992-04-01

    Fifty-seven wild boars (Sus scrofa) from protected regions of Iran were examined for helminths. Sixteen species of helminths were collected; there were ten nematodes, one acanthocephalan, two trematodes and three larval cestodes. New host and distribution records were established for all helminths except of Taenia solium cysticerci. Wild boar shared nine of these helminths with domestic pigs, six with ruminants and three with human beings in Iran. Metastrongylus pudendotectus and M. salmi are reported for the first time from Iran.

  4. Molecular evidence for piroplasms in wild Reeves' muntjac (Muntiacus reevesi) in China.

    Science.gov (United States)

    Yang, Ji-fei; Li, You-quan; Liu, Zhi-jie; Liu, Jun-long; Guan, Gui-quan; Chen, Ze; Luo, Jian-xun; Wang, Xiao-long; Yin, Hong

    2014-10-01

    DNA from liver samples of 17 free-ranging wild Reeves' muntjac (Muntiacus reevesi) was used for PCR amplification of piropalsm 18S rRNA gene. Of 17 samples, 14 (82.4%) showed a specific PCR product which were cloned and sequenced. BLAST analysis of the sequences obtained showed similarities to Babesia sp., Theileria capreoli, Theileria uilenbergi and Theileria sp. BO302-SE. Phylogenetic analysis showed that the Babesia sp. detected in the present study was distantly separated from known Babesia species of wild and domestic animals. Six sequences showed 100% similarity to T. capreoli while five sequences were separated from all known Theileria species and constituted an independent clade with Theileria sp. BO302-SE derived from roe deer in Italy; two sequences were close to T. uilenbergi with 97% similarity. This is the first description of hemoparasite infection in free-ranging wild Reeves' muntjac in China. Our results indicate that wild Reeves' muntjac may play an important reservoir role for hemoparasites. Crown Copyright © 2014. Published by Elsevier Ireland Ltd. All rights reserved.

  5. Indigenous knowledge for plant species diversity: a case study of wild plants' folk names used by the Mongolians in Ejina desert area, Inner Mongolia, P. R. China

    Directory of Open Access Journals (Sweden)

    Soyolt

    2008-01-01

    Full Text Available Abstract Folk names of plants are the roots of traditional plant biodiversity knowledge. This paper mainly records and analyses the wild plant folk names of the Mongolians in the Ejina desert area based on a field survey for collection and identification of voucher specimens. The results show that a total of 121 folk names of local plants have correspondence with 93 scientific species which belong to 26 families and 70 genera. The correspondence between plants' Mongol folk names and scientific species may be classified as one to one correspondence, multitude to one correspondence and one to multitude correspondence. The Ejina Mongolian plant folk names were formed on the basis of observations and an understanding of the wild plants growing in their desert environment. The high correspondence between folk names and scientific names shows the scientific meaning of folk botanical nomenclature and classification. It is very useful to take an inventory of biodiversity, especially among the rapid rural appraisal (RRA in studying biodiversity at the community level.

  6. Phylogeny and biogeography of North-American wild rice (Zizania L.Poaceae)

    Science.gov (United States)

    The wild-rice genus Zizania includes four species disjunctly distributed in eastern Asia and North America, with three species (Z. aquatica, Z. palustris, and Z. texana) in North America and one (Z. latifolia) in eastern Asia. The phylogeny and biogeography of Zizania were explored using sequences o...

  7. Taxonomic and functional trait diversity of wild bees in different urban settings

    Directory of Open Access Journals (Sweden)

    Étienne Normandin

    2017-03-01

    Full Text Available Urbanization is one of the major anthropogenic processes contributing to local habitat loss and extirpation of numerous species, including wild bees, the most widespread pollinators. Little is known about the mechanisms through which urbanization impacts wild bee communities, or the types of urban green spaces that best promote their conservation in cities. The main objective of this study was to describe and compare wild bee community diversity, structure, and dynamics in two Canadian cities, Montreal and Quebec City. A second objective was to compare functional trait diversity among three habitat types (cemeteries, community gardens and urban parks within each city. Bees were collected using pan traps and netting on the same 46 sites, multiple times, over the active season in 2012 and 2013. A total of 32,237 specimens were identified, representing 200 species and 6 families, including two new continental records, Hylaeus communis Nylander (1852 and Anthidium florentinum (Fabricius, 1775. Despite high community evenness, we found significant abundance of diverse species, including exotic ones. Spatio-temporal analysis showed higher stability in the most urbanized city (Montreal but low nestedness of species assemblages among the three urban habitats in both cities. Our study demonstrates that cities are home to diverse communities of wild bees, but in turn affect bee community structure and dynamics. We also found that community gardens harbour high levels of functional trait diversity. Urban agriculture therefore contributes substantially to the provision of functionally diverse bee communities and possibly to urban pollination services.

  8. Phenolic content and antioxidant activity of Armenian cultivated and wild grapes

    Directory of Open Access Journals (Sweden)

    Margaryan Kristine

    2017-01-01

    Full Text Available Nowadays the mobilization and conservation of Armenian grapevine genetic resources is becoming global concern and has crucial importance. Armenia is regarded as homeland of viticulture and earliest ‘wine culture’. Being studied enough by the methods of ampelography, Armenian grapevine diversity needs to be investigated in accordance with the modern European requirements. In recent years, grape phenolics have been a theme of major scientific and applied interest. These metabolites contribute to grapes and wine sensory properties, such as color, flavor, astringency, and determines the strong antioxidant capacity. The purpose of the presented research was the evaluation of total phenolic content and antioxidant property of forty Armenian aboriginal varieties, interspecific and intraspecific hybrids and wild species with different genetic background and geographic origin. The realized research has revealed a notable difference among the cultivated varieties and wild species in the total phenolic content and antioxidant activity, increased the scientific knowledge about the aboriginal varieties and wild genotypes. Obtained results will support the importance of preserving the biological diversity and favor the reintroduction of grape cultivars and wild genotypes thanks to the present valorization.

  9. Genome-wide analysis of allele frequency change in sunflower crop-wild hybrid populations evolving under natural conditions

    Science.gov (United States)

    Hybridization is known to occur between cultivated and wild populations of numerous plant species. This represents a major mechanism by which a wild population’s genetic structure and evolutionary dynamics could be altered. Studying crop-derived alleles in wild populations is also relevant to assess...

  10. MONITORING OF WILD BEES IN POSTINDUSTRIAL WASTELANDS IN THE KUJAWY REGION

    Directory of Open Access Journals (Sweden)

    Lucyna Twerd

    2017-04-01

    Full Text Available Species diversity of pollinating insects was studied in areas affected by soda and lime industry in the Kujawy region (central Poland. Environmental monitoring was conducted near 3 industrial plants related to lime processing: Soda-Mątwy S.A. in Inowrocław, Janiksoda S.A. in Janikowo, and Trzuskawica S.A. in Bielawy. We recorded there 183 species of wild bees (Hymenoptera: Apoidea: Apiformes. The species that are widespread in the study area, i.e. common to all the 3 localities, accounted for about 50%, while those observed only locally, i.e. associated with only 1 industrial area, accounted for 25%. In the analysed period (2007-2010, we confirmed the occurrence of most of the species recorded: 78% in the areas affected by soda industry and 55% in those affected by lime industry. The presented results indicate that, surprisingly, postindustrial wastelands (including human-made and strongly degraded habitats can create favourable conditions for stable populations of many species of insects, also of the monitored wild bees.

  11. Decreasing abundance, increasing diversity and changing structure of the wild bee community (Hymenoptera: Anthophila along an urbanization gradient.

    Directory of Open Access Journals (Sweden)

    Laura Fortel

    Full Text Available Wild bees are important pollinators that have declined in diversity and abundance during the last decades. Habitat destruction and fragmentation associated with urbanization are reported as part of the main causes of this decline. Urbanization involves dramatic changes of the landscape, increasing the proportion of impervious surface while decreasing that of green areas. Few studies have investigated the effects of urbanization on bee communities. We assessed changes in the abundance, species richness, and composition of wild bee community along an urbanization gradient.Over two years and on a monthly basis, bees were sampled with colored pan traps and insect nets at 24 sites located along an urbanization gradient. Landscape structure within three different radii was measured at each study site. We captured 291 wild bee species. The abundance of wild bees was negatively correlated with the proportion of impervious surface, while species richness reached a maximum at an intermediate (50% proportion of impervious surface. The structure of the community changed along the urbanization gradient with more parasitic species in sites with an intermediate proportion of impervious surface. There were also greater numbers of cavity-nesting species and long-tongued species in sites with intermediate or higher proportion of impervious surface. However, urbanization had no effect on the occurrence of species depending on their social behavior or body size.We found nearly a third of the wild bee fauna known from France in our study sites. Indeed, urban areas supported a diverse bee community, but sites with an intermediate level of urbanization were the most speciose ones, including greater proportion of parasitic species. The presence of a diverse array of bee species even in the most urbanized area makes these pollinators worthy of being a flagship group to raise the awareness of urban citizens about biodiversity.

  12. Decreasing abundance, increasing diversity and changing structure of the wild bee community (Hymenoptera: Anthophila) along an urbanization gradient.

    Science.gov (United States)

    Fortel, Laura; Henry, Mickaël; Guilbaud, Laurent; Guirao, Anne Laure; Kuhlmann, Michael; Mouret, Hugues; Rollin, Orianne; Vaissière, Bernard E

    2014-01-01

    Wild bees are important pollinators that have declined in diversity and abundance during the last decades. Habitat destruction and fragmentation associated with urbanization are reported as part of the main causes of this decline. Urbanization involves dramatic changes of the landscape, increasing the proportion of impervious surface while decreasing that of green areas. Few studies have investigated the effects of urbanization on bee communities. We assessed changes in the abundance, species richness, and composition of wild bee community along an urbanization gradient. Over two years and on a monthly basis, bees were sampled with colored pan traps and insect nets at 24 sites located along an urbanization gradient. Landscape structure within three different radii was measured at each study site. We captured 291 wild bee species. The abundance of wild bees was negatively correlated with the proportion of impervious surface, while species richness reached a maximum at an intermediate (50%) proportion of impervious surface. The structure of the community changed along the urbanization gradient with more parasitic species in sites with an intermediate proportion of impervious surface. There were also greater numbers of cavity-nesting species and long-tongued species in sites with intermediate or higher proportion of impervious surface. However, urbanization had no effect on the occurrence of species depending on their social behavior or body size. We found nearly a third of the wild bee fauna known from France in our study sites. Indeed, urban areas supported a diverse bee community, but sites with an intermediate level of urbanization were the most speciose ones, including greater proportion of parasitic species. The presence of a diverse array of bee species even in the most urbanized area makes these pollinators worthy of being a flagship group to raise the awareness of urban citizens about biodiversity.

  13. How much does it cost to look like a pig in a wild boar group?

    DEFF Research Database (Denmark)

    Batocchio, Daniele; Iacolina, Laura; Canu, Antonio

    2017-01-01

    Hybridization between domestic and wild species is known to widely occur and it is reported to be oneof the major causes of the current biodiversity crisis. Despite this, poor attention has been deserved tothe behavioural ecology of hybrids, in particular in relation to their social behaviour. We...... carried out acamera trap study to assess whether phenotypically anomalous colouration in wild boar, i.e. potentiallyintrogressed with domestic pigs, affected the hierarchical structure of wild boar social groups. Chromat-ically anomalous wild boars (CAWs) were detected in 32 out of 531 wild boar videos...

  14. Chromosomal characterization of the three subgenomes in the polyploids of Hordeum murinum L.: new insight into the evolution of this complex.

    Directory of Open Access Journals (Sweden)

    Ángeles Cuadrado

    Full Text Available Hordeum murinum L. is a species complex composed of related taxa, including the subspecies glaucum, murinum and leporinum. However, the phylogenetic relationships between the different taxa and their cytotypes, and the origin of the polyploid forms, remain points of controversy. The present work reports a comparative karyotype analysis of seven accessions of the H. murinum complex representing all subspecies and cytotypes. The karyotypes were determined by examining the distribution of the repetitive Triticeae DNA sequences pTa71, pTa794, pSc119.2, pAs1 and pHch950, the simple sequence repeats (SSRs (AG10, (AAC5, (AAG5, (ACT5, (ATC5, and (CCCTAAA3 via in situ hybridization. The chromosomes of the three subgenomes involved in the polyploids were identified. All tetraploids of all subspecies shared the same two subgenomes (thus suggesting them to in fact belong to the same taxon, the result of hybridization between two diploid ancestors. One of the subgenomes present in all tetraploids of all subspecies was found to be very similar (though not identical to the chromosome complement of the diploid glaucum. The hexaploid form of leporinum came about through a cross between a tetraploid and a third diploid form. Exclusively bivalent associations among homologous chromosomes were observed when analyzing pollen mother cells of tetraploid taxa. In conclusion, the present results identify all the individual chromosomes within the H. murinum complex, reveal its genome structure and phylogeny, and explain the appearance of the different cytotypes. Three cryptic species are proposed according to ploidy level that may deserve full taxonomic recognition.

  15. Comparison of foliar anatomy of ten bread wheat (triticum, poaceae) and ten barley (hordeum, poaceae) cultivars

    International Nuclear Information System (INIS)

    Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.

    2015-01-01

    The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)

  16. Variability of chloroplast DNA and nuclear ribosomal DNA in cassava (Manihot esculenta Crantz) and its wild relatives.

    Science.gov (United States)

    Fregene, M A; Vargas, J; Ikea, J; Angel, F; Tohme, J; Asiedu, R A; Akoroda, M O; Roca, W M

    1994-11-01

    Chloroplast DNA (cp) and nuclear ribosomal DNA (rDNA) variation was investigated in 45 accessions of cultivated and wild Manihot species. Ten independent mutations, 8 point mutations and 2 length mutations were identified, using eight restriction enzymes and 12 heterologous cpDNA probes from mungbean. Restriction fragment length polymorphism analysis defined nine distinct chloroplast types, three of which were found among the cultivated accessions and six among the wild species. Cladistic analysis of the cpDNA data using parsimony yielded a hypothetical phylogeny of lineages among the cpDNAs of cassava and its wild relatives that is congruent with morphological evolutionary differentiation in the genus. The results of our survey of cpDNA, together with rDNA restriction site change at the intergenic spacer region and rDNA repeat unit length variation (using rDNA cloned fragments from taro as probe), suggest that cassava might have arisen from the domestication of wild tuberous accessions of some Manihot species, followed by intensive selection. M. esculenta subspp flabellifolia is probably a wild progenitor. Introgressive hybridization with wild forms and pressures to adapt to the widely varying climates and topography in which cassava is found might have enhanced the crop's present day variability.

  17. A study of single nucleotide polymorphism in the ystB gene of Yersinia enterocolitica strains isolated from various wild animal species.

    Science.gov (United States)

    Bancerz-Kisiel, Agata; Szczerba-Turek, Anna; Platt-Samoraj, Aleksandra; Michalczyk, Maria; Szweda, Wojciech

    2017-03-01

    Y. enterocolitica is the causative agent of yersiniosis. The objective of the article was a study of single nucleotide polymorphism in the ystB gene of Y. enterocolitica strains isolated from various wild animal species. High-resolution melting (HRM) analysis was applied to identify single nucleotide polymorphism (SNP) of ystB gene fragments of 88 Y. enterocolitica biotype 1A strains isolated from wild boar, roe deer, red deer and wild ducks. HRM analysis revealed 14 different melting profiles - 4 of them were defined as regular genotypes (G1, G2, G3, G4), whereas 10 as variations. 24 of the examined Y. enterocolitica strains were classified as G1, 18 strains as a G2, 21 strains as a G3, and 15 strains as a G4. Nucleotide sequences classified as G1 revealed 100% similarity with the Y. enterocolitica D88145.1 sequence (NCBI). Analysis of G2 revealed one point mutation - transition T111A. One mutation was also found in G3, but SNP was placed in a different gene region - transition G193A. Two SNPs - transitions G92C and T111A - were identified in G4. Direct sequencing of 10 variations revealed 5 new variants of the ystB nucleotide sequence: V1 - transition G129A (3 strains); V2 - transitions T111A and G193A (2 strains); V3 - transitions C118T and G193A (1 strain); V4 - transitions C141A and G193A (2 strains); and V5 characterized by 19 SNPs: G83A, T93A, A109G, G114T, C116T, A123G, T134C, T142G, T144C, A150C, G162A, T165G, T170G, T174A, T177G, G178A, A179G, A184G and G193A (2 strains). The predominant genotype in isolates from wild ducks was G1; in red deer G2; in wild boar G3; in roe deer G1 and G4. The proposed HRM method could be used to analyze Y. enterocolitica biotype 1A strains isolated from different sources, including humans.

  18. Eight new species of Andrena Fabricius (Hymenoptera: Apoidea: Andrenidae) from Israel-a Mediterranean hotspot for wild bees.

    Science.gov (United States)

    Pisanty, Gideon; Scheuchl, Erwin; Dorchin, Netta

    2016-11-10

    More than 150 solitary bee species of the genus Andrena Fabricius are known from Israel and the West Bank, where they are distributed along a broad climatic gradient and diverse habitats and vegetation types. Extensive collecting throughout Israel in recent years has yielded eight new species and one new subspecies, adding to the rich bee fauna of the region:   A. crocusella Pisanty & Scheuchl n. sp., A. danini Pisanty & Scheuchl n. sp., A. hermonella Scheuchl & Pisanty n. sp., A. israelica Scheuchl & Pisanty n. sp., A. judaea Scheuchl & Pisanty n. sp., A. menahemella Scheuchl & Pisanty n. sp., A. palaestina Pisanty & Scheuchl n. sp., A. perahia Pisanty & Scheuchl n. sp., and A. sphecodimorpha mediterranea Pisanty & Scheuchl n. ssp. The previously unknown female of A. fimbriatoides Scheuchl 2004 and male of A. wolfi Gusenleitner & Scheuchl 2000 are also described here for the first time. The discovery of males of A. wolfi lead us to reinstate A. iohannescaroli Nobile 2000 as a valid taxon. Detailed morphological description and differential diagnosis against closest relatives are provided for all species, as well as information on the distribution, phenology and flower visitation, when available. A neotype is designated for A. sphecodimorpha Hedicke, the holotype of which is considered to be lost. Additional collecting efforts in diverse habitats and seasons, incorporating diverse collecting techniques, are required in order to deepen our knowledge of the rich bee fauna in threatened habitats in the Mediterranean Basin, which constitutes one of the world's major hotspots for wild bees.

  19. Genealogy, morphology and fitness of spontaneous hybrids between wild and cultivated chicory (Cichorium intybus)

    DEFF Research Database (Denmark)

    Kiær, Lars Pødenphant; Philipp, M.; Bagger Jørgensen, Rikke

    2007-01-01

    Crop species are known to hybridize spontaneously with wild relatives, but few studies have characterized the performance of hybrids at various genealogies, life stages and environments. A group of cultivar-like individuals and potential hybrids were observed in a roadside population of wild chic...

  20. Captive-rearing piping plovers: Developing techniques to augment wild populations

    Science.gov (United States)

    Powell, A.N.; Cuthbert, F.J.; Wemmer, L.C.; Doolittle, A.W.; Feirer, S.T.

    1997-01-01

    Techniques for captive-rearing and releasing piping plovers (Charadrius melodus) were developed using a surrogate species, killdeer (Charadrius vociferus). We compared captive-and parent-reared killdeer, and parent-reared piping plovers and determined that growth and behavior were similar. After surrogate trials determined that captive-rearing was feasible, we used the same methods to raise piping plover chicks from salvaged eggs. For captive-reared chick of both species, survival to fledging was higher than and behaviors similar to parent-reared chicks in the wild. Rearing techniques were fine-tuned, and ten piping plover fledglings were released to the wild. Based on our results, we developed recommendations for captive-rearing piping plovers using salvaged eggs to enhance productivity of small populations. ?? 1997 Wiley-Liss, Inc.

  1. From economic survival to recreation: contemporary uses of wild food and medicine in rural Sweden, Ukraine and NW Russia.

    Science.gov (United States)

    Stryamets, Nataliya; Elbakidze, Marine; Ceuterick, Melissa; Angelstam, Per; Axelsson, Robert

    2015-06-16

    There are many ethnobotanical studies on the use of wild plants and mushrooms for food and medicinal treatment in Europe. However, there is a lack of comparative ethnobotanical research on the role of non-wood forest products (NWFPs) as wild food and medicine in local livelihoods in countries with different socio-economic conditions. The aim of this study was to compare the present use of wild food and medicine in three places representing different stages of socio-economic development in Europe. Specifically we explore which plant and fungi species people use for food and medicine in three selected rural regions of Sweden, Ukraine and the Russian Federation. We studied the current use of NWFPs for food and medicine in three rural areas that represent a gradient in economic development (as indicated by the World Bank), i.e., Småland high plain (south Sweden), Roztochya (western Ukraine), and Kortkeros (Komi Republic in North West Russia). All areas were characterised by (a) predominating rural residency, (b) high forest coverage, and (c) free access to NWFPs. A total of 205 in-depth semi-structured interviews were conducted with local residents in the three study areas. The collected NWFPs data included (1) the species that are used; (2) the amount harvested, (3) uses and practices (4) changes over time, (5) sources of knowledge regarding the use of NWFPs as wild food and medicine and (6) traditional recipes. In Sweden 11 species of wild plant and fungi species were used as food, and no plant species were used for medicinal purposes. In Ukraine the present use of NWFPs included 26 wild foods and 60 medicinal species, while in Russia 36 food and 44 medicinal species were reported. In the economically less developed rural areas of Ukraine and Russia, the use of NWFPs continues to be an important part of livelihoods, both as a source of income and for domestic use as food and medicine. In Sweden the collection of wild food has become mainly a recreational activity

  2. Influence of pressure cooking on antioxidant activity of wild (Ensete superbum) and commercial banana (Musa paradisiaca var. Monthan) unripe fruit and flower.

    Science.gov (United States)

    Sasipriya, Gopalakrishnan; Maria, Cherian Lintu; Siddhuraju, Perumal

    2014-10-01

    Banana is a highly nutritious fruit crop consumed by many people's worldwide while endangered species are consumed by limited peoples and their health benefits are not explored. The unripe fruits and flowers of wild and commercial banana are consumed by peoples after cooking only. Hence, the present study was undertaken to evaluate and compare the effect of pressure cooking on antioxidant activity of wild and commercial banana species. The raw and processed samples were extracted with 70 % acetone. Except wild flower, thermal processing enhanced the content of phenolics, tannins, flavonoids, DPPH, ABTS, FRAP, hydroxyl and peroxidation activity than raw. Wild species presented higher phenolics, tannins, DPPH, ABTS and FRAP activity than commercial ones. Except few samples, wild species and commercial species exhibit similar activity in superoxide, hydroxyl and peroxidation activity. FRAP (r (2)  = 0.922; 0.977) and hydroxyl (r (2)  = 0.773; 0.744) activities were dependent on phenolics and tannin content whereas tannins may be responsible for DPPH scavenging activity (r (2)  = 0.745). Thermal processing enhanced the antioxidant activity might be due to the release of bound phenolics from cell wall and oxidation and polymerisation of compounds present in it. This wild species may be an alternative to commercial ones and will be valuable to consumers for protecting from chronic diseases.

  3. Lentinula edodes based GIS mapping, biometabolites and antiinflamatory activity of wild edible mushrooms

    Science.gov (United States)

    Khaund, Polashree; Joshi, S R

    2016-03-01

    The biodiversity rich state of Meghalaya, India located in the realms of mega-biodiversity hotspots, is home to numerous species of wild edible macrofungi that are used extensively by the mycophillic ethnic population, as a part of their traditional cuisine and medicine systems. However, habitat loss, due to deforestation and climate change, is destroying the natural population of these mushrooms, depleting their availability to the local communities. In the present investigation, a GIS guided habitat search, using Lentinula edodes as a representative species, was used in mapping the habitats of wild edible macrofungi of the study region. Sampling of around 4 000 specimens per distinct morphological type available in the traditional markets and “sacred grove” forests indicated presence of ten common genera, belonging to nine different families of wild edible mushrooms. Nutritional profiling of the representative species Lentinula edodes was carried out by evaluation of its moisture, total fat, crude protein and carbohydrates contents by standard methods. Similarly, bioactive components determination was performed by estimation of total phenols, flavonoids, ascorbic acid, β-carotene and lycopenes. Bioactivity of the mushrooms extracts was studied using the DPPH radical scavenging and Human Red Blood Cell (HRBC) membrane stabilization assays. The present investigation successfully attempted to explore remote sensing technologies and GIS (Geographic Information System) based system to predict the natural habitats of wild edible mushrooms of Meghalaya, India which we believe will lead to the generation of a mushroom specific non-wood forest resource mapping system in the near future. Results of nutritional profiling and biological activity studies on the representative species of wild edible mushrooms from the studied region revealed that it is a rich source of essential nutrients and antioxidants.

  4. PRESENCE OF TRICHINELLA BRITOVI IN WILD BOAR IN THE MARCHE REGION REGULARLY SLAUGHTERED

    Directory of Open Access Journals (Sweden)

    L. Di Giacomo

    2011-01-01

    Full Text Available Trichinellosis is a zoonotic disease caused by a nematode belonging to the genus Trichinella. Numerous mammal species as well as birds and crocodiles can harbour the parasite worldwide, but the wild cycle is mainly maintained by wild carnivores. Human represents only a possible host and the parasite is exclusively transmitted through consumption of undercooked or raw meat. In Italy, pork, wild boar meat and horse meat are the main sources for human infection. This article describe a presence of Trichinella britovi in wild boar in the Marche region regularly slaughtered. These case confirms the occurrence of Trichinella britovi in wild boar and the important role of slaughterhouse in epidemiological surveillance of zoonotic diseases.

  5. North Spain (Burgos wild mammals ectoparasites

    Directory of Open Access Journals (Sweden)

    Domínguez G.

    2004-09-01

    Full Text Available Twenty-seven species of arthropods were collected from 105 wild mammals, six wolves Canis lupus (Linnaeus, 1758 included. A total of 87 animals (82,8 % harboured some ectoparasites. Ticks were found in 60 % of the samples, fleas in 51.4 %, chewing-lice in 3.8 %, and others (Mesostigmata and hippoboscids in 3.8 %. Moreover, 42.5 % were single infestation and 57.5 % mixed. Some of the species were new records for a host in spanish country such as Trichodectes canis (De Géer, 1778, Ixodes trianguliceps (Birula, 1895, Ceralophyllus (Monopsyllus S. sciurorum (Schrank, 1803 and Paraceras melis melis (Walker, 1856 on several mammals. Two species were new records for Spain: Chaetopsylla matina (Jordan, 1925 and Archaeopsylla erinacei erinacei (Bouché, 1835.

  6. Dispersal and Transmission of Avian Paramyxovirus Serotype 4 among Wild Birds and Domestic Poultry

    Directory of Open Access Journals (Sweden)

    Renfu Yin

    2017-05-01

    Full Text Available Avian paramyxovirus serotype 4 (APMV-4 is found sporadically in wild birds worldwide, and it is an economically important poultry pathogen. Despite the existence of several published strains, very little is known about the distribution, host species, and transmission of APMV-4 strains. To better understand the relationships among these factors, we conducted an APMV-4 surveillance of wild birds and domestic poultry in six provinces of China suspected of being intercontinental flyways and sites of interspecies transmission. APMV-4 surveillance was conducted in 9,160 wild birds representing seven species, and 1,461 domestic poultry in live bird markets (LMBs from December 2013 to June 2016. The rate of APMV-4 isolation was 0.10% (11/10,621, and viruses were isolated from swan geese, bean geese, cormorants, mallards, and chickens. Sequencing and phylogenetic analyses of the 11 isolated viruses indicated that all the isolates belonging to genotype I were epidemiologically connected with wild bird-origin viruses from the Ukraine and Italy. Moreover, chicken-origin APMV-4 strains isolated from the LBMs were highly similar to wild bird-origin viruses from nearby lakes with free-living wild birds. In additional, a hemagglutination-negative APMV-4 virus was identified. These findings, together with recent APMV-4 studies, suggest potential virus interspecies transmission between wild birds and domestic poultry, and reveal possible epidemiological intercontinental connections between APMV-4 transmission by wild birds.

  7. [Leukosis in captive wild birds].

    Science.gov (United States)

    Loupal, G

    1984-10-01

    Among 2589 captive wild birds, examined between 1974 and 1983, we found leukosis in 26 birds belonging to 13 different species and five orders. We diagnosed lymphoid leukosis in 11 birds (two Melopsittacus undulatus, two Psittacus erithacus one Platycerus eximius, one Columba livia, one Streptopelia decaocto, one Polyplectron bicalcaratum, one Pavo cristatus, one Aptenodytes patachonia and one finch, species unknown), myeloid leukosis in 14 (nine Melopsittacus undulatus, two Agapomis personata fischeri, two Urgeainthus bengalus and one Neophemia pulchella) and stem cell leukosis in one bird (Serinus canaria). Among the cases with lymphoid leukosis we distinguished between lymphoblastic (four cases) and prolymphocytic forms (seven). Myeloid leukosis was subdivided into poorly differentiated (12 cases) and well differentiated myeloblastosis (two).

  8. Distributions, ex situ conservation priorities, and genetic resource potential of crop wild relatives of sweetpotato [Ipomoea batatas (L.) Lam., I. series Batatas].

    Science.gov (United States)

    Khoury, Colin K; Heider, Bettina; Castañeda-Álvarez, Nora P; Achicanoy, Harold A; Sosa, Chrystian C; Miller, Richard E; Scotland, Robert W; Wood, John R I; Rossel, Genoveva; Eserman, Lauren A; Jarret, Robert L; Yencho, G C; Bernau, Vivian; Juarez, Henry; Sotelo, Steven; de Haan, Stef; Struik, Paul C

    2015-01-01

    Crop wild relatives of sweetpotato [Ipomoea batatas (L.) Lam., I. series Batatas] have the potential to contribute to breeding objectives for this important root crop. Uncertainty in regard to species boundaries and their phylogenetic relationships, the limited availability of germplasm with which to perform crosses, and the difficulty of introgression of genes from wild species has constrained their utilization. Here, we compile geographic occurrence data on relevant sweetpotato wild relatives and produce potential distribution models for the species. We then assess the comprehensiveness of ex situ germplasm collections, contextualize these results with research and breeding priorities, and use ecogeographic information to identify species with the potential to contribute desirable agronomic traits. The fourteen species that are considered the closest wild relatives of sweetpotato generally occur from the central United States to Argentina, with richness concentrated in Mesoamerica and in the extreme Southeastern United States. Currently designated species differ among themselves and in comparison to the crop in their adaptations to temperature, precipitation, and edaphic characteristics and most species also show considerable intraspecific variation. With 79% of species identified as high priority for further collecting, we find that these crop genetic resources are highly under-represented in ex situ conservation systems and thus their availability to breeders and researchers is inadequate. We prioritize taxa and specific geographic locations for further collecting in order to improve the completeness of germplasm collections. In concert with enhanced conservation of sweetpotato wild relatives, further taxonomic research, characterization and evaluation of germplasm, and improving the techniques to overcome barriers to introgression with wild species are needed in order to mobilize these genetic resources for crop breeding.

  9. Distributions, ex situ conservation priorities, and genetic resource potential of crop wild relatives of sweetpotato [Ipomoea batatas (L. Lam., I. series Batatas

    Directory of Open Access Journals (Sweden)

    Colin Kahlil Khoury

    2015-04-01

    Full Text Available Crop wild relatives of sweetpotato [Ipomoea batatas (L. Lam., I. series Batatas] have the potential to contribute to breeding objectives for this important root crop. Uncertainty in regard to species boundaries and their phylogenetic relationships, the limited availability of germplasm with which to perform crosses, and the difficulty of introgression of genes from wild species has constrained their utilization. Here we compile geographic occurrence data on relevant sweetpotato wild relatives and produce potential distribution models for the species. We then assess the comprehensiveness of ex situ germplasm collections, contextualize these results with research and breeding priorities, and use ecogeographic information to identify species with the potential to contribute desirable agronomic traits. The fourteen species that are considered the closest wild relatives of sweetpotato generally occur from the central United States to Argentina, with richness concentrated in Mesoamerica and in the extreme southeastern United States. Currently designated species differ among themselves and in comparison to the crop in their adaptations to temperature, precipitation, and edaphic characteristics and most species also show considerable intraspecific variation. With 79% of species identified as high priority for further collecting, we find that these crop genetic resources are highly under-represented in ex situ conservation systems and thus their availability to breeders and researchers is inadequate. We prioritize taxa and specific geographic locations for further collecting in order to improve the completeness of germplasm collections. In concert with enhanced conservation of sweetpotato wild relatives, further taxonomic research, characterization and evaluation of germplasm, and improving the techniques to overcome barriers to introgression with wild species are needed in order to mobilize these genetic resources for crop breeding.

  10. Trends in Medicinal Uses of Edible Wild Vertebrates in Brazil

    Directory of Open Access Journals (Sweden)

    Rômulo Romeu Nóbrega Alves

    2017-01-01

    Full Text Available The use of food medicines is a widespread practice worldwide. In Brazil, such use is often associated with wild animals, mostly focusing on vertebrate species. Here we assessed taxonomic and ecological trends in traditional uses of wild edible vertebrates in the country, through an extensive ethnobiological database analysis. Our results showed that at least 165 health conditions are reportedly treated by edible vertebrate species (n=204, mostly fishes and mammals. However, reptiles stand out presenting a higher plasticity in the treatment of multiple health conditions. Considering the 20 disease categories recorded, treatment prescriptions were similar within continental (i.e., terrestrial and freshwater and also within coastal and marine habitats, which may reflect locally related trends in occurrence and use of the medicinal fauna. The comprehension of the multiplicity and trends in the therapeutic uses of Brazilian vertebrates is of particular interest from a conservation perspective, as several threatened species were recorded.

  11. Evolutionary and domestication history of Cucurbita (pumpkin and squash) species inferred from 44 nuclear loci.

    Science.gov (United States)

    Kates, Heather R; Soltis, Pamela S; Soltis, Douglas E

    2017-06-01

    Phylogenetics can facilitate the study of plant domestication by resolving sister relationships between crops and their wild relatives, thereby identifying the ancestors of cultivated plants. Previous phylogenetic studies of the six Cucurbita crop lineages (pumpkins and squashes) and their wild relatives suggest histories of deep coalescence that complicate uncovering the genetic origins of the six crop taxa. We investigated the evolution of wild and domesticated Cucurbita using the most comprehensive and robust molecular-based phylogeny for Cucurbita to date based on 44 loci derived from introns of single-copy nuclear genes. We discovered novel relationships among Cucurbita species and recovered the first Cucurbita tree with well-supported resolution within species. Cucurbita comprises a clade of mesophytic annual species that includes all six crop taxa and a grade of xerophytic perennial species that represent the ancestral xerophytic habit of the genus. Based on phylogenetic resolution within-species we hypothesize that the magnitude of domestication bottlenecks varies among Cucurbita crop lineages. Our phylogeny clarifies how wild Cucurbita species are related to the domesticated taxa. We find close relationships between two wild species and crop lineages not previously identified. Expanded geographic sampling of key wild species is needed for improved understanding of the evolution of domesticated Cucurbita. Copyright © 2017 Elsevier Inc. All rights reserved.

  12. Resistance genes in barley (Hordeum vulgare L.) and their identification with molecular markers.

    Science.gov (United States)

    Chełkowski, Jerzy; Tyrka, Mirosław; Sobkiewicz, Andrzej

    2003-01-01

    Current information on barley resistance genes available from scientific papers and on-line databases is summarised. The recent literature contains information on 107 major resistance genes (R genes) against fungal pathogens (excluding powdery mildew), pathogenic viruses and aphids identified in Hordeum vulgare accessions. The highest number of resistance genes was identified against Puccinia hordei, Rhynchosporium secalis, and the viruses BaYMV and BaMMV, with 17, 14 and 13 genes respectively. There is still a lot of confusion regarding symbols for R genes against powdery mildew. Among the 23 loci described to date, two regions Mla and Mlo comprise approximately 31 and 25 alleles. Over 50 R genes have already been localised and over 30 mapped on 7 barley chromosomes. Four barley R genes have been cloned recently: Mlo, Rpg1, Mla1 and Mla6, and their structures (sequences) are available. The paper presents a catalogue of barley resistance gene symbols, their chromosomalocation and the list of available DNA markers useful in characterising cultivars and breeding accessions.

  13. Colonization of wild potato plants by Streptomyces scabies

    Science.gov (United States)

    The bacterial pathogen Streptomyces scabies produces lesions on potato tubers, reducing their marketability and profitability. M6 and 524-8 are two closely related inbred diploid lines of the wild potato species Solanum chacoense. After testing in both field and greenhouse assays, it was found that ...

  14. Using tri-axial accelerometers to identify wild polar bear behaviors

    Science.gov (United States)

    Pagano, Anthony M.; Rode, Karyn D.; Cutting, A.; Owen, M.A.; Jensen, S.; Ware, J.V.; Robbins, C.T.; Durner, George M.; Atwood, Todd C.; Obbard, M.E.; Middel, K.R.; Thiemann, G.W.; Williams, T.M.

    2017-01-01

    Tri-axial accelerometers have been used to remotely identify the behaviors of a wide range of taxa. Assigning behaviors to accelerometer data often involves the use of captive animals or surrogate species, as their accelerometer signatures are generally assumed to be similar to those of their wild counterparts. However, this has rarely been tested. Validated accelerometer data are needed for polar bears Ursus maritimus to understand how habitat conditions may influence behavior and energy demands. We used accelerometer and water conductivity data to remotely distinguish 10 polar bear behaviors. We calibrated accelerometer and conductivity data collected from collars with behaviors observed from video-recorded captive polar bears and brown bears U. arctos, and with video from camera collars deployed on free-ranging polar bears on sea ice and on land. We used random forest models to predict behaviors and found strong ability to discriminate the most common wild polar bear behaviors using a combination of accelerometer and conductivity sensor data from captive or wild polar bears. In contrast, models using data from captive brown bears failed to reliably distinguish most active behaviors in wild polar bears. Our ability to discriminate behavior was greatest when species- and habitat-specific data from wild individuals were used to train models. Data from captive individuals may be suitable for calibrating accelerometers, but may provide reduced ability to discriminate some behaviors. The accelerometer calibrations developed here provide a method to quantify polar bear behaviors to evaluate the impacts of declines in Arctic sea ice.

  15. Ethnomedicinal utilization of wild edible vegetables in district harnai of balochistan province-pakistan

    International Nuclear Information System (INIS)

    Tareen, N.M.; Ahmad, M.

    2016-01-01

    Wild edible plants have a tremendous influence on human being even before civilization. These plants contain considerably high nutritional value. Present survey was conducted to explore edible wild vegetables species and their ethnomedicinal uses by the inhabitants of district Harnai, Balochistan, Pakistan. Information was obtained through informed free listing interviews with randomly selected informants and field interviews with key informants selected after free listing. A total of 59 wild edible vegetables belonging to 41 genera, 59 species and 20 plant families are used not only as vegetables and salads but treatment of various diseases The most common plant families in terms of the number of species are the Brassicaceae (10 species), Apiaceae (9 species) and Asteraceae (6 species). The most common parts of the plants used as vegetables and medicine are their leaves (44.45%) and whole plant (22.22%). Plants are often used as decoction (34%), powder (26%). Highest plants species are used for gastrointestinal diseases (45 species). Highest ICF value (0.4) was recorded for dermatological disorders category. 100% fidelity level was found for two plant species i.e., Descurainia sophia, and Caralluma tuberculata. The highest use value was reported for the Lepidium sativum (0.63). Highest RFC value was calculated for Caralluma tuberculata (0.14). Highest use report was calculated for three species Apium graveolens Lepidium sativum and Mentha longifolia, (7 UR for each). The highest FIV was calculated for family Brassicaceae (14 FIV).Our study reveals that plants are still used as a major source of food like vegetables as well as medicine for the local people. Too little or no information is available on their uses, cooking methods and nutritional and physiotherapeutic values. Necessary steps should be taken to perform phytochemical and pharmacological studies to explore the potential nutritional values and herbal drug discovery of such plants. (author)

  16. Taxonomy of Rhagoletis population associated with wild plums in Chile

    International Nuclear Information System (INIS)

    Frias, Daniel; Alvina, Andres

    2000-01-01

    In South America, there are about fifteen Rhagoletis species that live in association with wild and cultivated Solanaceae host plants (Foote 1981, Frias 1992). The principal information on taxonomy for these species is the morphology of adults. Thus, in the genus Rhagoletis, in general, there is little information about immature stages especially on first and second larva instars (Steck et al. 1990, Carrol and Wharton 1989, Steck and Wharton 1988, Persson 1963, White and Elson-Harris 1992, Hernandez-Ortiz 1992, 1993, Frias et al. 1993). Presently, in Chile, there are 4 species associated with Solanaceae host plants. R. tomatis Foote and R. nova (Schiner) are associated with cultivated Solanaceae Lycopersicum esculentum Miller or cultivated tomatoes and Solanum muricatum Aiton or sweet cucumber respectively. R. conversa Bethes has two Solanum host plants, S. nigrum L. and S. tomatillo (Remy) Phil. F. (Frias et al. 1984). The host for R. penela Foote is unknown. Moreover, in the last few years, a population on wild plums of the Myrobalan variety (Rosaceae) was detected (Gonzalez 1989). At present, there is no information about the origin and taxonomy of this population. In this work, we have studied the morphology of eggs, three instar larvae, pupae and adults of this population associated with wild plums as well as aspects of its geographical distribution in Chile

  17. Natural outbreak of Streptococcus agalactiae (GBS) infection in wild giant Queensland grouper, Epinephelus lanceolatus (Bloch), and other wild fish in northern Queensland, Australia.

    Science.gov (United States)

    Bowater, R O; Forbes-Faulkner, J; Anderson, I G; Condon, K; Robinson, B; Kong, F; Gilbert, G L; Reynolds, A; Hyland, S; McPherson, G; Brien, J O'; Blyde, D

    2012-03-01

    Ninety-three giant Queensland grouper, Epinephelus lanceolatus (Bloch), were found dead in Queensland, Australia, from 2007 to 2011. Most dead fish occurred in northern Queensland, with a peak of mortalities in Cairns in June 2008. In 2009, sick wild fish including giant sea catfish, Arius thalassinus (Rüppell), and javelin grunter, Pomadasys kaakan (Cuvier), also occurred in Cairns. In 2009 and 2010, two disease epizootics involving wild stingrays occurred at Sea World marine aquarium. Necropsy, histopathology, bacteriology and PCR determined that the cause of deaths of 12 giant Queensland grouper, three wild fish, six estuary rays, Dasyatis fluviorum (Ogilby), one mangrove whipray, Himantura granulata (Macleay), and one eastern shovelnose ray, Aptychotrema rostrata (Shaw), was Streptococcus agalactiae septicaemia. Biochemical testing of 34 S. agalactiae isolates from giant Queensland grouper, wild fish and stingrays showed all had identical biochemical profiles. The 16S rRNA gene sequences of isolates confirmed all isolates were S. agalactiae; genotyping of selected S. agalactiae isolates showed the isolates from giant Queensland grouper were serotype Ib, whereas isolates from wild fish and stingrays closely resembled serotype II. This is the first report of S. agalactiae from wild giant Queensland grouper and other wild tropical fish and stingray species in Queensland, Australia. © 2012 Blackwell Publishing Ltd and State of Queensland.

  18. Contact with domestic dogs increases pathogen exposure in endangered African wild dogs (Lycaon pictus.

    Directory of Open Access Journals (Sweden)

    Rosie Woodroffe

    Full Text Available BACKGROUND: Infectious diseases have contributed to the decline and local extinction of several wildlife species, including African wild dogs (Lycaon pictus. Mitigating such disease threats is challenging, partly because uncertainty about disease dynamics makes it difficult to identify the best management approaches. Serious impacts on susceptible populations most frequently occur when generalist pathogens are maintained within populations of abundant (often domestic "reservoir" hosts, and spill over into less abundant host species. If this is the case, disease control directed at the reservoir host might be most appropriate. However, pathogen transmission within threatened host populations may also be important, and may not be controllable by managing another host species. METHODOLOGY/PRINCIPAL FINDINGS: We investigated interspecific and intraspecific transmission routes, by comparing African wild dogs' exposure to six canine pathogens with behavioural measures of their opportunities for contact with domestic dogs and with other wild dogs. Domestic dog contact was associated with exposure to canine parvovirus, Ehrlichia canis, Neospora caninum and perhaps rabies virus, but not with exposure to canine distemper virus or canine coronavirus. Contact with other wild dogs appeared not to increase the risk of exposure to any of the pathogens. CONCLUSIONS/SIGNIFICANCE: These findings, combined with other data, suggest that management directed at domestic dogs might help to protect wild dog populations from rabies virus, but not from canine distemper virus. However, further analyses are needed to determine the management approaches--including no intervention--which are most appropriate for each pathogen.

  19. Contact with Domestic Dogs Increases Pathogen Exposure in Endangered African Wild Dogs (Lycaon pictus)

    Science.gov (United States)

    Woodroffe, Rosie; Prager, Katherine C.; Conrad, Patricia A.; Dubovi, Edward J.; Mazet, Jonna A. K.

    2012-01-01

    Background Infectious diseases have contributed to the decline and local extinction of several wildlife species, including African wild dogs (Lycaon pictus). Mitigating such disease threats is challenging, partly because uncertainty about disease dynamics makes it difficult to identify the best management approaches. Serious impacts on susceptible populations most frequently occur when generalist pathogens are maintained within populations of abundant (often domestic) “reservoir” hosts, and spill over into less abundant host species. If this is the case, disease control directed at the reservoir host might be most appropriate. However, pathogen transmission within threatened host populations may also be important, and may not be controllable by managing another host species. Methodology/Principal Findings We investigated interspecific and intraspecific transmission routes, by comparing African wild dogs' exposure to six canine pathogens with behavioural measures of their opportunities for contact with domestic dogs and with other wild dogs. Domestic dog contact was associated with exposure to canine parvovirus, Ehrlichia canis, Neospora caninum and perhaps rabies virus, but not with exposure to canine distemper virus or canine coronavirus. Contact with other wild dogs appeared not to increase the risk of exposure to any of the pathogens. Conclusions/Significance These findings, combined with other data, suggest that management directed at domestic dogs might help to protect wild dog populations from rabies virus, but not from canine distemper virus. However, further analyses are needed to determine the management approaches – including no intervention – which are most appropriate for each pathogen. PMID:22238695

  20. [Child poisoning after ingestion of a wild apiaceae: a case report].

    Science.gov (United States)

    Durand, M-F; Pommier, P; Chazalette, A; de Haro, L

    2008-02-01

    Apiaceae family (formerly Umbelliferae) contains several highly toxic species, including Poison Hemlock (Conium maculatum), Water Hemlock (Cicuta virosa) and Hemlock Water Dropwort (Oenanthe crocata) which are the three main poisonous Apiaceae species growing in France. Thinking he was identifying wild carrots, an 11-year-old boy without previous history ingested the root from a wild Apiaceae. One hour later, he was confused, had drowsiness, headache as well as abdominal pain, vomiting and diarrhoea. Upon hospital admission, myosis, ophtalmoplegia and a moderate rhabdomyolysis were noted. The patient recovered after 24 h of symptomatic treatments. In this case, the description of the ingested plant allowed to identify the Apiaceae family but not the species involved. The geographical location (Southern France in a humid area), the clinical features and the aspect of the ingested root, with an orange secretion led to implicate Oenanthe crocata as the origin of this unusual poisoning.

  1. Fish species diversity and conservation in Beijing and adjacent areas

    OpenAIRE

    Chunguang Zhang; Yahui Zhao; Yingchun Xing; Ruilu Guo; Qing Zhang; Yun Feng; Enyuan Fan

    2011-01-01

    Based on field surveys between 2002 and 2010, and fish collections in the National Zoological Museum, Institute of Zoology, Chinese Academy of Sciences, a total of 93 wild fish species including 12 in-troduced species had been recorded in Beijing and adjacent areas. Eighty five of these species, including some migratory and estuarine fishes, are native to the region. Only 43 native wild species were collected in our field work from 2002 to 2010. Compared with the historical records, nearly 50...

  2. Peste des petits ruminants (PPR: A Serious Threat for Wild Life

    Directory of Open Access Journals (Sweden)

    Hamed Ebrahimzadeh Leylabadlo

    2016-04-01

    Full Text Available Introduction Peste des petits ruminants (PPR is the most contagious and extremely infectious respiratory diseases in goats and sheep and is most common in West and Central Africa, Middle East and Southern Asia; it spreads rapidly regardless of country borders (1. A serological and virological outbreak of PPR was identified in Ilam province, Iran near the Iraqi border in 1995. Since then, despite all control measures, numerous incidents of the disease have been reported throughout the country (2. Between 1995 and 2004, vaccination of sheep and goats was performed by cell cultured rinderpest (RP vaccine; the small ruminants started to be vaccinated from early 2005 (2. In spite of vaccination of susceptible animals and application of some containment measures, PPR spread through the whole country, infecting every province with fluctuating prevalence and continuity. The cause of this failure might be related to the fact that well-designed control program in the country was not carried out appropriately and vaccination schedule was not covered abundantly. For instance in 2011, just over 3.5 million small ruminants received vaccine from an estimated National population of just fewer than 80 million animals (3. Some species of animal , e.g. such as gazelles, goats and sheep, that are relatively prevalent in Middle Eastern countries especially in Iran are believed to be immune to PPR infection (4. The wildlife in Iran consists of several animal species that include bears, gazelles, foxes, and also domestic animals including sheep, goats, cattle, and camels. It is believed that PPR virus circulates in domestic ruminants and acts as a potential source of virus for wild animal species in wildlife and the role of domestic small ruminants in the spread of the disease to wild ruminants is clear. It is quite possible that in cases of pastures exchange between domestic and wild animals, the spread of PPR is facilitated between the two populations (5. In Iran

  3. Personality in wild bonobos (Pan paniscus).

    Science.gov (United States)

    Garai, Cintia; Weiss, Alexander; Arnaud, Coline; Furuichi, Takeshi

    2016-11-01

    To understand the evolution of personality structure requires examining personality dimensions in multiple species using a common set of traits. Little research has been conducted on personality in wild populations of nonhuman primates. Using behavioral observations and questionnaire ratings, we examined factors influencing personality in 16 wild bonobos (Pan paniscus) at Wamba, Luo Scientific Reserve, Democratic Republic of the Congo. We extracted five factors from 31 of the items from the Hominoid Personality Questionnaire (HPQ) and three factors from observed behaviors. The HPQ factors were labeled Unemotionality Q , Friendliness Q , Aggressiveness Q , Irritability Q , and Activity Q . The behavioral factors were labeled Grooming B , Playfulness B , and Introversion B . We established the convergent and divergent validity of these factors by obtaining correlations between the HPQ and behavioral factors. We tested for sex differences and found that males were significantly higher on Introversion B and significantly lower in Irritability Q . We then tested for age differences and found that Friendliness Q was lower and Aggressiveness Q was higher in older individuals. Finally, we found that, among males, hierarchical rank was associated with higher Aggressiveness Q . These findings contrast with findings in chimpanzees in ways consistent with known species differences. For one, consistent with the more egalitarian structure of bonobo society, we did not identify a clear Dominance factor. Also, the results related to sex differences were consistent with previous findings that reveal closer bonds between female bonobos than female chimpanzees. These findings highlight the importance of studying personality in closely related species and the need to consider species' socioecology when studying personality. Am. J. Primatol. 78:1178-1189, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  4. Supplementary feeding of wild birds indirectly affects ground beetle populations in suburban gardens.

    Science.gov (United States)

    Orros, Melanie E; Thomas, Rebecca L; Holloway, Graham J; Fellowes, Mark D E

    Supplementary feeding of wild birds by domestic garden-holders is a globally widespread and popular form of human-wildlife interaction, particularly in urban areas. Vast amounts of energy are thus being added to garden ecosystems. However, the potential indirect effects of this activity on non-avian species have been little studied to date, with the only two previous studies taking place under experimentally manipulated conditions. Here we present the first evidence of a localised depletive effect of wild bird feeding on ground beetles (Coleoptera: Carabidae) in suburban gardens under the usual feeding patterns of the garden-holders. We trapped significantly fewer ground beetles directly under bird-feeding stations than in matched areas of habitat away from feeders. Video analysis also revealed significantly higher activity by ground-foraging birds under the feeding stations than in the control areas. Small mammal trapping revealed no evidence that these species differ in abundance between gardens with and without bird feeders. We therefore suggest that local increases in ground-foraging activity by bird species whose diets encompass arthropods as well as seed material are responsible for the reduction in ground beetle numbers. Our work therefore illustrates that providing food for wild birds can have indirect negative effects on palatable prey species under typical conditions.

  5. Short communications : Are wild African lungfish obligate air ...

    African Journals Online (AJOL)

    Laboratory studies have resulted in classification of the marbled African lungfish, Protopterus aethiopicus, as an obligate air-breather. However, there have been no investigations of the extent of dependence on aerial respiration by this species in the wild. We used radio telemetry to obtain quantitative information on the ...

  6. Molecular identification of Taenia serialis coenurosis in a wild Ethiopian gelada (Theropithecus gelada).

    Science.gov (United States)

    Schneider-Crease, India A; Snyder-Mackler, Noah; Jarvey, Julie C; Bergman, Thore J

    2013-11-15

    Since morphological identification of a larval Taeniid in geladas (Theropithecus gelada) has produced inconsistent results, genetic information is pivotal for species identification. Nuclear and mitochondrial DNA from a coenurus in a wild gelada were compared to published sequences from multiple Taeniid species, confirming the identification of this parasite as Taenia serialis. A demographic analysis finds age to be a strong predictor of coenuri. Tapeworms rarely employ primates as intermediate hosts, and the presence of T. serialis in a wild gelada population may indicate a substantial ecological shift in this parasite's life cycle. Copyright © 2013 Elsevier B.V. All rights reserved.

  7. Seropositivity and risk factors associated with Toxoplasma gondii infection in wild birds from Spain.

    Directory of Open Access Journals (Sweden)

    Oscar Cabezón

    Full Text Available Toxoplasma gondii is a zoonotic intracellular protozoan parasite of worldwide distribution that infects many species of warm-blooded animals, including birds. To date, there is scant information about the seropositivity of T. gondii and the risk factors associated with T. gondii infection in wild bird populations. In the present study, T. gondii infection was evaluated on sera obtained from 1079 wild birds belonging to 56 species (including Falconiformes (n=610, Strigiformes (n=260, Ciconiiformes (n=156, Gruiformes (n=21, and other orders (n=32, from different areas of Spain. Antibodies to T. gondii (modified agglutination test, MAT titer ≥1:25 were found in 282 (26.1%, IC(95%:23.5-28.7 of the 1079 birds. This study constitute the first extensive survey in wild birds species in Spain and reports for the first time T. gondii antibodies in the griffon vulture (Gyps fulvus, short-toed snake-eagle (Circaetus gallicus, Bonelli's eagle (Aquila fasciata, golden eagle (Aquila chrysaetos, bearded vulture (Gypaetus barbatus, osprey (Pandion haliaetus, Montagu's harrier (Circus pygargus, Western marsh-harrier (Circus aeruginosus, peregrine falcon (Falco peregrinus, long-eared owl (Asio otus, common scops owl (Otus scops, Eurasian spoonbill (Platalea leucorodia, white stork (Ciconia ciconia, grey heron (Ardea cinerea, common moorhen (Gallinula chloropus; in the International Union for Conservation of Nature (IUCN "vulnerable" Spanish imperial eagle (Aquila adalberti, lesser kestrel (Falco naumanni and great bustard (Otis tarda; and in the IUCN "near threatened" red kite (Milvus milvus. The highest seropositivity by species was observed in the Eurasian eagle owl (Bubo bubo (68.1%, 98 of 144. The main risk factors associated with T. gondii seropositivity in wild birds were age and diet, with the highest exposure in older animals and in carnivorous wild birds. The results showed that T. gondii infection is widespread and can be at a high level in many wild

  8. The role of wild and scenic rivers in the conservation of aquatic biodiversity

    Science.gov (United States)

    John D. Rothlisberger; Tamara Heartsill Scalley; Russell F. Thurow

    2017-01-01

    Formerly diverse and abundant freshwater species are highly imperiled, with higher extinction rates than many other taxonomic groups worldwide. In the 50 years since passage of the US Wild and Scenic Rivers Act, wild and scenic rivers (WSRs) have contributed significantly to the conservation of native aquatic biodiversity as well as to the conservation and restoration...

  9. Cytogenetic effect of low dose gamma-radiation in Hordeum vulgare seedlings: non-linear dose-effect relationship.

    Science.gov (United States)

    Geras'kin, Stanislav A; Oudalova, Alla A; Kim, Jin Kyu; Dikarev, Vladimir G; Dikareva, Nina S

    2007-03-01

    The induction of chromosome aberrations in Hordeum vulgare germinated seeds was studied after ionizing irradiation with doses in the range of 10-1,000 mGy. The relationship between the frequency of aberrant cells and the absorbed dose was found to be nonlinear. A dose-independent plateau in the dose range from about 50 to 500 mGy was observed, where the level of cytogenetic damage was significantly different from the spontaneous level. The comparison of the goodness of the experimental data fitting with mathematical models of different complexity, using the most common quantitative criteria, demonstrated the advantage of a piecewise linear model over linear and polynomial models in approximating the frequency of cytogenetical disturbances. The results of the study support the hypothesis of indirect mechanisms of mutagenesis induced by low doses. Fundamental and applied implications of these findings are discussed.

  10. MORPHOLOGICAL AND AGRONOMICAL CHARACTERISTICS OF SOME WILD AND CULTIVATED ISATIS SPECIES

    OpenAIRE

    KIZIL, Süleyman

    2006-01-01

    The study evaluated Isatis tinctoria, I. constricta, I. glauca, I. cochlearis, I. aucheri and I. demiriziana during 2002-03 and 2003-04 growing seasons for different agronomic characteristics affecting the percentage of dye in them. The results showed wide variations in the agronomic characteristics of Isatis constricta, Isatis cochlearis, Isatis aucheri, Isatis demiriziana collected from wild; compared to culture Isatis tinctoria and Isatis glauca. I. tinctoria showed early emergence (36 day...

  11. Sterile mutant of Verbena hybrida induced by heavy ion beam irradiation and wild species V. peruviana exhibit self-incompatible phenotype

    International Nuclear Information System (INIS)

    Saito, H.; Hayashi, Y.; Abe, T.; Kanaya, T.; Suzuki, K.

    2005-01-01

    Full text: Garden verbenas (Verbena hybrida) belonging to the Verbenaceae family are originated from interspecific hybridization among several species, many cultivars frequently produce seeds. Recently, a sterile mutant has been isolated in the verbena cultivar 'Coral Pink' of Temari series (Suntory Flowers Ltd., Tokyo, Japan) by mutation induction using heavy-ion beams at RIKEN Accelarator Research Facility (RARF, Saitama, Japan). We investigated pollen and ovule fertility assessed by acetocarmin staining, seed-set following controlled-pollination tests and behavior of pollen tubes in pistils with the sterile mutant of 'Coral Pink' (SC) and its original fertile one (FC). As the results, although SC has functional male and female gametes, few self-pollinated flowers carry out seed-set, leading to sterile phenotype. Additionally, the sterile mechanism of SC was compared with the wild species V. peruviana (VP) which is one of origin of Temari series and exhibits sterility. Interestingly, similar phenotype was observed in PV. We further investigated, therefore, whether there are differences on self-incompatible reaction between SC and VP. (author)

  12. Sterile mutant of Verbena hybrida induced by heavy ion beam irradiation and wild species V. peruviana exhibit self-incompatible phenotype

    Energy Technology Data Exchange (ETDEWEB)

    Saito, H; Hayashi, Y; Abe, T [RIKEN, Wako (Japan); Kanaya, T; Suzuki, K [Suntory Flowers Ltd., Higashiomi (Japan)

    2005-07-01

    Full text: Garden verbenas (Verbena hybrida) belonging to the Verbenaceae family are originated from interspecific hybridization among several species, many cultivars frequently produce seeds. Recently, a sterile mutant has been isolated in the verbena cultivar 'Coral Pink' of Temari series (Suntory Flowers Ltd., Tokyo, Japan) by mutation induction using heavy-ion beams at RIKEN Accelarator Research Facility (RARF, Saitama, Japan). We investigated pollen and ovule fertility assessed by acetocarmin staining, seed-set following controlled-pollination tests and behavior of pollen tubes in pistils with the sterile mutant of 'Coral Pink' (SC) and its original fertile one (FC). As the results, although SC has functional male and female gametes, few self-pollinated flowers carry out seed-set, leading to sterile phenotype. Additionally, the sterile mechanism of SC was compared with the wild species V. peruviana (VP) which is one of origin of Temari series and exhibits sterility. Interestingly, similar phenotype was observed in PV. We further investigated, therefore, whether there are differences on self-incompatible reaction between SC and VP. (author)

  13. Hemoparasites in a wild primate: Infection patterns suggest interaction of Plasmodium and Babesia in a lemur species

    Directory of Open Access Journals (Sweden)

    Andrea Springer

    2015-12-01

    Full Text Available Hemoparasites can cause serious morbidity in humans and animals and often involve wildlife reservoirs. Understanding patterns of hemoparasite infections in natural populations can therefore inform about emerging disease risks, especially in the light of climate change and human disruption of natural ecosystems. We investigated the effects of host age, sex, host group size and season on infection patterns of Plasmodium sp., Babesia sp. and filarial nematodes in a population of wild Malagasy primates, Verreaux's sifakas (Propithecus verreauxi, as well as the effects of these infections on hematological variables. We tested 45 blood samples from 36 individuals and identified two species of Plasmodium, one species of Babesia and two species of filarial nematodes. Plasmodium spp. and Babesia sp. infections showed opposite patterns of age-dependency, with babesiosis being prevalent among young animals, while older animals were infected with Plasmodium sp. In addition, Babesia sp. infection was a statistically significant negative predictor of Plasmodium sp. infection. These results suggest that Plasmodium and Babesia parasites may interact within the host, either through cross-immunity or via resource competition, so that Plasmodium infections can only establish after babesiosis has resolved. We found no effects of host sex, host group size and season on hemoparasite infections. Infections showed high prevalences and did not influence hematological variables. This preliminary evidence supports the impression that the hosts and parasites considered in this study appear to be well-adapted to each other, resulting in persistent infections with low pathogenic and probably low zoonotic potential. Our results illustrate the crucial role of biodiversity in host-parasite relationships, specifically how within-host pathogen diversity may regulate the abundance of parasites.

  14. Hemoparasites in a wild primate: Infection patterns suggest interaction of Plasmodium and Babesia in a lemur species.

    Science.gov (United States)

    Springer, Andrea; Fichtel, Claudia; Calvignac-Spencer, Sébastien; Leendertz, Fabian H; Kappeler, Peter M

    2015-12-01

    Hemoparasites can cause serious morbidity in humans and animals and often involve wildlife reservoirs. Understanding patterns of hemoparasite infections in natural populations can therefore inform about emerging disease risks, especially in the light of climate change and human disruption of natural ecosystems. We investigated the effects of host age, sex, host group size and season on infection patterns of Plasmodium sp., Babesia sp. and filarial nematodes in a population of wild Malagasy primates, Verreaux's sifakas (Propithecus verreauxi), as well as the effects of these infections on hematological variables. We tested 45 blood samples from 36 individuals and identified two species of Plasmodium, one species of Babesia and two species of filarial nematodes. Plasmodium spp. and Babesia sp. infections showed opposite patterns of age-dependency, with babesiosis being prevalent among young animals, while older animals were infected with Plasmodium sp. In addition, Babesia sp. infection was a statistically significant negative predictor of Plasmodium sp. infection. These results suggest that Plasmodium and Babesia parasites may interact within the host, either through cross-immunity or via resource competition, so that Plasmodium infections can only establish after babesiosis has resolved. We found no effects of host sex, host group size and season on hemoparasite infections. Infections showed high prevalences and did not influence hematological variables. This preliminary evidence supports the impression that the hosts and parasites considered in this study appear to be well-adapted to each other, resulting in persistent infections with low pathogenic and probably low zoonotic potential. Our results illustrate the crucial role of biodiversity in host-parasite relationships, specifically how within-host pathogen diversity may regulate the abundance of parasites.

  15. Wild and native plants and mushrooms sold in the open-air markets of south-eastern Poland.

    Science.gov (United States)

    Kasper-Pakosz, Renata; Pietras, Marcin; Łuczaj, Łukasz

    2016-10-07

    The study of plants and fungi sold in open-air markets is an important part of ethnobotanical enquiry. Only few such studies were carried out in Europe. Four of the largest open-air markets of south-eastern Poland were visited regularly, and the plants sold in them were recorded between 2013 and 2015. The aim of the study was to record native and/or wild species sold in the markets. All the plants sold in the markets were photographed regularly. In each market, 25 sellers were interviewed. Voucher specimens were collected and fungi were identified using DNA barcoding. Altogether, 468 species of plants were recorded, 117 of them native to south-eastern Poland - 19 only collected from the wild and 11 both wild and cultivated. Seventeen of the species are under legal protection. Most protected plants were sold from cultivation, although proper authorization procedures had not been performed. Thirty-two species of fungi were sold (including two cultivated species), all of them for culinary purposes. Two species (Lactarius quieticolor, Leccinum schistophilum) are new to the mycobiota of Poland. Ornamental plants constituted a large section of the market, and they dominated the group of native species. Food plants dominated among wild-collected plants and were sold mainly as fruits for jams, juices and alcoholic drinks, or as culinary herbs. Very few medicinal or green vegetable plants were sold. An interesting feature of the markets was the sale of Ledum palustre as an insect repellent. Finding two species of fungi which are new to Poland highlights the importance of DNA barcoding in ethnomycological studies. Most items in the markets are ornamental plants, or edible fruits and mushrooms. Very few medicinal plants and green vegetables are sold, which differentiates the markets from southern European ones. Such a pattern is probably the model for most central European markets.

  16. Characterization of low pathogenicity avian influenza viruses isolated from wild birds in Mongolia 2005 through 2007

    Directory of Open Access Journals (Sweden)

    Sodnomdarjaa Ruuragchaa

    2009-11-01

    Full Text Available Abstract Background Since the emergence of H5N1 high pathogenicity (HP avian influenza virus (AIV in Asia, numerous efforts worldwide have focused on elucidating the relative roles of wild birds and domestic poultry movement in virus dissemination. In accordance with this a surveillance program for AIV in wild birds was conducted in Mongolia from 2005-2007. An important feature of Mongolia is that there is little domestic poultry production in the country, therefore AIV detection in wild birds would not likely be from spill-over from domestic poultry. Results During 2005-2007 2,139 specimens representing 4,077 individual birds of 45 species were tested for AIV by real time RT-PCR (rRT-PCR and/or virus isolation. Bird age and health status were recorded. Ninety rRT-PCR AIV positive samples representing 89 individual birds of 19 species including 9 low pathogenicity (LP AIVs were isolated from 6 species. A Bar-headed goose (Anser indicus, a Whooper swan (Cygnus cygnus and 2 Ruddy shelducks (Tadorna ferruginea were positive for H12N3 LP AIV. H16N3 and H13N6 viruses were isolated from Black-headed gulls (Larus ridibundus. A Red-crested pochard (Rhodonessa rufina and 2 Mongolian gulls (Larus vagae mongolicus were positive for H3N6 and H16N6 LP AIV, respectively. Full genomes of each virus isolate were sequenced and analyzed phylogenetically and were most closely related to recent European and Asian wild bird lineage AIVs and individual genes loosely grouped by year. Reassortment occurred within and among different years and subtypes. Conclusion Detection and/or isolation of AIV infection in numerous wild bird species, including 2 which have not been previously described as hosts, reinforces the wide host range of AIV within avian species. Reassortment complexity within the genomes indicate the introduction of new AIV strains into wild bird populations annually, however there is enough over-lap of infection for reassortment to occur. Further work is

  17. Antioxidant activity, phenolic and flavonoid contents of some wild ...

    African Journals Online (AJOL)

    sunny t

    2016-03-30

    Mar 30, 2016 ... 526. Afr. J. Biotechnol. Table 1. Ethnobotanical data of the investigated wild vegetal species of the regions of the southeastern Algeria. Scientific name. Local name. Used parts. Preparation. Ethnomedical use. References. Artemisia campestris. (Asteraceae). Dgouft. Aerial parts, leaves, flowers. Infusion.

  18. Museum specimens reveal loss of pollen host plants as key factor driving wild bee decline in The Netherlands

    Science.gov (United States)

    Scheper, Jeroen; Reemer, Menno; van Kats, Ruud; Ozinga, Wim A.; van der Linden, Giel T. J.; Schaminée, Joop H. J.; Siepel, Henk; Kleijn, David

    2014-01-01

    Evidence for declining populations of both wild and managed bees has raised concern about a potential global pollination crisis. Strategies to mitigate bee loss generally aim to enhance floral resources. However, we do not really know whether loss of preferred floral resources is the key driver of bee decline because accurate assessment of host plant preferences is difficult, particularly for species that have become rare. Here we examine whether population trends of wild bees in The Netherlands can be explained by trends in host plants, and how this relates to other factors such as climate change. We determined host plant preference of bee species using pollen loads on specimens in entomological collections that were collected before the onset of their decline, and used atlas data to quantify population trends of bee species and their host plants. We show that decline of preferred host plant species was one of two main factors associated with bee decline. Bee body size, the other main factor, was negatively related to population trend, which, because larger bee species have larger pollen requirements than smaller species, may also point toward food limitation as a key factor driving wild bee loss. Diet breadth and other potential factors such as length of flight period or climate change sensitivity were not important in explaining twentieth century bee population trends. These results highlight the species-specific nature of wild bee decline and indicate that mitigation strategies will only be effective if they target the specific host plants of declining species. PMID:25422416

  19. Molecular characterization of vernalization loci VRN1 in wild and cultivated wheats

    Directory of Open Access Journals (Sweden)

    Golovnina Kseniya A

    2010-08-01

    Full Text Available Abstract Background Variability of the VRN1 promoter region of the unique collection of spring polyploid and wild diploid wheat species together with diploid goatgrasses (donor of B and D genomes of polyploid wheats were investigated. Accessions of wild diploid (T. boeoticum, T. urartu and tetraploid (T. araraticum, T. timopheevii species were studied for the first time. Results Sequence analysis indicated great variability in the region from -62 to -221 nucleotide positions of the VRN1 promoter region. Different indels were found within this region in spring wheats. It was shown that VRN1 promoter region of B and G genome can also contain damages such as the insertion of the transposable element. Some transcription factor recognition sites including hybrid C/G-box for TaFDL2 protein known as the VRN1 gene upregulator were predicted inside the variable region. It was shown that deletions leading to promoter damage occurred in diploid and polyploid species independently. DNA transposon insertions first occurred in polyploid species. At the same time, the duplication of the promoter region was observed in A genomes of polyploid species. Conclusions We can conclude that supposed molecular mechanism of the VRN1 gene activating in cultivated diploid wheat species T. monococcum is common also for wild T. boeoticum and was inherited by T. monococcum. The spring polyploids are not related in their origin to spring diploids. The spring T. urartu and goatgrass accessions have another mechanism of flowering activation that is not connected with indels in VRN1 promoter region. All obtained data may be useful for detailed insight into origin of spring wheat forms in evolution and domestication process.

  20. Sustainability of wild pistachio (Pistacia atlantica Desf.) in Zagros forests, Iran

    Science.gov (United States)

    Morteza Pourreza; John D. Shaw; Hoshang Zangeneh

    2008-01-01

    Wild pistachio (Pistacia atlantica Desf.) is the most economically important tree species in many rural areas in the west of Iran. The species produces resin used for a wide variety of traditional uses. Because the resin can be harvested non-destructively, the trees are maintained until mortality occurs from natural causes. The result is that natural...

  1. Chewing lice from wild birds in northern Greece.

    Science.gov (United States)

    Diakou, Anastasia; Pedroso Couto Soares, José Bernardo; Alivizatos, Haralambos; Panagiotopoulou, Maria; Kazantzidis, Savas; Literák, Ivan; Sychra, Oldřich

    2017-10-01

    Greece represents an important area for wild birds due to its geographical position and habitat diversity. Although the bird species in Greece are well recorded, the information about the chewing lice that infest them is practically non-existent. Thus, the aim of the present study was to record the species of lice infesting wild birds in northern Greece and furthermore, to associate the infestation prevalence with factors such as the age, sex, migration and social behaviour of the host as well as the time of the year. In total 729 birds, (belonging to 9 orders, 32 families and 68 species) were examined in 7 localities of northern Greece, during 9 ringing sessions from June 2013 until October 2015. Eighty (11%) of the birds were found to be infested with lice. In 31 different bird species, 560 specimens of lice, belonging to 33 species were recorded. Mixed infestations were recorded in 11 cases where birds were infested with 2-3 different lice species. Four new host-parasite associations were recorded i.e. Menacanthus curuccae from Acrocephalus melanopogon, Menacanthus agilis from Cettia cetti, Myrsidea sp. from Acrocephalus schoenobaenus, and Philopretus citrinellae from Spinus spinus. Moreover, Menacanthus sinuatus was detected on Poecile lugubris, rendering this report the first record of louse infestation in this bird species. The statistical analysis of the data collected showed no association between parasitological parameters (prevalence, mean and median intensity and mean abundance) in two different periods of the year (breeding vs post-breeding season). However, there was a statistically significant difference in the prevalence of infestation between a) migrating and sedentary passerine birds (7.4% vs 13.2%), b) colonial and territorial birds (54.5% vs 9.6%), and c) female and male birds in breeding period (2.6% vs 15.6%). Copyright © 2017. Published by Elsevier B.V.

  2. Interspecies Variation in the Susceptibility of a Wild-Derived Colony of Mice to Pinworms (Aspiculuris tetraptera).

    Science.gov (United States)

    Curtis, Ryan C; Murray, Jill K; Campbell, Polly; Nagamori, Yoko; Molnar, Adam; Jackson, Todd A

    2017-01-01

    Pinworms are common parasites in wild and laboratory rodents. Despite their relative nonpathogenicity in immunocompetent models, pinworm infections add an unwanted variable and may confound some types of research. For this reason, health monitoring programs and biosecurity measures aim to minimize the spread of pinworm infections into colonies free from the organisms. Wild-derived and laboratory strains of mice have shown varied susceptibility to infection with Aspiculuris tetraptera, the most commonly found murine pinworm. In particular, susceptibility is increased in wild-derived mice, young animals, and males. Routine surveillance at our institution revealed pinworm infection (A. tetraptera only) within a colony of multiple, wild-derived species of Mus, although only specific species showed positive results during initial sampling. To assess whether species-associated differences in susceptibility were present, we analyzed fecal egg counts of A. tetraptera in every cage of the colony. Our results revealed significant differences in susceptibility between various species and subspecies of Mus. Egg counts were significantly higher in Mus spicilegus than Mus m. domesticus (WSB/EiJ) and Mus macedonicus. Mus spretus had higher egg counts than M. m. domesticus (WSB/EiJ), M. m. musculus (PWK/PhJ), and M. macedonicus. Egg counts did not differ in regard to age, sex, or number of mice per cage. As wild-derived mouse models continue to compliment research largely based on laboratory strains, it will be important to understand host-parasite interactions and their effects on research, particularly studies evaluating immune responses, behavior, growth, and other physiologic parameters.

  3. Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare)WRKY transcription factor family reveals putatively retained functions betweenmonocots and dicots

    Energy Technology Data Exchange (ETDEWEB)

    Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk

    2008-02-01

    WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.

  4. Assessing landowners' attitudes toward wild hogs and support for control options.

    Science.gov (United States)

    Caplenor, Carlotta A; Poudyal, Neelam C; Muller, Lisa I; Yoest, Chuck

    2017-10-01

    Wild hogs (Sus scrofa) are an invasive species with destructive habits, particularly rooting and wallowing, which can directly impact agricultural crops, pasture land, and water quality. Considering wild hogs are widely dispersed across the landscape, they are extremely difficult to control. Disagreements can arise among different stakeholders over whether and how their populations should be managed. The purpose of this article was to examine Tennessee, United States landowners' attitudes toward wild hogs, to compare acceptability of control methods, and to evaluate factors significantly influencing public support for regulations to control wild hogs. Logistic regression was employed to analyze data collected from a statewide survey of rural landowners in the fall of 2015. Landowners had overwhelmingly negative attitudes towards wild hogs, and were concerned about their impact on the natural environment and rural economy. Although landowners showed support for controlling wild hogs, levels of acceptability for management options varied. Respondents favored active management and supported education and incentive-based control programs to control wild hogs. Cognitive concepts such as social and personal norms and awareness of consequences, as well as demographic characteristics, significantly predicted landowners' support for state regulations to control wild hogs in Tennessee. Findings increase our understanding of the human dimensions of wild hog management and that of other similarly invasive animals, and may guide resource managers in designing effective and socially acceptable management strategies to control wild hog populations in Tennessee and elsewhere. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. SURVEY OF WILD PLANT SEEDS AND THEIR VALUE IN ...

    African Journals Online (AJOL)

    disease, asthma, dysentery and piles. Seeds from tree species accounted for 23 ... SURVEY OF WILD PLANT SEEDS AND THEIR VALUE IN TRADITONAL HERBAL MEDICINE IN OSUN STATE, NIGERIA. INTRODUCTION. Seeds are fertilized ..... dynamics and regeneration of a logged over secondary regrowth forest.Ph.D.

  6. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  7. New insight into the history of domesticated apple: secondary contribution of the European wild apple to the genome of cultivated varieties.

    Directory of Open Access Journals (Sweden)

    Amandine Cornille

    Full Text Available The apple is the most common and culturally important fruit crop of temperate areas. The elucidation of its origin and domestication history is therefore of great interest. The wild Central Asian species Malus sieversii has previously been identified as the main contributor to the genome of the cultivated apple (Malus domestica, on the basis of morphological, molecular, and historical evidence. The possible contribution of other wild species present along the Silk Route running from Asia to Western Europe remains a matter of debate, particularly with respect to the contribution of the European wild apple. We used microsatellite markers and an unprecedented large sampling of five Malus species throughout Eurasia (839 accessions from China to Spain to show that multiple species have contributed to the genetic makeup of domesticated apples. The wild European crabapple M. sylvestris, in particular, was a major secondary contributor. Bidirectional gene flow between the domesticated apple and the European crabapple resulted in the current M. domestica being genetically more closely related to this species than to its Central Asian progenitor, M. sieversii. We found no evidence of a domestication bottleneck or clonal population structure in apples, despite the use of vegetative propagation by grafting. We show that the evolution of domesticated apples occurred over a long time period and involved more than one wild species. Our results support the view that self-incompatibility, a long lifespan, and cultural practices such as selection from open-pollinated seeds have facilitated introgression from wild relatives and the maintenance of genetic variation during domestication. This combination of processes may account for the diversification of several long-lived perennial crops, yielding domestication patterns different from those observed for annual species.

  8. New Insight into the History of Domesticated Apple: Secondary Contribution of the European Wild Apple to the Genome of Cultivated Varieties

    Science.gov (United States)

    Cornille, Amandine; Gladieux, Pierre; Smulders, Marinus J. M.; Roldán-Ruiz, Isabel; Laurens, François; Le Cam, Bruno; Nersesyan, Anush; Clavel, Joanne; Olonova, Marina; Feugey, Laurence; Gabrielyan, Ivan; Zhang, Xiu-Guo; Tenaillon, Maud I.; Giraud, Tatiana

    2012-01-01

    The apple is the most common and culturally important fruit crop of temperate areas. The elucidation of its origin and domestication history is therefore of great interest. The wild Central Asian species Malus sieversii has previously been identified as the main contributor to the genome of the cultivated apple (Malus domestica), on the basis of morphological, molecular, and historical evidence. The possible contribution of other wild species present along the Silk Route running from Asia to Western Europe remains a matter of debate, particularly with respect to the contribution of the European wild apple. We used microsatellite markers and an unprecedented large sampling of five Malus species throughout Eurasia (839 accessions from China to Spain) to show that multiple species have contributed to the genetic makeup of domesticated apples. The wild European crabapple M. sylvestris, in particular, was a major secondary contributor. Bidirectional gene flow between the domesticated apple and the European crabapple resulted in the current M. domestica being genetically more closely related to this species than to its Central Asian progenitor, M. sieversii. We found no evidence of a domestication bottleneck or clonal population structure in apples, despite the use of vegetative propagation by grafting. We show that the evolution of domesticated apples occurred over a long time period and involved more than one wild species. Our results support the view that self-incompatibility, a long lifespan, and cultural practices such as selection from open-pollinated seeds have facilitated introgression from wild relatives and the maintenance of genetic variation during domestication. This combination of processes may account for the diversification of several long-lived perennial crops, yielding domestication patterns different from those observed for annual species. PMID:22589740

  9. Desenvolvimento dos frutos nas espécies selvagens de amendoim (Arachis spp. Fruit development in wild species of peanut

    Directory of Open Access Journals (Sweden)

    Cândida H. T. Mendes Conagin

    1959-01-01

    sera espécie A. villosulicarpa Hohene (segundo Krapovickas (¹ e a V. 85 é, provávelmente o A. Diogoi Hoehne subspétie major Hoehne. A ocorrência de dois óvulos por ovário e de frutos catenados em tôdas as espécies selvagens que foram examinadas torna possível concluir que o mesmo processo descrito para Arachis monticola e A. villosa var. correntina explica a formação dos frutos catenados nas espécies selvagens que os possuem.Observations made on the fruit development of wild species of peanut, Arachis monticola and A. villosa var. correntina, received from Argentina, are described in this paper. The ovary is uniloculaled and has two ovules. Fertilization is normal, the embryo and endosperm developing in the same way as in the cultivated peanut, Arachis hypogaea L. In more than 50% of cases both ovules develop normally, nevertheless abortion of the apical ovule is frequent and may occur in any phase of its development. In the firs case the fruits have two normal seeds; in the second, they have only one, the other being small and shrivelled. Fruits of the two species possess the two seeds separated by a sharp constriction or isthmus; this isthmus is anatomically a peg; it is dry in the ripe fruit and may be easily broken when the fruits are picked at harvest, giving then the erroneous impression that these are one-seeded. Burkart (2,3 and Hoehne (6 described a similar type of fruit for the species Arachis villosa Benth. and A. pusilla Benth.; fruits of the same type were also found by Gregory (1,8 in A. glabrata Benth. and A. hypogaea L. In addition to A. monticola and A. villosa var. correntina the writer found catenate fruits on specimens from a collection of wild species, as follows; A. Diogoi Hoehne f. typica Hoehne, A. glabrata Benth., A. pusilla Benth., A. marginata Gardn. (according to Burkart, A. prostrata Benth. (according to Burkart, A. villosulicarpa (according to Krapovickas, Arachis sp. (probably Arachis Diogoi Hoehne sub-species major Hoehne

  10. Serological Evidence for Influenza A Virus Exposure in Wild Birds in Trinidad & Tobago

    Directory of Open Access Journals (Sweden)

    Arianne Brown Jordan

    2018-05-01

    Full Text Available Migratory waterfowl and shorebirds are known to be important reservoirs for influenza A viruses (IAV and they have been repeatedly implicated as causing avian influenza virus (AIV outbreaks in domestic poultry flocks worldwide. In recent years, wild birds have been implicated in spreading zoonotic H5 influenza viruses to many countries, which has generated high levels of public health concern. Trinidad and Tobago (T&T is positioned along the wintering route of migratory birds from the Americas; every year, many species of wild birds stopover on the islands of T&T, potentially carrying AIVs and exposing local populations of wild and domestic birds, including commercial poultry, to infection. The aim of this study was to trap, sample, and test as many wild bird species as possible to see whether they were actively infected or previously exposed to AIV. A total of 38 wild birds were trapped, sampled, and tested for IAV RNA, antibodies specific for influenza A nucleoprotein (NP and antibodies that were specific for H5 and H7 subtypes. Five of the samples tested antibody positive for IAV, while three of these samples had positive titres (≥16 for the H5 subtype, indicating that they were likely to have been previously infected with an H5 IAV subtype. One of the samples tested positive for IAV (M gene RNA. These results highlight the potential threat that is posed by wild birds to backyard and commercial poultry in T&T and emphasise the importance of maintaining high levels of biosecurity on poultry farms, ensuring that domestic and wild birds are not in direct or indirect contact. The results also underline the need to carry out routine surveillance for AIV in domestic and wild birds in T&T and the wider Caribbean region.

  11. Ethnobotany of wild plants used for starting fermented beverages in Shui communities of southwest China.

    Science.gov (United States)

    Hong, Liya; Zhuo, Jingxian; Lei, Qiyi; Zhou, Jiangju; Ahmed, Selena; Wang, Chaoying; Long, Yuxiao; Li, Feifei; Long, Chunlin

    2015-05-28

    Shui communities of southwest China have an extensive history of using wild plants as starters (Xiaoqu) to prepare fermented beverages that serve important roles in interpersonal relationships and cultural events. While the practice of using wild plants as starters for the preparation of fermented beverages was once prevalent throughout China, this tradition has seen a decline nationally since the 1930s. The traditional technique of preparing fermented beverages from wild plant starters remains well preserved in the Shui communities in southwest China and provides insight on local human-environment interactions and conservation of plant biodiversity for cultural purposes. The present study sought to examine the ethnobotany of wild plants used as starters for the preparation of fermented beverages including an inventory of plants used as a starter in liquor fermentation and associated knowledge and practices. Field surveys were carried out that consisted of semi-structured surveys and plant species inventories. One hundred forty-nine informants in twenty Shui villages were interviewed between July 2012 and October 2014 to document knowledge associated with wild plants used as a liquor fermentation starter. The inventories involved plant voucher specimens and taxonomic identification of plant collections. A total of 103 species in 57 botanical families of wild plants were inventoried and documented that are traditionally used as starters for preparing fermented beverages by Shui communities. The majority of the species (93.2%) have multiple uses in addition to being used as a starter with medicinal purposes being the most prevalent. Shui women are the major harvesters and users of wild plants used as starters for preparing fermented beverages and transfer knowledge orally from mother to daughter. Findings from this study can serve as a basis for future investigation on fermented beverages and foods and associated knowledge and cultural practices. However, with rapid

  12. Genetic diversity and relationships between wild and cultivated populations of the sea lettuce, Enteromorpha prolifera, in Korea revialed by RAPD markers

    OpenAIRE

    Huh, Man; Lee, Hak; Lee, Bok; Choi, Joo

    2004-01-01

    RAPD analysis was conducted to estimate genetic diversity and population structure of the wild (natural) and cultivated sea lettuce, Enteromorpha prolifera. The objectives of this study were to estimate the levels of genetic diversity in the wild and cultivated populations and to describe how the genetic variation of this species is distributed within and among its populations. In wild sea lettuce, 93.2% of loci at the species level showed polymorphism. The cultivated populations were found t...

  13. Designing Autonomy: Opportunities for New Wildness in the Anthropocene.

    Science.gov (United States)

    Cantrell, Bradley; Martin, Laura J; Ellis, Erle C

    2017-03-01

    Maintaining wild places increasingly involves intensive human interventions. Several recent projects use semi-automated mediating technologies to enact conservation and restoration actions, including re-seeding and invasive species eradication. Could a deep-learning system sustain the autonomy of nonhuman ecological processes at designated sites without direct human interventions? We explore here the prospects for automated curation of wild places, as well as the technical and ethical questions that such co-creation poses for ecologists, conservationists, and designers. Our goal is to foster innovative approaches to creating and maintaining the autonomy of evolving ecological systems. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. A genetic analysis of the introgression process from cultivated lettuce (Lactuca sativa L.) to wild prickly lettuce (L. serriola L.)

    OpenAIRE

    Uwimana, B.

    2011-01-01

    Many plant species can hybridise and produce fertile offspring. Hybridization between cultivated species and their wild relatives has raised concerns with regard to GM crops, as it constitutes a possible route along which the transgene could disperse from crops into related wild species, establish itself in the natural population, and persist under natural conditions. This may cause unintended ecological consequences such as the formation of more invasive weeds and genetic erosion. After cro...

  15. Development of a Compendium of Local, Wild-Harvested Species Used in the Informal Economy Trade, Cape Town, South Africa

    Directory of Open Access Journals (Sweden)

    L. M. Petersen

    2012-06-01

    Full Text Available Wild harvesting has taken place over millennia in Africa. However urbanization and cash economies have effectively altered harvesting from being cultural, traditional, and subsistence activities that are part of a rural norm, to being a subculture of commonly illicit activities located primarily within the urban, cash-based, informal economy. This paper focuses on Cape Town, South Africa where high levels of poverty and extensive